1ns``@00ھ;0H5 ``@! ` # `` g!" $@` ``d@ f# ga@2`"` H*/+ e g"a| 0 "#@㿐@s# g a "a  @ " e e!@֒c@  @ e  g!|@@K㿐 ec@  e e e!@c# @ D e?# c' e/ e- e+ e,`2 @   # #@@#@`b @@?@2 @a aa @`#@Ȳ@  `? f"c؆? Đ`IJ@` @ ? f?"  f 㿘@ " 㿘 @1  㿘@  e#` @ِ g!| ` g €ax  $€ax 2$   g!x e@9"@0   f$   $`$` 㿘# ga|`   ``*  `a|   '@`2`0`,6 * '@ 㿘  w& `& $& (   €n " '@ 㿘 g!|  @@ 0(@  㿘  @ $ ? g`$ *㿐 g!|/  0T@㿘  㿘 g!|`t€㿘 e#` g@ g!| ` g "x  fc g"!xJ  *@J` )*@㿘' g ?M   g@@"@$ $ $ $ $ $ $ $ $$ ($ ,$ 0$ 4$ $ $ $ `  e@U"X+ @" ``+  `@7 $ 0` "`$ 4` " @$  @ 2 &  $   e@+"x 㿘# ga  @ 4 "$a  & 4$a 㿘 e#*`@  f e"@ْ#Ę  f f#L         e"@’` ` e# @  e#8 <?*  Ș آ&@  `  e#Ȱ@㿘?( g,1 g\&!| H L` T ` X P d l$ p  t @ g .@` * @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  f̖̔ ? * `:```?  fcД "c"     f̐?"  ̝㿘 ga'H'L'P'T 'X "a@/H e@"t㿘 e"5555@5@5@5@5@5@5@55@5@5D55@5@55@5h5@5@5㿘 a'H'L'P'T'X"t@ H㿘 a"t@ N@`N@`%` N@`` d *` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @N N@ @E N@ @< N@ 0 x   ? e"0(  @ 0,  ?L?hN@@ `N@ % X lT㿈 e" @,(  ?L?㿘 f#Ԁ`  g! e bJ@ ^#!\ @ @   @ *0   @ *` (%s: can't open device%s: alloc failed%s: block table corrupt%s: read failure%s: short readpromprom0Can't open device `%s' Invalid controller number prom_iopen: "%s" error=%d prom_mapin: length=%dprom_mapin: invalid maptype %d exit0123456789abcdef|/-\bootxx ((( (0(@(P(`$585@555505555   5 PMol < @ Mok0D(P yI/mntD yIMolP@@<@T PMok0 < @ Mok0D(P  Mok0P@@<@T UMolkXMol7IsA Mok1Mol8APMol8APXMok2'PMok2)I Mol8AP`hpx T>"8Mok6(Mok6Mok6UlvjMok69Mok6pMok69VMok6EXMok6#rMok69Y Mok6$ Mok683Mok68308@HPJ9GAMok7HMol9$KJPMol9$KJP^b>AMok;( VMoly+B8Moly+B8_2AMok{: Mol @Mol @U[CAMok9hPMol:WhMol:WhV @AMok+IPMol' Mol' WAMokPMol SMol SXS3BMok*MokfMokf`hpx=|Mol3JMol3Mol3YUH7mMol3XMol4&^Mol4&^ (0utu &M~k#s\hS,̘6?y[^r%Z:ŕ.&hki)&Nޭ4.%sFҩJId2܈{OH#ELO9U"d2|IBa2f;MJxm+H_E7Ӝ/xIUnkrW1ޱE1@, E+J4I9P@Po%?] AS[urxH?5oma=^;@'wxjf.Sdz}>GܾеnaőG͗|V)tcO>B#i$"jݎa{3^ӍK|뜡r t5hȣGsЖ 6 0{i6l_=0>S) TMn+ iH \L#m8F_ȶRs4|E2\znJPv|ιP9GMNNQP).t J cgmh9a@9_{! Z:oӐٚBi?/5[GQ4^)OR!<_l|\se}QO 7e0}Y&yxS/stS4:M=XTf /G"ƒOpr=$Ay [6=o8 Ý~S_~ae}2TT L0]0Wyz}ey*&>T(Q?Z?]!Qͷ6۬a\ ", KCm-Z)kgҿRkwD?"RM[&a$y1p1<::> \ SfnqP}rUdHW*YQ\ U%%0+`t. 92uQ\^fټ 96 wD`?wM7yX;6@6[VVٻ]l:"yY? #C)&| 4)+ɰkG[~whTU2 0iEQq9kkE5Ϝ5>m<r$dK}P]aXNEB?Y@ `/d{AI:qgp@ZfP9IhZie)Dʢ{8sG.!C/rW<0ʒ[5*ivZX{IXTcMX& #j@L4g4~x9vMS\_F`Hivm6-#N /G#g ((f?e#ª+yA.wu+IF#Ktmc4a5{aœuڊUgQ9ekyoy ... ... ... . .. bsd  base49.tgz comp49.tgz etc49.tgz man49.tgz game49.tgz export VNAME=$(sysctl -n kern.osrelease) export VERSION="${VNAME%.*}${VNAME#*.}" export ARCH=$(sysctl -n hw.machine) export OBSD="OpenBSD/$ARCH $VNAME" export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs set -- $(dmesg | sed -n '/^root on /h;${g;p;}') rootdisk=$3 if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u /dev/${rootdisk:-rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T cat <<__EOT Welcome to the $OBSD installation program. __EOT while :; do read REPLY?'(I)nstall, (U)pgrade or (S)hell? ' case $REPLY in i*|I*) /install && break ;; u*|U*) /upgrade && break ;; s*|S*) break ;; !) echo "Type 'exit' to return to install." ksh ;; !*) eval "${REPLY#?}" ;; esac done fi #!/bin/ksh MODE=upgrade . install.sub cat <<__EOT NOTE: Once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. sysmerge(8) can help. __EOT while :; do ask "Root filesystem?" $ROOTDEV resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "$resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/$ROOTDEV)..." fsck -fp /dev/$ROOTDEV >/dev/null 2>&1 || { echo "FAILED." ; exit ; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED." ; exit ; } echo "OK." for _f in fstab hosts myname; do [[ -f /mnt/etc/$_f ]] || { echo "No /mnt/etc/$_f!" ; exit ; } cp /mnt/etc/$_f /tmp/$_f done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network manual_net_cfg startftplist munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!" ; exit ; } mount_fs install_sets finish_up  . .. bin dev etc mntmnt2 sbin  tmp usrvarinstbin.profile upgrade install  install.sub bsd install.mdboot #!/bin/ksh MODE=install . install.sub DISK= DISKS_DONE= _DKDEVS=$(get_dkdevs) rm -f /tmp/fstab.shadow /tmp/fstab /tmp/fstab.* while :; do DISKS_DONE=$(addel "$DISK" $DISKS_DONE) _DKDEVS=$(rmel "$DISK" $_DKDEVS) if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(l=$(get_dkdevs); for a in $DISKS_DONE; do l=$(rmel $a $l); done; bsort $l)' \ done [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK AUTOROOT=n md_prep_disklabel $DISK || { DISK= ; continue ; } grep -qs " / ffs " /tmp/fstab.$ROOTDISK || \ { DISK= ; echo "'/' must be configured!" ; continue ; } if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ /tmp/fstab.$DISK == $(grep -l " $_mp " /tmp/fstab.*) ]] || \ { _rest=$DISK ; DISK= ; break ; } done /etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." continue fi _i=${#_fsent[*]} while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} _fsent[$_i]="$_mp!$_pp" : $(( _i += 1 )) done &1 | sed -ne \ "/^ *\([a-p]\): .* swap /s,,/dev/$DISK\1 none swap sw 0 0,p" | \ grep -v "^/dev/$SWAPDEV " >>/tmp/fstab done for _mp in $(bsort ${_fsent[*]}); do _pp=${_mp##*!} _mp=${_mp%!*} echo -n "$_pp $_mp ffs rw" [[ $_mp == / ]] && { echo " 1 1" ; continue ; } echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" done >>/tmp/fstab munge_fstab mount_fs "-o async" install_sets if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF `tar cvf /dev/null [A-Za-y]*` >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(ftp_time) && _now=$(date +%s) && \ (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(ftp_time)")'?" yes if [[ $resp == y ]]; then date $(date -r "$(ftp_time)" "+%Y%m%d%H%M.%S") >&- fi fi if [[ -s $SERVERLISTALL ]]; then _i= [[ -n $installedfrom ]] && _i="install=$installedfrom" [[ -n $TZ ]] && _i="$_i&TZ=$TZ" [[ -n $method ]] && _i="$_i&method=$method" [[ -n $_i ]] && ftp $FTPOPTS -a -o - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed -e "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed)/" \ /mnt/etc/ttys >/tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; [ -f dhclient.leases ] && mv dhclient.leases /mnt/var/db/. ) hostname >/tmp/myname if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f ; rm /tmp/$_f ; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) (dmesg; cat $SERVERLISTALL; sysctl; route -n show; df; ifconfig -A; hostname) >/mnt/dev/arandom 2>&1 echo -n "done.\nGenerating initial host.random file..." /mnt/bin/dd if=/mnt/dev/arandom of=/mnt/var/db/host.random \ bs=65536 count=1 >/dev/null 2>&1 chmod 600 /mnt/var/db/host.random >/dev/null 2>&1 echo "done." apply if [[ -n $user ]]; then _encr="*" [[ -n "$userpass" ]] && _encr=`/mnt/usr/bin/encrypt -b 8 -- "$userpass"` uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:/home/${user}:/bin/ksh" echo "$uline" >> /mnt/etc/master.passwd echo "${user}:*:1000:" >> /mnt/etc/group mkdir -p /mnt/home/$user (cd /mnt/etc/skel; cp -pR . /mnt/home/$user) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root > /mnt/var/mail/$user ) chown -R 1000:1000 /mnt/home/$user /mnt/var/mail/$user echo "1,s@wheel:.:0:root\$@wheel:\*:0:root,${user}@ w q" | /mnt/bin/ed /mnt/etc/group 2>/dev/null fi if [[ -n "$_rootpass" ]]; then _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_rootpass"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null fi /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd finish_up 98aec4102444ddb3dedd560a11435ae9cf0ca215e882829f9f773cb1e45f270a 2214113c9bffb37d7bde2846ee98643ce640032bc1d382f30160f3de12009d94 ELF`44 (llp!p!phh33<\<\4c4c4ttX444OpenBSD㿠@ @D* @ +#@㿘"!@ `'""ؐ @, / &@ &J `Ȑ  *"J` ؐa&*!@_@ *`:` J " 㿘#@?#@`     , `2 ?, @??@@??㿘#8` #8  㿘 ܀    #0`"G@#X㿘 b  "b㿘@ J 2@@6@@} /  @ "`"@| 2     GGcx@7"@㿘 ?@?`Ŕ㿘 GGc@" b b)G+G@@  O4@ #Ф@@cآ`@ @#@H 㿘@k㿈'"0)"  h"` B%@é` $` Hc8@-Ԑ @a = 2,H` cH@-ʐ  L ` H` c`@- H'B b0!8@G  HcH@-  ( "Hc@-  €# (  $ ! (`@"@ $ ( (` @H@U# (`Hc@-{  Hc@-s  C"C##"@!C #C"$ ("`I`@-U   0Hc@-L C""`0`I h  I`8@-:   6 I`X@-,  #@)?`  `$  #@?    $  I` @-?㿘@:@㿘@R"`@"x㿘@I"`㿘@B "`?"`㿘@7 "a㿘 ( @+"`@ H㿘 ( @"`x 㿘@l:㿘@e:P㿘I`@, 㿐@T ?2 I`@0 2J I`@, `k`m`b". `w . . .  'J`x 4``*2 @$@s "` I`@,W  I`@,R 㿐 @–     I`@02 2K I`@,1  k m b .J w(J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& 2 @! 'J`x 4!`#`*2  @ @@ "` I`@+א  I`@+Ґ 㿘  0   "@    `* h 0``$   $ @$   $`$`8 p㿘I `@+ 㿘I `@+ 㿘I `@+ 㿘I `@+ 㿘@ FcT@ Fc|@ߐ F@  ? 3 @a?`&a@@ 㿘%0   I $  $ @1 $ I a@/A @0 !  0  )Ia@+; ) h #I!8 $ $$ `('"& @! $ `("& @! $ `$  h` #` I@/a#@g`h'( @20`h0 ` @? $0Ia@@. $`h !  @   $0`h  @@ $`hIaP@.Ґ  0 0`h`h`$"`$ ` " @b  $@(@( x (   @|    @.є ("@Ia`@*  @N  @/Qh pI a@. <     a@8؀     @  ?  @p%   & 㿘    ` %(@ @   0 @B  ' 0  @: '0  @&  z$ 63 ($2II a@.2 ! @wN@  (      @ 8 @( @w:(@0"  @  "#  ( $ @  $ "@ $  $  $ `` "` (` ! 0 " p@d y$ @@ 0`` "` @-c`0`` ਟ"`]㿘 C"@C"Ȁ@C$ #@* (! h`@  " @  h@  h`"` p @ 㿘 h  h``   H# h` $ 2 `` I"$@Q!h` "$` I@)ba'h @9 I ax@)S @n  I a@-?   > B; h @2   # ! h  " &   #    h@`"@  h  & - X'@Lm  Ж X" 'X\"@`'\А"@@'X'\XI"I?00"\ DB F?0 ?0 `I d#\@<8@y'8 `$`I"I" I d@- %@@b$ '`  (I"I" `I( d@Ԑ- 8"@G<$ \@"U##\`- @Ib BXI@ d0 ¨ @;`8<@&$@$@  I@"㿘@n ^@n"㿘V@? 㿘) 0   0@   0   @     @d ?B@I b@,C    6 0 0@  "  D?D?  a ?"aIb@(%  ($ `ـI@u2" рIb@,  㿐'h    @Ɣ    @  ?vtIb@+  $ '7a@ cIb@+ڐ    X$ Thh@ 4A`6Ib@+   7 'a@k?Ib@+ ` D 4h,$ (hh@8? Ib@+ ` D 4h$ h0  D 4h$h㿘@9!!!!!!!!!!!!!!!!!!! !!!!!!!!!!!!!!!!!! ! !! !!!! !!!    ' 't/G#-Itp+I9 x+;J 4&* P@€"    bܒ@d b   #@p   Ibܒc@' @D@J/c؀?Ґ?"* & @ @5@@t` tJ``@* ? 'x' 't '|'|t''`@({ @l`-JJ` @&Ґ x`H@*Đ @" 㿘 J``@А"@ 㿐@ ' @* @ `@㿐 #J @r` "L " n L  o  @ = ",@``"@, 2  .J @ @ @`JJ Ж J`@&c  2 &*@ &"``@&K `"(&@ "$&@@k"@ # J2&@@k`"2 &@Ja@&$  㿘@)&&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H%%&H%%&H&&H&H&H&H&H& /I! # % 9 - ; + )'J*7J $%* @€ $ $` $ $`$  '  % '`a Ja0@%Ð @"@@Hߔ ?Ӑ? "*@`&  耢  ` J@MڐaX@@kY  2@Ja@)  @^@!耢 ' @) @ R  @@b  @m@ @@r=`< @ @2 @@@ @ 2-`%a@*@ ! 䀢  @J@@M`@X 2 aJaؔ@@Mv` @@rPᰲ`@    @`  @Ð ꀢ4?a耦` $ ` @'@ޒ@g`?㿐@jƒ  @6  @< ꀢ ` @! 㿘 !  `؀`?  #@N    2`؀@ 㿘 JN  nJa@$Ȑ  N  o "` " ؠ %   @C , ` @"  $  @( $@ , `$@  @, , 2*@, $@㿘  ` ! `   쀢` @j; /- (+ ) 䀢 "!v  쀢 @>! @)a!貆!㿐@?JJ"@pq0"@pm㿘   @    @   @ 㿀J  @pJ"    @ cB ҔQ   @ @n @  @e @ ` @ @X @ܒ @N @`  @ @@ @ є  #\@7 @ #\#`J" @o" @  @   !, 4` `4 @  @?@ J "p BJbp?J "8@o  ` NJ ( 0 f7 @ u @  ?, 4` `4 @ ߒ @? @ ^ @ Ӓ .6 6@ Ȓ @J?"p B?@ ?J#\  0"H 4@opJ@ol"`J"h@oh 㿐  耢`J"x@ɐ'JJ"⨘@oT   ` J"$'@'@JJ"Ȗ⨘@o:  `"JJ@o2"J@o/#` ؒ!`  `J#'$J#('"JJ#8⨒@o `~   @ b @C@ ?@ 5 !@ /?J c B?@RJ` #p@: @@   @@ `   : @ @  ;`@ @ G;`   @ @ y  ;h@ߐ @ 0 ;h#x;p#\@na!贆㿘@6 ?J@og!?@C @Ր  @x㿘 @B@ " @g` 4 @g@3 J"c@! 㿘 "J c@"@` 㿘     %\FaT  @  }? %\Ua " 0t & 4F& 0aT&%\ 2.$@ ( :> 8@  ̘ d : > < (#  ; @ 8 @ Ė d ( 8b @ b >  @ ,? >( Ȓ %:> 8# @ j; $@ B > < d" $@: @ ] @  d@d@b>  @ ,? >($>0&`&dx J#@ Z@ ZK`@ն  㿘- $0$ X? 8;#S@2Q? L (&K? $*& 4* &@ (   $@4@@d$ >   > @ c >   >(   >0&`&d K @Y Z@U ZK`@S  㿘@=;;:t;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;:|;;:;:;;;;;;;;:;;:;;;<;`;l㻀  K'@'  ;K%- +K9 )K7KV 8QN* (@€ 'J   F"aaX@r @6J@ 70/KP@a /%  '"a Ka`@  @ܐ@Ia  a ' @=!  !@@@CH??  * &@ `   008䀠.`? @P  @|! K @v @=  K @ @    @'  " @ K@eΒ  Ka@$  @  "@!@Q  "@@@m aK@a@# @ 6@Ȑ 'K@a@ې @K@  @ߐ K@b@Ɛ @  Kb @#  & `&@@& ) @  K@ KK@b@  @ڒP "  @Ԓ!  K @Β " K@b(@   !   2`K@@P K"X@@c 2`@  @n@(@& #Kb`K@ܒx K"@n-耢 耢 @hʒ ? @d`Kb@#3 @Ʋ@㿐  @ '%K@Ɛ@`?@k/  2@&㿘 a  a@"   J@ " @j  @㵠  '@l  K!K! O K!K!@@?Kb@ `5K - @@-'%@#k Ÿ@) Z  @@!   @  `KK"ؔb@jҖ   @@   Kb @" ' <@& * &   * &*& 'K@j#  6 K!K.  @j# . K@j#@v@tv @-o`  02K@kq# @d@bd "4#K;K@c($@k&@i@c`c8@kS`@ 2@@c`K#H@kE@ @6@4@jK K@k5#p,  `2  `0$ `  @" K#x@F?   `@"  K"Ȓ@k `@  ` K@#`  'K   #@j   >` *    KKK#c@i  !` #3K! `-K+K)K@`  2 c#@i ,@`  뀌@`KK##@K#K!K#@i   p'̒@K#ؒ@i/bX@ PL!DK#K# ""KK##K@i#  @c KK##@i~# KK## LK# @ik#  "KK##L@i[#  " KK##L@iJ#  @" KK##L@i:#  " KK##L @i*# @@KK##L#@i( 2 @KK##LL  8@i@ 2 $@KK##LL $ 8@hH 2 (@KK##LL ( 8@hԔP 2 , KK##LL , 8@h` 2 0 KK##LL 0 8@hh 2 4 KK##LL 4 8@hp 2 8 KK##LL 8 8@h| KK## HLL@hj 8!L LL`@hd  PL`@h_ L T @hZ``@a L@ĤK#K#@!LL @h;݀`@B {L  !D l 2 p KK##LLL l! p@h! 2 t!" xKK##LL t! @h0 x " xKK##KL#@g8 x " xKK##KL#@gޔ@ x " xKK##KL#@g͔H x mKK##KL#@gP^aX@Ð 8L!D l  KK##KL#@g` l " lKK##KL#@gh l 1KK##KL#@gp"@ax  !DL!D@gp!  KK##KL#@g_L!K#@gV L@6!㿐@`Ӓ  @6  @I ꀢ  @B `@! 㿘 !  ``?  # @U    2`@ 㿘 LN  nLa@ϐ   N  o   "` "  %   @J , ` @)  $ @ $@ , `$@  @3 , 2*@, $@㿘 L@ @.@+ @ L @} @{0@K@㿐L'@!1K  -, , & @ =   , *& , & & @fa" 2J&@㿘 La@S"@{ 㿘 K@|bX  K@bP 26 @$ "0 @k  *L @ebP 2 Ka@@^ 2 L@BR"X L@R`؀ 2  Ka@@K "   L"@B=  㿘@㿘Lb@遐  bؠ L@+b`? ` "!LL"Ц b LL"ئ b) +L# "  s a"0" @@<? k" @ bP@Db .@qbPbP@>bP@k @{ 㿘 !` L"@ܲb0L"@ܭc@z 㿘@㿘@< 㿘@㿘@@㿀L'Uc'  @  2M` @ 2] `&` 2 NM @A@rN u2 NMa@쒐 "  N <2  Ma@쇐  `( 4*@  @ `M! @Al@GJ`M!8@Ab@= `(* N ^N `(`? `-   * `(*  &`  㿘 MMah@ a@ 㿘 M! @e* Lc c%M   @ @e  2 @`M@`%M!@e㿐'H@h : 'HȐ H'M 'H-M+M)M@Y = 2,, a@ gN@ c @" 2N@e&  i2 N@Mb@ 2N@X& i2N@Mb@ِ 2 N@@ ?G& $ l2 N@Mb @Ȑ 2N@:& o2 N@Mb(@뻐 2N@-&  oLMb0@뮐  L@ & (# "N@J@2  @떐 2  ,@ HCH  H@dV N@ x㿘@w@㿈@L@ -2&` &`` Wb@ D' @ 2 # 2  ` M"@@N@)  "  & &`M#@@=@ @ 㿘   D@ 㿘  " $@ː0 " `  & & & & $㿐 ?   #@􀢠6 FM c8@Ő  &  $  ߆C w   " * +* -* 0" $"    " * +* -㿘   D@J 㿐    ``'@K   '``@C & 㿘 @ݠ @a  &  @$**@"" "$@$   """$ "     " "  " 㿘 @ @^ & 㿘  @%0 @)  ?` # & & 㿐 ?   #@􀢠6 DM c@@"  &    $g`  ˒  " " " " $" 㿘M F#H@c; D㿘@^G M@c2#P㿐 `'@ McX@ 㿘@`n Mch@ސ 㿘@`o Mcx@ѐ 㿘Mc c @ 2    ` *@&`   &` U&`  2N!`! @ 2    `*@&`  &` ;&` 2O `  @Ӑ 2    `$*@&`$  &` !&`$ 2P! `!  @鹐 2    `*@&`  &` &` 2 cddd0dD  ') ` *`X# €P@b"P@b{"P@bv"P@bq" P@bl#P#@bf@]@]q P# @bYP#@@bSP`@@bK#P" P@bD#h P@#p! 4 P#x `@@  4 P# `@@$ 4 P# `@@  4 P# `@@  4 P# `@@  4 P# `@~@ P# @t@  4 P# `@i@ @ 4 P# `@^@  4 P#Ȓ `@S@" 4 P#ؒ `@H@ P#4 @>@4 P# `@2@4  P# `@&@4 Q `@@4 Q  `@@( 4 Q  `@@4 @"Q ( `@@Q@ 0  4 Q 8 `@@! 4 Q @ `@ݐ@ @ 4 Q H `@Ґ@  4 Q P `@ǐ@4 Q X `@@" 4 Q ` `@@$ 4 Q h `@@( 4 Q p `@@4  4 Q x `@@ Q @@  4 Q `@x@  4 Q `@m@  4 Q `@b@ "  4 Q `@W@ Q@F  Q @I@  4 Q `@>@  4 Q Ȓ `@3@ @ 4 Q В `@(@  4 Q ؒ `@@  4 Q `@@  4 Q `@@ "  4 Q `@@ Q@ (2 #4 Q! `@@ #!"Q"  4 Q#4 QQ@ِ!4 @Ր! 4 Q@А!4 Q@ː! 4 Q!( `@Ő@4 Q!0 `@@4  4 Q!8 `@@4  Q!@ `@@$ 4 Q!H `@@4 @Q!P `@@4 Q!` `@}@" Q@j!hL#`#%Q` @@ dp@tؐ@c` @ 2`@O D@K L##`2 QQ!a d,`` " ` @%@t`  @^@t 2 ` @_ @_` @ ؀!Q@_!!@_  Q@y!㿘! ! P@_#h$! "!㿘! !   !Q@_w!$!@ߐ!@`H QQ@_k!Q!@_g $!@_a!!@$!㿘 ?  1 Q!@tC &! 1Q ! ! M.! -*  ^* ? *4* ^*@**!8   'H'" '' 'H@6 ?2 e"  f a + g% !"@  'Q"ܒa@  ℀@H*` Q@@a℠H*`@Q QℒH* @'H Qa@ `@J Qa@ `h@? `Q@_"` `H H` HHvH''@ ^H -Q0 LHݒ FH @HJ@? `   ` H   #@   H@0 @Y@['HQb@  HH`'Q@:T"@/H 'H   @2 Qb0@    `g@ Q@_"@ Q@"P 㿘 "Q bX@"@s< 㿘@2vwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwvwvwwwwwvwwwwv(+]) ' % ! #Q/ 5 9h7h -* a@€  %!$  $  $( $!0@@4b??№,!0* @ &#ܐx "  . " `. @Q@b@, @r @'@@r?@p= Qb@J <  "@@  @@  `@@@r㺰   a0 '  @p Q" !$` <  2  @V "Qy"!(`h!\Δ Ā€ (<  !@Ɛ QX"#Q$b@r#( @V  ?"b@]J@  $ 0   @o Q0"@ @  ! `2' Q"@8  ! ` @^X   @VS`2 Q !,€ Q"@]   Q@"㿘 "Q  b@ӑ"@qې 㿘@V$@x~~|~~~}~~~~~~~~}~~~}(~~~~}L~~~~~~~~~~~}x}}}~}~~~~~~~~,~~~}~~~HTԝ㿐 )! - 5 ; #97 /+ ' 8|^* h@€ h u% h h  @  $ hk' h  @  b$ h h  @   'W$ hT S%T\ O&\ h  @  F$ h h  @  =$ hb:'`X *7/ P 3&P h  @  *$ hbRJ@P฀  bJ`  R"@`@q  J@    *  R  *ഐ %b %b@ R@2ࠀ?{? " h*@`&  $ h  `X   h  h  h@  h  @` "`  `@D 6 h R`@` ?`^P*` € @ e@@ @ Y@@ k @ M@ސP  P@u0 O "P@˖ @ Ȑh? @ 3@Đ h@>@!R`@ 蠒 2R``@  @U @@_  h@Z@z09ഀ 6 `m@ /R`@ \ h@"?@  @    ``@ h@⼰@Ე!@ h   h@@p㿘@N  Ra@ @ᘔ!&&& `&$@ 㿘 !W&&6@ ` 6 e`g@D  R@ !     @ѐ 㿘@T- "R   RR "R R!8!X!R!@60 @[~㿀  T` `s@  Rb @L   h` )  \`!  h e! e`r@" Rb8@1 `e@" RbP@&   `Rbh@6 aGRD#hEbxF@#\A#`B#dC@6 @:`l`@䩠 a * @ *?@ @ " @ . $@   `@B@@ h @㿘`( 2 @"&`&`( @!@ !Ԁ@ RJ b@ ̐ *J㿘N` Rb @Ȗ`N` Rb @п`R"@8`8 R #X* Rc@Я`(c@Ъ`(R@Хc(`,R@Рc0`0R@Лc8`4Rc@@Ж`8RcH@Б`pR `< BcP@Ї`\` #R,c`@{,` v # 5R/R-R+R` @  B a@`h` a @  @+ B ; p@P` ` @B @D `  *@9c ` Rc@2 ` - 2,` ` ,`: 2` - Rc@ ` <  ? * "  2 *@- R Rc@`` @@y㿐 @ۖ @P  !. 6`  `6 @D @(' R#B* : `/D_ L*` €&(''R#B8' R#B R#@R# @R#@R#@R#㿀. @ @ @ .B >? @ @ B     ?*@ !   ?*@ S  2  *@ "    `*   @S H    @B  BRc#\@=a0,` @ ;`B `B #\;`S`@ @)a  S  c* @S`@0 ` @ S@-S`(@ R`8@ l. S`@@  ` ?`&  * &@Đ 0@ 㿘.`:  *Y p <  @  (B %   * 0    @  B 0  @ B 82 @   @ B  6`    @(4" K6` @ K   @4 M6` @ M   @ 4 G T@ G T* : `  #*`@ R`* > 㿀.:` S`P@i` * #X S`X@^SS`h@XS``x@R S``@L `DS`@``A`B`C`E#\`F#``G#h#d@<S`@8`X`S`@1`X S`@*  `  ?`&  *  & @`(@ޒ`(S@``,S@ a`0S@a `8S@a8`4SaP@`pS `< Ba`@`p,  `< @ ;  B S8  ? BSax@ @ӐS @Βa`LS`P  Ba@Đ`NS `T Ba@ͺSa@Ͷ`\`    .`"&   !%S, @@͛ , !@͔S`a@͍SSSa(0@ͅ`  ߗ<`@   '@ޏ P?S@b@ ?R@R @Wd P T@  @@W   ֐SbH@ESbX@A@ P-Rc+  !@@n @ ג@!`hn @T@V@  @ڙ"P `   ` ? "`@    "! @͐! ` `n !`? "`@ؐ  !  $!@!` `n`N@? @M袒 2XR @Vؒ@Wf P  T@͐ @㿀TTP`HT'' X'@E' ?J T@; ` TJ TT hT`x@1z䀢?J? '@  @  @  @ @ `T @T@> @O`@U ? "2 @O " @N@ @ @ @ @Q@N"㿘T@`L  㿘1T@ L   , @L   㿘  L  ?   ` " @,, 㿈!  '@ߊ  %?@ А `    ɑ2:   *`@ + $`@$`D  T@֐ 㻈  ' 6`r&`  &`'`@ ,g "@/ :  T @0ϒW-T`@ː =T TQ #`@.  Q# #X`<@?@ "`@ ސX`@*@?   #K '耢T Д@06``@ۊ 0T'耥 )M %'T%T#T@w  '@n  'a@0_ L &`Xa(@V +T M `\)T   ?쀢'!8@05,`$ʐ p`L l` iaX@耢  ? T!h@0 U6`S6`TR a@ T `a@ T`@ ;a@ TĒ .T!@/'a@ T   ? '耊"&`(T!@/ɒ a@ɐ T   ?m  'T!@/&`,a@ڭ T   ?Q  'T!@/Ԭ&`8a@ڑ T   ?5  'T!@/w&`0b@u #T   ?  'T!@/[&`4@Yb T ?   T!@/> 6`p{&`<b @: uTb(@4 oTb8@. iTbH@( cTbX@" ]Tbh@ Wb@ RTb@ LTb@  G  ;TL  7T*`: ` T-"6`* @@~ ?   T"ؔ@.ђ 5` &@ "a ? q  T"@. 5`%` C-` B c `X@  @ "`@ 㘢`@*@L? `   `      2'$@:  '쀢 T耢 T# @.l'-` `  C$    ?즒` T"@.K ?    '@r@* @j@"@R?, @`@R e-` T"@.\   ?š즒`O T"@.G ?    '@,@ @$@ܐ@Rs?, @@Rl -` T"@-גl?   #} 5`$@: 6`#P@-$@ T@    T@#pT"@-㿘 (  T# , 2 0T# 2 4T#@- ,  2 8T#@-   8 2 p ,@l 0& 8 p <  B 2   8 4  @ 6 p& < T#@-^  `@  ( T@-U# U @-M  `@  ( U@-D 8 `U h@-=     -U  a  B * 0   @  B  0  ( B :`@- X * (    8@  B @ @U, @-:` " X   8@  B @ @U,!@,:` X  2   B " B U@,Ӑ!@` p    W@"P5 WP@ݐ$@? W  `  ?`$ P*  &P@%  q@   q//W"@ W@ L`u`U(@!!@@@ l ?* :  pk* @€@e`r@ 2  "`h@!ܐ@`Ր@ Nѐ@y̐e`r@ 2W   l"\  @{$ @N"@@ c@@ @  X`2W "@1` L@@j @א~` L@P' t @ W"@#' WL@ WW"Wc@)b?W@Jc   e!^!`@@K0W# @Nx@{k@Ő A `W@  \`)W h` %W@2! )W%W!W` @  *`@ R``y*: `   *`@ R` n `#x@&# 2L@` L@`   *`@ R` y   `hb gW@)># ' h`  "`W@XސW #@zbא@  %  @)X  @,` ``@ c XC?`#\@#`,`   ,`@  @ɒ 8`WXX X`h@ L@ Wc@. X @M 4 @X@Á!  ( l@  2X(!@eX!@a!@]@ x l l@ u@ rX@Ɛ W(!@J!@F!@B@ ] l l@ Z@ WX@ < `W@#83 `h W@(x#' " h"`\@! " `?""X X!X@LV  @*X!@LK:`@! W l@ 4 "W(@!@ W@z@z@z  " @z   X@|!8㿀 '  ?  @ռ ?Xa@@ڐ   'D'@ zX' % ',D ⠪ 'D""'L `      B @ B @ LC ( &    2  @(L (` L `L```'L%D ( @} D?8 8 lD *  'L@yz$L 'LD!@C,W` 'HH*  ,* 2@xw 'TWa@O @@*TD3,  ( @C 8 4 < 2T<@  <82`<* + T;   T< 28@ TB : 8*  T P<+  BT: P@ , H`&, (T2 'L@< @ < 2   (  f L 'L'LLH1 @ d?0T'$'(,      B  '@l++,`H L?(@ 'P`4'`` 8!`T$ 2 `( ``: @`0@ D`4 `2@` @@`@DD?@挖@I edE&@,@ y    @  @%,+  @ b  2 @(  @@b+ +   ,X @ d@EE?@9@ 4@2 @@@d E@`( 6 @x%TD'Dg 6 &6 & (, ( @ǔ 8,,`,, ( @跔 8,2L`L,L`, " . L,@J?*  .  6 `J`/ . . @@ W,P@w@`P #Wa@ L( $`H'L'( '$@wTD!@Ѝ,   X@y!X  X'@w!`XX!pa@ 2N@X !  `@  .` X"a@``   B2 X e"  X ]"(@ ,    ;`#hXX#\bPx@  @ 8  8X`8 8 <! 2 (@@`@@/@      @ B B" B"2  (X  "D  X "@bj`D 5 %``].` / 1 @`"P` `  2I``   B?   B@B @⨘C (X` $X 5 %    B@ ⨔C(`@ b 5 %"Xb@`a#@/" ````@{!` X@x#0㿐@ [ X   8   X .#@ `X '# ` // XX` `   B 2```a/#@Xcز 2@X !@֒b0ճ* >` `` ,` X"a@I p0Ř      B  Y"`@5>`0 4$* 2 " " " "  `*`2 6  $$ $ $ @    @  @'(`  @ b  2`@( ` @ b  `(` (`   4 $4 `$ ,  ,  4 @  2O$ @ ] 2I$  (  (@  B @z   ,8,``,`, " , `,@HZ?*  , @  2$ @  2$ @  2 $ @  $ $$ $ 㿘`XY 0a@p 2 X !@b0?* >`    ( X"a@``0.        B   Y"`H@I>`0    `  * Y "@5`h0@ 㿈`YY `@ 2 X !@b0Z* >`?    ,  X"a@`0I  ` 2@`    B 2 @ Y"`H@>`03`'`'` ''@  @ s @  @ _ @ ޒ @ N  $@$`$`$` 㿘` YY `@ 2JX !@.b04`*@ ]0.  `@  ,` X"a@`0   2!   B  ! Y"`H@0  l,`  @t$㿘`YY!0aP@i 2 X !@b0;* <    , X"a@Y`0*    *`0    @ B  0 Y"`H@C<0 @ D <@  Y!@FV@㿘@    @ F  @ 8?@  ?    㿘  ' Y!*a8/ V"@F8$@O 268  `,8  `*8@a $` ` ?5` @` P P` ?"`P* "P@  % @  ! 8@K ?L ", M!8`?!8@ L8`2L8@۔$L8 ?8h`'D? `8'X'H 'LX '@E7  ?/߰  ?/9Y5 H@E!$@͔ 4  `/` `0)@ %` ` ?4` @ ` P P` ?"`P* "P@ # ?@  ??@ː L O ,O ?O@uLO ? * `O ``hmL`   *`@ R`?ۀ`O^l *` €D  8D `( ,ND`($ 2   $D ( D  (D!`(   @ *, @L,Y"8 DD?`p<  @B Y@YԒ$O @L~,Y8 Y$@Y?O + -/߲@><'"@Lc@>6?`" J` @>, "?&? (@@@`Ёȅ B?@t ߑ*`:  + -@Fh@ehC?D? X D 5   8 @  F @@'@.`B @@ b 82 @( F? @ಢ@ b Y"@DF ` Y@t%"0㻐  '@` "  @ " -`@  "P5Y;Y7Y9Y-@@      @ @ C  B @B 8-`2[` W-`@@ll"@"2`2a`a@C@⠔"@Cbh( # #Y ) `/-,* a`a@CՐb!/$@ O  ` X` ?"` X* $ X@u  @]  O` Ґ?* * r`-`@ --@`2v    Y@s{"  !X'@8Y@C"  ;Y9Y7Y5  Y *`p Gc( "X@#    pD Y,`` @א 2` Y@`? @CO#@쥒P  % +Y- p'Y,`@CAc 8 `Ȁ` 8`@쐒P`D ,``( P` ?"`P* $P@א  @   YY6 #Вc ?@Ɣ /Z-Z  +Z)  ,8  #\;`#h6(? #X?``@@" ,& ,/Z-Z  +Z)  0  #\;`#hp? X?``@" 0& 0/Z-Z  +Z)  8  #\;`#hਠ? X?``@" 8& 8/Z-Z  +Z)  4(  #\;`#hʒ? X?``@Ԓ" 4& 4)Z?'Z+0  @  B 80@0  @ B   ~@ p *  <3   @  B @b h@g B  Zb"aИ@ p <  4  8@  C  @ྔ   2   ;`#h#\!XUh? BX?2  p2  pZ  `@[b p < @ B  % @ +   @ "B "t q+Z@!2`& < !@)b X b@"!@u! <& <6 p   Z@q" 㿘 !8 @f H           B (# ` u༐a8@  a8Zb0@G a8@VZb X@#@  " N r"Zc@. `@i 2` ?* 2  @uZ@r#Z@AJ#( `p 'Y# ) ;Z9Z7Y!Y.`@A<` #@ꐒbP``.`  bP`?"`bP *  $bP@ܐ %  M6 @bP% /Y-Yc0#@ "c0@   p.`@ "46 ``(.`@@㈐@RbP p!Y.`@@` #@FbP``.`  bP` ?"`bP* $bP@ c0@zbPc0㿈'Z%Z/ 2 p@8' p  <  @⠖ B ;`#\#h 3X p   < @ B -Z+Z) 5   ⠆ "@@ d  `;`#\#hÔc  2  pX !@ϒb0 p   < @ B @b8Ӓ ΀ D="=⠁㿈 @[ A 8 B C+[ D)[ E'X F# #\ G%[#`@@M#d`  "@ʰ @闒b0  @鏒b `㿘| 2   " a:a  : : :     " B"  ;  (b 8  @ B :  f 7 5 ⠒a.`⠸ @    B @B @C@8    2 ` (``     B       892 `(`99  ``@ 2@a.`    ; :㿘 N T  @ LB  P  :"" " B @ :b "` [  @?g㿘3  @  @(` `(`@ b @ F (`   㿘[@^!`[@[!x㿘'W   "@ɖ @n# 2$@ @0   " @l$ <㿘   `" `2 @ ` ``     `X ' |p @Ö t l !%\ ,` "`"@ " ``` @    K  r  \ @S$@AG / "K`L@r2F,@ \$@S`,@@?- @!Ŕ  XW@c *  "\ !a t   *  ` a* #\#\@L``  2@ \@nF"㿈.` `*`2``   @  B  ` B  ;`  #hY\#\bx  X  !   "Z  `@{b ""@ 2    ""@  ` \⠐""@ޒb@f `2 `  \"@ҒbZ  ` ,` ,`  @+  @D\+ 81  `8+ `82% `  4`$` *`2`    B@ @b  @C 8  @  $@4`   +  Ȕ  ‘+ \ #@b 㿈*` @=` `  `  B@ ` B `;``  #hY\b0#\  X ! Z  `2 `\ #@氒b8  ` @  B   @ @  "B \@ "c@c    ( &@]"`P@ &@6`  㿈 .`"``l@` 2i `  ? *`2 @ꁑ*:    ? *@ :`  9]  7]  5Z1 ;`#h#\ ? &X?`@'";`2]@ Ȑ@T@@M@=J ?, @=F .`  !@b .`  㿈.`` 2    "` ? *`2 @ *:    ? *@ :`  @ 3 ;]9]7]  ;`]]#h#\? JX?Z$``@&:   @b@a@Ԑ @Ж@ !@@@冒b @@ڶ@@@ڬ@< ?, @< .  !@eb .  㿈.``` `5  *` ]]"ɒb #  D ],`` @~_ 2`.` ]29 `(6 @;Ր"8 /.` X !@&b) /]-]  +Z) `   #\;`#hx? X?``@"` .`  㿘  X.``]  Y W U S.`'+]2)]   . `" @Š 2  4 L@ ]"c( a@M3 /]l@iF@ '$Wa@1  #P@䵒blb؀"]# %  ]X !@䣒b  c @} @i& 㿘 2 @@ 2  2@ `?@3(@? ]cx@ @j\! #eWa@ `r@ۇ 6 &@`e@ۀ 6&@]c@Ɛ 㿘 ]]^#cŔP 2JX q! U"* d D ^j  u^d `2`(^ Z X& (`,& ,`0& 0`4& 4`8& 8`p`<  B & <M6 p2(^ @ X& (,& ,0& 04& 48& 8p<  B & <`26 p(`(@-,`,@(0`0@#4`4@8`8@ p< `p `^ 聨 9?^ ؒ@:0 B^  @  @9㿘.`:`* ^@9 % Ԕ ^@9!! "̔ ^@9ڐ!">`@ c^@9ϐ!^YYb!(@9Ô   % P<`  㿘@39 l     < x !h?" @    ?S $!h"!8"# " |u#al#l( € e!S"a$!h @ !  $!h@2e@B6 !hTS!`P @ M!h  e!8 S"a$!h&@!  $!h@2eH@B !h $|!h,S!`( @ %!h  e!8 S"a$!h @Ԕ! $!h@2eh@A  !he!S  ""t!h ?1S! @[  @2we!@Aʐ Ѱ? !h@t`Ȁ 6 `@2fS!e@A !h < S!ea@A !h@??$!h$|2 !ha@D؀   !h $l  @⚖ ?2 $l2 $l@2*`2$l l`2$|   `S! S  ""ats#!i#X*` €c?   `S! S"!Z"a` H>c? !SS"!S"a  !Sl  ! >"!?;"a  S!S!  : `@ 8@S%!S?"!% 1 >$!!  : `@ 8@!   $!  ?! &!&!" S"a"%  $t 㿀 ah   S"!"`"Sà ,  !l`(# S"`)   `  ?`" *  " @ S@ S"<e @Ȓa@F # a| h!@c Ȁ   <    <8  S@9Ga$a|  ` ! S"`! @5 @h! @7 ̀  !l`2 !  e@"(S @"b ?$h S  "฀`" ap "ap̀ SSk"!"`)   `  ?`" *  " @* $"@ $" !SS"<SaeaĒb0@9 @ S;"ae"<@`"X eS   S@  e@b`#S"<@D"p #SSS! ap#\ #`#d#he"<bx?a@ @| $a?c  !l `' at   ?#! !h@I? 4!h$t e@f"㿘 !l "ax 1 !h  @ɒ    !h@Д   @0U?e@? 㿘 !l`eb@?s ?!8` SS!e"<c @?f ? 㿘 !t 4 !l  ah@IU S  #" ! ""!8ah@IC  "` $!t@0 e!p`@?W 0 !pec@?& 㿘 !t  ah @ה   "`"x6$!t$!t !l W 1 Q !ah  @/ E  > b ah@2 ; 7$!t 6@/`".$!t@/`"($!t@/ `E# @/` ec@>ǐ $!tP @/`"$!t@/`" $!t@/` $!t   "x "`x  ec@> 0(  !pec@> 0  @/a f!p@> 0 ``"f@Iz ff`@@>z 0`x@>v 㿐 `g? at b  `? fW`  "` !l 4=# 9! # 2$t ah7  a'@ 6&$t%t # al % "% h  @d  > @ @ dh@V   $t# t fa@>  f`@>  ?㿘  >2@ `(=  !t 4 5!l`21 ! !h  @#    Ȗ@ 8C 4 2 > <(>8@ b >8  !h@   @.?f @=H?$at㿐 !t 6 !l M  f~ `(|$t @=axs? ! q `(o$t!h  @Β   @.af @=Z?b  !p`f @=|aK?    !h@ެ D @.?f @=8?@= 2S "!1 `(/$t :`@<@ f@=Mb(? 7@p 'h a@  @. f @=\X?$t?$t ?c   at  ' ' ??ch @G? 4 !?@-fP!?# 7# h) '!@Д ; 7h'!@ǔ #@-f1h@F? h@-f$@F? 4h?@-f## 7 h- '@ԗ  @-f@< $?"%t@G fb(@< ? 7@~'h@t  `@-l?f(@< ` f@cΐ#X㳀  'Saؐ @6䀢  @-Mfh@<  @&  @-=f@< ` T  !x`OS!`L?Se< @"p B<f@<'#Sa e@a8 ae@a  !l | z   !paf@< #g@<   !pag@< (g@; P `? gg@; 9g ? "tg%`b@< ?`@; 9g5g3g-g7 1g)g/g'g<@;ؐ @;֐@;Ԑa@;Ґ(@;, @U!P  O ?%`<XM&t` O逢 2!h`Y `s`S!h0 `y!ha ia@;<g@;!'g!h@;< !pg@;!Р'g1g"@;<@;@;"@;, gaP@  O  ?<g!X%`#!t@;s?S"" 2gg@;j"(<bH@ g@;`"P<@G,g@;W"x<4 g1 ! @`a&!@|d R$a &! ` g@b"؁㿐@ա gb@t @ 쀢`"!gb@i @Ē0@@ߠ@ߞ0# @ڶ @ڳ g c@ڮ @ګ gc@߉@߇@1h gc@8   #?cP'@s t  `D l `  fS!̀` @  ^ @  Y @t    cH+ @ː >  `  ?? <  @=B0@( # @, @(0  @)_  2@gbP @B  `(Saؔ @N @'  g@aΐ#(x  ?cP '@   `D  `  @3G S"`@1= @t$ -S'?` ???<"ؐ y @(* v @,} @#Sb !?S!`6" @Y /b Sa #@  "#H @fa  ?`H  `V?`@ M`@'l ( @( #  S@/  <@a  S!Ԁ`9S!?" @ 1Sa S!Ԁ``@#  "S#`H  a ?`H?`@  S`@` @ @B0Ӧ!̀    @T   @pS "b  "  "@3 " @*Og0 @9   ? =? @ߐ@  @ @ @АB`@.̀ mS"`i  `   `?"`@*  "@@O T$" @6 O$"@& 6   @ @ @B@.=? <ؔ @C̀ !`S"`  `   `?"`@*  "@@ $" @ $"`2 ?"  @ @\B    S@nb  @)gH@8 @ r `(ؔ @z @2@& g@_#p㿈  ?` '@- !@  `0@&@.1`@ ``,  S` 0@/`  @rF+``% 'S7g@30@ "@- ΀`   ` @g  '@)*x@8~ 0@&  S"0` @  S@ɒ@-Ԑ0S!̀  @S@   $S`ƀ" $ à  #S  ` `?"`@* "@@ $b@ $b@0J `@@}à   #S  ` `?"`@* "@@ $b@Ր $b 3耢  `쀢 ( @耢 %`    `@ `@ `@) S" ?2'@- (` `4@Saؔ @H S!܀`@0@M   ?#P`  '@     gc@7k y `D q `  kSb  @-I c  S@. XSà    `Sg<@scS "b  b  @-n " @.  @   @)\  @B  `(@,ݢ @ ̀  !S"   g@ש#$"@  h@^,  S"  `'@,  @    `D ?#P   h@^ ?bp?H? #P`SԐ? '   '@,h2 !?L+ /!?b )`#H@M / /-@`-@,""b @@  "@'Whb 0@6 ``< @ @hb `X@6s S`@+x N`@ I`@/? CS"`@-5 ;`@1S0(#??b'@(  'S 2LS!`=L /d?@h`@65 0cHbؐ@a %-@@ Sa   @c   H ca ?`H?`@  @@+# ڒ!@$ Ւ!!?#H @% Sa  S!Ԁ`+S"ؒ @ $Sa S!Ԁ`  @#  S H #a ?`H?`@  Sà     @S "bSS!`"@I @W !̀ tS"`p  `g   `?W"`0Z   ? @ @ !@+!  @| ?bԦ  '@&<g @5x0 @V 6@@*0+@@@ڒ!̀ S"`  `   `?"`@*  "@@I $" @0 $"@p ֒!ؔ @ܐ Z@.e@` h@\Z 㿐  ` @? ' 5h- 3h "g?  @ `T  E @4a a@@䀥  a@ $€ % ` ``8 ( ` !@ !haP@4  !@ @& ѐ` `8   S0h` ?ha(@4 ?Sa  "a㿘 #"`  "0*` * & 6@ p?@ * @*`@" @ܒd a@ " 9 7h Uh@y O"  @  L? @4Tီ @v 4  c@  "( c!@@*` *  . `@  2   ? @4#ီ  a@ @""@Š"@ ha@4 ?㿘Sa S!@ "a@  `&!!? haؔ  !hb   "" hbH  @3?0Sa S""a  !@K !@ ?S!  @SS8"aD#!H 㿘  Sa@"!@S!? hb hbȐ "@3?0S\a  S S?aS!@SS  #!H:#aD ?@SS @"!"a㿘S"`hb SḀ  SS! "Ḫ "a "!  sSDS !H " a  @ :; F@y@6  @a :@ D| E@d S(!@`%!@a@$H@ %!DH᠔ -H!D $HH@"  V: @a $H%!Da$H@ %!DSaS@ab  %;a^8    "` hc0 @2?㿘 !`L   `hch@2ܐ C?f !SJ S7?S ;  !@B@ SS"!D8"aH(   :!S#   : !@Sa    hc@2 00 !@ S?㿘SaH" "aH@㿐  p?SaDS H" :   2 @!H  !H@fU%!HS! :`@L @ň@E P :?S@ f @ B D (8. !H"@:`   ` @h:   2@!H!H  d%!HaD!H 㿘#SSaHa@ !S!D "@ !D a@e$aH㿘`$" 'S#S% DaH"@  @@T @?aH@aH&@@$aH` 㿘`$'S#SDaH"@  @ &@ aH@ŔaH&@$aH 㿘' S!DH"   @a &!?< 2 @H H@ H@ < f $H S`S ( P@' S!DH"   @a &I>: 2 @H H @;c  H@ :d $H 4S`8S @"` h  hc@1: ">@ @"` i@1R >?@ i` @1 >  P@  '"` ,@ޒ  Ѐ 2  P>@!iP @1  >'/S0-S :2 @   H#\@Ú S"0` :S!H   #!H H: $H  @ d D` H"@%S@ Ē   P`4   `@ 4 S` "0 S?"0`2   @i`x @0z  PX  * 2`  *` '     "2  @   @0 Ѐ 2  '@!iP @0p'#S' a@@ #\@ <@ Ea@@:.ሠ 怦!@  i  @0B 1 P    @   i`А @0 @ے   @@  i @0   ia @/   P`  `@9㿘 a  )  $% #S ! 8 S  :a@Y! SS "b? a@> B@SS"!D8"aH㿘S!! ` 4+S  1%SS!!!  !'%S @3' ia8@/      S =ai"!S!@  S "aD@=a] && %S'   =a MS@ "aD&& -@ሢ@ `a <`B=a S!D@E@@Sሐ &"aH$ @S "!Ha@@ <`C &!S=a@($!H ` @ @$!H@:  SS "b?㿘! !  1 ! 2?!=@U  $!  !i &!ap@. ?㿘! !  1 ! 2? @U|  $!  !i &!a@.Ґ ?㿘! !  1 ! 2?!=@U_  $!  !i &!a@. ?㿘! !  1 ! 2?!=@UB  $!  !i &!b@. ?㿘 !` E1i!=@?* @ ! `! $2 !`2? `2.1i: !  @O !`$!  @R (!=@* "@@-   & iX& $@: `21i"P2& $  @  &㿘 !`C E1i @* @ ! `! $2 !`2? `2.1i: !  @' !`$!  @RN ( @ฐ* "@@ΐ   & iX& $@:7 `21i"P2& $  @H  &㿘@ "[?N V a   &N?@'5!=ᤑ* @ #   @  #  7?! $a  @ a`$a  @'!=@Q (ᤡ, "@  @  ?` &@ @ @  $` $ $&@ $?㿘@8 "[?N V a   &N?@&Ԕ ᨑ* @ #   @  #  7?! $a  @` a`$a  @& @Q (ᨡ, "@  @ ?` &@ @ @  $` $ $&@ $?㿘@"㿘ib`@o   ? P`@  ?㿘 <    < & +& "*0.P(P$#"P(0  #&  &  &  &  &  & P   o @& &  <@! ? % !?#P' @ '  'ib`,'t@` ` 0@ i@S"p㿘lib@,j ? 2 iL 2iN   ib@,U ?㿘 P   @   4!  P P@ i@,9b? P,  W @"&,i c,@ N,  ic @,  ?㿘`K ic@@e   ?㿘 L h!    :` @  & `  @  & ` @  &` @  (& ` @  ,& `$ @  $& `* @ޔ  0& `0 @ؔ  H&  P @&  8& `A@9 : `;@ǔ ` &L < (  @ &,., Y ?  W㿘@"@  c'@#H ư?``   :`0& ",    A4  #`P  A @,  `icH A @  !ǒ @  ~#`   @  t`   @|  k`    @s  b`(   @j  Y`,   @a  P`$   $@X  G`0   *@O  >`@   0@F  5 ; @>  - L  `  ``icp     2 ,֐, 6 `ic@*͐  ? ic@*Ő    i@Q#㿘`m ic@dJ   ?㿘`m j`@d<   ?㿘S @"b0㿘S"0` n Ӓ n #`  :` @  `& ` @ | ` &` @ v `(& ` @ p `,& `. @ j `H& `@& `8& `6 @ ̒ `P:`& @ Y `$& `> @ S `F @ N !?# @ `*  * `& `N @ > `V @ 9  @ `*  , `0& `f @ + `&`^ @ %  ??& 8 n ` "  .< (  @   @  b  `:&,.,    @  b Y ` ?  |㿘S @!8"b0   '?@!? #?` ``0&S"0`!’ @   `   ! @     @ ݖ  ` "(`  (% ##`P   `  b ` ;@ 6 @ <  `jÒ`,   ;   ;@ 6 @   %   @       @   (   @   ,   @ z  @   .@ q  $   &@ h  v `  >@ ^  l'? @ `2 @ F @ Q  _0 `  N@ G  U V  2  @ ;  I ^ @ 3  A n     n  $ )  j"`0    # 2! ,, & , $   6 j`X@(  ? j`@(   j@Oސ ` (:`((!Dž0: 2`(0 ?SP   P?㿘ڒ  S!P!    S;` `*  & ` `*`@& ` `*  & `  (`*`@& `  ,` *  & `  $` *`@& ` 0`*& ` @`*  & `* `*`@  & ` P`*  :`*`+ 2 *  @ :`R`` `*  & ` `*`@& ` `*  & ` (` *`@& `  ,` *  & `  $` *`@& ` 0`*& ` @`*  & `* `*`@  & ` P`*  ;`*`+ 2 *  @ :``, 3`@`H`8& B&?&E :  $ 3` < @ (@ `P   &,.,   `  b` ;;   @  b  ` ?}  &p  ?c'@" !B?  ?  0& Ѐ J  `] [  P * 2` * 2` `@  c * 2`   ` `+=  `-5@ *   - @ (`(`(`(``-) j`, ; ;  , ;  `***   : .`.`.`.` )   =(`(`(`(`)  q :  *   ǀ(@(`(`(`  2 *   (`(`  2 *   (`(` ( 2 *   (`(`  , 2 *   (` {(`  $ 2 *   (` n(`  0 : *   (`a(` @ ::: *`@ `**`@ (`(`(`J(`<  *` @ (` ?(`d  ^       j"`    $ 2" ,?,   , "   6  ja@&,  ? ja@@&#   j@M[!p}~~~~~㿘#`   c.@  6,`@\ #?@S!Ȁ` j , ( @}  j@&   ?&@ 㿘`D S"4`  , (  @:SaЀ  `  3& Ѐ  @   `  `  8 @   @@  @fj @% (, @ɹ  @Sj @% ?<   @B ja@%h ?㿘`    @+  ( @ɀ S!䀢`  2    jb@%4   (@] O#SS!䀢`2Q @@`@ jb@@% @?<  @֐ .#S0 @Ր (#S, @Ͱ?jh@%  0"@% ?@aȀ  `@v` j  @     `  '   ` [ <*` €@j @$ۘ *?S"<j@" S",` @#?,@ƒ < ( @M 2' &`0 `0 @?@j bؐ, @: jc@$a ?"%S@+! @ ``S!Ȁ` j ( , @ؐ ~j8@$e ?"4`` (, @ʐ , (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx ( @o `oSaЀ  !В  3& !Ѐ  @ѐ%`F) S"<j@b#P >@*  (!А@$ @j X@$ @ c@a!Ѐ  &` @Ô ) 퀢    `  `` @     `"  8@ @   j@J#x(@ђ #S!䀢`2*?<  @[ 6 ` @Vj@O   @Hj@# ?(L /?  / )S  @@Č  6,@dž 2 , c@a@: , @r / ,@n @! "4,?( !"!'$ 3 `   `a@N `  $a  `a $ @j @#-a@  @j@# ( !"!Т &$ 5    `@ҹ   $a  ` $ @j @"@aЀ  @j@" 㿘@Ϲ 6" S"<k@  @v` S!̀`@V 2 ?@gk@" ?㿘@ 6" S"<k@  @L` S!̀`@, 2 ?@=k@" ?㿘@Ƃ 6" S"<k@  @"` S!̀`@ 2 ?@k@"f ?㿘o@  @k@@"T 㿘@(n  @k@@"C 㿘\s)k 2 '&@"&`(& N    L "  2'<`  @  >@4 `7 S"@S"D  k`p@ @F ` $k`@! ?@*@@q @|k@!ϐ ?2&㿘!??@Ζ    @akЖ@! 0a@F   @Qk@! 㿘@ @?&@S!܀`  8   @ 4 ?c   '  `  &c  ` 8?# :D @ 6  `@ @@+8  ! P      k`%? @  @  k @   ka@! ?  @8  @  k@@! ? &  k@H'!`\㿘S",S  "aT  "TS"8`T "TS"(`T @"T !쀢`@E,S "aXkah@  ?@ S ?!܀` @߰? 6 㿘 kN a@Dِ  ka@  ?@I?`$ N /".  a$$ $ $ $  a " "a "!"a 㿘 !` "`S"`S "a`S!쀢` `  ! a @.    㿘S!܀` @ !쀤 )k' %k  4   4  2 `2 @ ! @L  2 㿘 !耢 + @v$a!S%S)k'ka쀢`  !X@=, 2S8?! "&!  &!-?!` "@S@wb  !@?"@  0@ˆ@ a@!@?@ 0 S$!XXT@{ $a 㿐Sa` % "a` % # @V耢 $a@}` @wkX@ː  ٰ? <?` 5! *` €S!܀`a D @2 a `O0ak bh@v 0ak  ak @ 0ak  ., a   ::&,D : ;` ;` ;` ;`  (;`( 0;`0 8;`8 @;`@ H;`H P;`P X;`X `;`` h ;`h< "9"20QRaaM (-  PAa08;aS!ܒ 3&  @ 8@l )a% # @ & : & , @>, 6 ,@ak @ 0'&,  & a @~:,,&,&a `&  㿘S!`1' )# %k a`? "`@qɐ  a  $a@qa *`S@ P M,  ,?% ! @Y! =@n: 28,  ` a `    @#a  2%,0# 3k a`? "`@qy  a  $a@qSa@耢c(@I  (Sa  '  S!̀`* @ @   `?`&@ * &@)0@@Ő` `@ S"2  `(;!@@kk#H#X@2V`(@8E @ /`V `ﱒ #h`   #`#dkch#\ @  ` ? ?` 2  k `c@k`8c@@n `  ?`&@  *  &@ٺ  @١ @| ?` k@F#, @o  2  k@:#, @c ?`&@ * &@ق0@k@` k@D#8Sb  '  @;a @W 4kk#H#X%@@1@7 @ "/  @k#@  k@Dg#㿐  `V`@'-@c N N N @|@ N 2N0@   J " 0" * 1 Є *`(8*`8( Ʉ*`8(  0(Ѕ8   J`/ `7$(@    8W0(2   0(2    0( :( ? 㿘@  @ O@ "`0"`A@I@Є  2`.* >а*`>@F.> +.>2`* ` >F *`@`@*@2`* >а*`@>F`@ O@/@7$. 㿘@  (  `0 8W.W.* 2`@2   * 2` ` 02 .   0.:. ?    *    J ** 㿘S!d "b܀`4`I?"dJ@ - S ah *ah "bSJ!h`@3d . :  "d"d'?@kg  :2J @ k"cȀ :2.  ℀  @k"c@ʖ  ?*@$"ℱ. > @@lxPhhhhhhhhhhhhhhhhhHhhTthhhhhhhhhh 8hhhhhh(0thhhh0h ,D\th4dp|t(8@P<HT(0DTh<||l|| 0<Xdt㿘@@ /S`""<`@$"<l"<@  l@0"<@ސ l@_0 0$"<@P  5l\- 퀢`JW"ȓ*` €R#b@!S$!`Jbl`h@N @BS "a<S "a7"S"a1S "b, l S "a$@S "aS "bb@ 0"-* : `"*` € "  SS  " "4"#  " S  "b4S  "alL`@ @T L  ݤۤ@`b܀ ӤS "!ͤ S "" Ǥ S  "! @!"# 'b(! @v H 퀢 "` "l`@   l @\bb( 'l+l@"@גؠ  `H"@M`0Ml S"a!@V"S: "  al`@ @a a la @u"@gS "!a !l"ܤ @Ȑ!0  ?T"a@P" 쀢 N"ala8@S 0@ $b܀ AS ""8; S  "",5 S 1"aS@"",, @ yb܀ $@ b܀ S ""( S "! S "!  S "! @r@W8??B   sې"P "` !%qȐ   @@  !  @  ! " % @?@@8  ` # "` `A"t*` €! ! "7" *@@ "@" $"0& "@la`@ @?. @S"b " " *@ "@" $" "!㿐  " '    ) 7l; 퀢`J#*` €#b@*!S` $!bl`h@^ @!* $! %  "! bJ@ -2 J` S"! 'S"!'ll  "  ~  SS"b4x"S t"b q% @b܀ l@he% Sa̐ `"aS \"b  " W% l;  "ܒ`S"K"!S G"b8@>L,  2 @='l @a@$l bS,"?+"?S '"b,S #"a!' S "b(l!S"al!l "l "l" l"0l"@S"a@'Ԕሀ?A?  *`@ &   2  " "P'` ?    @$     | -S/ ;l9lW7l` 7@bX )l !@T#"` !S h@m@ !S@  @@ "X@ !l@i!l %lb@N @@l@b 2 @`@`*% % `@c` 6 @@ l@@P  `@ 2`S"!  #H # "` l@w" S@nS! s- `  n- @bk` D` P  !l@R!l@D"X  !lb`@S !Slbh @͔@: !S/ @1@ "X@  !l@iX!l +lb@ @$@l@ b 2@`@ "1%`   @ c  "c ` @@ l@@ݒbP  `@ % !S! "lJ l@)" $!J l!$!(l"Ƞ%l+<@O@OΐL `?,@ K @ `@! @- ?  А @L  ?` /,`ΐ P SS!S SS ?S#4$! ""a#a"#!     /l9 `D!4*` €S "a "p&!S "a %`l S "a & #  "` %` %`S "b "P "`%`&S "alw  ~%`Sz"a@M'bSt"a!"l@RXb`  %Sl"ܒbh@ @%S@Ȓ @ΐ @h6l`V"lb@ @ObJ - J "B%"?%!"# 'b(! @( H 퀢 0"` "lc@e   l#@bb( %l)l@@ؠ  `H@ @S "b,l!S "a "( "` @@㈔؀?=?"`* `G@! *` €@ ? @O` 6@@@ 2@01@  Sla`@ @@S"b `@|@  @v "!%S! ` @+! l  lc8@ @a@_㿘S"    P Ւ"?S "a ?㿘-S)p'p+p/p$%q@ !p @㸀    c@%  #`?   @  ? %c ۢ# 㿘" !ΰ? @   & $ &`? S @,@ d&SD, ,`@ d&,`d   / &`l ܔ  (& `t ֔  ,&  `|<  P 8  ɐ` H&     ; @& 8&  :N` `2 `5`0"D., 4@., "5;`L4:., `K&7., N`(@  & X& @  &  &O& K  P@" a  b& 8 6: @&  &.&., &,K /`  `$` &  & & `P@`  a"@   b  `` & `& a : :K /2 +?& 㾈   ` '-#(*` €S!`$%İ  q`H q`x q` q`, dq, `%   dq a !@ d ,  :?, /,  2  1,,  d֖, d   c!P ,d  qVa " @  b a:!   `dƖ < (  `l 3 ,  `t * @  `  !! `   t!  ѿ  ?       qa@@\  ` q@*!h㿘ԁ ?ԙ  ?㿘9 ?Q  ?㿘a$?N!Y pN "?c!@<  2?  ! "? 㿘ݒ"  ?% @ $ & & NaY    ,aY /@,@ `? S ,@"@@ d&SD, ,`@v d&,`d ٔ  / &  `|=  P 8  ʐ` H&  @&  8& S.aHa    , Ca) 6 .a( `t峔 ,& .a(   `( ϐa   `l堔 `(&   0   ;@ 8& N``L#P*` €  @K     $  &&  & L@ /2} &y,@N` 4 `  ` `  ` & & aI U  aQP ?c , *`  0P&N` 2   (@ & B& `   `$ & ` & 6& N` K  P@" a  b8 & :`P@`  a"@   b  &` `& ` a: : 㽘   `'`qRap``   , dq, Ea @N qa: !@}֐'    :, Q忖, /, ?","  d崐 ?` F*`  € 54, ` 4 3, 0 ` I  ? @ `2 @Q     6, ` 1 2,,  d,t |   %p `  0 7,! P @" a  b   ;@|    qapc @Oqa @J`(l R  !S!t !tqL"?Sx q"xb@ !t 6  { ,t +  !S!| !|qӆ"?fSက q"ဒbH@ !|   T!   d  J @    AS!`2!q ( 6  @ܐ  , ҍ )@Ԕ  !" @ΐ ")@ʔ !< Ӗ  Φ!   ? ` `     qb@  ` q@'Ő"`da ?J/2 J"`4 ` 㿘` @_ʔ:@%&_㿘q"@T  q@Sb! 퀢  $ Tqb@S 퀢  "`X@R T@S"`q bb@+ ?㿘!  T'H'L'P'T'X H@}@{ T㿘  X@: q?@9c. 㿘'P'L'T'X LS "bS!̀` 5 1S"  @{`@ʐ &"S"<qc@n@|ِ@ 㿘'T'P'X PS "bS!̀` 7 1S"  @{w`@ &"S"<qc@m⨒@|⨀` @Dqc@mߐ⨒@ 㿘@[DDDlDDDDDDDtlDtDDDDDDDDDDDD DDDD4DDd(D5h5x555555666$646D6T6d6t50885@66887X7h7778$848D8T8d8t    '//'  @  'x't"`\qc @P @@˔? qc(@D  h `#%- /'\; 'd'`'p'h9'l 34đ* $@€b   #@@$"`qbܒc`@ , $'x$,, @$,,h,e@d  ,!q#@D @  `$,bP@8Ւ qb@6 ,@bSbܠ 2 qbܒc@  / , , ,,"$,b@ r" =xrb聨 rqbܒc@Ő  x@  x@Cΐ qc@ r)=x, $,, $,h/ %h@ " b@C qc@    #@?k qbܒc@ , $,,b@$,}q, x$,, t$,, p$,b? #  @?B 퀢c# drbܒ`@Z , $,bܒ   @?.P'trbܒ` @G , $,bܒ   @?=/rbܒ`8@4 bܔ    @? 'rbܒ`P@$ `\! @6 ?qr`h@  ,!$,b   @># 퀢 #`rbܒ`@ @ q@8?Ð? "* & @ @xrDc"cc" " H    HD" @# H+ H. & & & @5 #`(@a- 2 r`@ .  @{ @\!" (, ` `r`@ @r@ڐ` d` "d` @!' ,ra@     d @ -d`@  @5?c, ##c < 8 h %h 8" 8 `\+`8 *" "" @ǔ  ,ra@P , @?`\c @h , ?`\c @^ ,@?`\c$@S , <  8 h %h$,, d $ dra@" +`\  @4 S#<* @ *@@ St"cc, x4 4 4 , , , $ $  $ , &<  8 2 raX@  ?   '/?//???`\ \ @ ( 6hr@JH!@ & h `\  @ߘ  hra@ h `\  @Ϙ  hra@ h `\  @   ra@  '`\!?##`@y rb@ @'?`\#`@  '?rb@t ! #r`< '`b(@i `\ `@  `?@4 r"P@ϖ  r d@ 'r `(@ d  `(@wd͒ @ Ȓb@ Ȓ#(@ @2, 2`\@b `\ 4`*`@ J  ra@ #',  @ ''@w`\ 2 * +  & `  @ , '`\ p@:h  l@`,r@Idb,|'@kr p@ | @kj ``,4 ,@ ߐ@ @& 㿘@s#@QȒb@/ ````X  c @ ' 4`   @ `"   ͒`@  @4 `X"  p?   , @@ # p b@D @1"㿘@+ @  @%"?c  + `h' --   ` 5 `X`!*5 #5 @-4`: @)4`   *@d* %,!?# @ɤ#' ##' #`h#* #* #*  #* #*  *  **  d @`,  5 S# 5 @5 `\ H @  ,r@H|#?#`(r@@|@ ,  X `m @ X @ %Xr@!#@x@0  -  @  ,a:@y'r#H@00&@ #@ &4`d   V"4  / / / / / / //?" "@ ''Вb@ ?? *`" * "* * :@B:@:  `   B;` ( 8    1   `:1  `#@ : M@ <  0  4`?"0' 4@ :  `@   *@ -  ,``"  `l @ @'rcp@Hr@D#`d` #@  @Ɩ# r#@0 `r@+#  d@ r@"#  h `OdKr @ "!@#ȴ ?d;%s#s 2 @ @`- d ( #`d*  ,a$  *  @@ @s@А@  ,-S+s  "s   sɒ `N "ssȨ @ (  ? ` 's%s# '  `  P` ?"`P* "P@J  @2bP    *   @ *   *  @y0@u@r@?`˴?    ?wSbH 'P@g ' ,  's@I `\%'P$bH@vs$bHs@9 p 's%s# `';  `  P` ?"`P* "P@ِ  @bP    *   @ *   *  @0?@?@@̲`?@ x?@`H ? `@  % ? #  , %  `!  "P`""P *  $"P @ 0 @r"P@t%"P ,@ b@J `  ` `? (?888* 2 ?cx  ?c' `#/   `!  "P`"@ "P * $"P@; 0 @#"P@s֐"P s`@=c ?#`(s@[?#@=Q?#-Xs@K?c @=@`4 s@<@=4`0  s@.@=&X`: 4 s@*?'`&'sB' s!Bs` B()s!B s8?@??#c @<?#saP@< 4f? d`` 0  @  @ @g@ @[d ?   #@  @O#  #@  #@C #\ #@~#` #@5#d #@r#h #@)#lsX@@<{?#@x@   s@b!㿘     (   @<@B: 2   B* 2`@ : b`D 8 怢`  㿘 @    4 @`? 4 @f`?㿐`ݓ*`Đ#4 €s@1!0 `OsĐ"*` €s@#!0s@!0s@"0s@"00 `s@"P0s@ "x0s@"0s@"0s@"0s@"0s@"0~s@#0zs@#80vs@#`0rs@#0ns@#0js@#0fc#t@ڐ 0`  t0t0t@Ɛ  t@ 8 t@ H  t@ p @  @2't@ 01t@ 0Mt@ t  @ 0Dt@횐! 0@  t!xt@판!@0t@툐!X0  tt @!0 !@z@ 0t@t"0t@p"0t@l"00t@h"H0t@d"`0 t @_"x0t@Z"㿐t @R"t 2` 2`  @H# 8 ?t* 2` @?#  t #0 @8#t '@@0cH @' @(cH,  ! #t @cP`  `"P`?"`"P * $"P@ 0@ 㿐 ,` ' @Z~  @t'!Sq"x@ݒ!"x@h't!SX"x@В!"x㿘 * `  * t*`@ @Ő#`0`   * t*`@ @춐#(N@ ĠȢ̂ЈԖؘܚ tH `@ ` D `@^ H 2H#l;pt#\#`#d#h;x;#c@ ?#" 8 @ @ `. @ (  ,`u@V ( @ s#t@NcP`@&s@G!P02 2 0((  ``? 㿘 u`8@b"@I 㿘@>T>>>d>>>>>>>>>t>>>>>>>>㿘u`@o[ /%#)!+-1 'u5 -9 8" * @€ $!$` % $ p $` %` %t$ p"P@.   $ p "u "@b`@ @»?А?* `@ `  ` t  p @0@@F"P ua@f @ x㿘u !  "`|-u+)u'u  @r a@0ؒ!( 2 @d0%`x  %|@a  ` ?4 @1 @F 2㿘   % J' ,`  `` 2 >  ` `` Pu`a8@b`  @@䌐 8` *`  `  $P` $?"``P $* $P@ǐ $ڀ @P?Ӏ > t`  ^P` ^?"``P ^* $P@ ^@P? Ɛ IP` I?"``P I* $P@ I p``?  MP` M?"``P M* $P@` M@GP?  -P` -?"``P -* $P@B -@)P? ` ` `  `  `C  ^P` ^?"``P ^* $P@ ^@P?` ` ?`@P`? "`` *:  P * $P@ &! ?`@ P`? "`` ,`:  P `* $P@ѐ@P?  ? & @EȐ   &@E   @ @H  |u@ʐ!0 "`x ?6 @/{ P `@u0 @*P ua@ 㿘  ` aR ! @p!' u!  a"|-+u)u !@pa 2  T @S @D 6 @v!0 %x  %|@ T @  @3@"@ 2(  `  R"^@"P  `)+@ڒ ua@ d*$ @>%`l % ua@@  %u @@ ?2@ @ @`l? 2   |u@ !0 "`x㿘@㿘     "`Ȑ @ @4 `@?J@ -5  J@  J A a   "`     "`" @+ @`J 뀢 A  ? `@ @ @P  (?w@b@@  @P  (?w@b@@  `w!!$  " @o@ 2$$ ?`   " *!-!@P  Ē?" p " t@w@ob`  + @@o ?`@ + `Ȁ   @v@oc@ @ !耦    w"0@? !H`"@oy@ 2  2  " $   2w@bh@% `4  2   "]? ?@`   !H@` @oD` 2` 2 `  € ??@` 2 wbx@ €    "?&`@` w``2 wb@Ԑ €?   " `@   "?` x)u    `Ȁ    @̐!@ @ }     w"@ !䀢 @Oє  @4  @, 1w  wb@o    `@O   @ wb@[ @ 㿘!  ̀?@  @q  "`?$ $ ́㿘  #` !wb@4  @qՐ?L     `%0@є 6V @` ` az@Ĕ `@"3?@ &-?V ?# @"`!0!@ &6 V "b(`!@ 6 "!"!`0a~@ 6 "!@"!@ 㿐  Ȣ      @0 wb@ @qc@/ wb@   `/J?       @m 2  @)  2 J     "}  2#X ! @ki   @  @mV !  @kY   @  @mF  @N  @N       C   ` @ } <"   @m 24 ` ` `")  w `V @2  @  !Ā`! V @2 $ @  $ 2     U`@/`@  w"b@]@R 㿘 !` @N2!  az@!耢?wc@ې 㿘!` @N!  ay@!耢?wc @Ɛ 㿘 `"   "`2 "a 8  2`€㿘 ` € 㿘 ` € 㿘  2`6     @lj `"   "!""!㿘    # p% '!@k #`0a@  wc0@P ` @MW`" @@"  7`a@ wc@@3  w@L#Pp% '!@kv #`0a@͔ w@4#`` @MZW`"( @@"((  7`a@ w@#p w@#` d dd d㿘w @@ 㿘w 8@㿐И"@'   @. wc@Ð @'\  R  wwc@ `8@k w Ē@" p " h@k`@  Ē@" t" l㿐 R   wc@  ڐ"8`@[w  wc@ @,Ӑ wb@r     2 @k` 2 ?? @@ 2 2 wc@\ $` @. $` 㿐!`' @L!   #@.#!耢"x`@;   @a x@H (㿘N 0     * R  x" 2{ zN"  @  D "x   @  D x 8@-m  x Px@! pa 8 `       Д `   * R ?  `*      Д `   * R ?+ N \2 `" N @<6 2 ,  N` `@<'  $@ 6&"@ht &㿘 `   0    * R  x#0  @   2 ` `  J   2 `xx 2xx  @q0@n   x@f  &`# ``'Ȓ @h ! 'Đ 'Đ Ā `!/` @KU! Ƞ!$ 0a@ `x@ ` x@ x# ``''7@fА x @`@i ` @K  a@?`x@ ` x@ߐ % '@# 8x@#  @ '̀'b'x!@%Y x'̐!'Ȳ .`А?``"@ N!@%_  2NȰ !'N      ( N  :$ *: ?'̰   'txaEt /t.`" " `` N x@! 't +t t''` @J  a@?x@Y!@ x@Q!Ph% '  $@g` @Jl#`0 a@Δ `xa`@  'ؒa@” xax@  x@!!h' '@+Ϣ %xwb@ a@$ x`a@$ x`a@  @< x@Ȓ  $@f` @J! 0 a@v  xa`@  'ܒa@j xax@  x@ɐ!Ёh' '@+w %xwb@ a@$G x`a@$? x`a@  @ x@Ȓ  $@fh` @I! 0 a@  xa`@d  'a@ xax@X  x@q"㿘 x" , @#   x h' '@+  %xwb@-  ܐ 2@xbx@*  @ @.Ȓ  $@f` @IZ! 0 a@  xa`@  'a@ xax@  x@"h% ' 2xb@   $@e͐` @I!! 0 a@  xa`@ɐ  'a@w xax@  x@֐"Ё% ' @e 4X!!  @eh$ ` @H 0a@I xb@ @k2`B'dN 0N  x 'd Wd d # xb@z  7hxc@r xcP@k #\di@r  xch@] ''3` @H1  a@ xc@?   $@e-` @H 0 a@ 6xa`@+  ' a@ؔ xax@  x@7#p# ` '`!   @y  )$ ?   !@)ޚԀ  x#@.`#` @H1  7a@?`x@#` x@#㿘  @9  "`㿘x #y@ 0 x" ,  y @ x!  x㽘 `7'  @d'$ ఔ @Gې%0@=a  8@dvఔ @Gː0a@.X  4@dgఔ @G0 @a@  @dXఔ @G#0@a('  @dIఔ @G0@a  @d:ఔ @G0@a  @d+ఔ @G@aк  $@dఔ @Gr0 a@Ք `    `` y/  @P Ȁ 4 yP@ ɀ`8` `?#@`y@% (`'P7  @Uڔ  H $'@br7y@8P@0 |`@e& ఔ @G0a@z ,``(` "!y'y'aLyaP$"7ƅB' B'@y@א H`@Ӑ P`   y X@!P ,  , $    $@  0a@0?y `@Pn   `  , @ "  "   @     :"   x!@!   y@v p     P` ,?"``P*  "P@ ,, bP@ ,,  `x !@bP    π h y!  x@"Ph ly `@"Pu @ ;y! "P@x x#` x!@n"Px!䀊 y @  y @a"P耊  x!@Y"Px!耊 "yy @ y"P@K y @E"P  `P yT@ߐ 耧` W y!x#y@А! 0a@~E耢 ) R  #    P`?"``P *  "P@f bP@M y @ a     P`?"`P *  "P@H bP@/  @    @   y@ X!8x)  '@ '@$'` @En 0a@}Д y@8!XZ ywyy!p`Д@Eᐤ `,@ Dy@!@9@"y@3!      P` -?"``P*  "P@Ԑ - bP@ -    P` ?"`P*  "P@ bP@   y@ א!ȁ?cP -  `'%?w! ? %?@ )  @D' a@}F  @> V`y@ܿ!Q`@ޒ Р@>>' ' @D0a@}$ y@݌"6`  y@ܛ" *` y@ܒ" ?#А@0    P` ?"`P*  "P@4 bP@  ܢ`|`y"(̒? y@ I"0㿐 x /  4 y@S"H     P`?"``P *  "P@ ybP@ڐ y >@/"P x  @_ y@%"`  S@_ y@"p S`"y R'y'c`ych$"7ƅB' B'@y@" d R@" d y@" B % By `"@2`    P`?"``P *  "P@  ^bP@p  ^?# @`"6 ^y@b    P`?"``P *  "P@b  xbP@I  x    v* * y2 @c@h#  ` '"Ȓ  (@`A` @C 0 a6@{  @ ycp@7 "#P#P `yc@3  y@ C#㿘  #cPcT * !$cP` @CX!cP! 0$ a5@{㿘  !!<  @ n  #$!<  yc@  yc@ %z`@ P `4`@,`$P㿘t )z`8@ϐ #P?c 2  @z``@ ,  %#P㿘N  z`x@ "z`@ #P@ "`㿘4  z`@ "za@ #P@ "cT㿐'  za8@u 'zah@o P?# @ ` `    @$@za@Y *` $Pz 2```2@|#(z @2  22|#8㿘z"@N? ΐ|cP@ 㿘  В@;? |cp@ 㿘@#ΐ  wb@ !,@2 ?|c@ # @ x@:a |@㿘  `@2   @v 2   2?㿘` i|@#"x|##m#y@א`  `|@` 2` @ `|#@ٽ |0!,` 2*`?# @ # 2!` |#|#x#@ٝ `x!x#`@ْ @?# @ `` 2@6 `|@ق#p)  x'#// "@^-` @A 0aK@y = @ #\! @1 |c@Ab! }  @#\! @ |c@AF!} @-}@* 0  }@  8㿘} D`  @ 2` ` 2` `` 2 @1} @  h+ `}''@!"(} *`} ! @)( `}@!!`}@ސ!!@`}@א!)    P`?"`P *  "P@~ `bP@e `` `   ` @\ @}@ة"@I%Ȓ  (@]\ఔ @@#0 a6@y 6耦ـ `r}@،"Ѐ }" @ǀ @Ē  }b8@@ a6@x'쀢 6}ycp@5 @k"@ؒ z ؀@Y   P`?"``P *  "P@  bP@    P`?"``P (*  "P@ (bP@Ґ ( :    P`?"``P )*  "P@ː ) bP@ )    P`?"`P *  "P@ `bP@ `ђ}@!< '  @   2耤`2y}@Ӑ"P y@ϐ"  ޔ }@Ȑ 0`@  @  w @ 0!Ā` ! *! @  $ 2 # ` }@"hx1   '#`  %@ + wb@J +` @?)! @^& '@}@mp` @?|`0a%@wߔ耢 6 @ 1}@A" @\ /" |/਀ )! @]`0a"@w? `@ж 12} @[ `@"` @?A! @'ܒ}@%" |}@ "਀ 0#a @]ǐ 0a#@w? @Є 1} @[ @"!`@?  a  "  '@uܒ}@"    P`?"`P *  "P@  bP@|   }@"؁㿘  €   "` ?? * " * h+ `''    @ +2`wb@c ސ  #\! @i xc@>!}"@փ @В ! @[4` @> @] 0Ha"@v @ 1"}@G" @[  / / #\! @& xc@>W!}#@@В ! @Z1  @>I@\ 0Ha%@v   @Ϡ 1 }@ #  @%}@#0 ! @ZА  @>% @\0HaI@v  @{ 1/}@#@, }@#X }@#h }@#x }@# }@ސ# @}@ؐ# }@Ґ# }#@̒  V ! @Z~  @=Ӑ @\l0HaQ@v2 6 `@* 1">}}@֓#9}  "2}@  }@՜#` &~@ڐ" ~@Վ ~~@Չ ~@Ն @ &~@Đ" ~@x }~@s }@p 0` ~@P 0㿘#X`+ `'@| !')0$`!:@uʔ?@m $`!@u?耢`O؀ " ` ~ p~@1 @` ~@ xp)   ''Ԑ  /@ʚԦ ԑ,2  퀢"a~`@ߐ   "a@+ !#`0& a:@uy?`~`@  7a9@um? ~`@  ~@̐ p)  ' @'%0a:$`@uL?~`@ @<ڔ  a 耢 a~`@   /@cԔ Ԁ`" 7~`@|   !7 a9@u耢? ~`@b  ~@{!x' '@ !%0a:$`@t? ~`@A @ a9@t7耢?~`@2  ~@K!p !.`#  `'@z  `, , `$ @ /  @ ~ؔ( @, ~a0@ @4 '$  @ !`@@Y @@Z `@>  #@`  @{f$ wbh@ؐ ` ~@!H㿐 !.`   '  @ ~aX@  `, ,     @X 0$  * "@  * *㿘  N  ~~!h@Ӹ~!p@Ӳ   P`?"``P <* c"P@S <`N bP@9 <ZN * @O     P` ,?"``P*  "P@, ,bP@ ,*`: /   *` "P`:?"`` "P*  #"P@  : @bP*`:  NN 4N`    P`?"``P >* "P@ؐ >0bP@ >㿘`r l`. 2 : a     P` ,?"``P*  "P@ ,@bP@ ,@*:` A   #*:`   * R  "P`? "`` *:  "P* #"P@} `:    * R  @[bP`@*:`  N@N@ 4`N@``` !(.`'   '@WN   '̀`'А@* / @:!!( /wbh@M @*ڐ`*@@?  " ~`@CĀ  @u~ax@2 ` "`wbh@) @Y `? ?  `  ` `$`4` @ ~@!!㿐 !(.`  '   @ٚ ~aX@  `, , ``2   @V̔ 0 @Vǔ ` ` ,` ` "@ * ,      " 2 "   2   :2" 8톀2  &  㿘 ~a@H"@㿘! ~@榒!㿐~b@X  @Zڒ   /@UR !~@" 0!` @9!!  , ,  @W   a@q ~@f"@% @'@Pʐ@Pِ8@Q- P@ @@W}  6, ``?$ @P@P @@P@Q @j @@W`  \, ``?$ @P@P @@P @P ~@ "PH/ \' ` ?@ S?@W 5 ,@5 5 * * * ؒ@W  ` s @W   , ( *` ؐ@W@Ĩ @@@ @ @   ~@"`㿘@㿘 H@W`H㿘 H@W`H㿘`D D (`( 4   ? ,`,  ?㿘`D D (`( 4?    ,`, ? 㿘`D D ` 4   ? $`$  ?㿘`D D ` 4?    $`$ ? 㿘`D D 0`0 4   ? 4`4  ?|㿘`D D 0`0 4?    4`4 ? i㿘`D D88@4 2  D<<@( D `D88@4? <<@?>㿘`D D88@4?2  D<<@( D?`D88@4  <<@ Dt 0@XTdt(㿈@Uh    ~@Vߐ"p @ "a8`h @oߔ  ` "!8 "a")! ~$!`@V"p @g "a8@r   "ah#!-' +~7 /9`G"*` € %!`"!""aT#!$a ""!.#!! ?$a$!"!T"a"%!` ?$a$!"!T"#!v%!` "T"!#! " ""!#!"T$a`%!` "a"!T"#!$aT%!` "!XN"| "!|H"X D"a A ="ad  8"ah "!\2"d ."a *"ap &"a$"a!  "a "at "a %x $<  "al "a $<@L@bx?P?!*@& $!a !`a!l`a!` a!t`a< "a  a!\`a!`"a !l` !!@z! &!: $!x %< "  @!`!`= 7#d5"h!|`. !X`"&!p$# "  !`!` #L!!|`  D!X`! #|"aH!` #!`#Ta   H!T`!l %D@ ! aD@ !㿘!`" @   @} @M@v !\`o!d` `  @ /-~+~Q)~ =`H  "N`H0G8 "7N`H0B . !`8 !h`8!L `@{ `@tb$!L@ @@0!d  @ 0@b"0N`H~"Ȁ``H`@7`@T%@ 2`<@ƽ`~b@   'H'D' U !` '`!` !l`H '`H'x'|' ''t'p'l'h  'd'\< D@H~@"Ȑ $  "!2 LH2(!\`2($ .2 (!h`2( $ | 8'|` D@D (D 8' x 8'x84 8<8! `z'!` ~"\@᛬~ @ᕔ" \@ @’ @Wh4'h@Vl 4'la  @wLN ~"@Vp@ 4'p   `  @^  `  @.   @4t$@ @  $` @4l<  ᜘ 'tᜀ ` @  $`@4UN`-"$@$d 'd2(<d`S|'`'H 7't''!~ "@@V'l p''"@@V|'x" @@Vtap '~ @@Vf' 'h'!D@!  "aLH  @  ~@#㿘 <"0 @`< )   "  ?" 8 !\`2   ?!H@€㿘#㿘 %% #   @ `  P` ?"`P* "P@3  @bP  2 x  '8 !`!l` a @u~@Q#+<3~-~/~ !`D c@<`!l` ; `@ @ 8@fC @' `@ $(` @%~a 2  ,0@ 0@ a ~ #8@ `  "`2 `? 2 ~ ` @#@    (~~`8#P"@ @` (`8@0`<!|`@b` 0 !X`@[`00@X`(@9Ha  !t` `  2`@.``(   @Ɛ  `  P` ?"`P*  "P@\ bP@C 2S  ~@x#h㿘!`  !l` !`2!t`  !8`*  @w&@@wʐ 㿐͒ #  aP@!!P@K*`  @&P&P& ?$aP@+ 0 &P$aP  P-"@2 @w@Ő 2  8`!`!l` a @tL~@ # R53 %  #   `  P` ?"``P* $P@ @P P,` @ @& @Ґ`  P` ?"`P* $P@y @aP㿘! ``D~ #@ɧ!l` ;  @@ 8@ejC ~# @ɑ@`Ha !t` <   @ 㿘'D@VD % 1  2L@"P`L@?"`` "P* &"P@  @"P  !`$  2L@"P`L@?"`` "P* &"P@  @ג"P  i D;!@  $  2L@"P`L@?"`` "P* &"P@Đ  @"P  >   "P`?"``"P * &"P@  @"P  2L@"P`L@?"`` "P* &"P@  @o"P   "P`?"``"P * &"P@k 0@T 㿐  8`!`!l` a @rΐ~@Ȍ# + M#  E`  bP` ?"`bP*  $bP@)   @bP    #  `  bP` ?"``bP* $bP@ @bP 2 ` bP`?"`bP * $bP@ 0@ΐ 㿘!`   !l` !`2 ) e!  ]`V  ,"P` ,?"``"P* $"P@ ,`@"P`( @a8   "P` ?"`"P* $"P@   @s"P  "P` ?"``"P* $"P@p `@X"P`  @2  "P`?"`"P * $"P@Q 0@: 㿘<@ @$ I0p(@90@P I0h `  P`?"``Pj /@# /u bPm /  `  P`?"``PP |@  |[ bPS |  `  P`?"``P6 @@ @A bP9 @  `  P`?"``P =@Ր =' bP =!  `  P`?"``P **  "P@ *  bP *@  㷐  8 '2  ~x H@Ԓ$  ~ H@ʒ$@nє#~@D@ ~"c@=`. @ƾ#@(` ~@#㿐!p`@\G?~#@Ɵ0~# @Ƙ㿘N N% #'   `2+N*: ?  J   2Na  ?N "P`?"`` "P* #"P@  ?  J   *a  ?*: @P N  㿘 "~ c@="@` 㿘@M㿐  '  @OӚ ?! @ P@ X  㿀    @O ?" @䠒   @O ?! @ P `@  㿘  "a"@<`p@ h@˒? n "* &@    !T @@   @ '$Ḳ`   !T@L@ 2 `@? ??2@@ɐ 㿘@Kٜ٤٤٤٤٤٤٤٤٤٤٤٤٤٤٤٤٤٤h٤ـ٤٤٤٤٤٤٤٤٤٤٤٤٤٤٤٤٤٤٤٤٤٤٤٤٤٤P٤٤\٤t٤٤٤٤٤٤ٌ\hxxxPP㿈@  L @OJ?`d   "!  - ) # ' !+ `<#*` € %! $a $a  %  $  "b @ؐ@?ܒ?b!*`@&  a@a   "a @dž /   @#  !쀢`` * @)?   @$  @! @ @Ր @  @ΐ   @w @j 6   a@@ܐ ?7'@'耢 " ! a@ @̐  `@ @ !#@f " `@ !@ia@@ٲ @ @i  ' a@VX@ٟ =# P` `0 "@`P 2@`6 #* $, @qڡ, ?@qQ  @`@@+ @a0 @!@є 㿘@6  a@ O?@O`  a@ 0 @ \   a@ @4? \@H  $ @@= "   $ @c$ ( (`$  <$ @ϐ  $ 02 $ 0@*`P 2$"`P @?@P`"  `2@ `2` 㿘@    b( @   @& T    bp@ ?*@& X*`*`*`*`*`*`*` `@|  㿈 @ a P a'쀦 ' D@ H@ f D4d D !`  0b @H  0`Q *` €@D    D& 02 @& 0>& 0 @ & bИ @!  & 0  ` $ <"@`& $ & $& 0 ` "`@Z0 & 0 4@0b@ & 4& 0@_ D耢   H쀢@&'  6' H' 2 D䀢 쀢  b@̐ 4 @ @ @ !"`"!#@ " a"a # А"@# &! !` ! !b0@ !㿐 <@ْ  03 * € 8  %& 8 <& <& 8,  "`  !!& <& @!@K"@@p"@& <"@@+& @  4   & <  cH` @V 08a <a @@& D& HcH @A 0#@  <Дb? @& D & H?/a & D& H !`  @cH < @ 㿘  N  @LJ?`d "@9c0"@9`@M 㻐 ! `'P 'T'X'P !쀦 4`!  @G""@8`h `p$@@+` @ܐ x㿐! "?' 퀢? $"b*`@ "??$" "$@$$@  z  P) `F`2E`2B @"> `29   .  @H  2  `2(  !`$@ `@*` 2 `@y[ @ 0$ *`" `@yO  $ 2 `"`@v*` `@y: $* "@ a   !.   @g @ p b(   @A @ $b(` b,  @2 @  $,` ? "b  b *b  *  " " " " " " ! @c! ` ! ~?  @ :1 & T@?@`8 0i'Ԓ ) $@h  6 T@p@ `̔H@ 'Ԓ ) %@hј  6 @Z@ ``@  ??`@??' T : @h ?"!!$#b(,c T 㤖 @" @"#܄%#`"" #""" "" " @?@`xx p  "c'" c" ''  ` '' ''' X "  T" ` 8  . $ )## # #  """   "  ?  @     /  # # # #  0% '`T @Z  T@" 4@`2 !`$ 4@@Ж  4 & 4 @!P  '!#@B     @@ aF#`  `)%  )  . )`$ )` ) ` /``"` ? @   `2  @  h  # @  .`@L `@   .`@; `@ m c   .`@$ `@ؘV L `1 ? ?    .@ `@ْ`  . @ `@ǒ@(    .@  0 p  P 0 ` $ P`` $ 0w$ 4  @#T  p  ' @''#`%0@_ @#'  7`@_{ @# @' `@_m @e?@ cȔ I `2!`7`@_T <?@L@ cȔ.  #@$  #Ȕ(   #ȔP   #Ȕ`    #Ȕp z?  @| H    Т '???? @?) 0a@^ 6@@ Z`,  A A2;  ( 6????? @ 0 a6@^є @`"& (@@ /`Ж ?`` Đ   `   ` @  G  㿘 .@ G.` ` .` * * * *  * aڔ@# 㿐@   0"@D @@0  @D 2  ` 2@ @ 2  2 @j 㿀   )'''''  @Gj ?㿀   )'''''H' H@GS  ?h  '  @ @ @ w a8gH@Ұ @̀ @@ e a8U`@Ҟ `K)+@G`@Gא2=@`@Gѐ@ 23@`  2.@ ? ? 2'@ ! @B @ @@C0HaI@]  @@  !8ap@[ @@j: `@@j1? @!㿘 b0  @ @  &"0a 6?  @ ;`" H@u?@ aѐ 0  @D "0 8   @" " " " "   @U?@ a 8    '` @  @:@ a U` !(@Ama @$0JaJ@]$ @@ ax 04`( 1  /-""2 @ 2`@ ` `@  .@  S`@@  ` ؀@ip` @E"X0' `'  `  ? ? ?  `"/'/''''#@`"``  ` .#  $ )## #  "`"`"`"`   ?``@     /  # # ##  .@ @3bhx `H @ @n@o@ bhː  @ΐ"㿘@B 00000000000000000000000000000000000000000,           T d             T8DD  p   $ D      BBBCC@@@@@=$=8=L=`=t<==>,CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC???(?<?P?d?x???C@TB|EFFFFFF`FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFEEFFFFFFPFFFFFFFF8FEН@  'h" "aXaX"''''''''"h!p " " " " "  ) 'hH'''''5% - / ''''( 2* X@€!* h%!L  * :  2* @€ 4 4 4  4 4 @4@z L  k@"ܒ'@I @'`J` J`Ob@mܐ    #@ ="ܒc@mʐ ! @4%!!!@u  !@` "c(@m  `%!P@ '!@ܔ @" ""DJ J`cH@m !c`@m !ܒ@ܖ'%!'@O܍ J !J`cx@mn !89F@t?  @w c@m] Fa@ L"'"L …DB'$`"cx@mE  !! #@!@qc#$`! %!@t " @ "c@m( @  J`J`"`@m Д~'!@*@y%!!;!@%!o! j%!`(@l   ????    :'''' @*a  @[`X@lې  a@? @X"`! :%!ܒ@I  퀢 ""<J`J`""`x@l #Ѐ `@l !* !!%!!* !* @ %!@ @⸀?U? b* & @ @ ? @Z  `@lv  ? '!@ . @@i   @ . ?  ?  '???  :'?@)̖ " @[/`@lF    " " `2 `@l5  @? @{J %a@p !@!`  @؀ a@p  䀢 4  ?h ?p??x 'l :'p't@)~ "  @Za@k  `!!@$a8  )` 0@`` a`@oؐ @f !! 'Ȓ ) '@_  a@oĐ  ) (@_  a@o @s@_4?!a@o  ` `a@k @@ݐ!@( <   "a "!! )0 <!0  "a"<)0@䪐 'b@oy !   . @' ?c  "ad*Т *******@@d$  ! `@ '?Ȓc @_k   @`'Ȓ ) @__ ?b8@o6 Ѐ  'Ȓ ) *@_J ?!bP@o!  +'Ȓ )@_< ?!bp@o Đ   ?`?H?P?XX  'XX 'X @; Ȓ :Ĕ @_ !b@n ! 'Ȓ ) &@_  b@nݐ ܀(' bD?'@  퀢`""xb@jʐ h"  " ܀ `%`'"`"`"` "` .%` )%` $h%@``8` `(  耢 @ː ؀ "`b@j  D )%`%`  /h%@%```(` `   L@X   ) 3%@%`%`` @X 'c@jk  6*@'%#, @  @'̀ "@Y=@jU   ` (@jM @XԀ cP@jE @ʠ ߓ, @ah  ?@ @ !@| '  @yG  cp@n  ` `u`  ``" * " " " " 2 ؀  ) .@^"   c@m  bD?bD ) @^   c@m  D?D ) @^  c@mא Ԁ  +  )@] 3  c@mƐ  @b؀ 6 `@m ؐ@ ` @m @b`# < @`0!?##`@]  ``@m #`@]   `x@m  <@@00?'Ȓc@]  'Ȓ ) $@]  @`Ȓ ) %@]  @~@@ (?@ a@ M @ @ E @}@(@V (@V !` (@V  "L"L'' ''@]  Ā` @ ""a!"  " H?  !  @@"H  @Uᄀ  @"!a @  "ሀ !@ "! ?@ Ȓ '7@b   @~`$aȔ  ??  ','(Ș $'0'8'4'<''@ @Z`@@\ @I !!@ː@ ̀`y  v @  @ސ`?      0 0 ᄄ 0ᰄ 0ሄ ሁ㿈@;  !`  "`B!HąB' ' 'aT'''@U  @\  2 2  (   <x !̀` Ā  ? "8`"*`! !. . . . . . . @: @ސ a    ,* &, aАa  .   .  a  -!` .  . . . . . . 6  . . . . @:  "b<  aАa  .   .    6  -!` . . . . . . . #<. . . o. * ! В `* `2.  ` . ` `2 ` `-!`.  . a. . . . . . . 6  . . @:u  "b<D  aАa  .   .   6  -!` .  . . . . . .  <. . . #. !f *`,2`2  -!`2`2 . . . . ` .  @ ''ܐ@9  "<` a   ?#hh "`!`'? "`"` '@~ a 6 @F!P !!X@Wa    bA @w    (ad`?㿘  a@) `?㻀 @ ' .S-   `?$  '$ @ K`M @2J &@@`+=`) '7  @J   ሔᐐ@ܒ$$ې@ҔՐ  * ` `@@:  ` ``2  %@ @⠐!@  ' '@Ԑ  `?@  `     !a@!  !a @L!@ @@!y @Ð 2@v"o 2     *`  a  /" @8s ''@c  퉡 ȅ "h ?bpX HD LL? :"hH:bp:X "` -:"`/ , 82`! @: L@Ž <    !`?"'!@ŭ: 8@ũ   *@ ,  !`` b@ @v^ ! @6`@"@@"`!a  ?Д  ??'//  '' ' ' @'@ɐ"p a "x@ @"!@ b@R<  'ap '``:! @  "@v! b W \'  , 2 # !b8$@&: Mb8@! <   !`"!$b8@: @    *@ - !`c @#"@Z  "     @H"!!@C"!#@= !  * @`"``  `  @%#0!@5%@!@%@!   `?!' M'% #! " @J  a!@ `  '4! 3/-)`H @ H@;M  H@;H?, 'H`P#X@Д Ȓ $ ٤@c@!!@#`   %@ #h#p@ %@ `  `g  P`?V"``SP0V @#P   ##@`#@` `"@v#P # '`@k#P#@g` 뀢  `@\#P #@W  `  P`?"``P )* "P@t )!bP@t )! !a4 @@+"Ȑ@ڒ! &   `!  "P`""P *  $"P @tɐ ! @t"P!!@@4]"P   @#㿘     3'%#  )2  2" 3 # 1  @@ @͐`@M   ?  @   2 㿈 ,  @   ’  @@ @@@ h @ @w ؖ `   ` '*@s @Q & @j@f  @b  @%+)'@Q a@R` @ . !@r . @@`@ @!0㿘 ) % # @@$!@    " 6 6   " 6  6  `6 `6 ``$    *2 2@H@@@6`ƀ 㿈!P@  a !    "@ڐ!p@@֐!@c#   &? % @Ő#@0S Q O @/ `/ `/* ` B/.*2  * @  6` .@, ?#5 @*`  '`,`,`` ,X` 5 , O  ` * @* ` ! ` '        @Y#h @U#p  @O! `   "P`""P *  $"P @r `!  @rڒ"P`4@-!@i  " `A/-+)@` @ . @p̔ .@  !@a@  "P` ?"`"P* $"P@r @r"P`Ȣ` @Ɛ!   )  / `   2?   )  .$ `   2 㿘    "F # @ )/` ,+``0) ? !@$*     `"   @ !a"  @@Ua  $ ?  @   2  `  " Є@"" @ "㿘@ @N_ @@t   ! @O`?! @>`??cp ?`#  ?'#a/@@% 8@@ a X@ݐ@ a  p@ϐ@Ā '@$ '@?'…F?@??#c @?#b@=? !`7 !' 퍠"pbh Ƒƅ HD @ ??@F8?# b`';`  ?#bXb\;h#\@`@X?#@6А@pȐ  ` @0"P` @:#P  `'*` ` € `! L*` €@4#hp @/#k @*#f @%#a @  \ @ X   * * *` @  H H   "  @ h< @ 8  @ `3 @   "     @  @ܐ   @א! @Ӑ!   * * *` @  !0@ @*`@!H%`@!X `@!h`@!x`@!`@! `@!`@!`@!`@!  @) . 2a@n@ .@~"  @ . a@n/ ."@m`@h"("@@c$  *` ` *` 8 €@T"H @O"P @J"h @E"x  @@" @;#p !a"`  "   050    @ . 24 @"`@ @"z`"@ "Р' И$ "@f`@"a` L  @ . D  |* "@K`@ސ#@ې"@  *` ` *` $ €@̐"H @ǐ"P @"h @"x  @" @#p !a` `@"` "*` @# `@#(` @y#@X % ,  *  *`@ *4 #? '*@y#P  +     2`#\@k#p  @ . 2a@m .@Y#  @ . 2a@m  .@H  @(#㿐 a@ `?#\! X! @  1! X㿘&@ '@#y S ( <G"* € # #@#: #@ `1*`@# `)*` #@0I@#0E * *   @ݐ 09 * *   @ѐ 00- `@̒ 0( #&@  &@   `  P`?"`P *  "P@nf 0bP@nN 0@ x(N@ ĠȢ̂ЈԖؘܚ H `@ ` D `@]L H 2H#l;p#\#`#d#h;x;#`@Pߔ #" 8  @ @ `. @ (  !`@D  @ #@<``@&@5"ȁ  '@ . "@3"`?Z@kےNx,   `@  `   *  R *J 2   ???????????@w/w@ @@Oa @  @.  @k!  @d @ؤ!㿘 a @"@ڐ 㿘@$LHMML,MMMMML\MMMLlMMML|MLLQQHPQHPQHPDQHOQHO㻈  'a@+ߐ ''J * : `C#T*` @"܀@ 9' a 4"a  0"b  ,"b"@S@! $" % "b@^j ?b@` J     @X'@a@)?? "* `@쀢   @cb耢  b(@_ 2 @ @ꁐ" ?2@b8@_֐ `"@J@ +2@``@ "@@`@` J@ +"` @" $@"X@ @"㿈N  L      2  .`@ L 2L% @ǐ ?`$ ,@`@2" `@L?Г* @L*`В@`=$@ƞ$@2 ?` q#*`  N? ?Г* @N?*`В@*` *  * 8$ 2   @U d* @*`@*`$  N?Б*` N?*  ?А @$  N??Г* @N?*`В@` $ `2 @ ?$  N??Г* @N?*`В@`$ `2 @l N??Г* @N?*`В@`$ @^ N??Г* @N?*`В@`;$ @P@N@Ⱦ $ bh@Z  " < "  @8 ( ! @~9 ?2 b@^А '"@ '@r ?b@Z̐  ''@b6 b(@^ @] "b@ % 㿘@"@㿘! "# b@b@1:"ؔ b@c0@ 㿘@㿘@&#&"b`#X`@$b ?L "  $b "@-ch`?#&$b@, %&@$d@ @3@ @!@.b @,P#p@,M#x@,J#@,G###@  @0 c`@-~ ?@,/ @J@ - +J` 2@@. 2@@- @.@   ?@]@ "@@*`@ `?d  @  @ @Ğ0@  @@M  @^  "  &#P b #@1 @(@<_@ @;ؐ @  @  @; 0@ @3 @- @@- 㿘@0S  @@ 㿘@  #@0ג @  JJ "  " 㿘  """& "b@ؐ  " &"d @@@/`@. @<@ɐ]]]^^^^(^4^L^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^p`' % ' &#@+p# bȀ  "@, , $b@nbX"h#`n"Y`2"Q`"KoĀ`KJjĀ`"K`EaĀ`Da,EZ !@"Jg"@d:KĀi`"9"@6A%"@"5#@-48!@"*p"@'(%2""                     2b&̐ Ӓ ~Ր ?'&& #""''//// b@+t ,!&# @^@g#$ @Ԝ#㿀# `'` @  @@ِ` @ԁ 㿘 " !J    0 @ "Ȁ 2 @<ߐ㿘͐ "!@ "Ȁ 2?@<㿘 "! "Ȁ 2 @<Ē㿐`h @DД     2 2 &""@x "@Y & ( &""& "b`&""@_ 0 "@@ & 8 &""& P"bȁ㿐! ?"H`'2'#|*`  @ H P  X  ` h p x ~    "H,"H *` 㷀/ '@   !!$"@;k 4 $"+  $"`-&@/#& &"b &"b % $b  &"b & "b"bb&&&&&&&#""b#b" "̀  &"#8 bp' В!`""p @*" ! "b "b ! "b "b&# !&" 2b !"b !"b!b 2! "b!bĀ  "b!˒!! $"J 2    "$"!b!`""J     "$"!! "J  !  ""! +! %bJ 2& &%b"b "b)!!#! #\!(a0 "@b"b!!#\!8@a@%"b!!!H#\@P"b!!!XP@#\K!`! "b "b!h !!p8!x! "bJ !p"b!)좒 " bJ@    @;T ! p@ "@, @'@q!"bt!좒 b J@ & " @;* ! p@ h"@, @'@G!"b|!ؒ좒  !ϒ젒   ! ""x@(!"bx!"xJ   "a @!!̄ ̝㿘&"!!@;$""́㿘N  N@ *`  "b*` "N@  ސې6㿘\t &&&k &!Pd&  &㿘&#\  &!&E"@@;@b&#< 2  !&E"@@;4b  "b㿘! " &#<  &!&E"@@;b&#\ 2 $"!&E"Ĕ@@;b$"㿘!E"t@@; 㿘!&E"x@@:b㿘!E"|@@: 㿘!"@:2 E@@: 㿘!"J &"E @:ٔ@㿘@+ 㿘&" 㿘!&E"@@:b㿘!E"@@: 㿘&" !E"@@: 0!E"@@: 㿘 "    0 @(@P@9@)8@J@: @[@K㿘!"E @:j@  "b㿘!"E@@:^  ""㿘!"E @:S@  "b㿘!"E@@:G  ""㿘!"E @:<@  "b㿘!"E@@:0  ""㿘!"E @:%@  "b㿘!"E@@:  ""㿘!E"@@: 㿘 ?@+?@  "!!!@K ?"@c  !x!@+S 0"(   @ ?@L$?쀢"(@+4 㿐!"d$` ?, @  "  @" $@ "( @E!В  "! @ !&`?#(`?!#( $   "Ѐ`!"$ !@} 2$#(!"Й,    "`   "` & > @ & & @ " #@ %! * 2@  * @ @B ? 42?@(?d2d d@ d 2d ?@I ? Ѐ2 :$"@@* bs?:$ "̀? " `  ?*#"  ! "В$" @( ?倣  !"P@*w = !"В d;  B;d   & &"܀ ;d0  @/j'"`@*@G  &# 2+?!@, `"` @ "@@& &@" #@  "`   "` & &  " # $( @[%!  㿘?  "̀?"h@*  ""́!"Є `?( " " "  2 㿘@ W? 4^ @ 8Y  c @ F%!*Г2  $ 1: $$@) %d45 d8/  d@?&# d2 d@ И 8  +  c @ F+ 3` @* @ ( 㿘1!"d @d":0@D?  #  @L?& 㿘 q !$ "2 !@4  2 @( "Ѐ2!"а "(: &܀?!0?!$ ( 0 $(( @B 㿘!!" @$@ ( ?"?(#@`"( "(`B : 㿘1!"d( ? "d(d 4"21?d$  "d  "d ̐B? " ? B?"(: !" @$@ (@     ?  8 Є  Ё㿘!" 2??0:0  !!??:"Ѐ2?!!"@$"Д ;$0$0 $4;$ ;$@#$($ ?? ?#$ ;$0"В $ @GT ?"@(q 㿘` @̪  !"Д?d? "d;`#@``#`` "`"`#`#` `" "`   !Г*   ?㿘!!"@ b` @"`@@"b@2`""$㿘  @F ?  㿘# b@!! $$"В$8@I   ???:$ "$:$0"$ $"" ""$:$"$(` bӐ b"d ?"d b@"!"d?""d:㿘!!"$  "Т "d 2   2"@Id"А?"d` @ʚ" "$"@ǒ !Ё  ?  H  ?  " ?   㿘      !" !"ؔ@a 1!!@  @    ! "ؔ@J 1!"ؔ@C 1!"؁Td 0(t!""""" ("`""㿘""" "`㿘@%@&9"!"@"@&2 @$ 㿘!@&)"㿘%"@%@&`@$`$%"J "#"@&`&Ȓ@@ @耢㿘!"#" `䀢@ " `? $ " !"@"" 㿘)&'"+""%!" 2  `:  @ J L@%ˠ @"Ȓ"@2`@:`@ L $"`%`㿘)&'"+""%!" 2  `:  @@ !?L@%@"Ȓ"@2`@:`@ !8?!"$"`%`^㿘%"J , #"@%v`!&"Ȓ@@ @%i"`@@  J  "y`@$$@%T` @$`㿘#"`!"@JP!"@%A !" @ ``@%3$` "@$ 5N   㿘!!@%""!h 0@%""" @  @*`@ : @ *㿘1" !!"@  *@`J@ 2 ` "   "@ L"   㿘" J V 㿘!" 1!"@J " "@J 0  "@J  㿘1" J   J 0  J   㿘!J"  "" "`*``"    "  㿘 @ Z?`dp Г*` hd1" J  1" J N !" 1! "@(!"J !" 1! "@(4 J . "," "  0%1" J  >- [" "` 㿘"` "`@C  z  㿘!H  6.@.@H@(0?д(`? H@F26!"|\ ll (txdtlt<`$P\$$pԝ㿘@)G@" 㿘"s"!\z7"\ @ 㿘!"!` "  W"a\!` @Z"!`!T"!` N"!` H"!`"B"!` ";#7#" 㿘"!t? @## " /"a\ `#(``   #0  #8 ɒ 㿘}}"a\`*:" *` "!l@0.L@ +"` "`! " "L@@ŐL@ $"$""!t!"L!p@&,!p"!l L`L@0"!l L@L`㿐!"!\`/""L*` ?Ѐ @֒  d} ":ho$!\ #"Lap  & &"at ! ? +   @& & " Y"atk  "M&"ILap G !"!t ? ,ap@ϐ  !t@c@K @ϐ  -/// / ٖ : d  ?`; "!\*`   ! " @"a`  "a`0  o !\  ?݀   3  㿘@# &bp? bp?bp  @ 0bp@ 0 &" !&#  @$# $# 㿘 "䀢`" @G@"7?&":&# &&"䀢   @P" & &"##"a @& @ f :$a@ w&#H a  @ &bȐ ( @ e#H$a㿐 ``'#x@!t㿘 䀢`" @"J"䀢 @" "!\   g   0 @,㿘! "䀢 "" $"""!\@ #@!8 q "* $"㿘@ ? Lݠ?:L㿘@j!"!`!! @ @ !`@b0+  >$!`@&  @1  ` !"!`@*(!` `$!``瀊``#@  @?㿀&"" 2  :  &"`"h e""!\#&c"  ":h  *p@+&" ?Ic " ec;c 2" e- e!"!\ "/ "" !\ "/ " ")/@'쀢`H ??`c"# *` c   c"ah ah !" !hah &"#X!"!h  !h` @: "쀢 J ""h" h "a`     :h\"h" h "a`     :hJl!"!h !h `"a`!"!h !h "a`    J@H  @3` @ "` g .`"+ ? & +`J`g+` f`J@`J@J@"`J@?`J@2`?`@ Ɔ d㿘 d  f   d f" d㿘 !p㿘 !t㿐 !xؔ @. 'N   !|ǔ  p&")  '@ &7 "@ 1  +, ,԰ ` ` 6 d` d Ԁ ?3L ?  C  @L!㿘@M @ɢꏐ@&@@  0&  & @   @҂ ?@   J"N@ "    J"N@@`  ".@ `@ Հ㿘`@@ @*N@  N@ "`@ 㿈# b "@P耢?b쀢?b@@J! ! "  @b"a@!@!$! ""㿘  "@0 @㿈+ b" @b   @ @'@Ԕ @Q V a@  ! L'@ '!@@m耤@)@e@@a@_@q @4+  '@;'!@v@L&#@  @m @p ! '@耢 y Y@<^Ā@, ""@ ""!"a@E%bb&@<bp& "b* " ! "@`?&"d $"@@@ " &#l !'@@ 㿘 ""@2 㿘 ""@: 㿘 &#  @@퀤  耤  㿘ݔ 㿘 "Ք 㿘Δ?㿘 "Ɣ?㿘 @e "  @㿘1 " ""@ "㿘 @?㿘@@@K    ` 辐 㿘 @j! " !P@v 诐 !㿘0@8D?@㿘@Ɛ |  J"N " N`6 J"݀@2N  2/,  ,N`&  J"݀@2N  " ,@@N ",`@` " ,N  ,㿘G! !㿘1 ! 2 !7! &!!&!!㿘. @R> @ 㿘٠@UL    *`J"ܓ:`@ J"݀@ L 2  L   `/ @* ߒ    J"Jbݔ@N*`:  @"@ ,N  ,㿘 - L@ )@@ @Ē   Ș!Ж@e@2 @E @:o@?㿘L@) *`: `#`%2 @(L`L "L`L@ `%`#2  " " "@+`@`L@  @R L@1*: `#`%2',@(L`L " ,L`L@  @`%`#2  " " ",@`?" @@j `L@  @,P% 'ѐ !  @6Ɩ ?   @ @  # @    @!؁㿘  @6 ??? 㿘 dϒ  d@ ,,Ð@@u@,   ? $@L   $@&` Ӓ$,㿘!褒 )L &{  @ΐ@ː  @@C@+a@@$0@ahߐ&" WڐȬ( @H4Ȥ  ؑ,:@ "@@Ȥؐ; Ȥ 6Nؑ, @ "@s@p$@@ِȤN  @]J? @V*?@M+@@㿐&#, c &" 2r 쵐?" V/@֒ "d L |  @+@(ݒ   2 L %2 J  s2 @ٓ@ ,@ 倥`"@n   V @=@*  @~ WO&&@刐  @oL@  㿘&" K"@^"( A@ @@l " 4 L %2 @J  s2   @@@`.`@@ ݀ @ @(@   <  `?@ݐ(  @`  @ a@֐0$@ &@#@ <  @< * @۔ a@ز@(@C< 6 "8㿘&" ^I㿘&"܀ &# @??  &W@ &b "b㿘&b耢 @S"b㿘    &"?4 &#$  &"? 2?3&c &` ""&"?@ @ @ߒc  !Ԁ 豞@? @ @] "d?@ @c  S? !Ԁ 2N?@"@I? @D  @>   &" @6 S&@.  !Ԁ ?&# &#  & " && "b&# @ &" &#t "?? ` Ţ @̒?  @, ? &"܀ &""䀤 &# &b "b  " @b "!@ #?㿘@   &"?& &""@%`@? @? `@!@ ?㿘&# &"䀢  d  Eu 0A@??5 3` &" @] )&"܀ @K   @     @??  S&b  "b| 㿘@l ?  `@`?@1U Ѐ &  & & #?㿘"P@  ؀   " 2 㿘`2@ !@ && @" `&@&  b "b㿘? " " b?"b㿘 0⤐ ⓐ& ??> . & & Ȑ㿘 @ ! "@'$"ΐ@; @9 2  ؀  2    ؀ 㿘 2ސ   㿘#  a@3 2a؀2  㿘  "   @: `: ( :@ (:` * J   "  " 㿘?&-#8  "*  :&@ ܐF?  @ߒ @@Ԓ? @?`? 0#&- B? @ &#L &"  ?l& "eB? j#&c ǀ ?S  @?&#  0c K  ?m4 㿘 &`#8  "*` :  @ @ f   @ ?FF? x&# '-& 64  -&0&# a'  ?0U`B -& K ?2-&  9 @-@>0%B? @ &#L &&" &!"#@ ۤD@? @? ?D  @y㿘?" 絒 0`F ~?   :"t`F ?   :"㿘 "h@ 0P ?   &"  @0&"  @㿐@r?  e  &#D &"@0`8?  &@n"@7 0?"@2㿈@x@@[㿘?  "@R ?  "@  0@    2@ 8&D?&" @ 㿘 & ?  &#D #@㿘@6@͒ &@8?     : w&@+     # k&氒 #@ 0@  @??   W @8R(&@8""?   0& ? ܀@&&&&""b""%? Ҙ 054@  &#D $@ 0 %&? =? ߀@y&""@Ԓ?  㿘F#8" "aJ 2 #P"a &$ "b !$  $""㿘% ' * @ )   "@  @ܐ $ @<   $@ @ $@ %"$$ &"""""" "!"a*#! #!" x# !&` #'  @  &# 5 ""!  *bb`?   ` "@"2      " !* "!*@""ᜐ `""# 5"ؐ@ @̐ $  !" !"Xb "@ @B   "!  b*@"""!@a"#!#a""a@` ""ᘔ + b* a` #a "` @#`㿘L   N  `@  "NN `4N&J 2 J `JJ"  㿘%"#"a" 4!"!" 4 "Ԁ  "ѐ  " !@4"  "a "@ @  * a@ @  * !" a"&"@ """$#"  &    0   0  &&&  &    0   0  &&&㿘 "Ԁ  "* %?濐   !"!`   "@J?` `!` "@J?㿘"  b?"J@!"K!"@$!㿘"!?,  "J   @  2 ?  㿘". !@^:`@ 㿘` ""`B @ "a  "a5&T   {T  Z"a&@Ȓ@@ 4Y  "5"?@ ` J `` "@J? 27 @J?    " *??"` "@J?   2 `2   "a ?"a ""! *@!" *@ᜐ"ᜁ㿘"!& ""bᨢ   $@ ?* @@?? *`"  $@@$ *@@  * @& b* @" > 2  "a `"a 㿘%"L  "a@2a ",+   &#h ",:! @&&"@&""2  : @  ""a*""@㿘 &#h      0Q&  "! "3"a + Ԑ?`(&a %!"! # b. J?:`@b!J@  Y! $! a&aԀ -  a (Ԑ $!"!# b. J?:`@TRb!J@  +! $!" 2"aԀ ,#"a(  "! "Ԑ ! ". J?:`@$"aJ@R  a $a" "aԀ !"!`   "@J? ! ِ ~  !"!. ": J@  _  "`j _  _ /`_Ԁ  `  ! ""@ @  *! "" J@ ! !""!J  0 "Ԁ   "    "   " "a i   $& [  Y! c$!  &#h \ F 2X & 8&#T A  "> bذ@ "a&@@Ȓ@@42 N -*`: l "!`"! N       M "a "a 㿘"J!  " !&"aAa!&&""쀢@6"G" "!&bȀ&"Ԁ  &"Ѐ  &#T " "" + b*@ "" " &*@b*   "! " **@b *@ 2$"" "@&px H  H"@" & ""㿘??  ??  ?&?"*  ? z "?   kB? b*b&㿘 42 ?`F? # ?/? & b "? * ""@@ z "?*p  ?怤  gb b*`B  "&㿘5" 1# # " 3$!&`0  > 7"&"!ȸ  > && > "Ȕ @b:㿘" aȀ2 OaȀ " 4  8 "耢  @"$ 0" 0:`:`"@"`$  $@$0 #"ȔȠ@    4 2   8  0 2 $ 0 " "㿘#@    "b㿘!$ 4   d$ 4@g$ 4$`8` ?$ 4㿘&# ?   "2 `aȰ  aȐaȀ 4 @8 @,"a$ "8 b@ f4; 9e 2M $" 4 &= ?"9 D@ ""47@50D/ 2 $" 4 & ?  SD@8 ""ߒ㿘  "2 `aȰ ~ aȐaȀ 4@8""f!Ȁ" b@ f4- + 2=?B@@ &) 2`#`D (@%ޞ 2? & 2??D?@U㿘@) ? ? ? 3&@ϐ?   ?b& ?@B?   4$ X  ??:㿘? . 1!* #@? #@  . 1#*  㿘 '"1% . $0,! ^)$ "@  > & 1"@f '#޺& $ @> & # @!$ @@ &  "$ @!8  ?  ?#@Œ  㿈  @  > &> 㿈@耢? 쀢?  "$ X"$:$:$㿈 (%!82?2 ?2  "&"#!8  :" ??@"쟐   4$X  ?? ;`㿐 c'@  2` #@  0 "bِ㿘    ""ϐ̐ 㿐 6&  "@098@?Ñ* : `:? *` &#x`&#|`&#`  4 `  8`  <`&#x@Ԑ &#4&#x*` ' @㿘    &0&#㿘   @㿘   d "@m ( @j `@g 0@d X@a @^ @[!հ '  'C  0  Ր@А  *`, @@*`ВБ:  @ "@. $@ qN@ ,`  T?* @?*`@   " "bI"✒a@0@5 %  .0  aP0@ 0@|@y .   "@@X 瀦 0@g@d "@@`0@[@X  "@@הp'( @( @!㿈 +   "N@00/N@ @  *"&*bN`   N` !@ 0 *"N` ` *" *" "ܖ b//'!/@㿘&#0    !@ 0 ֯@ؾ  "bԼ &X4&pppppppppp㿈 'D+%aX"J@   2%aX€ %aX@JD@ aX`"@%aX%aX  DJ ?`03'DA @*` DJ@ +`? `}'D  D"b@| +@ 'DJ@ + ` ' d"b㽐 aDD z?'D @]? @ @< 2 '"'@Ғ  '  "    5( D/ )%`? !@ J  D 'DJ  D@U 'DDJ uD@ "@€ DJ lD㿈@'H@ @'"H ` @@' "`2``!" `@ސ'"@\0ɐ `   HJ " `@  "{``  "&   o`L Ci`"_`"```" ` \` `?V"``?Q"@"H`?I`?E` `             ` @f`)"@4(`$""` ``H@Δ쀢 2 `` "` "@"@̒ 09`  €H `  @  `  "`  `` * @'@`` & "b` @  ` 㿘1%!P@i !P㿘@א    S@ 㿘@ː  ` 2`%X@ 㿐'#@U㿘%!XJ㿘L@ 2&@{ &@+*`: `$ "$ @Џ 2 N $". -  & &.  < &@@:Д@*N 㿐9 L -2    ?А  &%?`'# @)  А  * .  @*`: В@ Ѐ$&`2 㿘 J"`,"&" " L d2 &cHPp $ $ $ $ $ $ $ $  `"  "@ "  €  $L & H⸔J@   `  *`P  $J2J ? ?* 8-`? 㿘@ @&"܀    c "c"# #쀢  ю  @p? "?㿐@㿘@p@@@  R@㿘6`.  .`@B2`* @ *`B2*@* @ d  @ d  d@Ғ @ 㿘 ( >@| @2 @2  @ d @ d @_ 㿐&# & v"b M >    0            չ  Ֆ  `@D 2    &"#t &"#tՔ &է &պ&q&"#t㿘% %!`@ "    @:& "b$㿘&cp "cp! #&!_@ ##* $#㿘N*` : N x%  ' & ``/ @ `0?, @Ė  ` -?,@ @Ð x%  ' & ``/ @V `0?, @  ` -?,@Ô @ 㿀% 6 '`2 /@9  0?,@# ` -?,@ݚ @g 㿀# `'Д [@ܐ` @O x# `' B@Ð` @6 㿘N2 *`:  % (`N n   s dN2N@L`  *`:  L`   N@@@@`N 㿘@ s q J   ?޼㿘&#l# b`"#l  &"d  &"b`&"d   0# &"\&"Ȁ& "b㿘ӫr  n& "cp㿘! " &"d ӎW@ " &"d f 0 &"Ȑ & "b@?&??  0 & &2 8 0* 㿘7&☴  0.8☴  0(8&   0* @: 08&☔   0*??@;☔ 㿈#&%&b`@"!  0 ?@d@ 0b??b0 b$ 0$`耢?쀢? 0*  :? `04!?& 8?" 6?`0*42 " "`0?㿘&" @ 4  0* 2      &☔ ? 0*@@" @ ☔ ??: & $ &6?'T'&`'''''''&`''''''''''''''''''''%&&&T&(&4'''''&T&&'&'''T'''''p*P+((L+(+(+(+(+(+(+()+(+(+()+(+(+(*+(+(+(+(+(+(+(+(+(+(+(+(+(''(+((+(+((+(+(()+(+()+(+(*P*+(+(+(*,8,X,X,X,X,X,X,X,X,X,X,X,X,X,X,X,X,X,X,X,X,X,X,X,X,X,X,X,X,X,X,X,,,X,X,X,X,X,X,X,D,X,X, ,X,X,X,X,X,X,+,`,`,`,`,`,`,`,`,`,`,`,`,`,`,`,`,`+,`+,`,`,`,`,`,`,`+,`,`,`+㿘Ր !&$#x#xϐ!$ ː!X$ ǐ! "`4" "`8"h̼! $ <㿘@ #&&b0"0@ "  @5Ob0@$b0*@㿐//x# `'p ؐ` @X"x# `' ` @B"㿀# `' ` @-"㿘"㿘? ? ? #&?   ?b& ? 㿘?. > `6pG#*` &"0&!h e@ Ð?P L&W"&X" "@bM&M#&# H Ӫ?2C /鬰  $< 0:&8"? 0Ӓ 4+ )`'% Z@  ӂ `@ r ?2   I"@  㿘?`6H ̓*` T? 0&+"0  `&" F?:4 B 8 ` Ē  |`z&"?: F?@ !`ߐB 0 " <"0ܐ ^͞  B 8 Q`O   H`FF?0jŞސ߲ ? 20 * !  _  ̐ҳ  ^ 0*&0&!h@  J  0"0? #"0J? "00*#"0  g" u  J:" ?." \ J2 02 0?㿘?* : ` &H"t*`  ?* : `2H!*` &@?&@? &@? &@&"&@&@?㿐#&ah%&$0N 2N1N"`:&`?`%%`.2* 0 `\* : *  N%  N '% 2  N  ?'  N 2N0ah` @&ah㿘  4 㿘&#4&&b&&"#x"@ *"@  &"b㿘&"&&""@ "@ <㿘N@= `  @   @ $  * R  N@ ?"@N@ 2 @N`  `N@ "N``, `N@ @(,L? "?,&P &h2 &h" 2 &2 &T" J    J  &X2  X\@ 㿘&"耢 '& 80 $8&" )&&$8" ? "  @  /ʹT" ?$8㿘 "?"`?E& "??":;"ў&"耢 +&b* k?  bb 4?2b? 42 b@( bߒdb ?㿘f &" 08  `?d"8㿘b!  ͐ @4   # @|" ?`X "$`X@>$`X!  \ @hȠ&$ \"bX 㿘!  X " @> $ X" \㿈&"X"   \@  X@  @a_耠`? &@ & 㿘# `@ "?@' ??&&:@$`@:H&%& bb"& 2& &b"; 1b&+&8-  &82'  @"" 42 2" 4 2 ( 2 㿘  `@ 42 ` @   " `4 >`2`` 8>``>` ` @ 4 >`2`` 8>``>```@4 `` @8@{0&@#㿐͔  S`   ` `>    2 J@ 2J@> J@ 5 2``'D J`  `'D Y J@ `D` D 'J '`J@D  J` ` 㿀'P>'T ;'PT  M PT "@@ 8 F :`@ F :`:`5T(N  PT  Pj ' @`2@㿘&"T &"&""Ph㿈4耢?쀢? W? @? 㿘~&#8&`""8㿘 ` V ΁?P M)vF &#`  ` ?9 & "` ͔ ?* '#&b "? b 0?? ? ?㿈\Œ &# ? 4 d d 2+:v4 p `D 졔 D?? & #d 2:M#  @, $v# @ 2 `  "&  &`&&#8  `` 2: 㿀`N@ 'e 2&]""X "@U"3&c8  \ c8  &&b8 &"b8&1""8(!&"   &U?`""T" &""P"&""P!&#8  ( &"""8#8 ??? ?+#` &??#\#`#d?  &#8   02&&"u&#8    x#&bH-&@?耢 Ā ?? Y ? @@?@ @bH bHbH`@ B"*  : 9FbH"&bH2@`( @ "*  : F&"@@"@2& & "*` : "*   * @ :`@ f "H 4 (&(&:"@#\#`#d ! &"H"H?"    & @?&:"@&:HJ@+`H8 2 H "H`HK@2 `2"2" J@ @ &㄄ &㄄ &㄄ ㄝ㿘  Qa@o Qa@k Qa(@g 0 @d  @a  @^  @[ 㿘&# Q ""# @N  ^ĉ  @C  @@ @c|@gI Qa@8 y *& "b #&%&b bȀ & 2  : & "h" Ȇ b & "b& "b"#(Ò x'''@؀ ?؁㿘 @Y#@& "c "c㿐&#1 ? ?Oϐ O   /&㿘@KIIPPPPPPPPPPPPPPPPP$PPPPJPPP$PPPP$PN<PNPPPPPPPPPPPPJJ`JtJPPJPKLPPK\PPKpPPNNOPPO`O    !'$ P '`h''@Ք X5 1 !' FR*  @€Ѐ  b@@ސ &  Ԁ "`b@@Ԑ   =&$` "ܒ  @  "ܒbh@ `@$`8s$`  n"` j$``(f$`"ܖ    @ "ܒb@ @,5`$`4 O$`"   @k# "ܒb@ `@$`(8$`` @4$``@ /$`"܀ +'/@-)+ ' P@h"p`4" `"P``@`"D```; > "S``` < M{ @"V`@"M`40@Bj @)e @"N`@@C[ J@OU  O$ L$``(H$` @E$`Ѐ "A& Ԓb@  Ԁ "`b@ &А =3$`0$` -" Ȑ *$`  "`%$`  "2 $`$`H$`L$`P$`T`$`$`H$`$`L` $`$`P` $`$`T \}"   #@"'"ܒb@ i"P"   @# "ܒb@ `$`$ S$`` O$` $`   I" "   @e# "ܒc@~ `$`, 3$`"   @O# "ܒc@h `$`  $`"   @9# "ܒc0@R `$`0 $` "`@@>i?T? b* &@ @@`@h@ @cH@! @  @|z X@ @``-c`@ c@ @|a h?'&#@C [ Zc@ @ @  @ : @C"#  *#&@c  @D 2@C# c@   Ѐ` ' ` Ԑ =$`P&`'   'ش ' P7&'`P `&9&#-a+  ;  ̒  o-  5`   ؐ@Œ,    ` 2t`P@ o`P Ȕ#2`''` 2  ܘ @Ě  #''@Hܰ  ` 2J`P@f E`P@*& $''$'' #\@UU"    2`؀`  Ԁ`w`(@r@Boc` 2`P`0@g@Bdc `P @ @$`P`P? #$`P1   ?@)!&  ?`@@ @{c @@B @@ @> @ H `& @  <`P N 㠀   `@{D @_ "@㠔 P@B0&#2  &`&`&` &&`D&` 㿘'HH@$㿐@ J @ "`E    >  &` `@ϔ 6@` "1 `  ?+@` &@ ! @@v `@"` `2  ` P`  P&@ 㿘 " `h@z"@zĐ 㿐@8 ' @Y @ `@a㿐 # @eWa "L " n L  o  @ƒ = ",@``"@֐ 2  . @ @ @`!@!Ha @   2 &*@ &"`aX@ `"(&@ "$&@@^"@h # 2&@@^`"2 &@ax@ΐ  㿘@㻐# `' @ ?6  $@l  , ( & J    J   2`J      2`J ݚ`@ ߖ@A` @!㿘 ' X@y$0 X$@y@ @&& @ & @e 㿘'$@yp X@z $ @$ $ @M 㿘  "  p a@+ 㿘 @5 a@ 㿘 @ 0a@ @bbbbbbbbbbfffffffc@c@cfd\ddffffdfffffdfff|dfffffffffffe e0fe@efeeffefefff dffff,f<fLefffffff\fff㿘 " a@ں"@y 㿈( t  %(`(" (( "b(x@ `*``!(""@ԓ*`$"`@J? "("Ѐ O(" KN ^`?` @J? $`?#(b   `@@x(✓*`" x *   b   b&@"#\  #`  #d@xY`(@a`x!("*`" x"* @x"* @*(`x "`x㿘l$ @ 2@`㿐`@ `@   K @ 2J   @0 @\r `@Ԑ @S㿐 "/(%J f( g e     (b  "bb "b(b "b      ' `SW!*` `(?     ( " l l33 ̀@(`@ (l(*` * ?А"l"h!"ܒ@ "܀@"J@ 2 # A`@g ((" l" h!"܀  (("`l"h@Ԕ "܀@"J@ 2 #(`@> (" l"`h(( (""b"(( (""b"(( (""b"⤔ (((""""b(b "b "` @ @w` ( u"b( q"b ,@>,"ܬ ,%@a@ bܢ$@$`%V ( R"b(|(` "J"| ((("""B"b( >"b( :"b( 6"b( 2"`p( ."b( *"`t!"@#Ȁ  " "@ "  "`@ݐ#    "`ܒa@ ( "b "@@     @8 ?ђ? " *`@ & , @Y , @z("Ā` @_`@p 2@    (8@?`(" (`| "`|("(`| "`| ("Ѐ -(a(@5 -(x@j$/(%x@e x+( (%bܦ %(, @@H (bܥ, @@&| "xb!( @@R"`@ x ݦ("   @\U"P  ("  ( "b 2(@ @v=`?" "?@v ?  @@??`@v(`?(( \ X㿘@Ր㿘@  $   $  $ <  @(X `$ $("X" \(`\""`\(`(`h  "`@(X`(  `@ ` "X( \ 㿘0@ -  㿘0 㿘 @=   @X   0  `!@g`!H@M @`@>Ð 2`<@Y aP@3 㿀  !`ax axؐ ("Ԁ 2 !@a7     ܀ 3( 3(`h+(/(???耢'''%`d%2" `@J? 2'`'@x 2`h  2`d %`d  (" (" ( B? '( h K%( (" 2@_!!@_ܒ#(b  !@_Ғ!("؀  !@_Ȓ  2b 2"؀ 2  ܀ 2 (" 2!@_㿈(" ( pLE '(x ?  (" @("܄    ؔ  ?,`@? @Rv ( t 쀒@2   2     x`@Ơ$( p `?    ܀ 23(`A3(b`( 9" 5(" 1 )!("Ȁ `(( h( d@ ( l `"(@_ !( l(`h $"Ȁ`&bb(" d@2 :0@. -b?&b? 㿘@ a@ 㿘@9 a@ 㿘@ a@ 㿘("    @/bP (" * $    P`? "`` .`:  P*  "P@#mbP@#T @^!ؠ (" ) !    P`? "`` .`:  P*  "P@#BbP@#) ! @^|  !    P`? "`` .`:  P*  "P@#@#bP3   @MbP  bP`?"`bP * &bP@" 0@" 㿘@uv,v,v,v,uv,uv,v,v,v,v,v,v,v,v,v,v,uv,v㿘@5U %(#(' `#]!(*` € ("b"ܠ $ "䀢`a@ΐ @b ( "b@9@4a耢?Ւ?ℓ* @   @#耢   "䀢` @" "@@   @8@ 2 `@ 㿐@WC  2 @z  ,`"* * %  @ Z @H @  2 >  '@_ @p2` h< @   @ؔФ  "()@"H#Ъ @ƒ  2! @   @ 2 @  "(@9H 2@  b@r  !(@ @  ,@] @,@ :  @R, :, @ ("䀢`"p@] !("@  "@]Y "@8  2S O"@L ,  ? ?/7  @ ?H'D'H'Xab'\'L @{D @"( @ ;$ 'H'P'T'L _#\#  @0b   @ @  @"㿐@V"   @]y"7 @64  ``@㏐ ꀢ ` `@(  2`@y 2` `@  ꀤ@Ҡ! 㿘 "䀢  b`?  #(@    2b@ 㿘 N  nb@  (N  o(( "b "" %   @x , ` @W  $ @Ԓ $@ , `$@  @a , 2*@, $@㿘 ("耢 "- @j "( @I . " *"@] 2  @V " @5 . "  *"@I   " 㿘'HH@H$㿘 b@Ҏ"@pؐ 㿘@/㿘 " `@@}"@pǐ 㿈 @J 6 `h@[   //07'c@@? 㻀  '')'%-  /"ܒ@@1@2Zp? o* & @ @' '`@\ܒ ``x@ @ `@ @pd 㿐@ؐ ' @ @ `@㿐 # @Z` "L " n L  o  @f = ",@``"@v 2  . @ @ @` Ȗ `@  2 &*@ &"``@ `"(&@ "$&@@T3"@ # 2&@@T`"2 &@a@n  㿘@?X@ȝx @    @1 #????@  6  -@[ ! -@[!H -//)" ")""""` #T+ `:O`#*` € b G"b b B"b b "b! "/@O 6$""a@5܀?! a@ " @<$"@!@ b "b"J`"@ !a@  @""@l@0Ŕapb*  @  b bbt@W??"S795-+/@@  @@  @@a +@@|@ 2@b@ 2 2@@!@ \  @   @   @b @@ D @Ր@ @, ??`㿘   @fa  @`b   @Zb "   @ 2㷀  '@ bP@A  "X d'@!'`$'@n *`"  ` '쀤`  @X `@@i *`"`*`'" ! """h@X  6#,   @Xܐb쀤 &@XՐ"@? 0K@Y"@@l  " @] "'9%⨘$@m@Wϐ@R!` `"@Y @Y  2@R ``"@Yq0"@Yl@m @[@Y耧 "'@Xl @YV"  `2  `0 `  @ѐ "@4`  ` @6"㿘)" # @  2 b耠`? 2b耠@ 㿘)" "1@h  2   21"㿘@y : 2 ,@b@  @V $ )"  `@B  "   2@㿘@ @Ԑ$@ѐ$ $   $  "& 㿘 'DJ  nc@    J o   "b'D""D!"ϔ#@W )㿐 N  c@3k? a@p @ ' "@{㿐@'")@ 2@Z, N  -,`$@ = `,` .$`c ,`$$ `@WN# 2ܐ?&@&&㿘 " c(@<"@l     "   㿘 'H'L'P'T'X"@H@ll 㿘  #` # #@W3##@W-#@  #`@W!# c #@W# #@W# "@W #@l3 㿘'H'L'P'T'X H㿘'H'L'P'T'X H㿘@Pf@#㿘 'H'L'P'T'XH@l (@Yk / @i <   L` r`@- `@͒㿘@YL / 1($"@, /,c$@"" @$" H "# ! @iH   @V 0E@i: = '< @@#0@#  %# @i%  ~@Vi !  @V_ 0@ `ˢ @3 `2 㿘 `P@ @/ `P@  㿘```@  @(  @``@  㿘@ `p@ ݐ 㿐)" ")c" "c   95 /@  0;@ 7Y @U @ ` ``2     0 @̦   @G@x À Ѧ`@`) ##@4)  #@T f@v#   2 @1 0f  2      @U~ ` `  "a @K `"`$  "@)&c & "" @4@2@0 c $ ?"c#?%#` @ R#)@`"c` "@` 2@@) 3)#2 !X!`! a0h@" "!#!  a!@֒20  @0` @  㿘@Q %) J? `   ` " @4  @ 2 J` 2 m & *&  & & && "@" c "c㿘)#`)'`@T!`  % @T 2 @T@`2`㿘` % @} 2@0r0 2 ! F$ C$ @$ $ $`$ `"@$`㿘` % @  `  @     c "c㿘@㺠  '`   "@a@iJ @va@В@Ĕ @:А @@w$?2@@i2 @  А @f$ 2А@ b@Ґ@=@i 㿘@㿘b@B  bؠ @b`? '%+  m@ܠ 2b(@ @!@@@* ?倢 ?b* @ @&@`  `J`p  &` @ "!@N @`@h@@h㿐 J c b @@b@@N  @/  @"J@ b`@=  @/  @"J@ b@, ?# * * 2 `@ ? 2`  b@ @T b@   㿘  #@*z 6 @Tb   㿘  !  " "@b0 # "b@b"ؐb@c @h. 㿘@"0000000000000000㿘 cp@ɿ"@h  㿈!1+171)1#% 51-1'1%/` h"*` €"$# %c & %#@b  "cL@b "cP@)c؀?ؒ?& * @&  % #`#$   ''11'#( @7 ?c@ L   #(c@  "#$##  @Rp @Rl @Rh (#@Rd 8#@m #%c@ec #@_`P  %c`X@ @Q蠒 @gj  @  `x@  @ @gX @9`2"@`@  @Δ `x@ ސ  "@ 2b`@ ѐ @)?@k耢 `@ Đ @ (  @&Cc   ` " `  " `` ` @-ް 0@  x@R @ J !@R0RĀ@a@R 0GaB + cB + 3`  *`  @  ! @-01@dJ: Ā@Ry!80@1c      ! !?   ?# ! ? ?#   F?2B  ?  ?# !  ?0@! *? ?c@  ̀@ ?@ ̐ ? ?c@ ! @  @!   #?9 ?  ?# !  ?/@! (? ?c@  ̀@ ?@ ̐ ? ?c@ ! @   @!  2 ? ?# !??? ?c@ ! @ ?#" @!  ?"  ?c@ ! @  @!  #? "? ?c@ ! @  "@! @#@" 1    @   11##"#"c!H!p  !@Q[@~N@z2 1 1c"# @P`!#`"!!@PT!@PP"c"(@PJ&@#@a &&  `  㿘. >@ 2@bP@ @bДbh@ @@ƒ `x@֐ @-b  b@̐ cL F 1#"" P1L" c * "c1 b@ 1#`"@Oݔ  @c)1'L, * #"@ c  @Oɐ @Lc @O"0 bА@   b@  b@y @{ c@f @ a@] @)c# Q@|z0 2c(@R : @ @ @* @e@ E @ :`D @ @x`* @d@D  0#H@ x1c* 0"0 ;  @ C@8 1# 1b@ #1"@  #P@O) ( (  c31+d,c*"@ c  @Ob   2dc @O"Ȁ>c #h@N X0#tc+1)d,c*"@ c  @Nܐ"t 2dc @Nɐ"Ȁb@  㿘@PPP8xLd|<L|\l|4l44444Čİp\@\t4,48ŤLTd,\€\HD4äƈĘĤ\Ą\\@\\ĸ\ʜʜʜdʜʜʜʜʜʜʜʜ<DʜʜtLʜʜʜʜʜT4444444444444444444l44444444dpͰ|ͰͰͰ͈ͰͰͰͰͰͰͰ͔ͰͰͰͰͰͰͰͰͰͰͰͰͰͰͰͤ  ްdLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL(LLLLLLL4LLLLLLL@㿘 " @)J" "! b@""@b@b^ 㿐 ' @$J!3$"-l+2)2'2/2%73#3!; 9253 "* @€ %c %#D $<  %@@ ܐ &d $b\ @## ?ސ?b*`@@F{& 2@$V"c '#4@  @  . @@(? (@ &X  @” &XXdc8@   3bؒ  @ ??c@@ ?`2l*` €?@ x`''#4@z ''#4@0@0T@@ap2#4 `   c`@^ 3bX @#ܒ ?؀ /3Q)2`@J@ -E@ p`?`=m t*` €2 8"c2 4"c2 0"c2 !,"c?2`@ @S@ 2"?@c@" ?2`@ @    ?@Ԁ  @c@  @ ? 4`ؐ   ?'''''  И @Κ c@  ""#<@y c@א  И @յ c@ʐ @L @ X@K0#<  @K 2c @ (@K`x s  2k#< " @Ԑ ,_2#   2W"  2P `"  2H  C3"\`2@ . &  X6 @@2#D`,`#< @%  `@ @~@K p@ `? @`@| @K{ p@Kx * @yN㿐`+m ؓ*` €2#  2# `@* 238b` "82  2c` "` 2"   ?@&@`@ 㿈2#4`Ѐ (  'c`@ @M@ g"?3bX@"k ? 52#2e/3`@J@ -H2@ ``5>*`m! €2   2    2   2   $"9"2 !  ##"0 ?22@ #  "``@ `@@   "! ?22@x #`!"`a@ @@ ??22@e #`! a@v !`2`a0@n @@p 2#`! aX@_  "a2#`! ap@S  "a2#`! a@G  "a & 7$2 "c3 "b`c $c  !"(?2`@ @ ?2`@ @  ?2`@ @ @ ??2`@ @ @ t@?2`@֐ @ @ݔ@g?2`@ɐ @ @^??2`@ @ @Ɣ ⌐ O%⌰?2`@ @@EB>,9 ?2`@ @s /??2`@ @    ?@쀢 @c@ @} #l    @   @y?j ? 4`c 2 ⌀ 2  2#l` a@l     "  #`2/M@L *`"(M@` ""`2"`@' @B"M@@ "M@@B`32@B`2M@ g@^ @B2#D`J !( x!@IFL` !@I>` 2#` 2"@'@I+!Ѐ  @I%!؀  "  7 "0 "0 !!"@@I "@ 㿘? 3 `@J@ -'@`?`m"`*` €    ! 2 "c찆?2`@ @b@?@ ? 4Ҳ`3"3d@ 2l  l '  ? ( ?* ??* ? *  ? ??? "`3"`(*``H 8 *@㿀    ' 2  2   2    2    2 "    ?? @   "( b0@` 2 l`@H"l ` @x)"8p2    #!"2cl?"clm#D* €3"h2"3"2 #H2#p  2#bP@ ! ,b`, @  ",   0  03 "  ð ,`m"ē*` €  ??  ??''%'ܐ @ Ԁ  'ؐ@Ԁ bh@ ` "`bh@  "`bx@  @^@ ? ?  ? ? ?@    $ 4 ؀ 2f  c _@[ߒZ b@S  $,@O 2& + 2#`' @Ֆ  •  @O " 3  * 3"`b@  @  @y  2&  @ $ bؔ@ b@ 㿐 #  @Қ c@ `2cl3 "clhcl3!"cl+ "  !**㿐2#  2#  c@ 2#l`"#l   @ c@@ # ` <` @- "@?3* " *" * " " " " " " " 3 *`*`"`& &  &  @h?#:,@`?x   ?''''  ܘ @> c@S  &@sx c@G  ܘ @% cX@:  @f*@tA㷈  ?' '쀦 '3+%0`@J@ -@B` "   " '0 @ ? 4` @ # ?$Xc8@   @ ?3c@ "d`X3ؒ  @ ?3c@@ِ 3"\ 2"#<g@[. !X@X(? @?s`"X#@ @^ '@dА@Ec@X㿐3'D'H'L@?W X" @ʔ"XD a/ 'DDcD 'D`g 2#p    'D2cl  "cl *+#p'D2c82 !2cl-133(  X 2 H L" " * " : (: 0: 8: @: H: P" $2 * * D* %" 33"hb@' 2l )23 "h ?   bh@2c<@  @jc2cl 2 "耢 ?   b@#<`@@Oc2l 3 " ?   b@#<`@@4c2cl 2 #H ?   cH@̔#<`@@c2l 2 #p ?   cp@˱#<`@@c2cl 2 # ?   c@˖#<`@@`2l$2 #Ȁ ?   cȐ@{#<`@@Ȓ`2cl!3 " ?   b@`#<`@@`3#<'@ 2@3"\`; 3bX @ 2#D`.?@Eq )?D % )2 X1Ȁ@X# @ ?X@W"X 4 ?3@EN @ `@:  @@*@ J "*@2l % !  @  ( @? * @  @? *㿘!`  2  2  2 11#Д@X #Ёx  2c< ' ` `@"`   *` ! @C""@C `@Cސ# `R*`m# € @CА#( @A " #8@CŒ  @CH   "P @ @C#`   "P@'  @R` #x@C    "  @C# @C# @C#@C!4` @C#  # @C~    "P@#<  8 " 0@ڐ  8"@& 8 0   L   L#\ 4# 8 (@CZ ,@G` @s8 ( 8m؇( 8 @# P  X  ` h"` Ё㿘3@#"h@C! p       ` @"0@ @ "  @ @ 09 53 7 ;;   3" `"# "  @"  @"  "  @"   @ 2 @ ` 2  @ @ ?` @` ̀  ,  @@B ؀ !2# $#@@B $#     @@B! ! @B` @@B!8"  @ @z!P@Bw (@Bp!h@Bn @bP@Bha؀"!@Ba!@B\ (@BW , 0`  L 4@BN 8`" 0@  8"@& 8 0   L 8@B<2#<`" @$0 ?H@B/!  bP@  `bP`?"`bP * &bP@Ӑ 0@ 㿘@B! 0! # a`@"P@B" $"P@|a`  @㿘 `' W) @A" P@h  P`?"`P * $P@ @P @2 `` 2  ?  @ @쀌@ 1@``, @@A"( ?  @ @而@  P`?"`P * $P@J 0@3P@P㿘`r QN>@ H  , < `   ?`&  @  *  & @N @N ( `   ?`&  @  *  & @@N `N 4N   ` ?`&  @ >* &@Ґ >0@ >㿘@@㿘 zcX! 7@d    㾈   `'   0   @U "0 @c'"@@@ے   @t!"P@@В @)"P  @p"`㿘@@ @w    `А *`: ?А *`: ? *`: ?ɀ`2    n ,  €* ,`  *  **".@㿘2 "#*#Ȑ*@ 2bh@; cl$"clp Ԓ  @  Ԛ 13&"bx@$    '''''''ؒ И @ ?"ؒb@ 㿘 3 @pb؀?2@b@ @?T@@A "@9 ~`" p   ?'  ''''  آ Ԙ @U c`@j  "@l  @_ Ԙ @= 6cx@R @?#` 2 @` @ 2@@@@@*`@mI  P   '''''' Ԙ @ ? @8`*8c@  @l8  @  Ԙ @ ?c@ @?-#Ȁ @ * @@` @l2  !    " !  x  !0, (#\#ؒ`` @> 0t!#ȆОؠ `#\#`#d;h P`ఘ @>Қ`0Y  2#`     2#` ` Ț`؆0#\#`#d#h#l#p#t @>2c< !8@>a@  `  P`?"`P * "P@8 0bP@   :  `" @`` "` P   ' `  ޔ2#쀢` `  !2@Ȳ#ʀ  ؀  @J#ʀ  ` ""@ `/ `` ` @  `А@Ô `  2#`"  @p  @ݒaH < (@>!P 4`@>!` !h@=ap `   0   L "P`"@ " bP* $bP @    0   L!  @u"P @> @=Đ!x2c< ؀`!8@=` bP`?"`bP * $bP@c @K  @m!! # 2h # $#h@} @` n`@A` d`@7 `` @Y@=g!㿘?`{!*` €! ! !!!В `@=F!0!@=A㿘` @)@3    2"@=& 0#`"@=0 "@= 㿘 @="(`  @h?@="0" " @<"8@<"@@<"H @<"P@<ߐ"X?`%*`{" €@<Ґ"h@<͐"p@<Ȑ"@<Ð"@<" @<"@<"0 @<"0@<"0@<"X㿘   !>0 ? ?   ? ? ?@& 2@ `@w@e2"@"@"@<8@@<2"h   '瀣@" +    +@<  @k"p   ' 2"!@|]! 2,! .@O!蒒 !`@!,!  !2b @!c   `!R{"(*` €@` T  ???ؠВ'@p  /Ѐ/؀``ِ ``ِ  ` ِ   耢 /'/@_!@ې@ " !1 #@ #ؐ@ `!2 @Pm!  @kY#㿐 'D " 2#`D @  @ . 2a@\  ". D'@Ȑ12 @S! 㿐2# `  12#\ ! @ c @! 㿐 ` @ 2`2#`  @Q  2  " " @; !"@`!2 @ !7 耢` `!2 6  @Oߒ!*  `6 !2  6   6 6 !2#\06  ` @OŒ! 6 6 !2#\#`@6  ` @O! h   ' '  '  ' `' ' ''T @`4 `@ A ؀`@ + 3 "$` "` ` "``"` " ` ` 2 `````2+ +  IJ` * (* ` `؀ ܀    䀢 $"@A#P2#`2 #\Д! @ @O!!2h @O!  @i#p㿘    !  ;@:@q @ 12 @Nْ!  1 Q( ?2:* c0  .*  ?** *c㿘 ``  2   12 @N!    @ @NX  "    "   ####Ȑ#Ё㿘  !2 ؗ2  @Nj! p @Nc! ,({("` "` "`L "`T"`X"`D"`H"`P((" 2㿘@㿘N 0       2- *: `8( @{ 2# N % N    D " N ?     D " 㿘@] @  2 `@ @eӐ  `@@  @:,  Lh@M   , `@ ,㽐  '?'`x?" $'p'@N' '   ' '`@s  `@{3     `@{)    ` `@{      `@N )'@֒ / 'J 2@ʒ ' 2b3 *@`'J@    2Q"!'0@¶ J? /'0@'  J  0!0@6A`@Ő' a`@ `@z    `@z  5 `0L@ +?'J  /*@@V / 'J *@K @ A'J =*@@@ : 'J !@ܒ@dÐ * 'a@뛐 @4@ *?a@덐  @*@ :@ J `@   *,@`L@ @ *  '2@R '?@8!@ ?X????:(A!   &@3!'  07 2  R"^@J."P''=#'@z  @؝  s0gc@ؕ ?`  ?:`@ '; @!?@d? 'a@ c @| '0[?@@ B :@ " ' =@1`=# @? P <? @ 5 @2  @0?  ?  #`?"``@*  "@@ #? @ #?  :?@@ F @ @( ?@B @I '@ =# X? P 2U? @` @2N  (J? ? @ :`  @2#     ? ?`"@  #*  "@] #  @D #  ? ?`" *  " @D ? @+ ?@  @7c"8 @! f=L@ [@9 ] " J ``:2*` @8 : ,  @  #P ''=#Ē@`=#Ā`P  P@K+@  @ "X@0;?'T #\! @ b`@$!=# ? bp@@ '?*"@  #\  @ǚ  @/] @/W@@/Q"?'b2@v& "@6@!b!=#`'? b@ *# ? b@ `2###\  # c @0O@#X @@ܒ : @ ch@A @Β % 2* @@c@ @x c@b @j ##@^ =# ? @c@c` '@ ?2@6#= @' #'   ?'*@ "  J? " @i ȴ @ Ȑ  !@~ `2/ 3- 3#3"  `  ""@ #@ߒ@b???:( @Δ '   ?'*@   J? "  ^` @wC   `  ?@~P?:(`8@w) 2 `H@Z `P@U @~! `p@L @ْ # 2*=# ? `@H`@ 0?@i'@b4iA!  &@!' @5,!V 2  R"^@F"P''=#'@?  @b  80,b@Z ?`  ?:`@ '; @?@a@a 'a@ڐ  'c @= '`e @ ?`@B:`@'$  =@Q뀢`2 =# A? P 2>? @ 5 @2  @0?  ?  #`?"``@*  "@@s #? @Z #?  :?@@ F @ @( ?@  @Ґ =# X? P 2U? @` @2N  (J? ? @ :`  @2#     ? ?`"@  #*  "@ #  @ #  ? ?`" *  " @ ? @ ?@  @4 I @ʒ ? ( (?= =? @ @ =@ =# )? @k $# @ː @A '@  @3#@3"(@/ !@ @2?@@`@`@` @`   @b!8㿘@  !? @!@@ =#@ 㿘@  !? @!X@ =#@Ԓ p  'D?''H'L X'@Ӳ  ? 8  @ ڰ `D@ϐ ``@ː @!p M " @!  M "  Ԫ H* @@|   a@< `@t   `@t   3""L?w0s`@t   L?f0b /@ :@@ @ 6 42`:/N@*  @,@ @~ @ 2 񀦠 @#0L  H*` @ !0%@O@LN@ [@W ] `: @",L  :2 , `  :@>@: / * `. @# :`N@ ݀`?,@``L@  @4D /  , ? 8  @  "'''  N ='' =c? "`T?" T"c @E? 8=`"#`2 @ 2 !@ r0 @ =#  ` L@ a@x@  `M a@x 2 ` L@ ` !'ؐ ''@ ? T M ="b  @  C #  `?#`@b` 0@E$"8''܀` ' L!=#p"@'$#p @Y $#p " ''  @@ @c d ԰ @^Ԑ 'Ԁ ?D 6 ?Ԓ :H* @+ O? 8 ? @    @`"H㿘 F @@]   bX@l N 5 N + (, %2%,@J    D ",J    D `@,`,`N Р $, * : ` : ` "ɐ? * (:8  ` * : 8 ` "??ɐ?Б* : 㿘`@r  `@r  `@r  @Vb   㿘  ∔ @ƾ 㿘@7  0 㿘'P'T'X P@~ 8+ `?'"`)@  @!d  @ #P  ''''@'?-b/@ b@  В @D OВb@  OВ @D POЀ @ٖ ?"@  @@3"@ @?"` `3"@!3"@z!3"3=&c쀦 b?     #\! @, @^!=# ? b@  @+ 6 6"@*   @( "  +=#      #\! @ b@#!#@/@(# @@(|?"  `6  @/#(@?@oK"m !d @ @oA'@a'@1 6 @/Ő#0E@  '  @ֺ  @/#@c`@&!@$!`ch@ !`1A &!`2=@ #p!`# ? c@c@ !` "!@! @@@?"` '?c!@v =#@ے ` @^f#㿘@G   ? ?`" *  " @  ? @ ?@   c  `"@!4@t 㿘!A!# 'H'L'P'T'X  $c@ G#@?"`' `@q !@ՔH!@ׇ#@!< "h@1cЀ@w`?c `@ @P 㿘# cH #@J !A!@Β$cH@c!cH  c4$cH "c4㿘 #0 @pa  "c8㿘!A!`#   "#4"cHcH  #@@8@9! c4$cH "c4# c4   @% c4  "#4㿘# c0 ! #8 @p( #8c0" $#80@p $#8㻐; `<'cp'D @\$9 @ؒ     @"   '@3!``怤` `@+!`!A!cؘ  4!@@!`!A!cؘ  @K@!!@D 3@=# !? @ֳ#@ @!"` ` G=#`4@> 5=:=# 5@   `  ?= `(@  ? `? "`` ,`:  @*  "@@̐ @   `    @*` * ?А"  @ ?    @ " d    `   2   d`  `) =#o d--  d`("  `- @"  "!@,!@@H!`` `=# 4  ?& 5%=#    ? `?"``@*  "@@6? @ ?@  $8$@!@{ @ `"#ƴ 1,<"#h @͏@ !a @ #   @`"?П@ ?`  @\ 0@l @ "` 㿘@ !? = ""@x @@y @!@< ? 'H :?P''D<' '?'@???'Dx??  : ( $;@'L'P'X`'@`?'܀ #=#  ?H X ?HJ -? `H@L`? `@L?  @܀ @HD@ L0^' '䀢 ' ܀@ @'@̽! +< <#h ! # @ة?$#䀢 @ϐ 耢 D@Ȑ D?"`P@<@?" %"༒aT@̻ 'c @̶ X'耢H@` sHJ |nH@A  \?@$  @$ H@,= 0sH@- / 2,H H0  @   /,?H@, 0R 0 ?@$  ?H@,! ?H@, 0= 0 @$ H@ 'HH 0* 0  H@ 'HH ܀  =#  @L 0=c|#  @C L@Y ?:(@  @@ @ @?y"`@! %܀  ( (  (,x ؀ cL  D m  0e#( 0@#`' X 2XH@` X "P<'5"c `#HJ | @Ɛ 'H @'ch' ?H#(@+d`0`P ""`P" <"c H@oP' H@+N 0#'  R @=@גX  13$'13#耢@!3@X##@W6 $#@+& &#&#`<  ?`P ""`P<"# L@?-=# "I  4   #(#(`!  R @< c, @c( H@* ?D<@" P"c i@#m u"+   R @<3# @@F?2 @#P `&@`d?`@= > #B E;`@? P ? ( = ? @ @Ȁ 3?Ȁ   ̀ *?  ?  #`?"``@*  "@@M #? @4 #?  :Ȗ B?? @@   R @ $@%e$@  @6 $ 㿘@   ? ?`" *  " @旐 ? @~ ?@0 @\=` @"\##"!4@ 㿀'D'!'H'L'@ʒ   ? 0   '=#|  1=<#d  @ Ȁ 2 1=#"@ J" ? @ 0  ? 8  #? @ܐ  @?"`@ϒ <!&cp @@{!4 ; b4@¡ '!D L @•  0@   `'H  ! #  `$#   @w  ? $# Ha@L0@j  "# D@6`  ?  !<D@'`  !<? #hz !<#h 2!< 2 !< H &0#h "?@ ? ]`?#h 2#!< 2!< H "!<K #h @ΐ C @!\ @?"`@  0J#h "?@ ? -`?#h )  @!`R @3q!` '7 @ͫ  6@@!!0@!\ @?"`@7  ?   @!\ @?"`@ 㿘@# /  1,   @G   /,`%8@!J < ?  @ɳ!804$@h@  .* `&   d,,:   9, 0@ ,:  02 ?L? . ? 1,?`,??`"ߨ 18#㿘!? @w!` @w!A! "@@{^@$!!@3 㻀  Aa'D' "@@!Ā @!@!\ @?"`@ ap@) ؐ$  @4ٚ   A!R @2! @l  !A@ !0!A!a@ @&!  @!`R @2z!` 7D'    DR @2hD '7  @̡ D6@@ !0@!\ @?"`@-D`   DR`@2>D@2-$  ѐ @ "(Ȑ Ɛ @    @OM!ȁtvuvvvvvvvvvvuvvvu<vvvvvvvvvvvLvvvvvvvvvvvvvvvvu,vvvvvuDvuLvuTvuuuv4vv`vvvv̝㻈  a="@'D"`'@!=  "cJ  !"c <?$?;=7=9=#=%=-=/?'<5="## ""'c&p'#$ct$%%P$l@U& . L * b@ 2$ct$b@ސ 2$ct$b@Ր 2$lb @͐ $$ct"(@ "@bP 2 $l@"`? "`J !<"p"`!<#l  `J 2@"x$#l@"  L b@ b@ @b؀ !  !  2  R"@1%!@[? "` % bP ? "`R@1 @H `@  %P`B t*`   |"cP  x"cP=="#s"ct? o"`Tm&k'ci&p!"   #@gњ ["0"D#??S"`PQ'#"M@   "PA?"`"C c @`?A? "a " "P1"= ="#t+""@&"`!"   #@g=""#(@ܒ @=  "cx= "c="#@D@s "<D* "?@ ?""`H'D@ h@{#`  @  @@  @$ "#T@ = `@ɐ D k@  DӔ @2@_   @MY#@㿘@ : ? X@ 㿘@#?@ 0 `8 !A!`  R`@0  @ @x!$!! # & $`8@ @O#?$#$`8 #?`8 !A!`"$`8  R`@/ @ @xr!$!$`8@"  @"㿘 "    cH@"@29 㿘 !!?@ @`` X p`X  @ג`x ` ? @I $@   ? @`@@6" #X`"@` 2  2  ? `@`@?"` J  q   l  @ @Ő  =="#"c|㿘!= # %=/`"$# #X#X` "2   @0@ J Ѐ /  * "$$#㿘  Hc"`Z 㿘 #(#(`!! @ 㻐'  ' ` &```@`  @?x"`E`@ A `J      " , *` "/K       +`:    * R +  *` +&`  ?  @`&`  ? "`@0`&``  `2 =#p 2` ``!(ﻚ   @:(@I @K!0 㿘@    ? ?`" *  " @d ? @K ?@ =A"c!@ h  'H'@ 'В''@=HA= "a"@$ a8@D c@ 'A@!.? =("##耢 %?@ 2  ? aH@:?#'䀣   #(#(`"!!    ?  @~H 2N@@w   =@ "#@K!p㿘`ސ!x`@ !`=# "`? @r!`Ȑ!` `@ "&`?" ? "`㿘#?`8 쮐!!A!  @v= ?"c$!$`8<c( J9&cJ!$J @J@` J2`@  c( @* 2  * J *c ?    *``` NLC *`:  $ \2%J*J!: J 0$JKJ@J?ϕ+`   "@  K`J 2 " K@2 K 2 J 2 K J   >K +`" >J` 1: #.#` J [  \ $"J+2+J  +J $7 J     * J 02?L  @`+J@  l +` f @ "`  +@  W  *`G: :  \ $?27JJ     ")JJ 0?L & @`+J@  J+`  @ "J +@   J  + J  , ]*`J d  J2J 2J  ]`\J BK?J ,V ]":R     ")+J 02?L ! @`+J@  +`  @ "  +@   J  +N# #0? @œ!㿘#?`8  ?= @a@?"`!<#l =#@ Ā 4`#l ? "J b@ <  8` #l " `귐"@ =# ?? bP@ =bx $`8@#="<b @#@?"4=b @#?"@b @ ? "L'@b @=#=="#"c|` @b %=?$n" "!@` 1@!@q  !@q   ?L? ."? ,? b@x! 2,!@bА!@ZҔ  ? @ "`< "cd` ? b@Z$ @" <"#d`!c@Z 2$? @# $)   ' ` *? T $!!x @ !@@  !@m@ 2#p!@X@-$! #p53#@  @O@ 2` ? c@ c@ @[? P  c@Z0,O 2`@-! `#馒  2@ϐ##阒  `@#آ#銒 ?`#~ #@̒2 ? T    ?  ??"`8  @G 㻐=#- '`=# 2<@"# > @r:&# 2< ""`"` "" !;@  N  @ېJ? /  $d @eD ?@a ( @f$?L@ / /,@ $"`P@Y@@E  (@% @D1=#?&#&#'=`$? `?` `  h p  ` x@ @Č d @!&`? f`?`&#$@\L&@k 2!; ? @@   &#@Z$ @r"&c@Y##*@  @F ؁㿘  h=# $ Ȕ 0@m, @ҳ 2Ȁ  @ @  @`< & @_ @ڐ 㿐#=c?$c; ?"?@!@n %  @`J      2$c? ?  !? @@! @ $cH%=+@`?!$ i`1@!L     " LL     2 a@Xc  2? @a  2 0, ,, Ĕ#\#`aP@!Ȓ  ,@?'''?Ēx''''@7 쀦` ? ap@Ô!$ @ !? @@5! @b $"%`㷐# `'$@}ݐ@u@Вa # @I O!@ /2 @@W 2  N /   ` @E!㿐! #̀?@6$#`w @? # `?㿘@  ? P? @ @"`7  '?!< @숐##  #<c("<# :@z ? P -?( (/?5 @(@ B `5`-  -`@B2`* @ *`B2*@ *@(  d`& `d4 d!=# 4? @ "#@^ "c# $% Ѐ  @s !  $#\!  !#\#`"@)"@)ږ@ "@ؐ@] d@E@Baؒ""@#\"@)$  4`  <  ` 4 ` a"@`, @@aJ@"` "@#\ B#\@)< "@'ؔ" 'А"@''<##<`@<"쀢" ;#<  "@ # '<##" `'" `'А"@@''  ĉBA?ЋD.'@Ȑ @@""@@),.@@""@@).@'ɐ@@"$ <@ <@'@)% @ @`    ((`@@`@]""@@(ޔ]% (@P@M""@@(ΔM% ( @b @!@?В. ȅąB'@E @,@)""@@(.@@""@@(.@'F@@ "$ <@ <@'6@(%  ? R @&? @@? `@ @B '?%?@<  ? ?`" *  " @ !  @ ! #Ѐ "?@A,$#?@  @C+ =#+ ``' `@] <##" `'x" `'|А"@@'x'|| x#?`@ĉB@U?pp B3? ?  @Ǡ  `@`@ `@  `@  ! P? $p#\@%;`   B ;h X `#p  @' d U`@ `@P ` L p D?(`@( #(`@@ D 49 (2(@ @b !@?hp. hąB'@.@&/@@ d$ <@ <@&h@'j     ? R @%$ @Ґ@ʒ` @BB 㿐@   ? R @% `h@?   P@" @ P"`@ "㿈'''' @[ 㿘@$$$$$$$$$$$$$$4ttttttttt444ttttt44䀢` "?    x( 񀠠"     怊 ?`       򀊀  + ` '@S #@#M( `@   `@` `  "  0 `0!@ P  `   `     'ؐ@ ؒ @ h ` @@9 2`)!D  @!D @`@$ `!D  @  @@ " 2`!D  hؔ @ΐ!D  `@ǐ@ m`h @@@$ @I!@ P  U`   N`!P I F1! #a@ P@2=`  2 #!@   T@.`@ؐa@ '"`T!D @"`!`  !@  P@`!P!h@  !D `@ !p@ `!x@(` @?!㿈 "ؒ @є  @ݐ  `!*` " "# "a,"  "#  "#@R@g?ݒ? "* & @ @A @> \1 &!@@ې! @>& ) %!D@ѐ!b4@> ' $T@Ɛ!!@% @@  ܀ !@ aؔ@? @!  "#@+^#@Q!(a0  @ِ!@? $ ,a0  C, 4 "L@R !@@T"`X!@@Y  + !@?@ &!@@ܒb /!   "b@Ҕ   "@ʒb "@FT" @ @ !@@ !@ "T  "@b0! "@@}  ?"c"P@F"@@"h @>"p@?@6"@ @"aHܒ" @Y ?@#"@P@Sba "b0@"@w@"@ !D `@ې!p@ f!   @m ?$#@"<'#  @[ ?@"@J@I#?2@#(@#0?2` @ؐ#8` @E?2 @ΐ#H @吒` ?2`@Ő#X`@?@#h@!@#x@6`!@ T !D @"`0@ @` 㿘 " c@"@#C 㿘!!D@  02  @`@"`!D"`,@@!D  c@ !(T!D""`4"`<@L"`8㿘!!D@U!D  D " ,c@ !(T !D"`"`4"@"`8㿘@"@!%D   ` ,@##@ @ r $@@@@y瀤`D`#  # 07a܀  !( "# $` c@  "   c  "  @# 0c @5 !( !TD"4""@S"8DD@:",@㿀#aD       @ @ aD@*#0v"`@<#TaD aЀ "*@vaD` "`aD ` aD#"`aD ` ;aD <"`aD  "@XaD`"`2  : "aD  "@HaD` "` 2`@ : @:@" aD!(` "`` aD#"`aD!(` "`` aD#"`aD!(`  "` ` #"` @㿀#aD <",@aD    2 ####aD`@`,aD`" aD  "aD@ aD`@ aD `@!p@VaD "aD@baD `$"" @7aD `@;@{aD@`(" @V aD @"`@ H㿘#aD@NaDD",a䀤 2  a@ aD" c@ !(TaD""`4 "`@"`8ha  8 H!!D  )!T   aT * @ ~ aT!D `` 2 @!D``P@ޔ  s@`2` @Đ@i 2a@#0_ '`0 $`0D`< p @$`,@E#@!TDb 4@? `` @DȒf @@Ē D`$@"`D  !(4 D$@` 2"`@ 2@"@!(& &@ (@ X0@Tb@!ā㿘@8(4 @P xm  @V(4 @`" ``$ 4$ 8&`&@@ K``` !!D & `P @/ !Ԁ !D! 2"!!DJ l "!@8a A & $+ !D @@`l $* @@ $ 2 ! $@  @95 $& $!Ԁ !D! !DJ @8:  & (! @@ !D @` (* 㿘!!D     !D @!00 @!D"@@#T!D  "`㿐!D+4%a(T"@b  @ 8`b  3` !!D`< "!D "`<!D < !D" T!@!P@^`T" @ !D" <!D`<`@!p!D`<@!@} !`-%D8 !T"@ "8@D2 `8@, $`8"#DaT`8@@uaT2 @2`@@< D "`8!D8 !T"@"8!T'"@Da(84@ "@  "8?# D2 H2 HD#`Ha02`0!@` '@D`8`@5a!L' @Da(a 8@㿀!!D@@!!D` X`o%D)!( C! !@ܐ@@D@!@`,D@@i D `@b!p@ "DD!(`6  "`"@ @ِ"D`$@ 0"@ΐ" @(@D` @"@"` D @ 2@D "@"D "" " %@"@!h@ !!D `@ !p@r!T !D""(b4@T @|x+ `%D'!!(4"@D!T"@ D!D "@z#T`` 2D`< 2D@ ,` @K!@, D`," <D` ,D@!( @&"x@4 D@@ D `@!p@ "@" D `@!p@D R"``8 !T"@ "8@D2 `8@Đ, $`8"#DaT`8@D@aT2 @D4  `8@y< $`8D`  !(@ `8 "  "`8  D??  !( @$?' C  D7//   D` 2?`0#42`H2`H2`H!@ '@U@" '@!(DcT8@d` @8"㿐!@#a0`' @-`@{"!L '@㷐 / (@M'D %@G @!)$@ !T $ a!$@ b  $ D  @&& ! $@ $ D"&  @ 2 ?!T ?"@ $ `D!8!,@8?D!,  @̐"D 퀢!+"f!,"fD *`@!!@ D* A!@ D* BD@* C!@D"D2H2J"L"P"T"X `\@ؒ`㷐 / (@ؐ'D %@Ґ @!)$@ !T $ a!$@ b D$ `  D! 4! $@ $ D ``2 "&  @& ! $@$  @ 2 ?!T ?"@ $ `D!8!,@?D!,  @K#D 퀢!+"f!,"fD *`@!!@ D* A!@ D* BD* CD2H,?"D 2J L@X !@"L!@D" P" T" X ` \@L`㷐 / (@L#aD %@F @!#@ ! $ ! 4 #@ $ !T ! #@$耢 aD#a$!aD!,@L!8?aD!,  @#0aD 퀢!+"f!,"faD *`@@ aD* A@ aD* BaD* CaD@2 H ,2 J" D" L" P" T" X ` \@`㿘 $ " (@5 (  @5 ,  4  8@5   , @4㿘#ab0 @#`b0@m%@Lb0D " @.  D "b0@# b0@U%  b0R @b0@ b0  @Ք  b0R @b0@ɲp`2  0!A"( `$"($"( 0 %a0 2@C#`0@}cx 02  "0@}c!@0c@}  @Y@0@}~c (0@}wc $0@}pc ,0c@}h .` 4 p 8  0 @ `@}R``.`@# !a` #\l#` #d "0@}:@# `Hl#\ #`#d "0@}'@# `pl#\ #`#d "0@}"0@}`@"0㿈`'쐆`" @' '@ @'@E @X  @T쀢`@M@w'@F @B!H@V㿐!!D d&"& @56 d!D"f!D& 2@h @O !Df"@!D& 2!D@Y !D#&!" !@``@!@ Xa@ა?@B a@ѐ`@3`a@Ȑ``a @Ô㷸- 0`' @R@@a(`< G `@@C`<'ؔ @=ؒ @7#@@ - @)@i@a8a 2 `( @ @#@@   @@HaH@f`(a`@_`$ap@X  )!T Q `4H-` " !T J  !0H`D@   p!@ʒa!TȔ @Ð!T`8@@   p!@a!T`8@!T@@@,@  `4 `8 p @!   @  @`` H` @a@Ԕ @4!ȁ㿀`(''耢 '@'`$  @'耦 @ ' D@  @'' ,``4   ``'@F "aP@@ @(4@ `(@ @ `$@ @ @@ `8@!H@㿈@F "aP ' '@k  @}1!H@@DZ !H@ `@! @"!H@ 㿈@F aTDb$ "P'@' " @쀢  "0@| '@"@@s@㿘@V#aD &  D&@F  aDD&J =aD &  aD- f "f@1d`2 @2  aD@1&aD"f"X@/"faD"&"&aD&" @@@ @0 #aD- f"@aD&  @"  `$``2 "@ @*NaD@f@@ߐ@`@]㿘%D&  D&@17D&"!D`& DD"& 2 H-2* _* H* 㿘!, "    "c"@ڒ ?! @"! #䀢?@@ #@= #@: @#?$#㿘 4.` 8 @  @`6"D.` @{ % p@# $@k !  p@" @ 2 #`@y$@0 #@p #㿘N .  = L .4 .`.`??     !$       _ - _2 _ 2 #@0  2L 㿐  N.     2 *:    N " @Bޒ "  㿘1A"0% `@Ő#@ `   @J     @@2 "$  @@$@ " ' $ ` \2 ,@ \,@ `,@`` @* 4,@@ 1 0"0㿐@? @ @k 8@>#0?2@b#8!@!  H@ܒ`#@ #@ #@ @#@ؐ 7' @Ô?? @8 @; X    @e h' #'@`h _  @Č @ pȐ@A $`h @i0 a@?@ 2@ @ ؐ @0 '@ 0 a@?@ ܀  ` `@ې в``!@ @ic  @̐ @/&@R !@ @iS  @! @1!0phxL0DX8HXhx$,XXXXXXLXXXXXXXXXXXXXXXXXXXXX,XXXlXXXXXXXXXXX㿐9 @ _#T"@ " <"@" "@!" """""(!,"@!@"$"@"@"@ "@ "@ "@@*T"@   * T`"   * T`#  *@T "  *@T "   * T`#   ( #ؔ" @EaX @ ?@-@ @[!t`?㿐! @ ##@EaX @ ? ! @~ @ !`@@[~㿐@ >`%*`!< !T@Zl0!!T@U!T*`(" !!T@I!T*`( " !!T@<!T*`( " !!T@/w!T*`( r" !Tb  @C 0h!@@0c#aT!! @aT"Y"@!!T# @!!T@@0L!Tb !Tb!Tb!Tb!T b!Tb!Tb @0&@OaTb$" @0@Ւ 0@ђ 0@30@ !@@  ;@ !@㿐@ ~ ! @ Ӓ> .@ @ ) @ `:@ `: 'a2@ @  "@0 " !!@ b @㿐 @ !!!? ("H   p,  @A 2 !.@ !@ p ,"ۤ ; 0@ ,"`0 @ '"0"@ #@k 㿐@ T!""!@@   @ E { "@ @L0@ "0@ [? }@ )`@ # {@ "@,0@+(4 2 @ .# @c(40 * .`@$0Đ@ ,?h }@qĐ@ !@ `T0a)!D\" !D "   @+Ȓ @&@ X  !D$"` /` `!D` $/"` 'D'!(  D @ @@ "  D D@ _#00 "@" D"㿐@ >`I*`! `0 D&`0@ z!3@ :"0 a@@  3a@#P@ .`@v,`@ʐ /0$`,@Q 0(@%&`(@!&`$@&`@&` @&`@`40@ #x@K@ 8 ;@ "@Ah- '@ (̠ !  !!?  @ ߐ# ;"?@$?  p, @̀ 2@ Ɛ#0ؐ p ,* : `2"@*` $@" @ !@̔  $̐@  @9؀ ؒܠ $@{@ !" @  @ ;"?@ Ő?̔ @  @ !̔ @ є @ !̔ @  @ !!!?2 @ A X ;"f?@ b?@?`p @?`x ̐ /@?w` @?q` /@  ۀ ; L@@  0$`L@` @`AK?@ @L@`A ,"< ; ! #`@ #0 @ @ 6?@)@ $ @ 5  @`&@ @, 㿐@   2 @ !@ 02 ,( ;@!2@@)q  @ !0@ @d$$&@@Βڤ ;@ "@ Ԑp% 'ؐ@ # *@)A  2@ ʐ!p @ !Tb0 $" @ ,؀ ;@ _"@   @,!@ S!X@ 㿐@D@ @ !`:`  21@%@`@  2)@`  @@2`P *`@* @@  @`@ D 2@@(! 2`@ i!`@c @" D@`2`!@`D !@ V`@@u@Eia  <㿈#a@ a@@ A!a@ T a""<@  X@a@"@ 1`X !( @  1 @"Xab8$"b8 "@ @4*`" *  * ?a@ " (?2a@@ "8a@  ( c''77@v @=!(?@ #"#@ "#@"X  a@` `T  `(?@   a@ a"< aaz""<8' '@ג$`#a@@ @I@ؐha@L`@p"L  a@`H "`L $"@` '@  @@ʖ @*"p%  ' @ݔ ?@i"В  @ @b0a@U? `A A`7 a@H?@Ӑ ?@ϐ @ː  @*"ЁH'  ' @ @'"В  @[ @b0a@ "@ A A %@ H   (@= @b0 a6@ @  "`H  @w @s  @*G#㿘aX  "   2"aX ab8  "b8"@') 2$ @# $ X`$ `  $"X"  4$  2"$X @`"a`2 @ "X`a8"@ 8h%  ' @ @l"Ȓ  (@~ @a0 a6@X?@  @ߐ  @   @)#Hp'  ' @  @4#`А@9Ӓ  @a0a@!?2@ @)#xX%  '` 2@{ @4 6 #@ @#`a@  Dbl@  a@#`@ @)H#㿐#a@  ('" ,  @A ?2@͐#  @0 ?2a@@ a@" 0㿀 '!!@"(bq@ 6@ (  !@@ H!@#  (bp@䀢 6!@@ !@by (@䀢 6!@@ !@ (bf@~ @~ !@ @%"8!@ "`4`8@q! !@  t`"<"@ D"`D''(% g@Z 6 @Z!0  x  <#@''#"<!@w (@A 6!@@A!X!@ (bv@5 @6!P% `'?'#@֒#aDf```@#\@aD'@''` '!@ ,@ה   @};!@  ''''0@ω ?@! @(M!㿀 #a@<@@a@8(@ 4 fa@  ?"`@"`<a@`@`<" 8`4U"`< @ @~a@< @ @ E"<@` ??"< "<4@ϔ a@a@/ < @ " <# ' <@ 4 a@< "<" e'!!D %@| @a@`<!D`4 @@~@ a@<   ?"< <   ?"< # @@@@@@@@@@@@@@l@@@@@@@@@@@@@@@@@@@@@@ @@@@@@X@@@0@$ԝ㿘@U@``O` `@  p*` @!@!B *` 2 @&`   p@Ґ!@}.& @ @&` 2  p@"@}@}&.@% $`@@ ` @* ` 㿘@7A`?b@@}Ŕ     @`* @@` ` ..@@}@  ݴ .h `;a' ? b@' "H@V  ,`p .  [ jp .   @+ @?* : `3=Ð#,*` +;  @ `  @J   &@  x t+?+` : *?ѐ t+ +?` ` `p` @ "@&`p .   J @ p.  "@`p` @ @"p쀥@@  p.  &@"@’ @5! p. @,&@ݐ#&  b@ @ΐ  ?* : `6*`Ð"P  > "- : `   @J    @@2 "$ 8@ @\$ " ' $ ` \2 - \-  -  @*  "- a-@'@I̒@]Քx$S@@@@ g?e$@@* : @* 2 H@ R?P$+L H H P@ z=?:$0 #X#`@]*$0J@#h@֐$`@  : -  @8А - ' b@@#"   @%##h-D @ `` @#0!@  ː @k \ ƨ (@yؐb@!,@kה  #!0$Т      `   lx @#` @ "  00 c!8c H `` @  `)D D , 2%   @{j@@x @ @{Y@ 0@y !T"0@ @{EȒ` @{@@r   @{7@w @@W @` Ȓ@{" Ā ,   " @"?  , 㿘 H5739&h&&al d"""a`**H'!t㿘   ? & @O   &@Oאc 2("c` `"H@ ""al"` ` "#"*􀢠Pa`*?a`*@ " 㿘<?       - "!p"a\@Ӓ0G?       "!p"a\@02@"!p"a\" *@'+ ""{ ?       # "@\ "!p"a\@\㿘c#!p !`"!d"#!p"!\  #ca`"ad # $㿘)#  %p'\#$c!$"gp%#c !l"!d\$p"$c$\$" # &#㿘 ? 㿘  #* %%`@] X%#* `\`" %2@H p%#"c *!㿘#,c  ː x     D  c@g  "cc* %%2@ %#"c *!㿘!,#! -_      @1  "c    D "! #* %%2@̐ а%#*"c @ 㿘@@5 㿘Ȑ`# "@  2 㿘!'H'L'P'T'X @u$1 $H@?3  c@Ϗ ! # " @|А  @Ȑ c @Ô #  @v"@{ 㿘!'H'L'P'T'X @G$1$H @?  c@a  #  @|  @ c @  㿘!'H'L'P'T'X @$1$H @>ݐ  c@9  #  @|z  @r c @m  㿘@x" %`N m`@?ې@? :&@(. *` 2ݑ: .h#'H'L'P'T'X`ʒ$!p!ah`$@  H$@>~`! #@ڔ`1!d#@Ր 3a\P c @˖ ^ # "`'@|  !d!#'̢  ?@|'a\'?P    c ''''  @ђ "at x# `'@' @@x ` 'ؐ `  @ * ؖ @x  ` @!8# x# `@'  @'ؐ@w ` 6  `  @ 2@*   'ؒ@wؔ ` @!# 㿘@2  @gҒ``?㿐    c'@  @Y 1 c@Y  1      @ ?8" *@  ? @ (8"?(㿈  @wv  @u{ !@ ` `@wh @ @um @(7@w\ @ &@x<*@ * @\@'   7///''777  @7 @w2 @ *  D&@7ؕ2777ސ ~ z@7ސ @w @ &@㿈@w @w   .. 㿘%  ` , $Pk 1!  ]&!@ 4]?!#&!P$` !&% @  @ $ 1!$ :&!$@ 4:?!$  $ -&!$   `  6    #a $a 1! &!@c 4?! Ha&!$a? 6㿐@v} 㿐@vu  g( 3f+gf# g( 3f+gSf#㿐'@vV 㿐'@vN 3f g2`* *#3f g2`* *#㿐  } {`0 ; ` ` Ғ0Β?ޠ㿐Œ ; "(̐ 㿐!u"@ @8 "`ڐ @ 㿘 &@`  .@L 㿐! "  !%!00  .` .@  .@.`8"0`` :@%   d ;%"m㿐W!"_0 @; 㿐` X" @6( ` Z-*!  ! @@ `@`@ ڐ# 㿘L@ -  `2-L@L@ 02( L`x !`      `# /"#8' L@ `` ? @ /??Ѐ@\L@` *  *   ' 0"## #h### ###۔      %. 0!q 00,      .c2`0O0`V!  ( ;" [  @-'C!  H ;" H @-Ā'l'ܐ8'ܐ, /  ` ;" 1 ! ܐ ;"԰ !а @-Đ?'ؐ / Ȑ ;"   !  ؀ ;"  @-'Ԑ!  ;"  @-'АҒ : ! ;" א ’! !@ ;"z ǐv @-j'̐ : o!` ;"g c ! _! ;"W S @-G''' ;K"(B ܰ. * *  ,ؑ: `  `?Ԁ`Ȓ !P*`   ?. *  . "*  . "*   ?. *  . "*  . "* 㿘 @  P!@ &@F!& 㿘   (6! @s_ & 㿘` @ #" ` @ ?` @`@ @" ?!Ѐ? ?`` " ?!?ڀ?"@V@@T㿘@ ?@ ?" ??@ @ #?ѐ"@07 'Ҕ  b  < 7 "P @ "P``@`  "p    @ ~"P``@<  r"pz @@@,(4(@Y"Pa(4] hD `F"P``@  :"pB ;    `#"P``@  "p    `"P``@  "p     "P $@&@`  2 ΐ"P @` $@Đ"p@Ҩ ''匐@@@    @ ' "P'  ?= 2!J F ["x @ߐ"㿘@C,ClClClClClClClC4ClC<ClCHCdX   b'J -'H  "x@qڒb       %x %!/ ;795 * H@€a   `x  @  @H@"??℀@@  @8u b@[ @ϐb@J .@O  x@@l bx b @ǥ "`"@Dž  bȒ @ǔ "@y c @0` @ @皒 ?2 c8@ @x  @u #H@ ?X?@?R ?!@{#P?@#`@?2#P@#h#P@˒ ?2 @#p @: @7@4  $@@p Ĕ`'Ē @   #xc@{#H@ @ x`? 2 ?2  2?@?' @b6 ?@* ? @J`@괐c$ @ `@@  @,  ?@  ? @,` 0@Ų@ @ ?Ȓ#0@n 㿘!x ꀢb #0@ c@`g"@ 㿘@    '"b""'|)'|# / o"ܒ@\@P@Wa? ?* & @ @A@`@' |`a@ ?`' ''|ᘒ@ "@ " - "0 "0 !!!@@7b  @@> 㿘 b8@_"@6 㿐@2 ' @˒ @ `@Ӑ㿐 # @ɒbh "L " n L  o  @A8 = ",@``"@+H 2  . @ @ @`""bp@  2 &*@ &"`b@g `"(&@ "$&@@"@/ڔ # 2&@@`"2 &@bȔ@@  㿘@ 㿘!'{  ᨐ ᨀ "a  @"  !  <@- 6 @> S") !  = # a $a% " @) 2a@>o @ Ր"a? $a! !̀  @ !̀ 4 @E 0 %!?$ $a! !̀  @ !̀ @0 !! ! @  @>7 #@  0 >  B!<*!㿘@ΐ   @> @ "H N 2 #&@+# )!  !!@.  @> "@!:%!! @ !??:!@= #0@ L @v0 !<@ $! <`Ba !@ #!"3a! "@," "@"#a:a `?""a! "  "`"@"a? #a1 !̀  @ !̀  @+  !㿘! """cX @N!@n!? @CAcp "a?@@=!@#x? 㿘1! "@B   @= !@o# ?&!@1!  :!"a 㿘! @A @!@ː㿘 b!@   a"a" !*    a*@ *@ ᤀ  @a *@`㿘#bJ  @#9?@ bJ@`$b@!")"#4$  "쀢 `    @7 `?#@ #@ 㿐  "@m*cȀ @  Ű?##@?0#@ + %c @ʔ &?0    a` ?2` @+!@` '"ԐJ?  `&?ʀ` "@lcȀ } "@l֒c 􀤠 O!@ ) !  = # a $a' " @ 2a@; @T a? $a! !̀  @ !̀ D?@Đ @?%!?$ᨀ $a! !̀  @z !̀ ! @ ! !@l&!!$"L @  & @  &  c@- "  "J @ L 㿘')"  9%# a`$a@;,  2a@; @ a? $a! !̀  @" !̀ !?@W ?%"?$ $a! !̀  @  !̀ @B "*`"`$ⰰ  *b 6"b* 2  bb  #bb   #b "  * " ⸄"⸅("@ *``"㿘! !#`b$!""#"@#b!$b? $!! !̀  @ !̀ @ 㿘N !` @ސ @@)Ӓ`  2@: (@. 6N'? ! @m   !@?   @: @@ ?0!Ȁ  X ` "@['#&㿘b+-bȒ@ 쀠 /`?%㤤  %bP%a`"M&a a? I&a1 !̀  @ !̀ }?@I y?@$㤐 @Ŕ a? +&a1 !̀  @ !̀ _?@+ [?a? &a3 à  @ à "@ @H 3 ??     h@'bbȀ 쀢      @b쀢 "Ȁ "   "b"b a`"  " 㿘b @ +   @@ s+ o-̤  ?+# a $abĠ "@m 2a@9 @ a? $a! !̀  @T !̀ ?@ ?%̐?%bĀ $a! !̀  @? !̀ @t "ē,*` "b!   ? % @>   %@>ː    +b̔  = # a $a%" @ 2a@9G @ a? >$a! !̀  @ !̀ L?@ H?%b̐?$Ā $a! !̀  @Ӑ !̀  @   "*  @ 0 @"  @9 @l ? "Đ *@ "bȰ "*b쀢 "Ȁ  2?㿘N !`@ @@'`2@8Ԑ Ȓ@1 6N*? ! @   !@=   @8 @?0!Ȁ  X ` "@Y;&  㿘`( @% "@ `"쀢 "Ȁ  *@ @ 6@?`@㿘" N@@  @8b @Ȑ!?` 㿘)"J ""`@e ?&"&- @ > %  $' b"@ 2@8+ @ ? I$! !̀  @̐ !̀ Ӱ @ ϰ $ᰐ?% $! !̀  @ !̀ ! @ ! "!@hc! ` *?  `*?@ & /ԐJ? @E! @ ?) !+  %!a "@} 2!@7Ð @) !? %!! !̀  @d !̀ k @ g %a?% %!! !̀  @O !̀ ) @ ) !@g!@ ! < # a $a" !@/ 2a@7u @ې a? $a! !̀  @ !̀  @K  %?%! $a! !̀  @ !̀ !@6 !*&!㿘  !    `? "`@<    "@<![)"  ? # a' Ԡ $a" @ɐ 2a@7 @u a? ^$a! !̀  @ !̀ m?@ i?%"?$Ԁ $a! !̀  @ !̀ @А "ԓ,*`  "b쀤 !  ""*@"?"    " @  @ؐ! @6!0@"!8   a` ?2` @& !""?   a` ?2` @%!Z "*"""㿘 @?!P "    "  !X@bP   ^*`: \    "P`?"``ր "P0L # `   P` \?"``P*  "P@ \NbP@ \N`/ 5@8H` )` ` bP "apJ@#   `  bP* #bP @ ap"J@ @gbP`  "P2  0`"@  "P*  #"P @^ ` 2  0@CbP`  "P 82  0`"@  "P*  #"P @;  ` 82  0@bP`  "P  0`"@  "P*  #"P @ '   0@bP     "P`N?"`` "P*  #"P@ N@ݒbP     P`?"`P * "P@ِ 0bP@  }dddddddddddddddddddddd}dddhdddd}}h          dddddddddddddddddddddddddddddddddd}Ddl\ <T, H(l\㿘 #@F^!'('D'H@e!H"c@h `  H@J? r`? #"!  x p 0  0""# "a "@Ta0 H" @T"@6 HD@?ـ s H* 'HD" 'DD HJ -D  `"!"H 'HD?'D@cՐ ! $!А @]   <      @ @  $!@"P@  @c c @~ a @~  @~ a|@~ @~#p   !@bV!J   "!D 'HJ !H@ H   !Ѐ HJ !$ H @!@E  D   !@ŒbHJ 2 ! !Ѐ     !   "b@T*# ! "P@@aF ??"Ѐ 6 !Ȁ 2 "@!ڐ" !Ѐ   ! "0"H#  @Sd     a` ?2` @"!""?Q "Ԑ@J? "P    a` ?2` @"!?@z""蠒 ?@ & ? #@ ???B 2?  b"@!j" !Ѐ [  ! 278 !Ѐ  ! "0"H#  "@Su0! """H  "@Sgې  !@ݒb !Ѐ &  ! "0"H#  "@SK  㿘%!#1$b$"&## "$"$b&#J`,`;2 `;#"$@ "b܀ 4  "b# #""؀ ?㿘# J@ `"J     "!"J`Uܐ!*` " $"J@ `"J     J     @#1  @$<#@|"h`-`^2{ y&   `    `-`^2 e? \""@#  $<#UO"h J"䀤`. 7$"I# A@`/ @v`? ;"J@@w `t$"䀣 -"`$"J``@$"䰒 h *? "䀤`;ܒ` $""# "c""䀢 ?" "?> 㿘   J@ `"J     !"J `p$"ܐ"*`  "J`n" `p`l   2  $" $" $" "J ` $"ǐ""耢 @@ # #c@  "J`n" `p`l   2  $" $" $" "J ` $"""耢 @~"@ <c &?@ c ?#c@} w "J`n" `p`l   2  $" $" $" "J ` $"S""耢 @?"@ c Fc b􀢀  `2=$c0;"Ѐ  !Ȁ "3?"܀ )""J     "@v  "J`n" `p`l   2  $" $" $" "J ` $"""@   &?@Y &?. 6L@߰?  ! !ؒ@B% L@  @ J!؀ 2*`ǐ"*`  !s &?@?  " \""``"܀ ""J     "@ "?L@ ! ""J`n" `p`l   2  $" $" $" "J ` $"l"L@  !ؒ@A  @ !@0`#b耢 "V#"@X  Rg G  GG V $ "J`n" `p`l   2  $" $" $" "J ` $""b`$b. "܀  " "J`n" `p`l   2  $" $" $" "J ` 6$"""܀ " "J`n" `p`l   2  $" $" $" "J ` $""  " " #J#  "@OȒb0#c  ""J`n" `p`l   2  $" $" $" "J ` $"""耢 c@nc@?k #@w  q "J`n" `p`l   2  $" $" $" "J ` $"M""耢 @9"# B@  0 "J `$"0" "J`n" `p`l   2  $" $" $" "J ` $" "@ B #@  "J`n" `p`l   2  $" $" $" "J ` $"ސ""ؔ @ c ذ ְ?#@Ԓ +#bc "܀ c"6%b" $c@ #H "J`n" `p`l   2  $" $" $" "J ` $"""耢 @u@ 5s #@ y "J`n" `p`l   2  $" $" $" "J ` $"U""ؔ @ Zc O M?#@K E "J`n" `p`l   2  $" $" $" "J ` $"!""ؔ @ &c  ?"܀ " "J`n" `p`l   2  $" $" $" "J ` $""##   "܀ 2"@ ""@"܀ ֐" "J`n"  `p`l 2 $"䀢"J ` $"""Ѐ ? !Ȁ q0"J     2""܀ ""#@  "J`n" `p`l   2  $" $" $" "J ` $"o""耢 ! @[L!؀  !L@ ! @> L@  @L!؀ 2*`R"*`  !# &H?F"@B ?"b"J DbJg"  p "509/0+ 0r 0%"b% "b! "b@b <# "h """ """  "쀢 #` ""'J@  # J` 2aې#a)  "쀤$a"@  "a? $a! !̀  @  !̀ ?@ , ?  @U@"  "b%"a? $a! !̀  @ ֐ !̀ @   !  "@ Vb !"耢  b b ?`"b b "b b  ?"bJ n"  p l  2 " `"`"`""$䀥#@X R J`n" `p`l   2  $ $ $ J ` $.""耢  @  "b@  #@! +#bc "܀  c"6%b"$c "J`n" `p`l   2  $" $" $" "J ` $"ߐ""耢 @@!ɀ "܀ ͐" "J`n" `p`l   2  $" $" $" "J ` $""@ "JqQ2J $"?"J     "@ "܀  " "#"b"@{  &v? "J`n" `p`l   2  $" $" $" "J ` $"P"! L!؀  !L@ ! @< L@  @L!؀ 2*`9"*`  !؀W##" cƒ $"@"""Ѐ  !Ȁ q?"܀  " "J`n"  `p`l 2 $"䀢"J ` $""## "@` " ?ϐ " @h  @<#@  "h ""ʰ?"" "J`n" `p`l   2  $" $" $" "J ` $""##" @&@  ? "J`n" `p`l   2  $" $" $" "J ` $"k""܀ #"@Ӟ#0`"܀ W"@Z T "J`n" `p`l   2  $" $" $" "J ` $"0"""@g`"@  !Ȁ "@\#0# "@` # @  ?#"#0?㿘"܀ """c"#@ 4 `"􀢀 Ӑ"?㿘'6?4?` "   ?" 멐Ꝣ "쀢 ` m   @  㤀Հ`#?㿐"J D J@ `"J     !"J   ! $"J@ !`@t$"䀢 ' ""@ң`d" #K\ %  4;'1 !"`# &!b@ 2!@(͐ 3 !? &!! !̀  @n !̀ 6 @ 2 $?$b &!! !̀  @Y !̀ "'@ ' bb " * #b`'"J 2 ! "*@@"  "㿐 !Ā ' # ) %"?'   = # a $a% " @ 2a@(Y  a? $a! !̀  @ !̀ ?@/ ?$?$ $a! !̀  @ !̀  @  #  !j*@J@ !Y %) # >% # a  $a" @Ɛ 2a@(  r a? $a! !̀  @ !̀ ?@ ?%#?$ $a! !̀  @ !̀ @͐  *J@` \"` @*" M+ c > # a $a) 򀤢"#@n 2a@'  a? ;$a! !̀  @U !̀ ??@ ;?%c?%# $a! !̀  @@ !̀ @u  # @`*"- "J  ) 8"+ c =# a  $a% " @ 2a@'\  a? $a! !̀  @ !̀ ?@2 ?%c?$ $a! !̀  @ !̀ @ "  #*@ "   _ !J!؀ @D @[;) # >'# a  $a% " @ 2a@& e a? $a! !̀  @ !̀ ?@Ր ?%#?$ $a! !̀  @ !̀ @ ?? ' #*@ ??'b "bbJ b)# A # a $a%" @^ 2a@&   a? +$a! !̀  @E !̀ /?@z +?"?0&%#?$ $a! !̀  @, !̀  @a  #!"@Vؔ"""*@N ! % 㿘"#' "耢 " ?Ԑ J?       a` ?2` @! t r?N "m J@` ""@  # N . aN  aY a $a a? $a! !̀  @ !̀ @?@ <?_#$# @ i a? $a! !̀  @ !̀ ?@ΐ ?a? "Ѐ |$a! !̀  @ !̀ r@ n㿘"`@   @U)  -` >) %  # $" @Q 2@%  ? $! !̀  @8 !̀ ?@m ?%?%# $! !̀  @# !̀ " @X  #`@Uϐ`@@)! =# a  $a% " @ 2a@%K  a? 3$a! !̀  @ !̀ d?@! `?%!?$ $a! !̀  @א !̀ @  # PcP* * @D ! <?!?c`#$c$! c @s !!? $!! !̀  @ !̀ ?@ؐ ?? "Ѐ $!! !̀  @ !̀  @  㿘#%@  -ؠ? +  + a`  %acS"c @     @ a? %a! !̀  @A !̀ O?@v K?؀ ސڐא@#$@" " $$$#" ""耢 a@ a? "Ѐ %a! !̀  @ !̀  @,  㿘!"暦 "ؤc " "cW` U`& "P` F1 !`@&&! !I$# @ !? &!! !̀  @ !̀ +?@ '?!? "Ѐ &!! !̀  @ !̀ @А  #<  ` 㿘%  $ @; )? $! !̀  @k !̀ 9?@ 5?"`@   ? "耢 "T"&@?$" $` %""#"Ѐ`$! !̀  @7 !̀  @l  㿘 "%?"`@ ː@" 仐 `"#  ͖ &?@@ 㿘  `    X?* # 2"c "c" 㿘?       ?#*`^  X? *`""``㿘@     ":@" R  㿘"  N \2 `?㿘) # < # a"`% $a @} 2a@"Ð ) a? $a! !̀  @d !̀ 0 @ , %#?$ $a! !̀  @O !̀  @    N \   *  *  㿘@ŭ !   ̔? * @"@@Ŝ"㿘@Ŗ !   ̔? * @"@B@Ņ"㾐   'aԀ  Q  ̒? #b* * %"! p #O  #`J@ /@3  `x@ǔ b#3 @nr 㿘 !Ԁ  @nj ?̒ *@* "̐#p@l?㿐@2? ̐ **@"`h @l)  ` ""` ""@"㿘 !Ā " N ! `@R @# /  4  㿘J@  1  `"J`   !  @ : @ 5 @@5 ! .  @`  " @  @@   $ @@!   0 ! "b @@  @  @ @xM!' @@ $ @㿘+b:  [ \  L@r    ` L Z L@ ` * b) $ H =# a  $a' " D@ 2a@!> 줐 a? 6$a! !̀  ߐ !̀ 3  / % H?$D $a# à  ʐ à 1  1 b@Qw D D*b쀢  %b D!k  D - J^" J]! 2 J `.`:`=2  J ]   J]2J 2J J] [J] 㿘&@&#bJ b"#4 @6 b/?J` @' b $bb @ϐ  @  @<#@$&@!&@ ?*:  g2 `$b & 㿘 "J % J+ : @!#`"ѐ!0##"y+ J= @s'㬔` &! !%  $!" @ r!$㬐?$ $!! !̀   !̀  " c* *:`#"䀢` `J `\/ c**@: #"䀢 $`"耢  0    a` ?2` @`!   "Ԑ@J?  `P "= J ''㬔` =! !  $!%" @ 2!@Ր ;!P!? $!! !̀  v !̀    $㬐?$ $!! !̀  a !̀  #"c*#㿘/-"@  v !#` $#@ &~?_#  j% #`$R ? Z$! !̀   !̀ [?N W?#$# @Ȕ ? 9$! !̀   !̀ :?- 6?? $! !̀   !̀  # `ؐ" @!  "#``ꁐ!` ?`# ? 㽸\   `3 "쀢 ` ' `@  @ :` Ȱ&@ @  `$-@ @% ) $# "@q 2@ !P? $! !̀  X !̀ ? ?%?%# $! !̀  C !̀ x "쀢 $ ᶖ #@N @В W$ɰ?-@ > %  $)"#@ 2@\ !P? $! !̀   !̀ ?2 ?%?%# $! !̀   !̀  "쀢  [ #@N$@ L@ 6&@)#@  = %  $'" @ 2@ i!P? 0$! !̀   !̀ E?ِ A?%#?$㰀 $! !̀   !̀  Đ    $@2 `6!p ?"쀢   !#@N$# !@*@! @*`@  㿘9/# M &D \` -`" .+%  c $" @? 2 @ !P?$%?%c $! !̀  ! !̀ @V @#`*@@P+ M 0K 9Jc?ЀG* @ - " - %  $+" c@ 2 @5 蛐!P?t$%?%c $! !̀  ѐ !̀ @ @;#`*@@1c & # a $a'"@ 7a%c?$㰀 $a! !̀   !̀ А # *@㼨 #% &8M'㸔 > # a $a%" @| 2a@ (!Pa?$a 2(?! !̀  b !̀ ? ?$㸐?$ $a! !̀  M !̀  #*㿘% # `T! X   Pd*@  *`@6$`T X$ P*` * "אX*@  P*` "ΐX* P@ *` &  $X@a ǐ!@Ȱ @ P$ P$`T㿈/ 79\㤀?"- `?) 箐!? X  "bޜ + a X %a`J?. *  P@ "@   @ 1 / P`` "`` !@`"@" ? `?"`"` "` " ``"``"   P ` " ?? X 2  : @+?. * !  P@ @L? X "* @ P*`  @L4 X"*  P* @L*  X 2  : ܰ?"耢 aa\?`&%\'"%` %a! !̀  O !̀    㿘 `X  `X P*` *  2 ``@ m@@@`X??"`X# b  " \"``# X㿘@/<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<$<0㾰a@HC "cغ    -#!'9%5 ') *$* @€          %cؐ $c$#@J $# $cܐ $ '#@]@?Ԑ? b* & @ @M#쀢  c؀  a@xd b`b@xY  c؀  2 @?"@ @}"c. @ l@,$#(dbP@x5  @N͐&d .  *l&d,`d$ &@@? @`?bh@|  <  -  ?@?% #쀢 2 @c؀  @ @֒ @@p <  2  c؀  #쀢 " @&@2㿘@ƛ / 2N  2  N /"?* N /2? (@>d   @{  -<3/7 "    0   @@Đ"x ;' 8 2 "$" @Jb "  J$`/h"L? / /,  `l$#  ,"@ а  @~˔$,l@0?<  H& 2D #`" D@ 2  lD@0 @2"@SlD`  @Д 0<    2 D"@8lx D @   @S @(@"@?X0@LR @`?Q ؀ 2#쀢`2 @#(@ @   l@n]a 7bhl@z  .@[ " bhl@z  D @ؒ`? ؀   @`? @ -@ɐp0  @3@ 2 @ 2<@*`cH@zs @<  " @<  `??㾸#` @t@ %cX@zC cĀ  @f@ &cX@z5  @G$@ @g 2D@F#` ` 5 #܀``@ʐl`2X`#܀`2S`#䀢`J ch"@9l `   a ? "@  !  $!! @А! ` `y !`? "`@ې  !  $!@!` `y`Yl@o  l$ l &@f2#`@ԒlV@zi     <   `?)(+@8Ā <   @k ? "?@'c`?#c`@žl  #@\@ Հ `8@y`<  @…#`  @n@n 06#`@ 2# `,#`@ @z `@#`8 o@a #`@Rl @nr@np #`@Gl 㻐   ' @iQ#?` #x, 3 @¾`l # `l`l@n #@  `#` @ D` @ #㿘` 3 @’`l  # @_`l #@`l  #` @( 㿘` 3 @p`l  # `l@`  #@ђ`l  #` @ 㿘 ! /& $# $#@nP#$  (#$  ,@nI $` @jX l  #@`l `  @   `0 `l@v[  `@ `#@`l   1& ` @ω 0 @`l #@t`l @` " L@  0 L@j`l @`- L  @T`l 㿘 !  @m. l   @` @? l 㿘! # "`(@7(b"b@7#``@m 㿘@Tt(t DL`txx " ?`#ؐ?'"`0' J g  ' `  ?#!)a8$ 4@F% $ 2  4  $ 4% $$ J@ u?J` n ? 4`  '$ 4% $?#@Fa@  @FaH "aX@sn @' #?c '@F!pc؀ '@c'' `@ex'  !"@ ?# #,`"@a@s@ !?#ܔ  @ex#' `??#@,`"``` `E!0*`  @'[ |?@J!x $#!?#bܒ@ J@ k $bܒa@s c `4 ^"`4`, Y"`, @'0 Q  4 ` "#`<E# 4B" 0 >"`0"ܔ$@'#6 a@r͐ ?."`?##b'J . ./' " b@&" b'4` "<"4`  "``( "`(@ې @ِ  $ `l* @@˜ ?i? "*  @ ?# " !&@&`  (  a@rp   @ ) <@ b0@r^ `0? 4`?"`0 @ݔ    @vB 3" &`8L -2 ` >`l @f@@f<@ 㿐?#@?* @ .`@2@ 6`@'@}  ? 㿘 H ? 2 @ L"@˯ $  $ H ?$   ?$ @`$ 㿘ݐ ڐ * Ր * А* 㿘  ƐbP @ p   e`bҐ`P`L&  `&* `&`P  & ??`?`` c@.@`~`P  & `2.@``l`P  & `"  H][`P  &  H  @ڰ? O"p "P"P! `  /'/ဦ`///666///瀦/䀦 2/  / P  /'&` ''@B @&'܀`  @_r? ?  @"`㿘`H$` d$`b!` `@}`L"@@ʬ $`  $`H$``@N ??@h"  6 %T`@@" $@`@ @Q  `$ P@G "+?@ `$@   $`H@7  @X $@  !`H  T` 2` ! T`@@D" `$@&㿘?4`c @@c@@ ? @ ? `  ?@@`?c@? @@rʒc* @!G?"P![@@`@`@`@`@`@`@`@`@` @` @` @` @` @`@`@ϲ`!?@r#@r#a L(7@@`@`@`@`@`@`@`@`@` @` @` @` @` @`@`@β`" !?@@`!?@r7#@r3#. @㿘?!? @TV#   @b@r##6`6 ? @#  @& & 8& #…8& 8& .  %   p    (``    00*```  0 㿘  1 㿘` `  G8@ * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * 6 @`"8@ * `@`6 @8`  `2`` 㿘  $ 㾘:;n # '  *`$``*xݐ`ʐ.6 > ː`.6 > ޒ))))))))Ttd#H$,%t&','(l())x))) ?$2"0    888 0 "L"""" " "(","0"8"<"l"P "? $  `4? <   ?(  8*" <" 8 㿘 N 12:?@ 5?2 (1? $  !$ ($ 0 , 2 ( !$ , (  0 0 `?$ $"` >` "` 8 ,"`$"`4?€ 0$ $㿘 ‒b  " X" L" T" P㿘 $ 4 2 ( $ *@ (  0 $ 4<  ( 2   $ * $ ($ 0$ ,  (&@@    4@;"@  (#$ 0 0" @8 4  @;t"@@   4@;m"@ ($ 0 0 ( $ 0$ 0 , (@@$ , 㿈  $`"Ӱ?  "ϰ? 2@  2ǰ?@ 2  $@   `8`< @`g#h*` `  $@"\&  @?*` * 4 @oƒ  :  64 `$  . * $`   $`& 8  $@ ¤ ",&  @?*` ?c4 4*`  , $`& 8   $@`   & & & &$`<$`8P   $`& 8 $@`"& `  $4 $@"&  @?*` $`4       4    #(&  $@4^ $ 4 "&  @?*`?c4  $`@   $@`@ 88 @:g`@%"$`@@&@*"&  @?*`  a$``4  $`d4  $`\4ak򀢠h $@$`h`h`\@0 "o&  @?*` `h*# `p*  2$`h4`\ `he0*# * `p2@ $`he0 $`L$`T$`l `p `l`T@Қb  &#(#(&  $@ $@$`h "(&  @?*``T * ?`L * @@7`@7 񀤀  "&  @?* `$4`h* `p2@  c$`h   "&  @?*`` $4`h ?* `p @ 4/! `"&  @?*`` $4  4"&  @?*`` $4  4`h```d@ n??" ```h`p* 2  ??$`h```d`h *o`T@ "@e0 $`L$`T$`l`lb`` `p`T@ i`` `l*``p$`P$`X`d@  @`X X  $@ "b&  @?*``T * ?`L * @@7`@7 * (7 7ꀥ ">&  @?*` *@ 2@  `L* @@7`7$ 4 $4$`@   $@ @ $@2  $`H$@`H` :`H "&  @?* ``H *@`@  $`@4$  $@ "&  @?*``X * ?`P * @@7`@7 (7 7ꀥ "&  @?*` *@ 2@  `P* @@7`7$ 4 $4 @ $`D $`H$@`H` :`H "&  @?* ``H *@`D  $`D4$`,`D"@i $@`u%`D"`0 `4`($ ""@`@8`@&8`@&@"$`@ @?.``@ 2@ $@`H  `C.$@ײ` 68  ":&  @?*` %@B > `$``&$`& 8?c4 4 *` ,` #(&  $@   $@ ?M?& & && $`8$`<`(  @ 8     $@3?  ' %  B@B > > ``` $` `M"@$`& 8` `<@@ " & 4`"?㿘 ? $` ,2`40 `" ,€ 0 ,  0€ $$ $㿘 ";? $ "7?   .?      ?   $? ( @ 4@75"@  ( $ , 4 "@7,$ , $   " ? $ " ? "?" "`0   0    ( @#㿐 N?`$ 2`0H 2 < B?   < 8 " * %% 8% < ;*  8  <2`?% 8 % < % h h@ h```@ @B "  %`%@=` h ?` `z  =`=`  % "? $ 2 ?   <`?㿘 `"\?`$ "X?`("T?`, 2`0N? 0  2 4E?   $ * `( `0  `0`,€?01@6a @3 @6\a0 L%0@ a,@zА" ?%0@$`L P:А" ?%0@$`P l:А" ?%0@$`l $ * 4@68$`4& $ P .ж6 @ Ѕ(`@`(@ 6  +`"@ 8 `Є @ // 70 0$00$%  +"@*  .@( S(.K`2?7  .@1  @(`@((6 12`@ (`    0n}!? (?    ?%(` ?(` &/7 /(/@7 `/7 ((&1(70 ( 6 26  ?  .( 6 8 @(@( @" "&@+  (. @  ( 4` (%< ,`(('80//7 #   /1(7 (06 26  ? ވ + $%     0(㿘@Z @Z@ 㿘@㿘@B;<`<`;<`;<<`<`<<`<<<<78\8\8\78\8\8\78\78\8\8\8\8\88\8\8\8\8\8\8\8\8\8\8\8\8\7878\8\8\8\8\8\88\8\88888\88x`@1  bJ o`?#`DJ g`?"LJ m`?# HJ? f`?"@? ''ܨ    ' # %37 0.* (@€ )  &  #   'ܒ ' `H b@+ ?J`-bJ bJ ? $b@@Zɐb&*  @@܀ ` a@a 2  @ @ 6`H@' @?А @"@X @`aH@d J`"'aH@` p @Xʔ耢 a`@`  8a'耢 9@ @?А &@y"@N  @o ""@k`ax@d J`"'ax@` 3 @^ 'ax@` ' `D  @@, :  @@& .  @@  @, @@ @@`@   @dl ? : * @€܀ `H@! `H *@0r  @oa @@`H c@   @\ @y0U@ R`H O`M@   DL "L DL "L D L@V 4/ `H  D@]@  ؀ " `H @ `  @X  0 @aՔ  ؀` @ᘲ @g 2v <@`a@cא @5㿐N "?@.=     ?@􀢠 `?a@_  㿐N ?@,     ?@􀢠" a@_ 㿘 H  @` "؀""! a@""#D"؀` "H"X! b@"{"`D ؐ"@"sb`@ 㿘@ɔ㿘@        *    "     " 㽐 L4 '"0"@$ƒ  B + B+ 3` @; 2* @ * < x`(4@W0@ -   = b<9 $,@@ "(  @1ː$@  @3 , @1", - @ 2         @Ґ"ȁ㿘 4@V (@ ,a8  4  ,4 (/  ,6+ @}@ 2$  $ `b@2@ܔ" ,`@6 "@. . .  ,   ,~B?< W$ ,  4  ,Q  M ,I @ $ ,  @ b !=< 9   3 /@/ * ,  ! # ""   < $b$ ,`<  b@2@{`@ 6  , `, p@"". `*41 2. 2 `)   `` `` `  `J@/`  &J@J@`?㿘@㻈  '@#"@ ǐ@"$@1` p@ "@#-`@ @,װ !`F\!T@ <    #<  ###@#q`"@#k` @ٓ# 㿘 @ ˤ x F\.`aT >`T  T   @Ӓ rc0@ Ք 0l   `x`F\!T@ <  "  <  2##  @#$#8@ 1 `x`F\!T@T  `x F\,aT:  + : " @F#H`,  J"``, 6 `,@6"@"#``, @-#x`, 2`x@,^#  `x F\aT T > " @ d4 㾈   '@3{  /`  `    " 67 4   $ 쀢` 4   2 , ,  ,  @/ ` @#㿘    @    ` $  2 , ,  X    ???????'@ѐ `x`F\T@ < `?"##@"U#@ b`,  J"``,x`F\!T@2     `, 2 @+#  @i#` G @ ! `   ''/'@ -$@"#`, 2 @+# !   @`  $ @   `, @1# @ `, $@%" h#@CxF\aT  <   ;<  3@! 0@+8 P 6   @  $) `  @   `@ 1#/b`ؐ /'ȡ- '`*`1:``2@    @! V@Ð@p   @!o @ (B ؓ.  ?82 !@>  @O@x F\aT   @ 4 `ؕ*  `2 @!J @!`ؓ.`  2 `,  @t"  @S!`  ? ??b?/'А'''???@z'@P  ' f pb``@^  ????ᤔ ???/'''''@S `x`F\T@ `aB * 2` @ 2 2* @ * >`` a  x F\aT "``aB * 2` @ 2 2* @ * >`@ E@(  $@.@@  @ ` @ֿ! 㽐  x `F'\!T@P  @D? Ҫ `̀ ˺x` 8ǰ `F\!T@ -`-` (  ;   p   @ x`F\!T@2    @x @-W`8: 2   (-``*`"" -` ()"  @ : C 0>  h8   @ 9& hF%\aT  p-`@`+` : x F\aT ړ-` p :x F\aT 0 @: C > x F\aT "00;   ;  B> x`F\!T@.`.` (@ : p `G %x` 8!  ` P@AG  %\F!T@2   x2   x2  x `0 F`L!Te\ e8e@   @@ @ @ x"@,x`0@ x@,|"``0# `@,o "`0   , x`F\!T@.`.` (@ : p @`G %x` 8!  ` P@A7G  %\F!T@2   x2   x2  x `0 F`L!Te\ e8e@   @@ @ @ 7x `@,  !0@ ,`"@P!H @(!X  @, Z  (.`-`"" .` (+"  @ : c 2>  h8   @ ;& hx F\aT  p.` -`@ :x F\aT ڗ.` p   ;x F\aT 0 @: c > x F\aT "00;   ;  b> x 8@,  ` @̐!`㿘 @F `    &@&` @ `x`F\T@ (: px` 4@ܒ   ? @+a ` `4@ # `@+S b`4  @  , x F\aT  @6 !x e\F!T؀2`@0g  @ ? @ L\ @@" "     ` @*    x e\ F!T؀. 2  ؓ-   2 @tx F\aT  6x`F\!T@2px`F\!T@2t@{@Tx F\aT "&p&x F\aT "&t&@d㿘@6 F\aT ?@P2@ڐ㿘 p` @N6  ?$, @_L 0?,@N$  #,㿘! Ѐ ?"@'$ Ё㺈  `$' 2&`$ &`0`x`F\!T@2  >`x`F\!T@< @@h@e(@1xx e(Fe\ !T : 8U x   8M x @Fx %(`x%\F!T@2  h : @3x`F\!T@@* x@*!x 0F\  !T::`@@BB F xaT X2e\e8 @  :@L@ C 8T @> @ &`( 8&`(%\@2 : "N`48@O: )>  @2.N`4 2@``&=`` @*$!p@@&:! 2.`@#`e\`0@N: > @! @6"``%\@2: N`4 >@`@ u ` ` xF 8T&`( 0*` * %\@ : @bx `07F: T @;9%\@2 2 N`4 @"N`4%\@2: >@`@U "7E 22 4 `2-`8`(@b>  @*$ap@*@%! 2@`%\T "  @b> @]! @"`  t` @@;  @d `     @&!ȁ㷀  M4' 2 '@   p'䀦 @(   ! x  0@&? 0` : t@@<  F@B@=Ζ x  `t:   @  x  `tF@B@= (!@N  x  t@ I@F!T.`9%\@2 ``,`  + @ $$@!`,  @h!`,`"@@)  %\@ ` : -` ` t@ Ǩ `(@&% @6y` x  F%\!T@ 2 ``` (M4@ @ ! %\F!T@: @`=! "<B`M4 264 218,@b: @(ْ$!p@@$p! 2@Y%\F!T "@b:@$! @k"``  f` @ `  ?%`  @!㿘% 2$ `(! ``2`@`@b:  @ 8   x `8 >; @ @  ;B  x@(  `x 8 :`@"@ڰ   :@<  =@?: @L- :  @ :`D @ D x2s @(p  @ =F 8@? @Lw- :  @ :`D @ D 2 @ (  `x  :@>  @LQ-  `: @ D @ 8D @G"0 @ :F@>ϔ  @L.-  `:  D 8 D "H@$F `@ F 8@>8426 2 `,x = @>;` @K- `: @ D @ 8D @"h @ F " @   㿘  p "@@ T + `x`x `x ?!`x    :`@I @>F @I * @K   D:` D @[@I x `* `ȤD  ?" 0@# $ x@IƐ @K~x%T`x F\aT x@Z  * x@Z  * 㿘! ` "! p +"@Βa- Px`)!༐ ฦ %! @I: @=ے`  @Ia* @K6   :`Da  D @Z@In x `*  d@:̐D !@ ! !  %ab! X@$ X" Px F\aT P !"P㿘 X "!"T"a V" x 8e<F`H e\T "! 22"!`x %)!@LM$@i\F!T@%!**"!  $!a ""X  @˜a %X@" 1!!`㿘! X "$ X@m$ X㿘 x 0F\  !T::`  @@=%`, p,Ԑ b@o " @x0,Ԑ c`@a ''"  #% !,ܒฐ m@T p&@ @ `l, X  ,`l X,`l , X "@ސ @qa`?? "*@  & @;  C @; `, C"4@; C@;    ?@@h`  @" ?a  '@^㿐@႒"J !@@(  `, ' Cb@;L `,@q ` `, @Ȑ!X@? `,`, @!h!"?"!@F?$"! (? @F?$ (  "!*`x `@֐!@A "@ΐ!@ː!@` `, J"`"@q!@"@`, @"(@>`, @"H@ `, @"p@ "`, @"@9x8 ; @8@ `F` ` d#\@@"6`.  .`@B2`* @ *`B2*@ *@5<$@6`.  @.`@:c3`+ 0 B+`@D4`, ,`4,@ <@5@  @6Ֆ ;`"#\@; `p? `@  b b ? ` #@" `+ -/l9 x,<8@ 8@7c  @ D4@ D ?:@Fz8 @ ; D  ; @7;` @ F b@ d : #0@ܔ` @Ր#H  '% p @ʔ  2 @Đxb0 @#b0  '% @ 2 @x%b0# %`耢  @ `x : :d0 +  4 xJ 0 `,6* + < @7;  @Dw, :  @ :`D @ d@4D `(  @ `,& ` *K"@T`x@6 @2'  @-"` cL@("@& "@"``耢 9`, @:# K" @.#@ "! @P `,`@@   '''@M   `, @  @oC      @ 0㿘 !,@C p@@   ` x`, X9 >: @6f @Cƒ. @ :  D @ :`D    @6O @6H   @C.   :  D :` D 4  <  @  * @D+@ ,@4`,&`x 4?H@E  : D4  <  @  * @D+@ ,@4  `x(?? /'?????`,#:`:"   "!􀦀^' pU 0a@C;E> @5̑;  @C,.  : @  D @ :`D @\2   x 8 "Ȕ  .  "@  2`(' p@D@􀥠`,& W"!㿐  'w `x`F\T@ < @`i x F%\aT Ub`(@  0 3bX@ ~ + ' @" U%\a ;cpp@ f ` cА@ ^     ! X@I@Ɛ x  xF\aT b8@- 0c@'!   ``T*@C"  x`0   @;:   :`  @4 B? x`F\!T@2  E  x > x 7 x F\aT  0 -   % @4 x`F\!T@2  &    `- x`F\!T@2  @ - :<`, $ <@2! x@  x x F\aT 4 :< x F\aT  !4 x 0F\  !T: :`@@4B @@4wB ? `&? `\- x`F\!T@2   @K-@@((@- x`F\!T@ x $` x z`8x x x;s x`F\!T@2h :@c`  x   \F# aTd" `(:   p@0  @@ "@  ` x`F\!T@2 * x`F\!T@2   В@< xF\aT  $h@( x`F\!T@  <E x e(Fe\ !T :8( x x    x x@ x e( :-e\F!T@2 h : . @) x`F\!T@2B*2B*2@  -    `t@@?   4+, ,  t`(F xaT`%\@2 :@  >`e\9:      `t@A   ., ,  Ԙ`XF xaT`%\@2 :@ `e\@@    @5  x ```%\B FT;``؀ . 2  x`F\!T@T  @ @  2@ Ő!(@B!H 2@ !X@ pa`"0"""0"@& x`F\!T@2  @ @@ @   @  *@O )$p3$t @  *@5` *`  * x`Fe\!T# $` ? ܐ`%\@$<#4 x F\aT $4  :`:h&`ɐ x  4`0@?:` &`0 e\FaT  : h:     xe  x ] x`F\!T@2h`0!h@ ,, @a!0$h@! @} x F\aT "`0`0 :<-!@  @  *@@r x  @  *@V xF\aT b8@Ԕ 0c@Δ!g @!ȁ㿘  ( / aؔ@` `B :`2  (` ( ( @ ! ,`@! @!H  @ِ !X@ Ka` ($+-/3)7 Ŕ  z , 4`  K@ `:  <   `B =  * ( d `h `B =`h  @ _" ,`@̐H N @ X@ a`@|  2@ <"(@H < @v X@ a` ̘`:# " "@""@  ̀@  `2@` 2@ ̀@2  0`2# ` " 0#  0`  D w& 0㿘 !,@>5 |@(@   `  )?Дx? 'Єx/?????)`,    "`x"􀤀 ,  `@6 +)x %`|%   ' @   & ` @  `,&&!㿘 (  ;5є  2 x/ +- ` ` X`x < : $`x`̀` 2 `̀ x@ D? ːt|`tH㿘 `@}`   㿘 `@m  @ߐP  '  ?`} )#*` €@ "@"   @K "@ bВ j!퀢 i @ "@ "@v#    U!퀢 T @ "@e# 2L @! "@ b@ ؐ#0@U#    4!퀢 3 @ ~"@D#P  @ "@ rb& `x F\!T /3`x F\aT  53    #X@ Q `  `  *`#!b.!(h@t !(bĐ  *,)# ?`0:?  "/' ?????؀$`F xaT31  `%`!a 晒cx"$ @А#P X `%\@   ; I ; B $@ J"` c#@ )"# +;  ;<` #Ȓ#@ %"#`, @Z# `,! >`$ @ q `%\@  ;  @!`e\7`%\@  <` +` ,+``( " %\@+` ( @`p@ <`  @*`` F aT `X`Ж \+`+`  <`` ' "'Ф*C)#&􀤀K%+)'1/`  :$`  "7  2?0    $ @cP %  r  ؓ*` ?2  幔 @cP   ؗ*  3  ؕ* ?3    9$ *!(&đ* @  `"   "  $  $ " * ` @^ @x $    `'" 0  p    @ 2 , 0 2 0 (! H@\ 2#     A`P $@x#P "  `"e 0  ` -`p T, %`  `' // / H@,!  ?  `@  @2 0 6, @ ( 0 "7@7@ 0`& 0  ؕ* ?2 @4@#P "  0 4  ' // /+`@Д! 0  ?   ` `@@v"@74 0 & 0  ؕ* ?2 @V4 `@ 2 U$  Q 䁒a ,@#P "F E `H@   p!@!?  b@!P?$ $ U7@@#P "  0 & 0` ؓ*` ?2  "  `( 0L .2%!`2L   a$@X#P "   .2 a$@H#P "ܨ ݰ & 0`p     @ ` )#*` € 0  @! 0 ` @  2 ! ,` J"`! @!`` x FaT\ @  <    +@ <  +@ x *`\F!T`؀2@  ) 0 , ؖ @$ @$!@7 ,`@k"(5 @!`0` 0  $ `` 2`   P8`#P 2`@}, "  ؓ*` ?2 "H@ `2$   @"h@((@b  ?4  `  㿘 a(@x   㿘!(ē*` . !  ^"- % P? )  ``G  @  @?  @  2 a,  ؤ      @  ,$    `ؗ*$ $  ?3  $  $ "      *Ę&!@ 㿘 `@u   `  ?`x/?Д ?????/' ,. #Т   @ "a`x  @8Sbȕ,`    h` ^  ' @ `P.#*` € ؓ, R `⎐>"0 ?2"0`"  @#"0bk ,b:x F\aT 2      bbȐH   "@`Ȧ `x `,@`x&!㿘 (  D)/͔  ?3 . 6`   >  J@ `: $   2 2  < @% 2`@>  @  +* +@ B?=`F ÐTܝ㿘 `@x   ?b  x``0'?#`  @&b?b@ "@ X %$ ! , @# , 2 &%$@#( " X&%$ ,` "`h X %$  #@ #Ho `4  &%$%P@7 , *   `,`:  `,`:  0` `:@`,``:  !  , !#P@Ē=&%$ , @0#h 4 , #@ %P@6, *   `,`:  `,`%$:   `:@`*`: %@ L &  x* "h%L? (%L? # T# &@"U%#?%P?"":`# &%P?#a"?b!@`"@x`U\!@  % \% T ,  % X @6}%P* % \ ?" `# ? \:`" % ` ? "?:`"  % d%$  % h%$ * @% l ` :@`,`: % d@ \"U d?% #"@ ?## "@#?#  @? $#  "  , 4$ $ 8?  ?? ? ? ????  8$8 ;  @  E;`  4  <  @  * @D+@ ,4 ,/" c "! @  "` ?`   ;`@(g#    0 @5Œ/@  : @  D @ :`D  @.`@"U@ "  cԀ #@i : @(< $8D4 $82`$<(`$8`% `% =  ,?@2  @- 5 5 %% %$ $%  8@7 % p% % $%  % `( @6% (% (`,`&% , @6% ,% ,% 0%\F!T@25 % x`5 `0`&  @&% 0 `x @(% x% x % t`0  &% 0 @"U@% 4% 8% <% @% D% H% L% P" \?@  %L2 @"U%# @5#bȕ/`   ?@ "` /` 6"  @ ` /#*` €  %  @ bU? % =`b \ ` *@   * b #@[bȪ` @ Π ` @"U   =`b \ `*  * ``% x  - @"U#  < D 2*@ `:J@ : 2 8 @@:  ` +@* 8 ܄ 8  % %$`$9 8 8@6  l:  8@6   *@ (,& $`% $` @"U@:c ` `` 8 " %@  : :@  4@   8 :D@ 4 88 8%$ 4  l  p h@   @  `%$4*   # ` (   p`@瀋@ %?%$4*  # %? $  ; B?    ; B?    ; B?    ; B? #L@@  @'`   $@ x$   $  $$ * h  @ 0?@ ?c  p@`(  ?#@e 0 *` J"``?b@@ @ F?@"U b \ b@`\@ $`@"U  b/-`."``@`\@ : 2 ` @3j@1@```?@ & ?" @ 6F @"Uc@``@  c ` $`@"U  b/-`."``@`\@ : 2 ` @3@h```?"@€ @"U@" \@"Ub`\@? @ $?c  8@8` @`"U@b`\@ @"U@" \?# @ 0 *` ?b@ ,@@& %L ?"?&%P#?"c@~ c@` b@@ @ `. Вx. Ґ *`   @    "  㿘 'H'L'P'T'X"@ *H@ 㿘   `  쀢  @t  @n @.F   `@b  `쀢  @Y   @S  "@N @t 㿘'H'L'P'T'X H㿘'H'L'P'T'X H㿘@@!㿘 'H'L'P'T'XH@B (@ / @Ē <   L` r`@n `@㿘@ / 1$ @, /,a$@א   @Ӕ$  H " !!@  !@ΐ!0E@{ = '< @@#0@  % @f  ~@!0!  @!@@ `ˢ @+t `2 㿘 a`@=H @p a`@=@ 㿘`ap@=6 @i  @Bap@=) 㿘@ a@= 㹨  !J`?"('*"$"   @  $"@~@@4#  @m$ !J$@6"0`,"0"@= 6 @~ @@8@2" <  #P@7#p @2" `,  @#@*$ #@J l` ,  @~  %(,?`%(#@͐#, @Ɛ#??"`x" :, :x$   ,` $`@$ @  $``"#@ "" ("`" @  q` y , 2v @" n@# i#`x ,@ @l%   4@20 A, $D ; @"< @0O, :  @ :`D @ @D % @= D#\ `@` @.`     `x J@!x  `р, !H!Pϐ! ? 2xǐ!Xx $83 ,5:` @/  0*@ *` t  :` :"p  @"y<` @ E x  `!@ !`2x " , x  <`c}!@!2x  "`<, x   @ *@q! , "@",   @Ր! 2x "* , x `0`H  O" `0, "`H@",   @"@ 2x "* , x `4`L  ,"H `4, "`L@^",   @"@ x "* , x  P 0,@ @  "p@ 0,?`$ P@9", 2 "@j"@ 2x"* , x  T 4,@ @  "@ 4,?`$ T@", 2 "@F"@ x"* , x , $H0204x04", `:%0@",   @"@ x "* , x`F\!T@ x <(@",``"%(@Ȑ",   @"@ x "* ,` x  H8%8: @ %< "!x%<m#   H8  ,:;%8@",   @ΐ"@ 2x "* , x  L8%@: @ %D "! %DB#H  L8  ,:;%@@r",   @"@   "* ,   &`8  ::8 L8  ::@&` 2x e,., 2 @~# + #p$x` "$ ",` <:%0` "(`H8  ; 88`" L8: ;%@*` +`  Sx eL2P , 2 @J#  ϐ#hx "h #%L "P#\"eT%`"X`eP@-, *  ``,`: ``,`e$:  ``:@`*`: x" L%@  $` * ( x `eP@-, *  ``,`: `,`: e$ :` ``:`*`: x``Le@ B;   "Dx`Y ``eP@-, *  ``,`: ``,`e$:  ``:@`*`: x L%@ , $`@f",   @"@ x "* , x U\a 02 2 x` x@  ,``" x@=",   @n"@ x "* ,` x U\a 02 2 x` t@ 8,``" t@",   @E"@ "В "* ,` "L  `2 xx  @`h(@x  @4  "cL cL 2``@ P0ɤ : 3/57 ``0"4cL`8@,Ǡ `d: dH@ @hB "  @ 2 p`@p  @   0  Ϫ``B 6+ `B + 3`@; B: 2   B*2@ *` @А "` @0h`p @Ð  "``p @u`0Z`p @   "``p` @f*`0Kx` ,@! $"`,@W! 0<`# a,2 8"@ "@a,` "!(! $!$@  "b!$ !Ha,@y  "ba,!p@+*`0@x e *b*" @     @!㿘  `  :` xb @ 2I  Fe\!T@OU!@Ka" ?6U xa 9 75F3@@ @-U: @ Te\ 2`  < c耢 c쀢 b`@?ר b-  2a`x $ :`x,  a4\aF!T@`x @+     , @+v? a`x h b0@2 o@@$4wb 2  4 `& : !ebH ܒ: @ؐ `d `4 @,*@ : $ ܐ@  P=`x`,%`?  ; @;`  ,@+*@  : @  D @ :`D h@ 2]  @ $ `+@~"p  h ?'  $ @~:`  b@95 `xF\!T@*  ::0`$ ; ;d8(88@`;8`0&`,#&`8&`@(R?@(N@*&?`&<``* &@"* &|?@+u8?@+p@)&@)@+f&@( ?@(&,`&d <`` &dP@)ȡ, *  `,`: `,`$: 0`:@`*`:  8`( ( `(`:`: &&`( " ܁㿘e!`e@ 6  @w@oI#p#` 2v `  2q ` 2l ` 2g ` 2b ` 2] `, ,2X `0 02S `4 42N `8 82I `H H2D `L L2? `P P2: `T T25 `` `20 `d d2+ `h h2& `t t2! `x x2 ` 2 ` 2 ` 2  ` 2 e\%\  㿘 x F\aT < @  ("$ 4 0" 0    ` x`F\!T@@|͐# 㿘 ,`y#c@ɐ`?@|# J l` (` @|#{*bJ`X     J l` @| j "P/' @|@``? "`@D    $@ FE) !-  "(` @! %#  ` 23- @4a  *-   ` ? "`@   y Y n N@|5 y Y  .`X*" 㿘 x0"`@"Ȣ 2 ( ??:00""* $ $  0@)($  1? ?j ($ $ $ " $ % , <6`@ސ (`@`0 `2 @@`" 㿘 `' d@l  2   0  2`   2  H@0   $0#   " $ $ "` "  $ 㿘 d@-  `(@4`"4 @G& & >㿘N` F`  @(`2  @ ``@.` `@&` x@( ` # '`#L@@'8 8$H d@ : @ڐC   0"(@` 0  㿘 ,`@{# ˖H# { 㿐 ' @^`(   !@("?$" @O 0 xF\!T@ 4" 'd<"`$D"(dL"`"c"`"d "` Ӑ *'@ ([xJ"̀`(#`ܒ: @x x   ( ,`2 ( Ѐ  `ܒ: @u=x ( , 0 (!, 0 0 @q7  +`'5@"` (` @]`@[  (` @"$"@ߐ  %`Ȑx  `р ,`"! !( " x` *  (*`  !!4#*` *  a0@'* !4!@@z;a0@'C? (@'@&% ( @ 㿘 ܮ :`@ @#  !` @l !h@# 6!`ڔ @@y!p L '; @ =@< E@ :C  @#  !` :`@b @ ; @B @'D8F@ya @'4 : F @ya @@y#㿘 e ܨ :`@( @#n  !`e @= C"`!U@#Q 6!`H@yf! )#+`ܐ@=Ē`܀  <  D @ :C  @#,  @&ɐ : F @yAa ܠ޲@@y9#㿘 0   x `8@   % x`8   3/@ : J :2  : J :    : H :" 6h@ @&o<@|<  @$ܒ,  : @  D @ :`D 0E U " #Ԁ !@e #=`U%  :` `(  *   @:  ` ` (*@ *`` `8B@ >` ?"%  $"% $``8"@n  x `8  x8; ; bSP x `?'썐`  aba      ` `` b@^0L  ?? $a/'?????# .#' ''ܐ 'T'^ "@&@@Ғ / @ .@܀ b '''6? $a ?.@|@" 㿘 $` @ 㻐# `'($@ܐ@S@ !H @SL @ 6@֐!P@-!p @͐!x s F#  "b$  "b !@@L?逥 f ""F@!F! @U   F#\#`#d!ܒ    @H  J#\#`   ! @= K! @8       #\#l;p#|# #x';`#h#    @B  @   ?''' @   @  @" @" @"  @"$@ 㿀  ?''L'P'T'X'H'`L?`' '' @ f  ?`?㿐'L'P'T'X'H L?`(@n̴ " **@& ?㿘 'H'L'P'T'X@RkH@R}@ 㿘'H'L'P'T'X @R[H@Rmxa̔ 'H'L'P'T'X@̐ @H㿘 "( `""(@㿘@-yܐ!@Đ @㿈   ?'  @ ? @nd?@"㿐'DD  ?   D@ ? @nF@²D"(㿘㿘  @< b`@ ! 㿘@@q @Z ?"h_@D @%?"U@: 㷀)  '%$@ܞ'⸔$@ܘ  @7X 'Ɛ"' @͐ '' b@*"Р@s#c;''@sc2@ @ % )#@? @tC  ?BF$$ ( ?@t5 ?@? @m %#p〢  #@qs ?$ "$ 2    ڐ#@А @ #F#  G"" ,  @ߐ p@6 4?  ?ؐ ''' @ސ  @ڐ ," " 1 0 8'耢' @ '' @$ !@r" P"{ 8@` ? pb8? @s  ?@o \1F@s ?@g?@m  b]8B1F׀  ȒbN8@pҒ ?Ԑ?Ԑ     "$K @?'@.0͐ 2 21F " !0a8@ `1I!#㿘1!@ "  @ "  @l@"!@    @m &!@  @l @!`㿈 D!@ '''' 'D  @lD@ !㿐 !@ ''   @lm@ Ȑ!㿀D!@ '' 'D  @ 㿘@= 2  @  # @a & @  a@ , &  㿘@   " @@   @~@| @z㿘 ( .  *@~ , @B , & &a@N: ?a@*? @    & ("!8& $& $$ (㿘  @9@7 `a@@N ?a@* y   $  ! @ %$ ` !   @@` $ ! W  $  " @ $  㿘%8    " (Q (\ 2 $8  1F#`e 2@ 5 @!1J"㿐@4?  "(0' @< @` 6 "X @p@ @"x @p 㿈@3 ` `? @??@4? `"s? o@@P  @?0b@O 1`  Z$`  W$` "1`@` @:!?@j @j @j  b@5ؔ @y@ b@5Д @q@o@& ` $ 4 ``#"@ ` `@ ' @餐 `@pi@`@#`@ 㿘#a8 4I /p   @ $ $  $` ("`($a8 (` $"`$d0H?2$ J#L "b$@r $ ?E(JLK ,K KhKDK  $ $㿘! $"$  !8@> &  ( "1   2 (?2& J#L$"$ 1  @p ?""$|"$ ? "$㿘'8 D  ?&  ( 2 0;  ( 2 @` 2 (  &  #@O& "     ?&   ;!   @m& 0̒@ 8@ F!8 "1J `2 (`&  @m  ( 2 1J"8 J  (2 J"  <㿘 @ "",㿘 ",@ @"",㿀!8      @ml$  ( 2 @Gn #!0`@ycx1 8@ ?"A @2?; )  ? ''' @  @ ;" @C ! `0 8cx@ng"#" 8cx@z @o͔ 䀊   2  2  ",@ "", #l,  @m??#@i3 & $a<@Ɛ ? @o ?"a<ra< @i ?@i "    $`# @",1F#㿘@F !8` `  "` `(`2` !0cx@` #ؓ.  @lÐ??!@h "%1F$!<@v ? @oX ?"!<"!< @h ?@h   $#1F#㿘@ (   @*`2 㿐@ǐ ' @& @ `@㿐  c@n "L@ " n L` o `@W = ", `"@g 2  - @ @ @`  c@"  2 &*@ &" `(@"  "(&@ "$&@@h%"@ # 2&@@h "2 &@`H@"`   9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 5 5 9 9 9 5 64 9 9 9 9 9 9 9 9 9 9 9 9 9 6H 6 9 6 7 7` 7 7 9 9 9 88 9 8| 9 9$ 9 94 9P   "ج'@V`耢 ?     "# "b"@ @'쀢 !!(@E??`5L#ؓ*`   "b!"ܔ    @ ""@|!H !"   #@""Ӑ!`""#!"  @@ ""!x!"   #@ ""!!"   #@q""!!"ܔ"  @@` ""!!"   #@N ""v"!"   #@< y""d" !"   #@*g""R"@!"ܔ    c@ V""A"`쀢    "ܒb0.G`!"@\bx "ܐ   "b8"@Pb   ""-"b"@")`  $"c !"  ?@ٚ:"ܐ"@ `"b@$ 2 `@` "`*`@ & "& @Ȑ @: +В?@ +b쀢 5@ @ +b@ &b$@̐%$%@@k$@@kc(@$ b쀢 "c8@ X @h!  " @$??7ʬ?''7'7 /7" P?  @2 6 @f@n#@@@f    )@e@^#H@#`@   %b#``@   r,``@e  @`  #h@!'b쀢 #c "@_i  c@#   @і 6 @e@ #@@@$؀ 6 b@e@#@@b쀢 2@!<  #@y  #@H@@X ?"J?``     2@@R#ؐ@N       *: :   B 2 @ @-N 1@ 0@$N1"" @2     B>"   @B " #  "쀢 #  @C  N `@@ #b耢  b ( $b@@ b耢`"a:` :`@ " >"" 4  2 # `#@  "b# b耢 b  ? *`2 @ő*& &b耢   ((*($b 쀢  2   *@ "쀢   "*  4 "c   "* "c " # b   "? c @G   $bc H "䀢  "2 "2 "cH @#\ @ 1"  @ᙔ  @0" @ڐ@ؐ@ 㿘e!`e@ ?!H 6!H3c   `@]" c@'#0 @k! #@!H㿘# 6f6 e`g@  @k{!(!8@㿘'H'L'P'T'XH @q    "ؒ @G @G @G@F@ 㿘"쀢   " "@AaX0" "@:b@ % '@cc`,pc, @;@@. @c" @#( `'D''H'T'X @o%  $@@h  "cc0@! @쀢 ("2* @ *   @c "c8@!̐ #\   @?"#c8@!  @%  "c "$b b!   "bc@#@ ! "䀢 ##@ bch #@?b':  :@ c@  "  # c 䰀  Lc@n  " c@c "耠 c@Z @` @R `H@J  `x@B  ; ;`8@8 8 88 4 H L 0@ "`P@ `4`0"`T:  "`8 `4; `@ @ `4"``@ :  @$ d 4<$8 be:  $ |$ $%\$ X #$%P 0 2 2 <#$ t $ x?$%,$%( < "%,"%(?$< < " " $" D" "#X" " @"  `0 2@2 x"e("e,:c"`t"`x+c4? ; @  B @ = @C8 ; @ B <@@t  @Z$?@V@͒0@+ @ *` :` ; <0$$  c t @Q;  %0@B?<%0# 4c" %c!#+cT:@& x@#d8< )d<##$<)#`x`` : @ $```8@@@@|$`$`#`?@`x?@@k``< @$```8@@@@]$`$`#@ڐx?@Ր@LP, @E$*  `,`: ,$: 0``*`< , :` #} 4 y#c @D*+ b#@  #:`@$8 4)   )#8@$x?@@b@ 9$<`8@Ȣ<41#2#@ +#`eP@, *  ``,`: ``,`e$: `0``:@`*`:  #) ()#``8"@:$``x?@5@b $`!(@C# & % @" x?@@% %`?  ;`; d8@ @aC$`,`x```@: ``8@@@@x; d8   d<  $8aH@=    $8>@4 @  @@2 8+c !x@CQ 䀢 cc |@: $ ``,"`"`"`c`eP@-, *  ``,`: ``,`e$:  ``:@`*`: @c L%@ $` x ` @:   ,%D*` L @ @; <$H$ $ @C  "(a@ǐ c3DL%h "h"h " c  c * c" <" \" "":$P"$X*c* "%Hc@" c*`c"`  4?@I   $8:`  ," d@@ : d `=$@@h 8 @-@ :  d :` =#&:  D =$@? >e  =$=#=$@!  :"䀢=$0$4% $D$L% (% ##% % $$ % % #b쀢 <# c!@$8c48 "d"D@?xx? " #\H@fVc  4' 8$"D@?x ,x?@f;@# b䀢  @x  c0@ ' @%\F!T@ e $%\  @@c쀣 &!;  ; @ b䀢 cF!TU!5  "\@e"P0쀢  @ Q`@) H"#@v c`0#@4 *`*`  "b""!"@# $bb@ &"@ c@bGc"#,@֐ 2=% ; @G= @- :  @ :`D @ d@CD  '⠐@z d c8 c?&@e" "@e @ߐ"P# , # 2@et"" "쀢 ! @z ! "䀢 TX@e\ b@* ##" #$" $ "  " @ #b@ #c쀣 &!;  ; @c  "Dc T= $H :@  d@͐C  0" #(  @c 0  cD *` % 8 4@  @@e?`8@e,  D *  2 @א"؁㿐'< >@q 8E 4  7<@$87 @W;  @. @ :  :`D @ d@UD  "@,: "@ D "  @b@j ( @  .@ @@ @@} @@ %@$@  4?@ @#(! .@'#@' #@?`U":"  "t x *  4 ; b&@"x"`  ,?2 22#  ""Tv:2"t"xഓ*``"X഑* @"\"\#`#`,` \: @# ``,: @# d` $`c@ %  #  #@"U@= b\  * @*# ` ?"`  ~' 8@o%@bU `@A b`]" `d`@V-* @"U@TT @ "bU " X`d`@:-*   @  d @/-@%P* 'eP $%`d`@wA-@`@``d`@w5-@w2`@`@w+`@eP@`*  4# 8''8@w *$#*`4  " 8@%@#@"U@<`c` ` * @*#``$@ "`$#~8 8@#c@bU `@c b `^"!#`d`@-c* @"U@TT @ "cbU " X#`d`@-* c  @#  d @{-@%P* @%eP $%@`d`@v-@j`@``d`@v-@v~`@`@vw`@eP@Q`* @@ 4@c  8` # ( "@*`4  " !#@"U@=c`  * @*c`$ `  "`$!# @>`%0&'#@@  0ܬ  x*   ")F%\aT @<$ l @7$`Pa?2)# @;  @J. :  @ :`D @ d@D @ "䀢 @# 83* bܢ @ @`$ l`x@ ' @;  @. : @ D @ 8D d@ = @Db0@ 8' x ` @< +㾘 @汔!"' ''@7'h 'l!@9H7@ 'h'l " `7  !X  #H@p1: ?#@ 4`' # L@@ 8B @ * 2`  '`d+  :@4@ϒ 0 㾘! @`> ?(7?@8? @ w'' 7  @0#H: !#? 4@O ?hhl@#  L%@8@ B @ * 2`  2 ? d@@G 4@ 0 㿘 "܀"`` `6` @`?$@a, @*` `2` @"㿘#  : d@# @cc@"U@9#@  2#X# #@"U@c`c 8 ; @ߐ @ cc 8: @ F ' : ږ#@<   c`@ @"U@`@ + c?# cc(B?;c ? "  # c`B ;c " "䀢 !cd@Xc  @; *`@bU  TT @?"bU  cd@8c  @d; *`` c X d@(   @U; %P @; *`@ !#eP ;`d@#  @; #  @<; #  @; # d@#  @; #  @; #  @; #  D @ו; %P @֕;   @; *`@ @?4@!#`0F`4@  ##c(8` #@ #` 8 @ 8C c8$4@"$8"@*`  " 8$@ ;Fc* 2`@@ "U@ `   * @*# 8#  :@ d @㿘- 䀢 @)& l@)& P##  :@q dc@ c@"U@" c@@ )6`\? "  `  * @*#  :@Q d @c#(B?:?",@ @ #c@h  +  :`@ ͒ @ @ Ò * @ z   D :`D @ג@  x `*  d@D  0@"b䀢  #@`xbܑ* @@   #@`xbܑ* @@!#0@&b܁㿘"쀢  #.`  @06`. @.`   # @Pcؔ@ "㿘"쀢  #.` @̔0" 6`. @.`   #$@8c@̐ $㿘 8>"># 8 2 8@ `?>@ * @ * *@ `?@*` @ `?@:ِ  㿘 8 >   8 .@>@ *` @ *` * * .@ >@+ * .@ 8@: 0㿘 8 >   8  .@>@ * @ * * @ .@ >@+  .@ 8@: H㿐`h @?   @֐ `  @ " P㿘  *     ’`h@ 㿀   ?'  @ ’`@ 2 * #?, ; @<   @;  8,`B * 2` `2 B `* 2` D 2 4`,  3`+ ,`@B+` B@E  2 `   ` B 2`* @ *` B2*@ *@ E 2 `3`  3`+ @+` B *2@ *@ E 8쀥@- 5`* 2`5  2  –  @9 㿘@1 x x x x x x x x x x x x x x x x x x x x x` x xl x x x| x x x x x x x x x z z z y z z z z z z@㿘’`@ؐ  "c@ )]'#!%/ 57 "* #H@€ $4 $c0 $#< $#< $c0 %c@ @@4I??ℓ* & @ c0 @@U@  @- &8@0@@rYD㿘#0`  #<`#8 @   @:w  @ݒ ?` K]#ԓ*` €0 ``p`!  @ @9c`!`@۠ @ 20 ``R`!  @Ȑ @8E0 C``@Z`D <@<\  6$` `  0 2 `<``@F`D (`<  @(` #@``@| @^"` 0 " `@V` `@]! "cD@: 2`<@V`’a@Q @:( N 3/) -<+5@ N 0c0  c0#4`c0@8l-%#D  #@ "$ @Ő #@`@@] "c0 @U`@]!%#D  8  ' ` ?@ n`<  "` p  `@8!0g  @ "T@9\?N$*$@ 2`8’ah@  @R :@ 5  @Ė @-`8 @< $@   @ @`8 @& @  @Ɛ@ ’@\!@ "cD@  @!x㿘@V 2    @ﶦf4 8  x#< ` '! ’a@I"02#8`p< ( j@8  "f @T` 2` @ؒ@H @u O逢  –!! #\a@"@ߕ" `   a ? "@  !  $!! @ɐ! ` `y !`? "`@Ԑ  !  $!@!`  `y `Y` ` @ؐ!㿘 @ %#@]z ? (J /"*@]j / J .2 J  .2 J 2    @6ÐaȐ $D `&   &  㿘 " a@}"@oǐ 㿘@&㿘@5㿘 a@㿘!a@#H #H’b@B 㿈@@] / "ch @"chch@qb    "`l  b@Ɛ"  " t "@@19? f "% l*@`&  @ `  `@ `? `@}`@x@{ : l’b@ܐ     8 #@` @q' #h`b@ ʐ @6 2    " U찒 6 @S^    h @Z#@n  . @`7 @ ' J  @c@   '* l ’c@u c @p  @,@nȐ 㿘 R p pT`+V@2 V  @Y#xV  @0# V @+#    P`?"`P *  "P@+   V@Yk#X0bP@   @Yb# #@Y] 㿘  N  #@YN#@YH`N     P`?"``P <* b"P@ <_NbP@ʐ <ZN * @O     P` ,?"``P*  "P@ ,bP@ ,*`: /   *` "P`:?"`` "P*  #"P@  : @~bP*`:  NN 4N`    P`?"``P >* "P@i >0bP@Q >㿘  l  #h "@xc0#h "@q`@m 㿘@㿘Ò`(@ @S 8 a` %'+ - p @ ܠ 2ܒ`8@ = @ >!@D@@/V0?• mb* @@`2@@@ 3 @@Z @?` @ J /"* @@ @@  a @@Y 6@@Y P @ @mD(),@ X@g@@<@L@ `?,@@j`?  <   / @^  a@Yo  ? <   @QS "?  / 㿘 " ``@Υ"@l 㿘@ 4 l  X (  ( 8                       㿘!@"""@ @6#"0*` @ * 4$b(`*`@ !$",㿐 +-cp@t  ' Ò`@ ϐ 0`J@   J@?   `  'J (J@J`#"֐cp`"Ӑcp`; '@ k &`* * $`JÐ @ j @ X  @$` ' ' J@   J@?   `  'J (J@J ,2E$` 'J   J@?   `  'J (J@@   @z$`  'J   J?   `   'J J$`$`' J`Ò`@   @,`LJ@" L  L`"LJ@2 L 2  J`@   J` @ ` cpc#*` € 'J   J@?   `  'J (J@` 2  * * @$`' `J   J@?   `  'J (J@$@J`֨Ȑcp`  $`Òa @ " 'J   J@?   `  'J (J@J`;`cpL`a0@k cp 'J   J@?   `  'J (J@J`\L`a`@D  'J   J@?   `  'J (J@J`L`a@ @B$` ' !%J   J@?   `  'J (J@J`!Òa@ !@Q  `$` ?$`& @5!? $`@N@dÖa@ؐ cp' J   J@?   `  'J (J@!@ $`  'J   J@?   `  'J (J@J  4$` Òb@.$` ' J   J@?   `  'J (J@"@ʔ@r$` Òb@` @HJ@ ;cp`'`'J`  \Òb @I @ $`@;` 'Òb`@; ?'@e`'@` 'J@   J@?   `  'J (J@J@ ;<cp(`` @' 'J@   J@?   `  'J (J@J`;` 'cpÒb@  cp㿘'D @. `:  l'D \ Òb@ΐ  DDa DÒb@Ð DJ U . : !J [2J @LD BD @#=DJ \ J ["&.@J \JJ \ J n2 J .@D``'D \ J \2 J 'D.@'D`J".@D @`.@'D`DJ    *@J`^ *@`J] *@`J@ ]=*@ J[(\J . : = \ `*@J` ]*@ "J" `(8]*@ 2J 2Jn*@J` ]*@J] "`㿘@@ː "  @  &@@  &@" @ @ " @@@Ôc(@ސ @`4 *"4@R㿘 `  } ,@`$@ @ t&`" &`&`  @Ő( 8$ : N $ * @N I/`:  \97Ñ*`:  \-"  N` -?@#8 "N,@N``   @{H`&&` & \2,@ ` 2Òch@e ,@` N $@ #x@dc| Òc@P 㻐  'D' ?&@&` &`&` %# D`DJ@ 8J`J@?   ` D 'DJ (J@DJ g  p 9 ; 1  Dw}Ds w$DmĀ  @Ƞ i&@ f&` @DD@ #?@ Òc@ &@'D !J `J@?   ` D 'DJ (J@DJ*'DJ  2 *Ē` @ @" `&`& @!? &` @K@)Öa@  DJ`8@ D V'D @ `㿘N  \Ē`p@} @܇@@   1`@y@2 ?  2N"`؀   *`: ?   `  N @S@PĒa@> 0@! `*?L@   +@J @&@@0@@ 㿐 '  4@( 8$@ : L@ $@ *@ @ڒL   `\2 L  "  L "   *L  " *@ @U@.㿐N 9 \ 06  $ /aPİ ` 2&@Ēa0@ &@ &@ &@@-p &`aP@  㿘$ N< 9;8   + : ?   `  N& #;2+  N ".  + : ?   `  N 2+ . Ēap@W &`&@@㿘. ?* : `#c#0*` €b0 "b0 & @I &  a@% @~  2 㿘    `,` `*`#@ @' 2  @ר 2  @ 2 @ $$ $ $ $㿘 ` ,`  `,` `#*` "   2  @s 2 $ 2  㿘# *` `'   @ @~#`2 `*` D P \ t D 㿘 -k+)#!'1 %5 9*;Ā 68! *  @€ %b %"  "@$b"ܮ @   $$@K"P  Đ"@ƭa@d @&”Ѐ?Ӑ?b* ` @ @`@Ȑ `@  @@`@ 0@Ð @r"@D @"P  @I@bH@ @d 㿐 ' &@ J#  z0"#a`2` """`3#`@ŒbX  "a@Ha@MĖ b`@ a  "$!Ĕh!@dG  Đ!bp@_ a!  "b"!$a@# )#b $b@@* @}( 8@S&@&@*@b`2aL #2]L  n2YC""$aa@Y"a$"`%J@ #2 @J` n2@ "b$@' @@*h&@ h" '&@J  ",$`V@",b $b, b `$$b  ,$ '㿐!`G)'@`$ᰀ "a  ! Ĕbx""$Đ bX@$"  $"#@H b`@y@   ``? "`@H  @  "@@"@\ " & y @N `    `@  @G @GΠ"`"  @G%" X  T%" @,Ėb`@ @ `Ī"x"#1!'@va` $a`!$&" $"@sX  $@G@Ė"b`@p  `? "`@ː  @  "@@@\j  㿘@  " " ""@"㿘@   " "@" "㿘@zʐ  @GK@Ĕb@, 㿘@|Ò  @G9@Ĕb@ 㿘#@{aĒ@ǖ Ӡ @$aa㿘 'L'P'T'XbL@r"    ""b@e"@("Đ"@]b @b  @ ( l 0  L d t 8 4 D 㿀""'3/b@ "@ `?Ƒ* : `Cn *` €`%!"0  +*@ b(E*`"0%b(*`$"0*`b( * $В " " ``O!`aK` А _"`  [$ Д@ А M$   ?% " @$ Ab!!@Q 8@!! !Ēb @D !@? &@    @2!@` @L"@@@$  `  `ЖP@ @Ԓ  @a " @Ȓ 2@"$` `  `ЖP@m @a ` 2@` ЖP@` @  2@  Д@g  ?%$  ЖP @D  2$ @"$` a a P@0 @@a[ %0  +**@ b("0]*`%b( *`b( * $` $ @ք` $ `~$@@w"b "s@`p"b `2k@`?` & @!? $`@Ej@Ė` bJ `@M   "M@@EW@Ė` b7 A@% Ēb @M `'`'` '`'' $ $ "` "`"`$ "` $ $ $ ` 2@` ? ` @- @"@K"@`i$  `  `ЖP@ @ АÒ  2O$ 㿀 `!"   "ĒbД   @͖ ܰ !"   @  c-P? -  @ = ,,@,   ,! @  `@,@`` `   @ !@ ,! @ , ` $@-!@ (!,,`  $ @  @` ?2,, !Д$@ @d  !`@ђ,!  $ @X@ !   ' " $  '' !%! $  $ " $ " %"  ''`  P@  `"1   2- ` ?А & @O! ? "` @D @}Ė b  `  @  "  @C @iĖ bݐ  ?c  a  '7' ?#/-đ, (* @  #a@  @NPa@`@  @@P @Qc @aґ,   `P `@  @CP  @C`" @C@Ĕbw  "b%a@y#㿐 !@p# @%a`h @q  < 2%a <%aN ' ! Ĩ#0a&N@Iސ#  N`/  `@ J` ` `"+ : \  "P`?"`` "P* $"P@m P@U"PL+ :  GĀ`#("P` \?"``"P*  $"P@L \N \@3"PN@ " "@"P?M " `  "P*  $"P @(  M @"P@Ic#8 N {a  $"P`?"``"P $* $"P@ $@ "P  "P`?"`"P * $"P@  @ Ԓ"P "P `@0@B"P @B`" @B@Ĕbo 㿘,` w@: & \ ?N? `   ` "?N?Ѐ $),`:  \2  N \ &2      $   &  & &,  3& ",* ?2 (?2 ?"!  $@    $ ݒ &  & &",@ @Ҩ @& ,`    $  &  & &,㿘    $ && & "&  @x @& * 㿘@%Ģ?N  w""  { s" 1", - ?" @R   @A @&  " ?"& @> "& @A @ & 2N 㿘 `"!  2 y  `"]  2  "( @  `Д `@l  2 _  "` "  U " `"Q  * $  &!@  `Д `@F  2 9  "` "  / " `"+  @2  "` * &! $   Д `@   "@ `?"  2  `?㿘  "` Ēc@  "" J?` "?,    ;; ""4`b,@:d  "  0  "Ĕc` 㿘@em 㿘 "&@u   &㿘@t,  2@Ēcp@J @& & "&@ 㿘 ??`@v   Ēcp@I  "&$ `2$@ 㿘 @ 2  2Ēc @I̖` "`&@ `"@@tȐ ܈ < P X ` H ܐ ܘ H   p p p p p p p p p p p p p p p p p  p p  p p p p  p p p p p p p p p p p , p p 4 p p D p p p L p T p \ d p p l 㿀cJ    !#"   P ?# #@odc? L#J`* l#@#@#@#@ b( [!S#  2  Œ` @ L!@ b( C < ( 8`8J  0 8 @kݐ 8' X @3"@@0 8@@+@h `}8@d @_8@@@@Y p@HA ! h$ ''^$' '@8 @2-' `8@p`@@q@̐  Ő @H @>@JŐ @G`hO`7 @: 8J@ @u J@ /  `@q 쀤`  @q@^ @q"(쀦ŀ  @H^`h` 㿘J# #%"   P ?c c@nP? Lc* `@G p5  8J` @q @Ò  & Ő @p:  @>T @@Gs 0 Ő @H h` 㿀 J`eE J# `   '@˾`    'L - L    L  n e  E`2L  k   f L -b L   \ Ŧ 6%`63t"\*` €`Ŧ ) '`%  @H’䨒  @F   ` L`  @H%䨒 6 !@F @m?ƒ?  `*   @=`   ?$'*  'h  ' '' {`h ?" @hS`Z \2Y*L f0  r a"O  b 0".  \ A \B*A \>* c \8*"7  t n \/* v \)*( ( $ "     А  *`: ?Д  А  *`. : @Р? \*L    * 2` *`*  ` "`@C~6 # 쀣 "@P` ` @ٔ 6&`@Y@<`2 @`ꀦ @2` @C 㿘 J@  w`?  !Ţ!!"  v ? V #    #@lm?耢 p# *  `2 ?`2ͮ ̀   ` ! @~@  ` !#H@~@~  " @6Ē   `Ő! @F ?`t#8*` €|@F!(x ŀ`!@!X "(@E Ő!h@E@l ]Z@Eސ!x @Eؐ! @EҐ! 2 @Eː! `@EŐ!@E!:7@! "(@E!* @E!   !X "(@E" @E!  @E" Ő"(@E  @E"822`/ 㿘㿐Jb8      r7 s e # t  #Ŭ"P Ŭ"P$ #  `"  5`9' t#T*` €# %# % %# %@ # " %  $ % # ` +,- -#@k?Ȓ?`'@hY " `'@hP " # ``#* `J`-`+ `J  ` $# ?#@@D<"Xs #* `, ,P @  - "*#* `C `"#* `64`"%@@@|@4ǔ ` ! "*"h"X"Ŕ"  @@  `@ "=`@ Ѐ` `8h  @}ϐ@ "`-+1)ŀ-- X(b"   @ @@DA @ `Lװ 0@C"԰ h ϰ @}@ Ģ`"  `` @ "`    "@0"+-5  " U`R`@C""@C" @C"$@C" @Cڐ"@  @CҐ @ @Cʐ"@@@CÐ#@@C#@@C#@@C#Ő @C ? 07 "#(#0@C#   #@@C - @C -  " @@C~#H "@Cw  @j{ @Cp"8 "@  2i@ BL5 㿈`  "` H' ''   #ŀ  - +`9u <*` €   '   P ' @i?cP2  * ` "J`-`+2 J     P`?` @C#x @i @ސ#Xڰ 8@|``/`;9 =5 @ 2"쀢 'c@qJ"XX`@qF+ `2 @p =0$ * $ @i` @BŐ8`ڤ "5)97 =@ h$@@c`@{`<`2:`27@{k ) $쀢 '#@pXX @p+ `2`@p =0$` =*@`$`@i  @Bv"8P Ő#@Bp H'@{e`  `$ `" `2(`$ 2"`` $ #̀` "Ԕ @4   `" @c4#$ `$ ?$+ $8 @@`$h`  2l㿐#H  !%" t ? a# #    PF #@h ؀?〢 d#* ` %@zJ@z 2  `" $  ?$  2@{   $c ?$@{  2㿐   @A#0  `?   @7    㿘   %'"  p ? l  z   ?% @g?• n* `2 @HN 2 @HF 2   㿘@+c cJ``? #@@ (  (@gSc ?c * ` @F `  @F  J `" 㿐"`+   Ɛ   #\#`@o0   #` #\0@o㿈  1 L -.#  * 2 *: ? `   `  @z  2 Ɛ @$ @ġ`P ) ' #%"  s ?c" c@z  2 c Ɛ @@@ް c@fX?ဢ lc  ,`   ƒ``@os" @?"(    *" '%@cӒ  '?  *`" @@g  @@bР   J#` "b( ' %Ƒ,`@@Iآ`` 0 @@B"8u  ' !`'@ꁒ  "  ' ? @]@4'@V@4 ? } "X\  @gd >   6+'L % @E3 2& %`@c0쀢 @?U` ?  @䡒  `@9 6 `@6 @@?;`,` 2L㿘 J#`  !@eȐ x x$ x" 㿐! (@eĒ# ?# * ` I! B!8L  @J`Ɛ!P@>  h`L`2ƒap@?  u  2``?@&  '*`2x@  x  *`@@ƚ @xƐ!@>ð 0M$ @eg  `? `   +// /` ?///`?xx" !@! {b&! " @R x `@k 0@ @@ Jcؠ`?    @7 ` 㿘   !#"  m ? # + #@ea?쀢 l#* `2  @ @  = "*@`@ 2   2                                 Hf`?㿐 h#` (@dc ?"* c*   @3   6 ƒ@=#(   +   "   @ " $ $ @=ؐ#8 x   '!#퀢 S" #@dncP? ?#*  2:@6& @6$-Ơ#Xc`8  =   , *.  .   + " @ . . .?#h@># Ɛ#p@>  * А   * - ВБ:  @N #x@5Ґ @5ЦN8`y +ƀ g  o a" I N u"@NN`@# 2N" Ic*`@<` P  ?* : `  #*` €  4 4I"N N`@Ӑ# 2 @f<``- `=`+"  N,N-"-N`,  @c "NN 2+N Ɛ#@< 8@5G  @j#㿐! (@cr# ?#K * `D "Ԕ @/* # "@#Ɛ#@<- * @  h `#@   `@       @Z  @3\ @Ɛ#@@bD  @;9 ( ) @u@    @: 0 `"L@ -2L` "    @u%  "?@vu 2 㿐! (@a# ? = #*  @^4   ""ƒc(@:A ""J`r` h` `@?* 2  8` ` ! L  @AP  $ L @Z @Y㿐! (@`͒# ? #*   @^ O  'ǐ @@: C  h*`2` :`   2* 2 `:  22  ` P @9ʖ  ` ?4`# `` @9 J@ b  @Y\ 㿐 h  ` |8 @\g /  %%`*`?&@[0&  &:``$`q* $`&`&   J `  㿘 !#"   v ?"# #@``? f#*  "" 'ǀ@}d@$@9T`  [@@ @( @*2   値 㿐` 2Ǹ  @c#\`@h0Ǹ  <@ <@J @c#\#``@hP@; #)ǐbX    Ф'ǔ  ؐbX @&? АbX   bXؒ    X@ j @  @ ?  `! " "Ē"`" d@# V  J@ H h@ ?@   "  И@?$'Ж '?/a  ?(@', F'?/a @h"@l'"'Вb@ ?""`"?А @ 'Ѐ '?/a  ?p"@t'"'̒"@ ?""`Ȑ @ 'Ȁ '?/a  ?Ȳ  $!"" ''Вb@ ??` ǘ `ؐ"   `ǚ`"   ` ǘ `ؐ"   `ǚ`" Ж ؘ ` ǘ!`ؐ" ͖ 0 ǚa" Ȗ Ę @d"x@@^ 'ؤ!" p :  @ *@@7! @7!@@^!?倢 ?؀ "!@ %, h @  `؀, ؠ *@` $@*@ , `$@@   @ *@&@㿘 h` ##ؠ `h, ` R $L@L 2   `h R@ @ؔ   `h`h"  㿘    %'M@   "E@奒!@b@^`? m* `4    . `2    J`p   `"!@/ `@XH@W`@/0  !hǐ!@7&"cǐ!@7"  $x $ $ $ $ $    !@ ! ! !p !  #8 "$ "H # L "t " " ` t #l # # # $ $ $ $ $ $ % % %Xx "pc Lp'''' 'ؤ,`2@G` ,, @>` @6ʐ h f ,  ''܀Zؤ V #+€  ꀤ#  €   @ ؀`ʀ0ܐ?'܀  M `@` "'  @ `?`?€  "'ܤ'@㿘`#`Ȳ (N  N@ *`: N`2`@ 2 `@  `?怢 `N@ 2N` 㾨  `# *` €/N'NN !`? 2@Wې ''#J '`?@z  @u @p @e@F @[ V <  F @O J < : @C > < . @7 2 < " @+ & <  @  < (  @  < 0 @   (@   $@   "@ @   4 Ā ڰ  @YZ ' $ @'@Ē  # @ @  @݆@ `? @Y8 @< @Y+ 3@5@2 @  $ 0 @+    @+   r$`-#*` €  d`?  ^@  @Y W   ˀ@ @M K  @F D @D > @D @@44 @Dڒ , @DԒ @@  @Dƒ  @D @  `? Ȑȟ  㿘@D(@ƒ #``@D  <  I?㿘@  2  €  2     `?㿘@ 2   €     㿘@ "   €     @ 㿘   €  `?@㿘 2~  €   2p  €  2i Ȑa  2     y  2  €    2  Ȑ= 0   2  Ȑ8+ €    2  ȐP  2     @Ȑh? 㿘   ``? `   !*` @`?   $  ` "㿘㿘 .`   ` &@3/!0Ȑ!@3* 㿘J"8"8`  .' H-"8 S*ؖ a*` ؒ # **  *"  a?H"8 "8  "8@Y㐔耢S㐑* `@2#(d @Y~ &%"%"8a?󀢠H "L 2  >` @C "8< @"8@Y[㐔րS㐀`*`!؀`'!1@37#`@w  2 `2 Ȁ`!@   0 cP@2  @Y 㿀Ȓch@ !#&? @(l ?  @`* @2  Ȑ#x@2W.   ; : @C  @2?耎2? @e  @)`@23#  @)  @}v@2)#㿈 @Œ ` 耎`2#2  2 @2#0 : @3 @2#ȁ㿘?#"" """ """`@nO ! bc "c "bT@ @w  T㿐T 4 tc"T- c@ϩ`h %    "bDȐ#В   @yv "@w  Ȑ#ؒ   @yg @w㿘@v cJ` J` @ J` @~?@] 㿐  ,`  @O @lҐ @K  @Y   @(G`ꀦ ?㿘@^"㿘"`2@`  0"* "㿘N "   ?*:  @_ N$  *@`$  N H P `@'x p"P"`!'`("` '` '` '`'`'` '`$'' "' ' ' ' "''` ~Ә >w$"& & & Ԕ& &  ''///@9/"`2 ?$"  2 ?&  2 ?&   2 ?&   2 ?&   ?& @ڔ  " @   c@  @]#㿘@0 / 2 Ȧ!\c ,`,  @S  @R 0``,`2JD #    " J# * `J `? 񀠠"'   J "  &J ?  #J 2 * *  #*  "㿈g @ a  @@4  @ ,`@  @+$`@M,`` %@  J?`/2 h`/*`'' @' h$< , /, @''',`@@"`@' h$< , , @'''" 'r p @$ h` @91 N@   5N@ \@ 2.@  .@   N@  \.@ h  @D`"" & @=' !& Ȓc@/ \ h 婒` '''`d$ @I h$< , 娔, @'''"@`'h"@ 嘔    . `2  h@ @?\x J`2h@/  h厒`  &@  &㿘 @@`@  `"@㿈`ذ @#@ `h```h +` '''@0H@+@&<`h    @ L  "Ԓ@C@r @s "(@5">   &`h` A`h. * `    $@@ $`2 @nB "$`$`` ?А@$   `h,  &@  `hْ`*@U ?  @  .&@`h伒` ,`@.. &@ @' `h$< , 䇔, @'''"@`'`h"@ w&㿘&'   \ *`*:  ' " ` = :24J ! : \2  &  *` *:  ' " `倢 = 4$ N ? `   ` 2  N @ ` `N / N /2`?'&㿐\`o '     !@  `$  $@$'@㿘` A  h`@O.N '%L \2LL  "L `*`[`?`$"LL  (2L@(  L /"  L  \L  N ~ *`.@*`㿘 $ @@ @*` @`@K@J    K@ K @" @*`㿘 #, @ " `hZ` , `hR`㿘`@" (NN / ?N /"?N /2?N /2& *&㿐@f @P @` `h`$< , , @&`&`&@`h@N8`@"@`&@@f #㿀@d `h  ''Ⲑ' '耦r@C : @@J@ `-" @N @ 2 @,  @`,@   /,  " @M@_ $@< ": 6%,",'@ @x䀢 6@䀢 `h@,  $@ @@v`?`,&M@`i㿘ɒ @p 0@q   ) 'ɒ ƀP ƀ &@? @`N@ 8 N@ ƀ 〦`?`ƀ㿐""h"t"bl"x#bd#"p.+`l "D#    "b3`H#"#b(&b@D p1`Hb" %"x"|$|  &" @ր @b""@&""!b "@`H$""@Dy " 4 !b&"?$"@  $|!"` `lc#" :  *@#?$"ɬ#ت`X %@  6MP #p %#p#p"*`@  @ #t` "  * @*`@`   ⨀ 6"""b* * p X* @@$p "p  0 0 `",0d"@f  @J 㿐 2/@  0/1"?? &"@C"&" 㿘t @  0b>  *  *` "tJ ""t 㿘#bp"h@ !"l "@A"l@="lbp@$"l$bp@ Z ?㿘"l'@֐ ?@ <""1bl"x `?"|@ϐ   "x@Lbl8? %"| 㿘  㿘"lbd!@    " 4$"" @B""@ 㿘pl@@ 0 4"@  㿘 _⤀ %l @ """⤀`@ѐbp?"l "bp  )L@M@ lp"@l@U%"|"`" `4@  @  "b@ %"|l ?@Ll?㿘@  㿘@ 㿘@d bl@㿘@[  㿘d"l  @j 0I␐??B#     :  _ $ -J?   ` * bdJ?   ` 2 *:  _ $␔  ␐??#@W 㿘p"l  @ 0G␐??B#     :  _ $ -J?   ` * bpJ?   ` 2 *:  _ $␔  ␐??#␁㿘"t b @""l0bl  "l$"l@J"l "l0  "lJ@`@Z$"l"l"l㿘@??@ ??㿘N  * @ : N`       㿘"@ `N`bx   @: N  xb*㿘 ?@#0 `   `  ` @; ^  ? @@5@3㿘"lbd@'   b 4"bb S"㿘blp @    4" =@㿘"lbp @*#b??$b% p @~   bd@~  b@ސ 0??$b  㿘@"l"??#"d bp2J@ 0 d" ??#" 㿘@ @  "p *@`""p㿘b$I   㿘c@6 㿘`l@/ 㿘b* @%"@ 㿘b* @@ 㿘"`@c0  b l*@ * @"@ 㿘#Ѐ  l !@K 0!"d"bh"d@""d@q"bt"d@!""l$"p@)""p@@`"p㿘 `l"`" :"@ `n 㿘"pbd "`m0㾈  '?/@ )1  "J??..?# %耦*.@ݐ #` `.!"d@n  "d&O`^ B?` @*@ ``@#@@  "  `@? @TM# 㿘"`?cЀ  %@# @ *d@L@`^ D?0 cР?:@m  l?$✁㿘J@ ^`@@fc   ?@J) ?"㿘%p#*bd'p $ bd@2$lbdl ""x$p#"t+@""@ 㿘bp] 㿘bdV 㿘@? 㿘 ?""|@ 0@  %"tbd #! H@?Y b $@B@Ϲb#|` Hx@?>b  @.@ϥb"@$b "@ ""$@""tb)tbd@2 b"p"x  b 8/"p"x@  t"& /@  b?@p"x@  tbd@  > *tbd@8 <@?" "x@ ??"xNl8? &b|㿘1"d"l @s 03"p J#`" J"lJ"lJ"l J"l ? ?*?"l*J"lJ@"lJ"l ?*?"l*"lJ@"lv  ? p   p   p 㿘"lbp"d " #@ "@ @ """@ <d H   㿘bl%@G `1#hc* @ "#hۺ`#h * $@ @6^ &#h㿘#h "cl"#l#l?c* @  ##l"l"b 0@#? 㿘 " 0  1#l*`@  ` #h&#l@#?" @ bl"  l ?&#l&#ll* `l#l*` = d """bt"l"p#"x( 㿘@}  㿘)"d ""t#"p#bl x*@Q?  㿘@FUN *:  ^2*@ N>  ?`  +*@`?` N *@  X     ^*@` `@ ?(*@`*@X㿘   b@%#؀  b@%#ː@%#b.  ` *`ɔ  X * @$#0 b.  .` @$#㿘"` @$@#ϰ  ɠ X #ʒ *` *   `2  @$c  :  !  ,``⬐     2⬢`   h 4` ⬓,` @      h  @``2N@ap - &ɴ \  : , *  " @8 2  ; , ɒ`X*   ː @#E b` ⬳,`  #` .b@ b`⬔ *b@ "@ "` :`*"  *@* + " :   ?"  *@ +  㿘!ك"`?"b"`ٍ#  "b !"* "   + b@* b   ʚ"  ` *  ` @ G* ``^,$" +   b*" +  @  @`( ː@`0  *cށ*   8("8⬄( 㿘`     ` ܔ  ` ֔  ` Д  ` ʔ $l ⤁ 㿘"`@a 0"l@"@"  a $b 㿘⤀"l  z"0@A  㿘#%')+dhbt"p@)blbt!Ԡ " %bl$bt$d@_$h%"p (@$d$h$bt%"p%bl@N? @  㿘 @j  㿘 @d  㿘 @^  㿘 @X  㿘 @R  㿘 @L  㿘 @F  㿀"p!"l"d#\#`" "  袒 "d@ː 0* @ А"'% . @@0    V0 @ 0@d 㿀"p'"ld#\#`" " G谒  @ 0H` h א0;"    d@ w@0@# ` J /` "0 ` z - 㿘"2`@l"d:`""  #" "bt"btb"*  㿘 `?" ct J  "ct"ct 4 㿘  !""""  "" "   "? $""|` "`b?@㿘N`"*` : N b*`㿘   % #* ? ? `   ` `,    $b$m$$b 㿐1"d%"dp" h '"@` "d $p* "d#blT#"t    b  㿘 l@`V 0"`:@?@(L@(N "? "? ""? '"? , :    " '2?, :    " ' Ő0K N )   " '!N    " '2  N  "  "  ""  '" ?`"NN     " '2 , < {.. 㿘@ U㿘@  L㿘@ C㿘"lbp! 0"??$"  "p `:  _ $"p  "pK?   ` *"p0 LK ` `@ `  ` *: `   ` `@ `  ` *: `  #*`@ R`+ "pJ   K ` `@ `  ` U*:  _ $3" U*: ` `@ `  *:  * : ` `@ `   *:  *  R +p 2K"??e$"C  㿘"`'bt"p  "  tNp  b$x %"x 0 ` 0 0  H  0 @ @  ܝ㿘'#h `@3`$ $$`@,g !"h˒`8@ h`$``d@L㿈 C! h ے``'''@ `h  '''" '`"  @g  `h$< , ”, @'''"@`'`h"@ Բ 㿈! h Ԗ` '''@7":   "( hԱ`㿈! h x` '''@" :   0 "(@ƒ hԌ`(  '˒`H@\  @g  #J`2J 2J 2@! h  ''-  '' (@  ' ''Ԧ?$@@? - €N   -  € N N ܰ   ڸ ظ   $,@` (,@N ``?$@@?d ,@N `4 )@z2@sb  ' #  $,@` (,@`,@N``?$@@?3 ,@N ` ),@`,@`" ?/   @x@s*  @biL m?$@@?  ,@L `[  @s  ؒ@} ? @^y ˒ @X,@]G ,@ `2D    h F`" " $4$@ 444 $` ` %"  = #    ? ,@` ,@ `b"( @^! ,@T T    %"  = #  O ?"7TI,@` ),@,`T@a T@'J` T "  T@@wh `ʐ@@b% @a'؀2@@ @Z @˔ ː x@P N '   '~ | 'z )y 쀤@us J  l'd   J  b'؀ W䀢 2  '܀`N' "@  W䀢 M FW䀢 D  A   ?% `'`  ?"` `  "`@Jm  뀥  ? @J ?'? @Ht'W䀢` @!M"` 2耥  `  *`    *` p ml ,@` $@`@$@ @ @ @ B(`@R:(@`` ``h$< , , @&`&`&@@" &@` ``h$< , ˔, @&`&`&@@W @@"@`&@(@  'h  ''ј  ''쀥 t  *` k i + 2' 쀤@2# @bQ 2@˒`@} @` ``h$< , w, @&`&`&@@" &@  R-`?߀`]O#@*` €G [`@ ,@?`< ,@`@6`@3 {`@0 ,@`*`(%` '  " (`'@;  @ 2  ?` ,@`@' 2,@,@``,@`լ 㿈N@ $`N@ #cNN` _ } `@pt [ % *O  * @ *O  ] *@fd@^  @2 '$+ 2 2c @  h`+@^@_' b( @D@ +cJ `   2&ː @6 &@;ڐh @;`*$@    N :  N   N * `@  @2?N  J  2&?&'N@ * @*  %%=# h`` 2` "($@@^$` @ +  @`$`` ``?$@$`4`  @o [ w O  * @q O  ]m  %%=#?! h ` '''@e@]٦  +  h$< , , @'''@^"@`'2" :   "($@O `@  h `6  h, ϐ ,   '''" '$`@ `$`$@O  @`?4` = @ * @ B? ?@]w@^p$`$@ + . @2 "@@J` "(@ += -?cJ cذ cJ ` @"(@ . @2ˀ +ː @㿐%h @.F`#`$ @P$hy``$`Q V@ -``(``#`   " ˒ @Y @ː    @DK 0 2$6 ː!@@ @D{ @ɐ    @ @G  2@ @Ӓ@  6 &  㿘@n %2#0Q@0L@8J.@< A. (;*7.@< ..?:(*$@< 2? h&@:@ @˔܁㿀@`$< ! h' 'O!' ''쀠`  @ p`@&> &㾸@S.@2|  2   2Z @<  "  @  L / '< %@(@ @'  ?    2. @ (*L /%< @ (@2   @'ג  ?    <  2 /,@`,@ %h$< , ۔, @&&& h$@@93"@`&@ /,@`N /?$@@9-,@N /`@m7 /  ,@: @; 2,@$ @" @9"@`@ @&@;P @ː! @ D  9@ ` . L 1 .2LL +L .N .#@;  @ @"@@8@@&@ @' 2J`@2,㿘@l  :$@=@L`- &@)%ˢ (2  L  `@l( 2  .@  "&@.@`&@: .@` L  &@ ݀.@@|&㿈  h' 'ʐ ' 'L@?"@$ `@8B ``*@L@` 2 *@L` /"耢 :*@ @   @' N "&@?$@8 2,  ,N  &㿘N  +@ZU!0@[O2 NN  2 N@ZH!8@[B - N  @Z;!@@[5@  "(" 㿘@O @O 2 @ 2   @7c$ `$ 㿘  @kÒ  +N {2( N   `N { }   ,?2 "N  逢` $ c$0f   `h$< , , @& & &&"@`L& 0B> "& 4 N { },  ,? ,% 2# `& h`˧@@@@,f  2   P x x p p 8   $ \ @ T l h x p P'D'H'D'L ' : L 'LH H DR` H?L {D@@4  ,`@Pi DR`VDD"`D `  *`#cTA:`'H$DJ#`1`,@X!P@Y!  ˒aH@DZ"@ ˰"!X% #   ` 0b8@DC @ @A{"` @H ;'HD` 2 !DR`"!DR` ! h @ǒ` h @"` @ D `%D `5 #% @ 6 '`d&` `@\@G( D@?* : `N*`" €DLH@h'0?DHL `H `'HH! 'H@3 h` 2@.  h` 2DR`"!@U @  D H@` @ @^H 'HD`'DDR@ ! h ` @R h  L2`HD@`@H`H "'0DR`D H’ aD`'DDR@ HL aD0c@ `h 2 @<   @ @3Ð @3p# `   @!`@ @ ! h` 2@  h` 2@֐耢  @ @$3c$  쀢`$   @} @ &c@s  $ `$ $  @U H `h ?2'HD H#@ib0iDHL 2`D!>L'D R@  `? D!-L'0 D!&L`?'HL!`'H< "@08D '`!c'''''Ӑ0 'D` "D | h`  h' 2@ h`?  @3 @2`h @n  'DR` 2, `D@W` '@XDHL a'`0'D@V`@Xu DHL a'@ '0 h 2 h`?  @2 @2``h @  '0DHL a|'D!v DR@@  `? 0D `D!a DF D HL aT02D D`'DD`gDR`bD '`  @6i  '@ D 'DD >DR`07DHL aD`D@3HL DcD @[@'@N#@2DD`@Ê@ `D@(@ @]mː!@'"b@2 H @1  H!L   @L !J#߀`@1 㿈'H#J` 'P'T ' J`    2 ˒( !"@Y ?@W_ HL ^" @  'HH Aː!@H aЀ   J`P 'P*Hy a <#@8K  3ˠ @8Ka p?+  J#`Ӥ =#*`   @ɒ 'HH `H ``H c􀢀  `'H` "" H Ha2 @T`H H ` Hh   J؀ 2`  @ "N9 )'  M`#`(2  @U8P@V2Q "@@!H ː X`" "0 "8  @@  ` @=ʐ"  @XŘ  `2  `  @X   `` '0eH J#` @f / ː a@˔R @'HH    0C 0>H@09H`LH `H ` H@[`ː a@  ~ b@ H  @. H@s@[ ː b8@| @I@O @  H bh @f 'H'Hh"&" h `" ` ! hH`"`(`` x "` x `"( ", "0 "4 "8 "<  "@#K # 'H H2 + # "'H h"2@~   H PT a "bH*H" }H@ #@ &$H` HH@H ?"@ @R!H"`#D*` €"'0a@/А @/}@/̐ ˒b@ 0UH`H ` H@[`ː b@@ ~ b@: ː @a4 #L ` ˔ (!"@Wp H @U9 P @TP L   "@L= "@L9 H c2c"  P""T@n?'P ""@/ 㿘@S"@T~ L "Ԕ @  L 2 ˠ"  "?& " @@@2@Z "@ 㿘@HA@H < b@t @㿘 h`    @H  L @H& && 㿘 @Hה  2 " ?$$, ` $ @Q" `2 @HԐ`?@O`$ $V``$ 㿘 # N = *! +@GÐ@H]`<  " "" 㿘@GJ# /@d|   q`  <@H ` @2 /`_   @R"@S b(  & &  @ &   ` @2  ` 2 % `0 !  P@GÔ #`   @     &Ġc ?&  `  [ W`U `    P@G & # &  & "#  @ # & c@/&  hZ` &`@R"@R b(  @_  c & "c& 㿐`P@G  J`/  c "$ ?$@G 2(@ђ  '?@ `@ <  I ?    "&㿈2&@cK / Ő 2X 0Võ"@Q@E   h' 'Ô ' '耦`:@c% : @,@$" @.@_ /, "@@.@My N@ ɲ`Dz  Â㿘'@%#$$bX @9  !#@3$ 0 @@9ːbX$ 0$$、 ?      -J $`    ' ' ' ''''J`#!'@P!P@Q ˔  @Lː#@ Q`S#d*` €L J" J `E&  @B`@ɒp x<  6`3.1"   @ `*L@ -  L` 2 #     @ Ŕl 6˖ @L la@ j ?" `J ` "˒aД@ W ?@w!!2z? #(#0ˠ#8@(?@W˘c@ 1 0_ h *`R  ?@   h` *2 "@? <@   ˖ @L1 @@W`˒c@@  +?@z'?`@t` ` !Ѐ@   @ @   @7Ғ  㿈?''D 'H˒cp@ Ő ?1 h  @@ ǐ ' '쀢`  `@ؒ ' 쀢 2#0#(@@V` ˒c@ 쀢 R?@84  '@+s h @   H@+{"`@?09  h1`@  D" "& @$!˒c@  `d&  @:x @:uD@+U @7?0@Ѱ?@<@V` @ Ec㿘 +ˀ )'%ˠ , `2 #ˀ` @OJc@PDJ`@8@O@#@P:@ aH nЀ  @O/c@P)J@ ۲ @H 4 * ? "(㿘.`@ `@:㿈   @@&     @͒  '"4 ''@2˚ 㿘.`˰H@:V㿘   @@&   "`@2 㿈    ' `A`?J@ `J@ "`J@`? * J@   : + ``+J@   * `+`   Ґ"T.`  @`? `  $ ` @7 㿘`   "`1  "(耢 В ̒ 㿘㿘̐ &`@ ]  4     , @ P ` p 0 @ ` p ֜ ր ָ P ׸   , @ P 0 @ 4 x"'ؒ'@&@p'Ԑ 'D'L''''@)'`h @:   *@"@)  L  4 @ "(@)a@` (2Ԑ '@"`"@p @Ԓ ("D  @ " @PPD0@N L@O*D@)  㿐`C& #ܓ.` €  ''&"  *( )"  * @N  " @//@ ̓*` 8@b( b@ bXbb@ C 0b@ = @( 㿘 `Y ߀ ```#@ @`! 86& `"` `?.& 2- (& `@c ϐ`$̐y  @S@  @F c `;@ @703  *̴,`@ 8*`   @ `@  @  ` ` ` s@耢 ``    $ ̐  `#*` € @  @w  @   @  "@  *@  :@  @    @    @    @     ~`?   x@   t @  p@  l@ 2  $ @ `  @ `U   "  $ ْ@j `  "   8  ?3$  @   $   ?$  %̐] @9   $   ?$ "  `$ @"@N}@M2&   ,`8* `@㿘  `L?   ` `2 &` ( `* @ 4  [ L * `2 [2 ` @S4 2̐ `  !@&`@@ "` h$@)@K| h&`ǒ`Z & 7 _'  _  *  @2L #"Lh $@(@&` }"`" `"` ``@M h `% '&`̐ 8 J  2  @FÔ  M ` 2&` )&`&`㿘@@O` ` & " @M @L"& 㿘  ( .`N @ .`̑* 8 >  .`̑* 8 3 㿘! h ` h""" " " * 㿘N`  @@" @b" @MQ  @ "$ ` @@ @K&@  @ *@&@$  | | | | | | | | | | \ d l t  ( ` @ H P X J# `       #'<7̀`C9"D*` € ̒cP@ )@`h @'̒cX@QZ `  @5#` `u̪@,0㐀* K   2 ̀`2̀"X#` J@ `@[ =   h@'P`$@  , `  ` 2 `6 2̀  @ؔ @' `'@i7 ̀` # ` 2 `2`2  ̐#h@z  ̐#Ȓ @ @  @   ` @ @ ݀`@ @͐  `?=`#̬#؀@ ,)@)753+Ԑ"Xl":@4# @$"X@4c@Zג 2 "X@4c耥"`@ @@1"X `h @ @ `  @ΰ @P:`@#0@ @!@@4Z#耥"`@ @(@@1B? @ @P@Ȑ 0d @Iq 8`@JK #`͐ @@#Y $`R`  @0 2 `@ XD @  #'`( ' 'x'| "  x|$" @&0xx"@@2N x&  $@0,|@,ɒ$@| @O `@f x@0Ӑ㿘@ #+)'̤ @Z  #, L " #Ԓ   @# @ǐ耤 ,? `@"ג %`㿈` h@%`0V@@   h' 'C  ''$@"  @%@@@'i  〦$ @  @ "@$@%@$t㿐@' / #` "l* @l*@ #Ѐ   l`*@J. `!@)%"   L ?   1`l#В " : ?@i '͐ @ #Б* @㿘#`l  2 l  @m  l?㿘c l@\  㿘! lcЀ #c%   "cc l`?$ l$lЀ`": @*` Ȅ Ȑ 㿘 lcТ "`< ? @ cаcБ. @@ #l@!?- @@B  cЀ c@@&e cа&@ > cв@@ l@怦?㿘 lА@@]" <  ?  ??4? ?㿘 ) p'%lР"@< . "@@*̓,  % p$l$Ё㿘#Ѐ`"!#̀ "1@  1# #@#"Ēc&##c"l$#" @Scԁ㿘!#Ѐ  !"pc'Д?"`l$#Ё㿘 c@#@X* 2*#`@31`p#Б* `l  c`p#Б* ?:""p#Г*` ?*"&l㿐J#•` "Ш "@F. @G(|"# @#c$̒" @'! p@ "c@v@͒   @C  ` "#@ L@@G #\   @P ?"c ?  ?c@Þ@@̀ 2" cĀ` @+`p cc@K c@̀ c@|@rcĒ#@c@p@q   @ $cā " T* "        2     `p'|'@D| &@3  t#c͔$@0&@m! &# @  |@| @@" c@& @۞@c@:2  @.y!@?  0  2? "  2?@" "@  㿘   IA`#l* €@ 7`5 @`* 0 @`* * @`* $ @` @ ``lЀ ?  @ `& & V `  㿘 lcВ$ : &@@@ "@*  1#̐@"0#$㿈!#@b #  @ؖ  #Ĩ@ )D"@ ##\   @ ?9c  @>00!#Ԓ   g# #Ԑ"@, %cĕ>  > > //#///@% @' #@#  @ %c#@ 0@㿘!#@  @#$#㿘 b@  @ 㿘 "b"0N'H'L'P'T'X  3@q H@/Րbb@.А @,Ӑb@ 㿘'L'P'T'X@_!L@/" @."@,"㿘 "b"0N'H'L'P'T'X 3@B #"͒a @/dbb@/H @.b@,b` J#`"#@e 㿘'L'P'T'X@ !͒a(@/="L@/v""@.q @,t" @I 㿘 !    " @    J͖- b"@/a !    $ ͒a@@." "`㿘#'H'L'P'T` 'X!"@/'H@,("㿘 0'H'L'P'T`'X͒aP "X@/H(@5   <   ` `㿘X @*Ӑ  @*ΐ  (@*ɐ  "c؁㿘@  @` !h㿘  @e  @` ?ؐ!h @T 㿘 `"(@+ ``@b0 @Z㿐@9 ! &@H  & @@ 㿘@;@9 㿘N? `   ` "+NN  2'NN ?А@ `+(!(  %` `  2!!؀ p N  @G͐!&??#"#   㿘!#`  @@#?$#㿘c   c` @?$ 㿘# `  @?$   `̈́"@?㿘  1# `# 6## #@?&#  #@?$   @}?& 㿘 `͢" @А ,% $ ($$@-y@T  @) $ t$$& ( ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ( ) ) ) ) ) ( ) ( ) ) ( ( ( ( ( ( ( ( ( ( ) ) ) ) ) )@㿘 P"c` "`@sW "ǐ!bh@9 ) 'J`  *`  @) J"cJ "͠`" .  * $ @9Ŕ ?. J` "J` @l @?ސ 㿘# ')<% t24  2.  2 #J` "%J` 2!Ԁ2   @ 8  @{  2  @ ) @l  2 `@6 @t@2#! "  c@ޒ " @4 #J` @*`㿘 cJ` "J` J`  @?k @"@H)ɐ ;$   ` ) # "؀ @ " ' @  "`@@H͒b $  !8@9  !@` @B# &! @2 "b ,   *  @8?,  - c & @Ҽ  #@[@G͒bf $@S#Ԁ  `@K@G͒cV $ "" #$``  #͒c F # 5@b01`" "b ,   *  @8?, #"ͦ`" , *`` 2` `@8 ?, #J `@? 㿐` ܒaMc@qА @$$ $ `$ #c䀢   t͒cH2 cc"%"c@n` `2$$ $ t$,$ $($$$ $ $"$$0$8"#"cܐ@ ͔x  0@; '`@,`@ @`#` 4` @͐@Tc @qg v#`?`"$ @"`t$ J ``     $@ `  ` c@\ `@```kb@ސ`fb:  @q$ @`J `` 2J "b .@  *  @7.J ``@ `!͐J `  @7"" @7 b͐#@> "͒  @͐@ǒc#"c"* @=* @6a`Ӕ ͐ @c@ @E 7 @b # $8 " `" `"@#J ` c@*d"0  % b@*\ 2  @)b@'b @u  @p 㿐c@p c䀢 `@E" @pu 㿐c @pmc䀢``  `Β`  `ΐ  @pT   }Δ0@3  @pI 㿐c @pA  &@# t   t@2 2' @8   t   @p "? @p `͐"8*` ΐ @D?ΒH@  @o   &@㿐c@o @   @oߐ ͐"8*`  ΐ @04 `2 @ 6( @ @EPΐ @  2  ``2  @I  @F 6  @Ȱ @E4ΐ @ @o 㿐c@o @   @o ͐"8*` Βɐ @`  ` @o~  XӰ "`0`L p`0  +)'   2$ $  `x   (5  2  ."8@&O"X2$` @s `"` @J` 2>` ` `  c`<@Β  , `h#`h`@F  ` #@  @o `h#`h`@, @D I0``  ?@ $`"` @``@  :`@`(` $``   c@x  ! ##@` @@DZΘ#``  @nŐ @DMΒ  0  `` 7$`@  @n 㿘#'  tcԆ " J` "J` 2  2  2 " 2  ! Β!( !0!( !8Ζ!('!  㿐c @nVc     @nI 㿐c @nA􀦠    @O ` @n0 ͐"8*` Βh @B #``    !% !`  @ @X ?   "$  2 #  3 "@֒a@ 2  @m  㿐c @mݔc '#L` "    @ @Д ? 8 "$  2L`  % "@H`2 @$∐ @m 㿐c @mc耢`"` "` @m c㿘#耢  !!2 ΐ @kaP  2 4ΒaX 0B c  "#쀣 7$c)+ΰ%# 耢 "! " @6   c a# #ax  &#@&#@#㿘   0& ` 2 & 4`t"@ 㿘```$``$`#J `"`` @ ``(  "` ? @2$``$``"` @2v 2]`` "` ` `x$` $`J` 31  `/#` ,`  !@# $`h`($`!#@  6` @@BIΘ a# `  #``<# @zX$`#&$`4` #` #`$  @zEb`4  ?S$`# @)` `2`4` ;$``4J` ` 2`(   " * "`(@1 `(""`,"" ` ""`$"" `` J `!` "ؐ @Y"@#N"`  J ``@-@[ #  t   2  2"0 2 @?vd@?  0"   2  2 0 h @zV HV? ("? $ ( ,l@@ $ ,?/!@$ ($ , (" $ ( ,"@ $ ,"@ $ ($ ,p  $  $t@@ $ $?/!@$ $ $ " $  $"@ $ $"@ $ $ $ @z Hd ` $   `    $@?@E  4h@"㿘 2 0Βa 0`  `  4@`2` 4&  ``" &  &   &  ? #c 2 8 ^$  8`"  @2   ? $ =c  @c& L  : 8c 2L @r L  -c   ' h!  `"R``2 2 #@![ #@0 @"%# ` c ΒaH@cJ `  #耦  ?& & `"@a8  ' `' 2 4  ΐ@$b    ?` ' "ΐ"'#2 +" - 0 З*';      `0>" `09b *  `"./  Βb(@Z[ @#` @@$f"0`  2 `2  `2     2  / * @Z9 @`` 0  b@@$1; `bP@$+`` bX@$#`2O $` '"hb(Βb`@$  '  "b(`"hb(Βbx@#   ; 7  3 )' "(/- +΀`` 0 #\#\@#Ր2 b  "(@#Ȑ     ڀ` 27  @#b8   @!x"㿘  * &*@1c  4 "  2 4 |`   z 2 p`:  %`m k&@L`?F *` €## V` R`0T@1\c I  J 2 @`# 7  0 "  @/  `"`2.&@-    2 0`@{y#    0`@3@ 2`` 2 0`` &@ 㿘` "`c l `" & ` 2@`"& 㿘` "` c @㿘##`@2 @Βb} 0*" 0`   @"`"  !  t @  c?"c c& # #c耦" 2`"`0"""" """㿘 0   "@ &? 2  < =L =X =L = 1< 6\ @ < <\ > < ?H = @ A BT ? M M M Ol Ol M M N@ O< Y Z( Y@ Z( Z( Z( Z( Z( Z( Z( Z( Z( Z( Z( Z( Yh Yh Yh Yh Yh Yh Yh Yh Z( Z( Z( Z( Z( Z( Z( Z( W0 WT Z( Z( U Z( Z( Z( V< Z( Z( Z( Z( Z( Z( Z( Z( Z( Z( Z( W Z( W X Z( Z( Z( Z Y Z Z( Z( Z( UX Z( Z( U` V Z( Z( V Z( VP Z( Vh Z( V Z( V Z( V V V W W X \ \ ]8 ^D ^d ^h(  ''(593?'''' @h' 'v H ''&' J   , B% ,   `J` `\ " @ . ` " #  '  `J` `\ " @  쀦  ?' @ ܐ``$  ?"`$Jc "    *` ?$@ vː!- €J#܀``$  ! [J`  `\ " @  k i g !?+ a `   ` `? -? `   ` `G`? `   ` `?/()`J` `\ " @ v    2,@@ @,@`@ `,@ p?* `#Г*` ` `@J`!`@  [ ` @P(@`" " <"" &`@  [? *`< *,@:  @  $ ,,L  ?$@, , L hR``` @(`" <" " "_&` @ + ? ! '`J` `\ " @  ( ,`,@  '"   \ ", \0:9 \`J` `\ " @  K ,, `'  @  %8  , @ ې %)  \ ` ` $? ,: ,J` `\ " @ t $ڐ  \ " ? ` ͐ ?Ȑ ?$@  , \,,J` `\ " @ = (; {`J` `\ " @ ) (  @ c %  %  $ % @  2 @ N %  % %  W ,,@`J` `\ " @  : # ,,`J` `\ " @  # %@   @  %P @   @  %A  `* @ 1  , X,?$@7,`J` `\ " @  * `2, ," X ?$@  , X,,, ,, , $,@ %`  @  %  ,% J#`Ѧ @ @ 2% @ 2```~ ' ?2@ l , '  " \?2@ X   ?ː * € ("  ) " ' .  \  (  $%  ? % %  %  % `' %  " \% 2    %  '2  % ?'   2*,$ ( )   % 2, ? % `J` `\ " @ )?2@,%@a   $ @u , (,  % %%  } *?2@Ґ  } |?2@Ð ؀ (0ڀ ` \,2,`J` `\ " @? $", \ " 0  ` ,  2,  \, ) (  ?M% `J` `\ " @  )Ő @ݐ6 '4 '  0%  \ '`J` `\ " @  Q, "  @! %  , `i' 9  % , ` " \ , %V & `J` `\ " @ $  \ " `  , \, ,,+ ) | ,?@ؐ ( , * , , @ % `J` `\ " @Z c?$@ @3"" < > L@ ~ ``* @vh B` L`?$ >`?$`J` `\ " @  <- & >* &  >  $ 28$`J` `\ " @ - $@$ > <  $$   > $ | @$@$$ $" d!2m,2j, )"߰ ) ; &` ( 4 7  | `J` `\ " @ | ; | &!,!!!( &&!@? J#``J` `\ " @S (!@!~ t$ q"`d@c `@d@J@  ` @,@`@ `J@ `A @n2$ 2,?L? L? J!@$ @%g   !  }  hdJ`. *#H@%N "$! `"!< " ` @( `"<"" h" d&``i?!  @"㿘 \cX   @ `\  X$`\㿀 .  '`` "` h!' '! ''+-  $ ` ` L@!?$@ , `J` `\ " @h`ڀL  `` 6@-%'@<?$@ , `J` `\ " @5` ߀`?$@ ̐, , O$ `& `?"`㿘 'H'L'P'T'X`?  H `<`? (`<"! "("? @"긐㿘  @ "(?$`$ $ $ $ $ $ $ $$ < $ (!$ 4$ 8! 4$ 0 $ ,$ ,$ 0$ 4$ 8㿘` @J  $@``t$@ː!8*` € s"(@h@`   $`$` $`^$@` `  "8$`$@S$`"0 $`$`M$@`$ `< $$@ U" $`  J`"`<@@= J?? `   ` "`<`<`$$ 9$`$`$$ `$ "$  ``$,`,` $`$$`$`<$@$$$@``@ h` ``<$@`2 `$ "($`$`$@  !@6"@"@J  s$@㿘#J  ` 0  `?   $ @  ,8$@  ,,&` & "Ѐ  "b<@q `J`  J` J`  J( & ,F+ " `H@ɒ ? & ?#+% , @ޒ"@  `$  `, `"@%  ,"  J "   0$ ," $٠?@ V ,Ҡ? `@\ ` %`"Ѐ` ""<@   0 && @$ 0    2)&@ %&##`2JJ ` * J  *`  2J    &   @ 㿘!*` @ #  p㿐 "# '0*@-I# @.C! h@ ɒ` h'` @ ' h @  #D "`HL @ "`H@  0@-&#(@. !$ Hh  'N     ިN  2  ר  @ *: ` ` `   /   `  : @ `? *:  \_ !M J#` ΐߑ* : `V;*`ː!\ €( @(@+Ζ}8 }@>zL`{`$@N"@>l } 2,@@(s@ ̠$@@>\ }  $@&\j .@&U$0ΖҔH@ܐ @{   #`Ӑ #ѐ $ // ݠ @(0@ʐ̠ΖP@('@̠ΖX@(@̠Ζ h@(@̠Ζp@$0abԐ @= `@= `$@M @= 2,@0E`%@,"x@-!΢@,#@-@oΒc@lz /@, #@-@ln _ ~@,#@,@' L@ /@+x@,Ζ 2 @+#x@,@٠@ML$0J `ΔH ``H" А   А ( LL0@$0$*`:`*, :Ζ @$ \///  /  L0@$@oY`( @6W&@!$@0M ! !(  `ΔH @@o9` @&$@6&@ @k*2) "%@$ `"`2 @ "* "2 "` M ( @"`2'@   @c#㿘  㿘  㿐 'J  \  `" @`kː".` €, :  #^  `* @ V  S  P N   *` G`, :  [A @U 2.# L #?&@Z  .L  `h`J  \  `" @   *` ` `2, .: @\ 0 ?&@!.p 㿈   h' ' (' '')J@  @ \  `" @U?$@,`: , [  ]":`  , a$&`?㿘` ?"`  b( ` @` "@`( * *   " " <"$  㿘 `  @J  7"@`    $`J  '"#$`! @J  "@  \ J` "    $`㿘 h`Ӑ!" !$ $ 㿘`~&h``& !t(@%c  , "# , ,`0" 9  # , @)#     %%<#   "$ @ 2$  2$ Ā@   @$  2  0( ` !#` ##̒#@Ɛ$` $`@G  <  $` " 㿘#@>`c@$` 4#ؤ@:ђ : , @:ʒ % N? \ @l͐ ?@lm  L  @: ? . @ "$㿘 % # -̐*c̀ (c $ $$ @֒ 2 $ <  2$ $ 㿘Β @)Z#Ƞ @*3   ΐ#ǒ "#А@-w  q r q r q r r r t\ t\ s t\ s tx tx s w w| w| w| w w| w|@  #, @!" #̖  ????????'7{ @'"`h@('@)@- 9 P#@] #H#@X  #@S @a/ <#@L @`'\ǐ!` ;` M  2Ɛ!`   =  2ϐ"p$㌐  @   #5 @ޒ$@( "0@) `#ؔ *`(@hh* `@hbb @k`  @k``?ϐ@hRb   ϖ#ؒ "H*"  @; !#ؐ *`!   #`  @+   `@ڣ"c"tΔ    @+n#Β Ӑ#@'"@(L /@@ ϐ"@Ѐ  @Ѐ@2 DԀ@ @ ` 8J@ @   8J@  "(@) @@'z"@)_H`@'t Ԓ`@( H``    @@J%㰀 cD"ϐ""@@'M" 㰀 @(?@8 # #J `2 cD@(4@b cD@( @#㰀   @g@Z   ,#,  @” 6L @  h `. @ $@$` ʐ#. @ P\%`L %#L  !h `. @  $`   @5 0   $`  @ٰ"b@.` ⟐#` &%` `, Ϣc $` m   @Q $` @f \@f    \, ,$`$`  $`$`"$` \@ h<   #ؐ#J `"L @ 9 #L  @ , L hh. `?`@&""&@J L ,  8L , J@ 2 #L ϒc(X #L ϒ #X @{ L ` #ϒ #h  @o #J` ϐ#x  @e 0J` @&M#@'Gf J@    @Q @@ 2  @&8"8@'2@  Ր##ؐ *`#ؐ *`#J`  @*`@  㿘@&#  #`@& #@(`ϒ#"@G` 㿈'D'H'L'P'  @ 5 0 'v?L   h`''0''@ `h @  3L "  @   h" "?`ِ"*` €? "P`"`5 @+ϒcȔŐ L 3 h"`H" `h `'D`h" @` " @!@V`  `h" " 㿘 h w`"`"@"`@ 㿈'D'HD`$ J ''` H@  ' '@쀢 " L`h @  <?`/*`ِ"4 €쀢  2 ᣐ"8J#ဢ`D `  D "`D Db("" " @ @"`@ ϒcؔ* #آ % ,`@E D <`L  D`$ D`$ ?"`$쀢  <D D@ CV .  L ?'`8D"  3`L    D&`L"`H (@/   L   D $` N "b V  쀢 `L 2"`L@@Z "`㿘 #J `   "` "J `  !"@հ ! hR`ِ"T*` €`h@~   h` 2`@  h㿘#`h DQ`44 < `h`$ $ $ $ @$`h㿘 h` " `  `@"` @#y` "` ` , R@`"   $` ` R ` @ ޒ ` 5 T@ ( J#•`ߟ` "   @cԀ  ", @ @% @{ @ /@D@Fb@ &@;h$h`㿘 h  "    ,`R@ `@`$  $   2 h" 㿘 h @ @  㿘! h@`@ h`"`@㿘  !  t@2@A  2 㿘@U / 2@5 r  @`(@ 㿐`J c b; `@Ô `@J@ ) (` @ ` @J@  H?# * * 2 `@ ? 2`  А h 0@@Ւ   @װ @*C@ 㿘@@   @Ű @*1@ `    ?0  3 J ( 2J  㿘 – @  2@ `   @  2@ `В`2 Ē А! А! А! А!  А!( @А!0!㿘 L?Т!H,@B @?,@ 㿘   @f= @Cܔ㿘` `@* 㿘 @    $  &@ $$ 㿘Р!\ . @ " @b   $. ?㿘 .`@#J `  њ (@ h "+ޢ 0ЦȨ!\'Ȥ  Б,` "`@eː$?$Ƞ @'Ȣ``$,`ߐ"XЖ @֚ 0z Pа#ؤa\ !N " `,``"`i X``$(N b"8h  Вa\#؄ '` J@  @K@ " *  $` h*`5  @  `㿐#J  *`5 4 0    %#* * *  * ` @'@Ē@ c@  #*     `tԀ#* $xJ P P`   +ђ`p (@B@e !ђ`x *@B x@e x xЖa\ J`  ``  ,@`" *  $`,@*`J#؀`-   @ / ",` J  -2,`  ,` P x@ и#شa\S7р`A2  `o`?`0* `0'? ? ϐ8  O.  , R @/#iЀ`s!\ !\ `  $ %J`@2`R`@ %Pѐ@M耊 !`ؑ*  `J`-`+`J  ``- #J `2* * #ؐ '؀`   耊 2  ؑ* `"'@ '@ M  @%tJ`ѐ [,?`܊ &?ؑ, `2 *`ܒ$ @ِ ؐ*@( ؑ*`" ؔ*`2'؁㿐 @ ݒN J`2   <#$&@  㿘 ѐ P  ' `+ @cƐ@cÐ@@* 2$  @ h `@`H`?@p @  ؁㿘   U + M  * ? [D  ]`2@       !"   23   ]". -  `'20 #  `@1P  `  | )`02 `  2 *  ``?㿘 0퀦   @〦   ?" ` [ * fŀ " 4 Z`"° @  ?    @{ "   ? 2 @g   2   2w  @ِ@> "h   ?g 2\ @* U  N 2C  @V@  M?J  @, @ 2        @!*`?㿘@0( :   ?&? &"c8`@ 2J`2@ 2  "?㿘'D @  `'D ` !`?D 'DD  [  [2  :D [2.  :2*D 2$  [2  :2    ?I " ?D 2  ]Q 'D   'D  " (2D`[= ; !  -    ]'D ` 'D `'D`2 `  " D@ 4  D `}  ]2z  㿘% #   ) |?? |2  2 ` `@/;` 2  * 㿘@ 㿘@]@ "" * " " " 㿘`" @@* ?J@ ; @ @+ ` @ &`-*J` - `J`  ``  &`&@`:-" J`` +2&`J`  `&`?@-`  &@&```&``,  :` `?&``: `; `, `#"N@. 2J N :2` `&`Q.` є!`!і!ѐ 7`耢`:`;<`,@+`?`J  S&` `&`L&@`;2NG&` :2` `&`.`\ : є!`!і!ѐ aؘ<``  إ"(A ?`#2=<`@* `K   *` 2 @ѐ @\a0 2%&`@* ?`@ &`&`  `* @2 @ѐ @\ߒa0 2 &`@*   &`&@&`<`㿘L   *` !2 L L  *`a" L ѐ!@ڒ0/L ' Ѧ!I%1`'`̐$ "XƐP "X ?L@ܒ   " *@`" L  `ث!P㿘'T h 'L`/ bD @ " @@ݒ` ` @``T T@BD@Ő" $  @- !`1/- @-@ T L!X@>`@7( @l@&٠  h`㿘`' @[  `@L@ "` @[& "$@^@ $,㿘 @熔  @K`#@E@   @;"㿘 @   ?  @  ?  㿘   h$`d$@`  @^`h e h}`㿘  `  "(N@ / .'m 2N` .``*`:  / 2   LJ@  :2`J@"@  `&  L /"" "N "@^"@@Zߔ@J / /,  $'" c@ZÔJ / /,  @^t "@J@Z "&Ja/`? 2   . /J@/"`J@ .2K((G(/J`"`/"`.%J`/  "((((`ЖΒ` (J@H/2J@"J@(J@ @/"J@(`J@ @/2(0㿘     "(@] c #"c`8O$`8`8@Z"  "( h]`㿈@]ΐ`h ' ' @ ''@  @2*@ /*@`*@`"@㻐  '&@ d{_N /"N Z@+ / $@@]  N .G 2 N .2 N .  @ (;N@ /@ 4  /&@.@` @" @@Y@.@ @z# 6 .@\`" O / @ " 2N @!h 4 4 4 4 4 4 4 4 4 4 4 4 4  4 4 \ 4 $ \ , | P < 㿘"! h0Ȓ` h`0 "$`,$`$@$`(@v   4`  @ِ@~  ,װ 0` 2@\㿘`"`` @   "`  `0`0``` ђax|    ! hf`&  d & ! h0\` 0& b h`  & ,& & & & & & & & & (`&& $ @i 㿘`"`` @Z   "`  `0`0``` ђa%     a (6 ђa  & & & & & `& & & ` &&& $ @ 㿘 ђaؐ 1 h 0ݒ` h   &,B B `$ @̐?& &&&&(&&& &&&$㿘   @H@} &?"$ ,0 , 㿘  @,@} &? ?& & & & 㿘   ` &  @  & * & " ,㿘! 3 1? 6ђaj h@  $?"@  *@ &  ;    @z^  & & @ @ 㿘!   6ђb4 h@ $?s"@ `l * &a `G d@$@2\?  ,*`   &  " "@      @  + & & & & >& @7  "@ % @ 6$@Ɏ`  (@Ʉ& & $@  &  @Z @& ?ܢ@`  * && &     & &  &㿘!2L  6ђb ҩ @ h=?@F $8"@ X ?2-?  $$      $ @)`2  "    ?(@$ $ $$ $  $ 㿘ђb8\ `ђbP U` 4@V) @"&& &@`@ ?@ @$@( ?㿘ђbh `4 `0 \?(  @!,@@U> " $  4@UҔ&@ @"&& Ң@,@㿘2 ђbܐ   !? ?  $ @`$ 㿘@2@ђbѾ @('?"7?``@` 2.?i ?"%?``@2@`@&`@` "` ?*  &` &@ &`*&@&`*`  &` 㿐@?ђbw ?"B?@ "-`` /ђbh @(@?`$-"6` @`@ " ` ?(@&@&`$` @ߔ  逢 0 2 ` ?2`?`?&`*@`&`㿘 " ?@XƐ@㿘ђb `6ђb  `@@`4 @Tߔ$@@"&&`: ?24?@ $`@ᶐ&@&@  @v 6$@ǁ`  ?(@v&&&$` @T@"&&㿘'L'P'T'X@6Lh'P'T 'X` ђc СȒ P@hȖ'H'L'P'T'X  B H@H   '`  @, `:  %"N@ `2  & * &  `   U`* : `L# *` €CA?"<@;N@7 261N@ -+ )  *` &,@: , ?Ѐ`  ,@-,* :`@  ?Ѐ` "N@` & , 5 ۦ ۑ* : `S#H*` € Ϧ쀌 * : `Y`"*` €   ,` @Z 0,@@w2 2 =  u< -7 +20 -`   04  ,@" 0"!#0і#H`   4  ,@  x X,@ 0,@'@$@`Ѣ#`@W  ` // `@@d`%@ @"@@ L@`+ @`-` `0  )?"*3 0  ? 0Ò &   @*@`& `  @` x 0  ?*`:  `&   @*@`& ` @  0`', `2 < `& * & `,   `  ?L@r &   @*@`&  ``$@, `2 < Y& * & `4 @, Z(?   @ϐ#p㿘 !` `?@}$    "` $  "` ` ` ` ` @  $``@ 㿘@ * #%@   @ 2   @S  @L $ ` $` |Ő |$ސ $`㿘ϐ "#%Ȑ  !@Y   @% ` $`۠ $!瀤! $`㿘  )+ ``% ۅ %`  `@` `瀦 0`* &! ; &   @ 2 2  @і  @ʖ $ % 㿘 `  $ ;! "` # a#& `d$  ! `  @?`?@ b `d& J`  & \#@ `m#"@"\& 㿘  @ "0 "`@ 㿐@X  @ @] P! h`g   h @a` @''' h @Y` @'''خ  ` % ڸ`, "`aaa sЀa!a `{ a`(h  ,h na  00"  aaah % ~̀ah % `=h 8`h4`0 @% `#&  V 耠` "@ :` @`! $  % T%a"a`(c!0riᢐ#,%@ צ% ؐ" :  " :  2 @_# "6 " :  N` #`d@  h$< , , @'''`d" ' h$< , , @'''`d" 'h`" : ؐ" :   ؐ" :  " )@w  %  %   (Д ) {˔ }ܰ@ː `& %  h$< , I, @'''hђ`@ 5#"@`'!  h$< , ,, @''' d"@`'@  #ؚc'% '''''_!" @t @W!`d@&   ha #Ȓ#ૐ#`=#& @C@I@& 0& @:a   @G @&  & @> !!  d& @ ! @& @@+  @& & !  @5!  @   @{    h `& * *   @g   !`d @}!$,9#%@ ,h` & %@h,e& V  ;h h$< , S, @'''"@`'h"@ C&  h$< , 7, @'''"@`'h"@ ' & @`h<`㿘`  "`o "`! {! }@  ͐ W 㿘 Q!@h   & @ @& 㿘`   & < ,"`!!  &   @֐ @=  & &  㿘`   $  "`! {!  }@     @`2$`&  $ $฀ 㿈! h @o` @'''@  ` $`̐  "`( $`%!  h$< , W, @'''d" '`` $`ע % |ݐ! $` h$< , 2, @'''"@`'h"@" &  v ) `` & $`s % 0 !b 㿘@ BL #  *ac؀=cޭJ 2 @[  `& 6 `&  {6  "``h ` U2` /& @@ `h& `  `h"`   ` :"  @* `* `* `"`h`  "`  "@ "  `h` ?2`㿈! h @` @'''`   $`  "`;: 8$`%  h$< , m, @'''d"@`'` $`ָ $฀߀ ;@W " :   h b`  ,  h; ,   '''"@`' h"@ +㿘@" " " 㿘c̐ @ #`# T` "`@@Ő@_" `"T`" `@ 2T`㿐 Ұ! "`р"`d"   " ݎ!Ғ  `dҒ @ @ "@R` 2`@  // Ґ!a"" " "   㿘 h ~x`22 " " " " " " 㿘cX" "\"#  㿘J#`2$ N  b@L  Ғb@L " Ғb@L @Lb(   2 <   "  " $ 㿘 ` $ ` @ AՅ "`   J# @ ``H`D `A`d9\`7(3) (` d` ` "pҔ"x h @ڒ`A   d `dҒbh@L`? .`,$ 2 ` hҔT.` @``@`*```h$< , }`, "``"`@"``@" "@㿘 `  $  @"` !"$ $  @`* ``h$< , }x , "` " @"` `d" "1 "( 㿘` & `@ " !" ?#` .` "dPJ@  @`*J@(8 @ ( * "* * 㿘"" 2 `2 @㿘.` } V  @*``@$.`6 @q 6 5&  @6/*``%`@ "`V  * ` 2V *  " ?6 |@ב*`|㿘T  ?%  * @ @N N@@2   @J 2   2T *  2N  㿘T ? T?* @`@L`N@@2 `@JĒ .2T* `2L`T TX*`T@N  |^ $@$`$`$`$`@J>`4$"R`"`"      㿘@ @Jn`㿘T` h `|* T``  "@ 2`T` &"@< `j, &㿘!"b"ݢ"c $  !" """  !  "  T t!` 4#"`T$$ "`"` `Ȇ`@"$ T$ t$!$ 4$" $@ @ @ ` @! @ߔ 㿘"!"!Ԑ!b@Ҕ )㿘@K# b<  @jߐ  $b<"`40@j@:"㿐 `* @% D A 4@ 1* ";" !%  /`@ ,@M # @%  2 @  @I @L  @  2  @I  ΰ  㿘. "@ݠ@ $   @" ," 4"   2 " ("`4 `@@"㿘 4`@4"@ ! "  @    ! " " H2 @  㿘 <  Ґ bĉ"<0 "<" , @" 4"" (" !     "  2@ 㿘  & 2L " @"" +""  $!2 & ~&  a!#T"$"! !zc &  & 㿘" ,"`4" (b ! $  "   J@ 㿘" ! 2 ` 0 @i< 㿘 !zY#̒#勐 & a` & N@  T    "@& 2  T J#•` π&   &  &  @( 㿘 8 `    @   `  @    @  㿘  8 @ 㿈&@?* !@;?* p >& >&| cT >& !&( ?` *` €#bԀ !kӒ#}#$b 0u֎ L ""@ ~&v1\  ” 0#` kc$`VL /}@\  x@[ s<  mǒch$` ~&h*1d0"`T&8! J$"D G$"Dɞ ~&ϻ!4& ~x&@[  &" ~@&i$"!" `& "" ~T&cT" ?"a&㿘Ԑ ?`/!<*` €!"Ԁ 1k#cF#$"Ր 0Ԑ ђ   "b@1  jc & X 0π 0 㿘@N  @ r!. %!!܀@㿘!܀ + "@r @ !.$aܠN@r`!ܒ @$!#$a܀$aܲrw aܒ?@&a$a!" @  $aܠN@rc`!ܒ @$!$a܁㿀  )! #Ā  !D!D ad %!D\$#!D "%!D!d#\#``` ` uߚ줒 d@b?0Aj   %!D"9d"`5/+- 3@  "0  2?@,`@@+3wS\ `?!D  " `d`"`aĒ %%&&a 㿀 )! #Ā  !H  @  $# !H! #Ā  !H!H ad   %!H$#Ā `'%!H`  !d#`#\ ``` uY覒 `@ܰ?0G@@԰?ru 0s ',`@ u @+97/5- . @uޒ @'=   ,`@+97/5-@* @u+   "Ġ`?97/5-ad%!H^b\ad"v 2`   "#ĐJ?`/  "0  uzĒ &&'!%3 㿀  #\  #`tš蠒  r4 u[ 0@<?   H     ` 㿘J#`  p!0   p ^ @pݐ㿘  H! ! 㿘@pȐ p㿘!!Ѐ  !`Xnc$!$`$`㿘@㿐!Ԓ!8@"Ð c@@   # @@vP!8?b* & @ @@N@`*@`."(N@# * : ` `@ `  ,@o,N@* ?Р @L ``N@`@`.ߑ* N@ .D`N@}x@`"!# *: ` `@ `  2N@@?N@@J?Ц@L~ `N@ @N@ @! *`: ` `@ `  2N@@N@ @''  @F   @F 㿘 " a@@"@ 㿘@A_ 㿘@   '#!%+ -/ i  $#$c $c$#@@uX? fb* & @ @@$| . @%?@7  <   $`@`@Y@@?@$#@a`@R7 @(АM / /-`?< @ /@ 2L ?`? ` L /"?* L /2? @( #@@z3`  @(7@  2  Ȳ@D㸰   '@J Ԓ!#`@Gޒ #` @GӒ   Ԑ"a@͔0`#`)@G  $@ 2  @Xb@UҒ @U O !Ԗ! Ԑ"a@#\` `A `   a ? "@w  a  $a! @P! ? y a`? "`@Z  a  $a@4a`  y Y2g @ _ @`Ԓ!@VS  <  @ Ԓ@ya!? @UВ  @$\ @yQ"/ @J  <   @H   @ Ԑ" @   <  @@Ւ  @"0㿈 @A   Ԓ!&@A! 6 Ԑ!@@J @y "@d @ؒ sc )H @$  %# @ $!@0+@a5c @r # Ԑ!@@4 Ԑ"8@@I@Ig @I"@!", Ԑ"H@ 3 &#`2Ԑ"x@|@ Ԑ"@r@"L@ " @`-L Ԑ"@\ #$@I''(#,@I''@E耢 Ԑ"@G@Ih Ԑ! @͐  "8@4 㿈'D@'H 2!DHԒbȔЖ#\@"Ԑ!@"@>Ӑ @& ? Ԑ"@bI  Ԑ"@x$b@ 2  Ԑ#6b@ 2!DԒbȔHؚ @#@Ԑ!@#@@> @ ? Ԑ"@ےc@  Ԑ"@wc@  2   Ԑ#c@@w 㿘! # "ԒcP@b"Ԑb@cp@ 㿘@ǔ T l 4  h < P㿘@Ș  2"  @Sh "㿘@ȋ   @3 &  @SV  &㿘 @` @^2   ."@, J-`?` J  *8  + J (J? `2 "@ 㿐  ’ 2  @ $$ 㿐  c@v? @R  & &㿘 2  `?J@   ɐ "   㿘c    8"c$ ."c L`*L   =԰#@K "#"#$L  `<" `>`! 0 0  "c$  "c$  "c$. "c"$㿘Ԓc@N 㿘!#$   # @#$  0` ` 'c$ M) VT`@_ "  @G!#@NG  @p  Ѐ  *@ "    #ƐĐ@jc$  @&#Ё㿘#$//    Ԓc@M 2` @F`& ` Ԓc@M @G & @ & $ Ҁ Ѐ 㿘#$     Ԓc@M  ` `" & Q$ ဤ 㿐Ң c$ sĐ D -? (?` X#$*` € -@@J H @D B  /@1 3 `^?` -"*` €  @Cn $! 0 @Cg82  @Ca2   @C[ 4 0  @CT`? @CN@ ֐Ԑ$      㿘wc$ ; m    c$ 㿘c$   c$ 㿘Ԓc@Y `@ ` "``"#  #$`"%  @ސ 0 @ڐ @㿘@h    `N""0"@Ւ @o`M`>䀤<  & ?'Ȑ ̖Ș @"O Ւ`(@Pd ` @Ŋ'̠ Ւ`@@Lb  @H̐ 0''Ȑ Ș @"/ Ւ`h@PD @)  쀢@6'  M  @"N@`>? < `<`4 `1` ؤ`? @;d Oـ #    "P`Oؔ?"`` "P* #"P@\  O@\ђbP @%`@ `    P`?"`P * "P@\Ő 0bP@\  㿘 " `@ؐ"@" 㿘@㾐   '#' ) @6@n֔`? sℓ* & @ @'@ " @":@B@ Ւ`@O @+! Ւ`@O   ؐ@ . 2* @@א 㿘 " `@"@͐ 㼐   ? #cȦ '` $ `@͒   ``7c8("c8" 3 !/@~ *`  @ *  "  2 @ٖ & @ #Ē`@ $@@! ( "` '@@з @ Z $@  Nc(c("c(F" '( @`D $(/      @   2  .•ހ2 @@ؔ!ؖ Ր @Ya 2@@KÐ("` c(`  "` "c    @ƫ!h)  ` '!Ж @>h#@ ?А@Ja@Ĕ OЀ  Ւa(@  L { L b ffj``2g`   ?+ ؗ2" "  0$ !0@a$0H@Y$0`@Q$0 #\x@G$@D@ )  @@ @"` @  "& 2   22 & @J' 2  ``4 L а   @!㻀+ `` '!Ж @=#@r ?@JKa@ O  Ւa(@  L 9 L b f$($@@@   @Ȼ@ @í (@å `0@Iؐ  `4 L ͦ ` @Ŗ!㿘   А :`Ր!@ 2  .2 N .2 *`  `  ` '#!@=, #'Ш''Ā  $``"  2  ? !c$ '  @ט% %cP@Ԁ `p  Ԑ @$``Ԑ @``'``" t"Ь t"`"`' @h*  '2 @a*   2 @Z*  2 ``.22 `/  ؐ@΀$ %cP@ Ԡ%@[ Ԑ @'@UԢ % @  @"``'$@`!@ؐ@R$ &` "`@0Ԣ % @  @Β'Đ'2`  ``:`07`0@!Ā Ԓa %8Ԑ@% &v`Ԁ o`` " ` %?]`@Բ @U'%``@Ԁ  `Ԓa %@qK @2G`̐@    䀢 ?#@̀  @$`Ԑ @'  " a '` X@ Ȓ``''@ @DԠ'Ժ``̐ '̐ ?`Ԑ@͑% %cP@Ԁ 2  ̀ "#``%`` '@@_ Ԕ% @Ԓ$``' @@"# "c    @ö!㿘`  !@;w#@- ?2 @ 0@ @   @ 0@ 㿈` !Ж @;T#@  ?`@` ?     @"# /" %`" " @ݒ . 2N@J 2 N      I-N? ."DN!@Ԛ D!!@e!$`"cа`t& c"t& "$!@' @"#J       .2 NJ 2JJ .N     D "c  @j : 2NN :HN $N? .@!@5 !!!@!`$`"#' t& ## t& "a#`J     D 2 + :  : . J 2JJ .@ה O  Ւb@Ô  L . L b f@@  @~@ @k@`2L צx/ ` '!Ж @:$#@ِ ?@ݰ`? ?@?@` '`$    ?#@            0 @+ /%耦ꀦ/    #\@$#  $2Ք(@   @p "?"cj Ւb0@$@ O  Ւb@  L P M@ b f;>@@ 8  @@@  : @%@!& & @ɔ#"#Ѐ "`@@:  & & "#@ M@  @i"@㿘! #Ѐ Ր"P@˒b`$#@ "#ԁ㿘! #Ѐ`  #Ԁ @쪐 $#Ё㿐` #!@9  ' Ѐ  Ր"P@֢b` $ ?@'  "c @J? '#-@ڐ, N #ߐ@遒 # 2,)Ր@U"h #, @Ra   @Ka `@a@ '  ' %`    `@a"cДc# # # "L "  " `t`" $`*`:    & @"h " &,  "&L  &`@`d'@_1"# `㿘' 0 @   ;   @ 2 㿘 `" "       @ms 㿐@~  .@?` .@`.@`@q 㿘  "    & &   "@& @ $&@@$@  &@ 2@㿘 `" " 㿘  Ւcp@ʔ   P@Д   > @X@` ` ` ``````(`@((&`0`0` (`(`0`(`-@Ն"p@3 3 + + @+ 3 @ @  Ğ  ((0`20` * (`(`2@ *1 @)  1 @/ ) (`0`2 @  1 ղ-@,+"p3 3 + + @+ 3 @ @   ?%@` `@` ``@``#`#@#`#`#` #`#`#`㿘8 @*2@ `?#2 @" @! P@ P @, B> @@&$ P ?  @bB > @`@?  P@ @.B> @㿘`@*2@ `?!2`P , ``8  8`P" @@ `@`? @`P" @@  @ 8 `@`P @ 8 /`P`@* * * 2 2 2 2`2`2``G@/`/`/`/`/`/`/`/`’ P㿘   @v @| Ё 0 ( 0 ( 8ب @h ' $`$`$` $`$`$` $``9?"K` 2+? 2'? 2#? 2??"?    ?@' `"$``  ` `@2`"  "? 6``   @ `  $`@i @ @ % ^@ה  "R` " ` I2H`@ " `  >`2;` @   1`2."$`` 2`  2$``   2$` @ @  q 0 "  2   2] 2@\? V? E@j `@28` " `  .`2+`    ! 22` `2$``  2$` @&  "  2   2 2    &? "&@Ϳ&㿐`  !@5#@  g @Ƚ ? ֒`@\ )@a O )֐`@M )@4!`! O L b f   @M@M  `L 逢 b@4Đ!`@@ ```& #` ,#*` ???`@Fx& ' @OҔ  @W + @9@ 2# @\  "  "``@ϐ $  ? @  & @`)  '&'ܢ@В F @+ ? @Ք /@`+?@ $`"?@  `@q `  ``` 2`ܰ &܀  @̴  @<!㿐@{ 2E @  2 > @䟒 %   .@ѐ $'?@#?,@v   2 @?$ 2@㿘   @՞&` ? 㿘`@ @ `   @$ `  *`@$  $ *  ` `@0 㿘@ h`"U    2O     G?E??   #@à   *3?@ ""-? " '?    ֢ В  @G@?@q2     2  2         㿐N 2`%??@?@ ?@?@?@@ ?@C & @   ?@&? ?c ?#''T'L @ޔ @  "`6 24 `?`?c#شخ $` @Ĉ& `@ `@ ?@]  'L?t " @?ب"@[ <`@ "Ī`@@ * 2 `@* `4 @* 2  L`*"@0$ € "`@  @ `@2@n@ ?#x֔ a@@)֒ %@cf@`2`@`2Z@?@    ?䀢 ??#@?#t !?@ !?#T@ #  ' !?# #7 & `  "@  " @  2 @@>` ?ct@@`?ct@"@ @`'?t ?#LT?#T?#"# "c    @Ð!`8  @  @ؒ  @@@  @@ 2 `@?"ca $   "0.! 0+  '  @'''Ȁ'''  '' '@''''@ '''Ȑ@T @]@[% EĀ   $    2   / 2% @9@7?ch+ `'?#@̂ 2 Li #@ɛ? #֒ap@v ',@ox ?, ߨ L  *`:     "@Ux , @ˎ " !? ?L  ?#̠#Т @ ' F ? #@$@  ?  2@?#` @!x֐!@%a   @    $     2 a  @㿈` !Ж @0X#@@ ?"ch?@  ; Q"#+@ $`` ` ` #\#`@#d  @@r 6@   2   2  ?# @ &`@`2`,#-      "c@ ? "c@0@㿘`  !@/ސ#`@Ó    "#@)" %#N  J@ .`J@d?  .@ J .`? 2 l@ѐ "lNk2  ? @e 4`#   2 L 9`8"4L .L@G 4B@E =8# "   " `2 ``  2`""`  `" @  "#` ? "c?㻈# `` ' !@/5#@ `"#%?֒@$$ ?L .", @S$$ "c?` @4!㾨  ' @@    @7 /    6.@@ `7`/`   7 / @ `5@-  7`/`@@ @` 5` -`   5-@ `6 @.   5`-`@ @`7 /    6.@@ `7`/`   7 / @ `5@-   7`/`@@ @` 5` -`   5-@ `$6 @.   5`-`@ @`(7 /    6.@@ `,7`/`   7 / @ `05@-   7`/`@@ @`45` -`   5-@ `86 @.   5`-` @ 7 / @`<3  @+ @ @ 6.@  '`87``$ /`` @`< `(@ ``@`7 /   @  25*- @ '5-@$`$`@ `,7`/` `@ @ @@5` @-`@ 3` 5-+`@  6. @ $` @@ `0@ `5`-`  7 / 2z `4*` @ @ @6.@  3 7`/`+ %z @` @ @@7 / ' `$ 53-@+ 'z㡕4@@, @7`/`@  5`-`@@''@ $`$`$`$`5-  `(6.`  4 `$@, @@@35`-`+  7 / z @@@`06. `(@  07`/`('z㡄 @@ @@@7 /   3`@5-+`@ @`0 @ @7`/`@  25` -`*@ @  3 5-+ @ $`$$`($`,$` $`0$`46.@@@@@ @ @5`-`  3`7 / +`@2 @@ *$`8@$`<6.@  7`/` 3 @@ + @ 7 / '  `(5`<-`$@``8`@` @ `@  7`/`@   26*.' 5`-`)z#@@@ 5-$`$` `, 6`.@  0@@( @5`-`  7 / $` @`0@`@ 6.@   7`/`5 `4-` @ @@ 7 /   0@( @'5-@ `8 ` `< @7`/`@   5`-`@  4+`3` , '|''@$`@@5-$`$` | $`6.z|@㡔 @@ 5`-` @  4 7  / , #   `, 6.@@ @@|3` 7`/` +`@ @ @ 7 /   3 5-+  @@7`/` `4 @@@ @ @ 0`8 5` -`( @  6`.`'p't5-p@ @  @ @'l6.@ `<`4@@@ 5`-` @ $`$$`($`,$`  6`l.`@$`07  /  @ 6.$`4 @`8 @  0 7`/` ( | l7 / 'h@  `<@ @ 3`+`@ @@@ @5-@  7`/` 3 + '\@ $`8$`<@ \'@ \ 5`-` ` @  @ 5- @4 @6 .,  @ 'P@@  5`-` 67 . /   @ 'D@\ 'H 6.`  @ 67` /`. P l@ @7 /   @@5  - D'<h5-@ @7`/`  @55`-`-  @  5- @ @4 @ ,  '86.<@ 5`-`  @ 47  / ,  @ @\'4 6.@  4 7`8/`P, @ @  7 /  @4 @5 -,   @ @4 D7`l/` @  45` -`,@  @ @ 5- 6.@ @0< @( @  l@@5`-`   07 / (2 !'0 @ @@@@ @6.@  0`7`8/`(`@ \', @ @@7 /   1 @54-)  P @ @@'@ 7`/`@  65`-`.  @ @ @D@5-  3 @+  6.@$@ @ @2ֶ  @65`-`0  .< 7 / 2D@ @!֐ @@6.3 @  +  7`/`$` ,@@@ @ 2֖@3 7 / +    $` @5-8 @<@ @@@7`/`@  6`5`-`.`@  @@`@45-  3 @+  6.@$` @ ` 2֐ @5`-`  57 / -2  @!4 @ @@6.@  3 7`/`+ '2 ֐ @@ $`@@`7 0'/   @5,4-  @'@ $` @,7`/`@  5`-` 4`,` @0@@5-  4 6.,   @` 2` @!֞  ,@@5`-`  37 / +)2!֞  @@@6.@  3 7``/`+   @@ @ 7 /   0@5-(  @@@@7`/`@  5`-`0 `( @ @@5-   2@6*. @@ $`@ $`$`$`$$`($`,5`-`$`0     &  $`<@@& & &  & $`4$`8 @!ȁH;j&. 0㉘ `va  " : "" " " 㿘 .*2@ `?B?>  @" @2 7  ?3 @ ? @  & @@㿈%  '8  @ߕ*,@  8a֒a    aa֐  @(!㿘ѐ  8 @ `*`2 .   @ `㿘#`H  @'ѐ`@a '  @'ɐ!@'`@ D @     @  @'`@㿘Ӑ 㿘!@' @@    @Κ `X`@@' @  㿘`H  @' @a '  @'y!Β㿘 "@y0 '@y& @y!"㿘!@'Q @@L    @~ `X`@b@'= @  㿘`H  @'1 @a '  @')!Β㿘 "@x '@x @x"㿘1 D  ֐!@Ģb& D@ @ְ 㿘@ 㿘!@& @  " X @& @㿘! D @o$ D㿘!@&ΐ @@&̐ @㿐  @x# ! D@B$ 2!'1   D    @7U D   D  @@xO D  @xc|"@F 2! D D`? "`@ڞ @  "@ 0@~"  &"@ϒ 2!"@~&"@~ "!@Zٔ "!J 2!8! &@!  $& J@ , *@"    *@" " #  '@w"" 㿈%@&d h  @  2`/"@r  '#'` $@`l 2`l@%dh% '@` 1 /АВ@M`''Ȓ@   @"㿈 3/D'D@-  ''@ܖ  㿐''@%d%h` @   l@  hh@ 2  @ $h 2'@%d`?㿐`l'$Ø 2'㿐''@%ed%h` @^   l@  hh@ 2  @ $h 2'@%;d`?㿐`l'$Ø 2'㿘!@%! d" "`@% d 㿘 㿘#@%`d! h" @ $ h@%`d㿘֐"    @ 1  & h!֐"0   @{ & h 1 `  ֒b@"0@ZU  & ` 㿐 h  Z T &* .@` `&* .@` `@%   @   @  &* .@` `&* .@` `&* .@` `& * .@` `$@  &@@   ' 㿘 I@ 8@ @(o@v-  "?><" " " " " "  㿈 !  H#d   #\#`#@ #؁㿐NN     2  @͔  4% &" J: 2      2 .@J ".@  .@  հ 㿘!   x' '"h@bx +4?@}0  J? '܀@Րܐ , ܤ`, @k  ܐ@є  @ @Q@u~? " @"㺀' '"h@Gbx *3?@3/  J? '䀢@ , `, @!  @֐ @ @@u5? " @"㿘 (N  "NN      2 ֒b@@㙔 @t? "            @  8 L            T p x     x                      T p x   T  8        1 1 1 1 1 1 1 1 1 1 0h 0 1 0 0 1 1 1 1 1 1 1 1@ 1@ 1 1 1 % / / % / / / % / / & % / % & / % ' ' ' ' ' ' ' ' ' / / / / / / / *` / / ( *` *` *` / / / / (0 / / ,< / / / / / . / / .$ / / / / / / / / *` / ( ( *` *` *` (8 ( / / (T / * ,@ - (h / - (p .$ / / .$ / (x㿘` @&`&`&`  % '''" ` ` @G!` ` ?`,`$7''7'''''@0 @ 2? @`  @4`  @I"㿘# ` @W@ ` @W0 `'H'@ '0   `" a ?"a  2  @ " @s? "   (V Hzh' H' ''''  @  #$@ f젒 쀢 % #"@$$@ ' '5 h  ''Ȱ?//aM`Z@ *` Oπ 2M /L ?Ѐ  33 ̀l*`: ,  @ /*`" b?Р L?Ѐ  L $耢   'H@k耢`, @'ȴ'Ȩ `- @ 'ȴ 'Ȁ`6M @, ' +/M`*GL ?Ѐ  33 ̀*`: ,  @ /*`"  ?Р L?Ѐ  L $耢   'H@耢`, @ `- @ ?&U?TMЀ  33 ̀ԓ,  @ /*`"̐?РMЀ `$95 33 ̀,  @ /*`"?РMЀ `$2 '耢  'H@MM h2 @M l2 耢`- @  ,耢`- @_  ''W `- @N  ''F耢`;- ;@`4- 4@耢`,- ,@@`- @  * #:  * : 耢`- @  * :  *  : `- @ :  6  -/Ϡ`ߐ `a ֐ xb p/a'/ XbȚ P/a'/ 6 `@耢`- @     ''ش#\?А  @غ 0a`- @     ''ش#\?А  @2غ F "#@"k/aj؀ /    / /  & `@&耢`- @     ''ش?Б+`   Дܘ@'ຒ 1@q) a"`- @     ''ش?Б*   #\  @غ ܤ #@#'؀  -/#@L N ``"֤"/"֤" Z "`g'`G@ /& # & "+`: `@p ' 1.`  2`"%'`@!' 耢`"A- ?@`"E- C@@ 耢`"- @  2 `"- @ *耢`"#- !@`"- @耢`"- @ ? :`"- @ "耢`- @X  ''P `- @G  ''?耢`"5- 3@`"-- +@耢`"$- "@@ `- @   耢`- @    `"- @   耢`"- @  ֐" x'/a 耢`- @ ֤"   @[ ?="@ 7/Ϭ耢`- @X  ''P `- @@G  ''?耢`"5- 3@`"-- +@耢`"$- "@@ `- @   耢`- @    `"- @  o "֐"'耢`- @X  ''P `- @G  ''?耢`"5- 3@`"-- +@耢`"$- "@@ `- @   耢`- @    `"- @   2/a/π '  "N ", 4` 24`>֕4`,  `4 0 ,402 0/, @ؖ `0, @  ` `0,4`,   ` 4  ,#@%@`d @8`/ /@ & Oπ 2`Oa 2`3OȠ" -  # $$` ' ': h?  #$$@ ' '$ hOπ ϒ $$` ' ' ihOa  0/`` $$` ' ' Qh`3Ƞ"@ .    $$` ' 'ْ 4h?   $$@ ' 'Ò h" -    $$` ' ' h?   $$@ ' ' h $$@ *  ܀ b# ` $$` ' 'l Ǧh 2$$$` ' 'T hܠ  .  ` $$` ' ': h? `  $$@ ' '# ~hi" 4 $$@ ' ' bh & "@ -    $$` ' ' Dh?   $$@ ' 'Ӓ .h   $$` ' ' h"4 $$@ ' ' h & &     $$` ' ' ަh?   $$@u 4 U  / / $$` ' 'X h$$?` '`'D h& 4    $$` ' '* h?   $$@$$` ' '  hh $$ @ ' ' Th0Ƞ" ,  # $$` ' 'ݒ 8h?  #$$`'`'Ȓ 2$ Ȁ&'#Ȑ"@   2 'Uh  2 ' @ `?@k? "`@ 耢 @6 '   @# P9   ''  '@ؐ@    @Д  #$@w Ā % ?   N `Zx@!*` N ?Ѐ 33 ̀Ǔ*L @  /*`" Д L?Ѐ 33L $'7N*? N ?Ѐ 33 ̀*L @  /*`" Д L?Ѐ 33L $ @4 *@@4 *@ Ѐ NЀ   33 ̀_+  @  /*`" W?И NЀ  $vq o`N h2k`@ hhN l2d` a` _b]d@J4ʐ `@ @:4 b @-4 d @4 `  @4 ` @4 `@ @4w h @4i @ޒ4^ ` @В4P @Œ4E `  @47 ` @4* `@ @4 b @4 d @4 @ @r4 @g4 `@ @W4א b @J4ʐ d @<4 `  @/4 ` @!4 `@ @4 h@4 @4z @4n `@ @ޒ4^ b @ђ4Q d @Ò4C `  @46 ` @4( `@ @4 h @4  @4 *@u s * &#\   @{??&Y? L `=@!t*` `+ @''`-`+ @''`$`+ @''`: `+ @''`: `+  " `+ @''`Ț ;@  @h? " @3'  @#0㿐@@* @6@@@ #\   @?&@@#\   @??2?@@@3?@& @  @$@ &@㿐`,@ -,`  +,``` @`  0?,@: ` ?`0,  .  &eE`0 0. `0. &`    ?"J@ @"J@@ 㿘 `  '֤#H @& )   @  2@ @!@ː >Ԓ?@:@2!, @!,!,O@W @,#Xx  '@ #א @ H@Q $@;@? 0 'P`w'H'L@?i@!@ƒ؀  `nא @n < @ @ `0"$@ 0@b ז $@ސ@U? @@,@N? a ,@`<א @IߒR @ "X@gF``@4?-@s X`א @n4 א @n- Xe`e@&  `א!@n@ @,:`@ z` `א!(@I    *` J@   ` @f!P㿘@ `a@  ??@ @ @  $ @m 㿀@fԤ "?!`ר!h@ů /  !$@[  @>@ 8#$@L`א!p@?!@R `'耎' ' '0`w@ ?@"@f?  "@f`@f? L"E?B@fw`<?@=! a#\הᐐ $@ޚ# @@fZ ?"?@fS`!הᐘ @$# @x@f< ?" &㿈   ?'  @Z ?㿘@ `  @  2 N  .   А  8 $  㿈׮גa@Ӑ! ~ c@%- @ϒ # 2,L@ Sפ! @ Jגa@  " @ L 0גa@” ` a   @p ` א!aА @IR@6 ע a@$ a@N @ J *@ 쀥 @ݐ@G㻐  '@ac( @eg ?":aא"@ #@me @eS`גb @H@!{ O @e@`Hb(@k,@N  גb@@Hѐ 0 ;9פ ?-!+א@bX @"` ,@$# @e" a@H0@ ޠ @N:   @]"h㿘N          *`: ?   ` "N N N - +2N*:  - +n? 2Nk  N`-`+*N C  *`: ?   ` .2*:  .`J $ ?Ѐ`5`- @-`B2*@ *@B `5-@-B2*@ *@B  N 8@ y @ r N l>@dMp @dIl @dEh @dAd  !(a0  K@  `  *`@ R` 2L N ? `   ` ޑ, @@ 3 #?@k @  @^  @ `    @H    E>  (K@@c ""?㿐@c     !0@3` + @0;   4  @c? ""!0 a ? @3` + @; ,2& !, @@   0@ @ؐ `ʨ 4`,  ,`@B2`*  *`bC eC (0  8  `   &`F F?   אbx@ 9  4 ?`c ?!  !( 4 2  ` &`F F? !(Jא@~  !(J#`#\@~    'א" @; "@"P  @,=@,9 @,5!@@-ٔ!,!,@!Y@t @I"㿈   ?'  @ ?   @* J@ " 㿐'D'H   ׶"-'N] `.`?: -@L2 Ǖ< 2 $ '    ?L@ "'`.`: L@@  @:  ?'  ``@ؐ 2@u @ .`   &D@  Y-: U R@ NHN D..`  L   <,@ L`  2,@L "),@L  $>   < "; "   2 "  ,@ `  ,@L Ȣ`,@@ҐH 2"  p'@cr" @ミ" 2L b /$@﯐"؀ @類"薒 'J  ה@}$#($@@7$ $@*@.$$@O` J@  :2`*@`J@  "` :"`  $@`@ܒ`J@ 瀢 $@L  / @\ʐ .?'l@]l l l@$@jm : ?L 2,? l  l%` ?@??  @# 㿐`@` ?㿘` :@\@ 㿈 `///@_찒  $@Ϟ@@ @&@  Sl QP QP QP QP QP R QP QP R QP QP QP R Q QP QP QP QP QP QP QP QP QP QP Rp QP QP QP S QP S QP QP QP QP QP QP QP QP QP QP QP QP QP QP QP QP QP QP QP QP QP QP QP QP QP QP QP QP QP QP QP Q QP QP QP QP S\ QP QP QP QP Q QP QP QP ST㿘  1#(* N%Nۀ`M S#*` €``,`` !`c ސ@ d 0,@z d`Р @w  0, Ɛ@z  0, "\ZN@ N R@P N @``` !"̀` )'!ꀥ"Ȁ`"0"̐@ `` 񀥠 :1,¬ `` :w1,@ * @z6  `` ?$@* $@Nf ฐ$ @$@Γ:T1ׁ㿘 z N?  `   `   N,  N*  ?А   ` , ."*  N? `   `  N?Р  N?   ` 2 N * @  *` ƀ: N  bА* 2  * !h: *`2`:`@: @ 1N"ҟƀ? N"ҁP? '?''   DD"# !8    "#m  ƅā"#\: 'Ԁ 7 Ԓ?'2` @'* ''  * '̒ 'Ԑ`̐" 'Ԑ ̐" 2@@'̑* 'Ԓ<'  'Ԑ `  2 @ @' 'ԓ: ' 2 @ @' ''''''Ȁ )Ȑ ' Ȑ 'А" 'Ȑ ' 2 @ @' 'ȓ2 ''Ȁ SȐ ''  1 *Ȑ ' 䀢   ܒ 'А" 'Ā ?'Đ" 'Ȑ ' 2 @ @' 'ȓ2 ' =אc8ג@@?אc8-אc8ג@@D??'ؒ 'אc8?ؒ ' ' `@'ؑ:` '2 'ؐ `  'ԑ*`@'''?聠"# *  *@2@*@    2@ : :*:       @    㿘    b`  ?   b`  8  R  @ $D` @  $$`@ $:`  @/  @ € $@D@`@ €  $@$@@` $@:  @ $D` @  $$`@ $:`u ?n #!@? ?#  א#H3   2 "  S Q 46, 6 +   " B `  " " € `" < . > @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .         b`㿐?H  @  ?@ `㿐? P ذ Z  X B `7ąB' B'@    ɖ @> . 6`  `6 @3 @؅? P ؅$% `7ąB' B'@@ f  `  D'…B'@@ F #dd؁#dd`h B BpBD# ?B#82    #dd؁#ddx B BBD# 2@  2*2   㿐    b`  ?   b`  `V  $D`  $$`$: 7 @ s  @ $@D@`@  $@$@@`$@:   @ $D` @  $$`@ $:` @??#@a@? ?#@  ؐ 4@   "  d`]4 6 6 ,@ ,  @  "B `  ""€ `": .  >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@.  @@b  d , 6 @4 =   b ?㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@ <@ 8㿘  R  @ $D` @  $$`@ $:`  @ Q  @ € $@D@`@ €  $@$@@` $@:  @ $D` @  $$`@ $:`u ?n #!@? ?#  ؐ!3   2 "  S Q 46, 6 +   " B `  " " € `" < . > @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .      㿐V  $D`  $$Ā`$: 7 @    $D`  $$`$:   @ $D` @  $$Ā`@ $:`  ??#@? ?#  ؐ"4   "   d `]4 6 6 , ,    "B `  ""€ `": .  >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@.  @ @b   d , 6 @4 =$6 3c@$ 3c@㿘  ``?` &``@ *:    @ *  &@ @$ @#㿘 L@  .!!*!@鳐@J /"J /2 L@ /a . /*a *"J /"" # 1!@Ɣ.@X  ?"` " (0 (`0" " #`@"    `  0 "! H P """  """㿠   @" &  g @㿘ؒc @#2 x  ??''쀢'@X4 " ?"Ԓ *@ @  '@ ؀ ?؁㿘@ >@  $>>2   *` 㿘 ) 3 & `&   &@ , 㿘   2?2?    `*`,  @t  ` `* ,  &?   2 ?`2? ?   2 ?  2? .2 ? 2 2 . `0 *`    2?  2 ? .`2   ?  *` 㿘2  @  @⦐.. . . . . . .    ?  ("   *㿀   ' 2/?  )?2  *@Ð6 .`. @` @`'`'` ''&@&`&` &`   `   @q# ? 2?2 &? 2 2 0 ` *`  $ y y y yt yh y\ yP yD y8 y, y y y x x 4^(.#+#(#% " ( X x   ! !  !0!H!hِ!% 3c@ |t | | | | | | { { |, { | |D { | | | | | | | | | | | | | | | | | | |\` ``*`?`[`#??  &` `  `  `  `?   +`\ @ +G` E^Ї*` \+  n+ \+  r}+ \+  bw+ \+  aq+ \+  vk+ \+  te+ \+  f_+ \+  sY+ \+ Є 0+P + K+ ` 2 ``*`?`[`#@ ` \+0  00+ 0+ ` 0(+@` \+  M+  `?     ^+`  ? +`@+ -+ +  +㿘@N@:`@*``2`"*㿐N@ nl)  *?[# @  ` 2%.    #    @  ` "`. \  @2`*.?  `` N@"@ @:N@ 2.(&N@"&` N@N@"&㿘 N@`wN@8N@N@m "*$ 3c@㻈  +a '753/@r$ @qa Z#٢!@_a %a )J #@R & @M & @ a  Ḑ @& !ِ!&  @4찒    #@! $  @!찒    #@耢$   a@ a %a J #"a@ $ a@ $  a@쀢 $ $ $  a@찒    #@^耢n$ aА @۔찒     #@M耢]$  @©$!ِ!@Ŕ !!@ᕒ *٠!@᎒ #@ሒ a@႒ "$ a@ @Ր  ٠!@m $    @6! 㿘!`@:    1 ! 㿘@* " !@7 !  !  㿘@  ! @!  !  (!! 1@ 0"@l 2 Ā@<  @Sf  O ""@>b$!   㿘!! @"$!㿘@(   2H( HJ  " H?" J  H  2*? " 2HJ㿘`@S ? "@ 6`? -&   ,,-`@o  6 @` 4ݢ2ت`i@P @,` @C @,`  # @3   @$-  @,`  @5 @   6  @,`   @,` ܨ@ΐ 㿘@Rc" @ ?2 @RY`2?  @R ? ? 4 ?$ 3c@$ 3c@% 3c@$y 3c@㿐 @?.@ .  ?#@.   ?#. ` '@=   !  'L'P'T'X'''" ` ` @/! 7'@'bc''''Đ@\'L  @D" $Q 3c@ $v 3c@㿘? @SS 㿈 2'  'n耢 "'$΄ 3c@㿘 "PĔ$= 3c@$i 3c@㿘 @U^ @Q? "$: 3c@  2 ` `x" '" "  @؀ ?  '$Z 3c@$S 3c@㿐`w@ ?㿈0 ْ(@ `@ `@0. .`0 ?@0@ ///`///G/ @* @ * @ * @ *ֈ 1 ///  @. `@ 6 ` . (06`///ٲ(@*@ *  =@*  =*  *?㿘 H "( @ e "`   `9N +`3N@R"@* .@*  `I"@@: .@@**`  ` `9"@@: .@@**`   @+"@@ .@` N  `   ` `2N=ـ=B N     ; 86?       ` `2N=2"?N      ` "?N ` @ ?0?㿀@' ''''  `@3H`0   `a ?"a@ @35㿈' `1 `#\ `!0p@kc !0$ 3c@㿘 N  .!H*!H /*@J /"  J/!H*!H *`@" J /2"  #1!H@.@O  ?"$! 3c@㿐#\  @&  㿘@% 3c@㿀@ .  '?''  `@20   `a ?"a@?`  @2 @$$" 3c@$j 3c@@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" $+ 3c@㿘 @l 㿐  ?  @޹ ?? $. 3c@㿈'H'L'P'T'X H "!ٔ!P@i('& !P("@ @ ! "!P@iɒ(!!H     ?'  @q  $!H!H a "" $7 3c@$8 3c@$  3c@$) 3c@$ 3c@$ 3c@$ 3c@㿘 @ɒ .  (``  ,+  *    * @ `J@  @`*J@  * .  ߑ+ *㿐`2&@2&'5+L@ 1ڤ ( @G  2  `@< 2  `@ &@  & ڤ   @Sa 2&  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@$ 3c@$„ 3c@㿐@'!ڪ_!L [@ Q" J``MJ  1ڀ`M*`k`G`K`(#!!`m`g!!ڨ! !ڨ!% $ڨ!$!!@/r"% @ڐ!@/i W !ڐ"@/]a""!ڔ !P@h>  &&  &&@!P$Ä 3c@$ 3c@$u 3c@%% 3c@$  3c@㿈`  `@''''$b 3c@$ 3c@$ 3c@$ 3c@$ 3c@X  >' 2 @: 2%!! !  ` @  2` "`@ `@Ӕ 2۔@g 2@! @` @!㿘 ! "  @٦  2 ے@g1۰!$9 3c@@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  㿘@@ @ِ @㿘bL   @ %= %bL@ Ȁ @  bLbL`? "`@f @  "@ ဢ0 L?   ` 2 *:  "Π #"ˠah"ah  @*H$`L $`$`@$`L $`@!h"` "`L LH % ےa@  L  `@ `  `` ?$` a@z  L  `@ `  ``  $` a@b  L  `@ `  ``  p$` aȐ@J  L  `@ `  ``  X$` aА@2  L  `@ `  ``  @$` aؐ@  L  `@ `  ``  ($` a@  L  `@ `  ``  $` a@  LHL  =2 LH@n$`@%L ELH #" L #2 !h L "  " !h& L "& @ 2,J A"62 J\2 J ""  *@'`# *H&*  2 *H* J "   "   J "  "  " 0 Jŀ"*㿘@ =   㿘1"L  ې!@xb&"L@ @ 㿘1"L  @Y8&"L@ 㿘"PbX!  @ ! @In"   '@ P @e X@IWP< @ H D " .@ .` ".`  .`  .` .`  '  ?8h8 '<'@'D'8 @H 2 LH @ "@L` @  @@  @o" (@2`" '@H+@24' "@20# `@ @@b  @@`@@bې 2@2  ` p p   8 p X hI @Jg" `8o-"H  XJ+"F J ?`F  u2B a00 `   +  *@+  *@  *@* @* @"    @ *@"  @  㿈M O?'@  @I̐ @Iʮ @  @} 8  , M? `0 `   ` 3 @*Ĕ J`@|q@H  " @} `  =@/*@|Y@G " @|P 0 M g  o a *`:  u*` : mid8` :  +  - =`=*` }  ?* : ` nl ē*` €$`" `" b II -@} & ? ?@ <@ < ="  +` -@| & ? ?@  X@i  -@| m& ? ?@ M<@R?2 << = ``<="  -@| H& ? ?@ @-` -@| 0& ? ?@  X@P M  ,9*` .@T`g"*`o`= -`X`+`-0>0;`u06*" -"   +* ("  %" *2 ?* "  * " +-  =  *   - +  X"`" `: J@+-X2@   `J@-+`8  X`8  `( " **   " **  "J@" ** ʐ p  '` @yِ A  ۘ"0  2  *  **.@   ????` @|"HP   'a P  @(?耦4!x 5 ;  ` @ > g2$  $ @_ 4@Eu@E "s  @|>"X㿘    # ` '#M` @|"h㿘'L'P'T'X@L㿘 "! ےbx@"`ѽ"ې"@b@a<$\ 3c@$; 3c@㿘bآ @:@Y  b  b؀ @<㿘!"@! @^ ؠ  @4  @N 2 ؀ @㿘!#` ې"@b$#`@Jbؐ"b؁㿘!#` "@$#`""؁㿐c`   ې"@b $``@z y J?` 2'#`!#h@0, L@ #@ג # 2,"#l@ې #l* ۦ @b `, L%L "  " @⠢ ,@`@7#l| " ""`  "'$L " *`:    $@՛ , @c⠠ " $,  "$L  $#l㿈L@ 0  `L@ x X2 @ ` @, `<  :`?   `  , ?Г:`! $, : ?   `D : ?.    ` ?? ` @, `ʖ*:  . `$? `   ` 2$?$$:  . *  $ 3c@㿈 2 ''   @- ?) `"@wj좒    @ ? @C @xD@C"@s@x; @C " $ 3c@㿐N'J@  =2`J@ ="@@C? M" @o  *`"`' *  `"   $@S ( !`%  2 $<``@x*` ? ,`@Х$$$ @" 㿐N'L  =2 @K$ @ 􀦠 m''* `" &@ &!`% 2&<  @x*`  , @M$'$@" @v  *`" (?`*`* : **`: *   =2 =*@*`*  @* *`` 㿐 'N  = `J@  =2`J@ "@@BŰ? "!*`  "  "@q  㿘` ! ܐ @B@ !  $N @B " 㿘 % X ! @<.  `@By $X*` @f  @ @Ϥ ` ` "㿘! @X  ""X x@Fےb  ؘ '''''''  `1 @%u"P"P 0   `"Pa ?"a"P@`  @%a"P  ?2"2   *@`*@ `2E   *@`*@`    *@`*@`    *@`*@`    *@`*@`    *@`*@`    *@`*@`    *@`*@`    *@`*@ ` ??     zg# "" " " * * !㿘'L'P'T'X@L㿘@A!  "ےb@"` Đ"ےb@"@ې"@b@]<㿘  @ 㿘 ?*` * `@N  2! #a@   $a@k 2$` 1ې!HȖ@\Ւ !H @  㿘 ?*` * aXN  2! #bX ȅ  $bX: 2$` 1ې"`Ȗ@\ "` @  㿘!  " @$P 2`  `@$L$] 3c@㿘@bp%3 3c@%$ 3c@㾈  'L'D' @@ #  ,  "@ , `  ې"   " @@ ")  %@N   ?????'̐ ?'•  / @  ???''????'???'u!'p'' P `  @ 0        ` L@MDD@ EL@-+ /O? `   `  O`  *`@ R`/ O` #*`@ R`/, @YT  O` ` ɀ@@,̀ ېb@  @L , # @{? p@?`p X p p P l ` h @ d  ` 0 \  X  T  P [# , @`" @?@C "   4  &    , ?@?"?    @v"㿘cp  *   `  '`''' ''''' '$'(''`  ``0 0 ```R@?K? "  @u"xې#c?' '> ''@ @?? "   @ '? @ aې#< ѐ  ͐ ܐ@E  @  潐 ??܁< $ b(" c4" p ?" d ? l0 " - ?" s ?*@`! - r*@`  - w*@ (@@` 0 @ 0  - x S s*@`  - r*@`  - w*@ $` 0  0  - x S s*@`  - r*@`  - w*@ " `"   *@ "   *@ - x T t*@` *@*`$d 3c@$K 3c@$ 3c@ o 3c@$  3c@$z 3c@JJ2 @(*`*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  $' 3c@㷈''쀎`'"@"``"`"``~"` "`"`@ #4J?4G?" A? @`@ - ) 2 :%2  2`@    \2 2   \?2 :2  2`@` @ 㿘 {  }   @I0@n { @?0@㷘@ @`2@ 2  " [ {  ] 2  "   }`2 `   〢 [` @U@Q@ [ { ,`C` }`=``@ ] 2`@ "0 /`,``(`,"%` 2   * 2` * 2`Z ?``@(@ 㿘 ~6 (2.?  *@`@  /2*@N @= @(# . "%   2 *: 2`J@  @: 2* 2`2   @`  㿘 : @@_ "2  ]",  < "\`@  ֔ 2`@J` `:"\4$@: 4&@,  @& ?㷐$X''@@` '  `? *`] ?"|`  [ *|  ! '@ `@ ]  [2 !p'?l' [2 !'!2 '- ' [`: i    [' :? ]` ^ ] 2'@ -` ] 2' 2 ''  ]'` !&` 2@!&` 2@` !@&`  `2@' 2@`'  i'2@@0 %@` 2 #"?@H ?  `,`*` z #|@$  㿘@i@㷐  #\#`@  \`  / K /6@ݔ p  @" ` `$`@:?"6_6 "#  /9< 3@(@2 @Ք 2  2  (6< 2 `$ @ɖ1  @2 `2@  /2@  / 8  6 /  #\;`@㻈\ ` d'} @:,6"@' 2` ` @$ i?@:`€ `?` "\ [ X @ ` 4> Ϩ 4#@" J @8$J . ." @4 ` ې@& ? 6#\#` 2`  2` ` @`@  @9?" /66@"   @p#㿘`@#   4 `#5,`!%, ` " `  "` @m` " ` "   " `@m@  ` "`@m&`` ?@m&``@n "`` 2` `` *` ?$` @X&``@nɒ "`` `` *` @?$@&``@ * 4$@ p&` ?#_@l p`@ * Y$@h;h;;; ;(; 0;(8;0@;8H;@P;HX;P`;X;``@ * "    ": @&@l\ @W "@@m<?` * `$&@`@`  *   $@@  @8?"  ?㿐@:z- ?@@ `[*@ @c@"^"e  "\   W  F  -` @! `? 2`@  ]`1,  "` :-]2`-`@  * @''@4  `@ 4`4` 8 ``@( `" @`ٓ, @   @*@`?㿘 `"  * ?? @@ ?@l?`@l &     , @ "@lr & @lk & 㻐  '  @q$   `ےc@$` @`$@@!H` @nH#㻐  '@G$ ? @(€` @n%#㻐  '@$$ ? @,€@P֒` @n#    (*@ ` 2                   H         D  @  ? 㿘  `? "@    "@  @(*`  *02 @$_ 3c@  3c@"` $/ 3c@$a 3c@  '@i (  ې"@ڒc^ @i!  ےc@ΐ"0Oc "c& & & & & $@$` $` $`@ $`@(`'H 'L'P'T'X'\@!@<ےH !,`€ $@$`@i $`@k`@& `&@& ` ې"@c, `@@j@j~ ` @l#؁  ؁  '@|!?% @/\ @   "؀4 p   @ #@`W @lA#㿘` $  !㿀@( $` @`   @j$ @   & &   & '@$ & &  & @\ `$`@2`8  $`''``@ϖ  @< @* ''  €@< "  @$`$`@&$ '@;``@㿘 $@i   @i@i $  @i@i㿀 $`!@ @  @| 2 @  @$a  `@$I 3c@$ 3c@㿘` ` 2 `0@ "`0@4? %"   `"`a ?"a`?` &``@ , :   @ * &@@㿘!  @ @㿘`0   `"`a ?"a`` `&`` 2 @@ "@@4? %"``"  @ ? `@?&`*@``&@`  @ ?                                                   @ P t                             """"$$$$$$#l$ $$$$$$$@$h(    " @@gq!S 4y * @` $`@i  $` $`@hJj @$`$`$@$`$` И P` `H  " "  ! $ $ 4$ 8  !$ $ $ $ $ ($ ,$ 0$ <$ @@$ D$ H@  `?$ @:   "@(  @8  @ u`$ $@ -@ Ғ@ @ Y4 (< DbE$ L$e& & & @ ` "`@ i`㿘   @J @:  J@ | 2@  @&J@ |!` & "@ 9  "@   " @ Y "@    " @ K "@$㿘 @?ܑ* : ` X&"* € @ @C   D`" D D  ,  " @Ӕ @J@ )} )  ,  H" @ J`)g&@ c@   ( "( `, T"`,@  `( "`( 0 G"0@ C@ >  `@:5 @~ 0@ , @ @В  , &@:` @:,  @   `  @ , :`@ڐ @  @?֐ , :  ? {`  `   `  ` &@ , :  +"(  ? *"  , {J"@( "@  "@ "@"@ "@s "@ "@  @$" "@ٔ  @ $@Д S@0 @J@ ,2`& `   `   !@@@  @o @:  J@ }2 `&@ :J@ }"   @ &J  }  @ @ @ݒ  @ ! @?֐ , :  ? {`  `   `  @ 㿘 @ @ &@Ր *J㿘   @ J@ ^2 `&@1  `( "`( , ", @-  @  ` :J@2J`` & @   `( "`( 0 "0 @Z 㿘J@ ``\ & @ @J J &aa)|a{`." `[`*,`:`#a(),`:`! a}a9,`a1 ~b[,`:` `@r| @ w@Bs@  o  D`" D D  ,  " @ @ `  J@ \J` ) \G )  ,  H" @} @ ` J@ \ J` )`,&@ƒ (.` H @\ `@@@R @    "`H`2:`@ ,`:`@ː  @"J *  &"@G "@( "@; "@| u s`$J \o`$J {k`$&@l @ #J@ , ` & `   `  !@P @E !@ @ ` : J@ \2  J` }2 `*&   : J` &` :J` \2J }2 @ @  `$  㿘     . J@*`А @ "   ?  `  $   @Ӓ 㿘    ݒb@xY  2&   ݒb@xJ   (@Q  &@  @J@ ^2 `&  @:J@ ]2 `&@ ` ] *] ``] @:"J@ -2`&@ ` - *- ``-,` ` : J@ -2J` ]"@ @ :J@ ]逢@  @:J@ -2 `&@ ` - *- ``-,` J`]&@=   o ` 1`?,'` % @ `@ ?  ` "?@ * :  @ `@* ` ,`?<@` @1- `?, @ `@" * * `" * ` ?,`  `" ` @ ` * * `?,`` @@˒  @@@>0@\@d 㿘 @ J@ - [    * @ 0*:  : ="40e   &@ J - ]@ @ @ @  @  `  J@ :J` ]3`@q 0m   &@h J - ]@^ @ @ @T  @ ` J@ = J` ]`?&@> 0:@ @ J@ -2` :J` ]"&J` -`& -@, *`: :`@@ @ ` * `@   .`㿘  & @ J? `   ` 2""ܢ` @  @vr 2` @J`2`@В 0!L  @ `@* ` .`L `  `@@v L 㿘 =@L@ ` + `@.`㿘 @ @   ` :J@J@ [2 J@J` .2J@`$J@`$ .@ @ ` J@ . J` ]`$@c . > 㿘 @  ` : L@2L` ] ` &` :J`2J ]2   cx" cx@@u 2`@J`"N``@   @ 0L@  @  `  *`P( @  `  *`P(*`: 㿐 &  ]&/// & &㿘 ` `8`   `   * : Ւ0@V`   `4, "`4㿐 &  ^  ]&////ː& &㿘     .  `y#d*` € $" r&  "@(`Ԕ  "@  @F" "@  @= $@ 0M "@ "@  "@'"@ܔ  @ $@Ӕ ` @ 0% "@ܖ "@0@~0@t0@  "" x" " 㿘  " 4  $64 @a5,  "E" @a, ; " $@,    :`  @$@ @ː "   -  < , % $*@,`,`$`$`  @_`" @_`"` `  (  @ (*@   *` 㿘   *`   7` 2. * @% @  @ ` @  @ @@`@ ` @ @ `@ @ @ "`@ *   &@>    `@ @" * :       `@ @2  㿘`@ `  @`B&` 2 `` "&` @_&`  0"?@C&`  &8    ` "     `&8   `  "     㿘  '`8? @  Ò `4 &`4,@ @ 2  ɔ 2,@  $ @ $ @㿘  @c@ .` *  @k. @$ 㿘      `2`@:`*` @E @ *`"`& 㿘  ' ߐ ,   H.    @ "@ @  "@ ` ` "@@@* "@    (@> "@㿘   @_W.` 2&  0& 㿘 &`  @_F*` &`  &`㿘  w `  >1-+)'%#@ `:0`@ "3 / &`@" !`@""c>$""`@ * @@  2`(  `@$ &`@ 2@`@ $@\א  &`<&`@ &`(`@`>@ `@ `*`*  ! `>   4  2`("`(㿘<"e@& "4"E@&  $@]c  " @]]  " <@]W < @]Q@]O$Ƅ 3c@?ch?#ض  @z ޺ ?@ ?# @!?3?a/?#?  ?# !?#?󀢡?#?  ?# ! ??󀢡 ?#? ?#  ̀??  ? ?# ! ?#?  ?#  ?U#؀Q??# #?  ?# !  ?6@! 0?#?  ?c@  ̀@ ?"@ ̀@?#?  ?c@ ! @  @! @ #?    L # #?  ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"  ` @! @2` @   ??  ?# ! ?#?  ?#  ?T#؀P??# #?  ?# !  ?6@! 0?#?  ?c@  ̀@ ?"@ ̀@?#?  ?c@ ! @  @! @ #?    K # #?  ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"   @! @2    ?#Ԑ# @ ?`?D '#\   @2@Zr  x?@&? "@ a` , 4 $    "?J 2, ?:#@ :E4&@ @? ?`)` ` % _ J _"@H 2 `?$  ` , `4  ` ,  "J 2L Т` 8@1 `?@Z0#fSF  @   `? ?b  ' 4 @ 4    i Ӑ d?cH N ]آ   #\   @?@Y F ؐ @Ȕ 06*` *      @ `( ( @Zd   @Yp   @@ZL?#\  @h??@ ,`4`$`` @  `J 2,``z0d %`@?`W@ "SL "O @B " L _2;`  @8 25` $` ``"!  ``  ?#@ " #`   ,`@ ,`,`  ,` 2  ? ,`4`  ,`` @ "L  8?#  @" @Y -   @[#㿘 "x?  , @€? 㿘 [ ?خ㿘 @?: 㿘&@&&   @*&"*? &&  㿘  `"" 'D@’ = ?$@Ɛ 5 17  `"  " &N@ :"@G& ? ` @mt 2 @܀ a-` `! "`" N@ :ސ#@   """"N@ ? :"` :0^ ?`  "" D*``"%ℐ `:`"܀`5` "`" N@ :ސ"@   """"ℰ ??%N@Ā`: ℰ??% "`  N@ :ސ#H@ ""  ?2'@ `2   "@㿘a! "? @ #`@ $"" *`:  + -"`*`:  + -  "`) %"$"`""' ?  "b"" J`!%"  bސ"$! "b""@ " $ "$?%"$b6?*@$J - J 0 @ - * ސ"` $ * @  %b$`# b?! " "?b$""@ " $b $"  b?2"bJ` "`$J` -J !  "ސ"$⌀ $"O""" "@$?%"$")* @⌀ "%JJ`-`"J`-   $⌀`:@ 2 G?ސ"$J  :$⌀ -J  -@  -J`"?J`  $ "`  N :ސ#0@ ""r ?6 W25`J` ;1`J`! $ "ޒb $N :ސ"@d W ""N`:L ?J :* @$⌒ޘ ޒb$<`J@ : J`3 0$%bJ "J`"%b܀ : $ "ޒb $N :ސ"@% ""N`:  ?  :* @%bސ"`$$㿘  _ 㿘U 㿘K $ 3c@%7 3c@$O 3c@$t 3c@$ 3c@$$ 3c@%6 3c@$P 3c@$ 3c@$ 3c@$3 3c@$ 3c@㿘 @" ? /"@㿘N0k N x XfN  a? `   `D U! .@N H Eޤ#p# ')+ހ` @ ` D 4` @ `    *@ R` @"`(@㘔#c@ a  .@* .@ߴ`.@ N ŀ 2\[?ɀ `   ` `%ޢ% ')+ # @ `   @S"` , 㘔#c@ r*  Nް  .@`/.N  @ `  Ϡ 0s?/GN B? `   ` 5@3+ :   %ހ( `   ` ` @"`  ,`ސ#@O * @ ` 7Nٰ ,)@'&@ `       `  &@* @ & * @ &@*  .@`@ ` @  @  ("?㿘 ߒ`@"@`㿘 ߒ`8@ "@T$R 3c@h  \' ߒ x @    @  *`@ ٰ? @" Ұ?  @`=`(*  ??'؀`6` ߒ Ȑ @,?"@Q @j͐?@@jƐ ߗ6`@;’" :?8?@֔   0: < @ 8 22``2`*`        ?#@2` 2`  2`   `? ? `MK``2H? 2@" =?@ڐ 7?!""䀦``@@ !?@@c "?  @    @ؖ ?   @V 㼐  ' @" (?@`@@$ `@!   ? @ %@.*`  @UՐ Ё㿘 ? ?   ? ? ?@߀  @J " @< ߐ@:  ?㿘 @i@i 2 `"   @    @&㿘!Ք   㿐@m    􀢠 `" ` 2`22  @} @o@"㿘  0 @ @2@ǰ  /"x     '#\@:.  @  "@A` @U  0    '????  4 :`*`$*`#@ * * # ?''  ?,` ?'' ' ?@$'''', ?@''? ?'P ?# :/ @ 2: :[ ,2 :R ,, ,  , , @$ 8 @@$@9o $6)   @    @ :,   ",@ " @d  @T0!   'P'L'T'X'''"`` ` @!?"77@Q '' ''֔L?  *@S "& @Q'@& "? @S! 㿘'H'L'P'T'X@H㿘 "! ߒa0@Đ" "ߐ"@a8㿘   @?`  ` `2 @ - +L@  L@` 0 L@ x XL` ` 0  ??  + > @? ""?σ  @`?` @ `  ?ܠ?` @ `  ?` @ `  ??à4 `2&@ 㿘%?  ? !?`΍!@` ߐ!H ޔ ?" Q  NK  $ ( 㿘q bm `9 1 *$㿘 "  ${ 3c@" JJ@ `2J  㿐@eT@?ߐ@EܔX㿘'L'P'T'X@L㿘 bT@mӘ㿘 @o]⠁㿘 @ok"㿘 @b `"`%4 3c@㿘@  " @Qޒ ( `& & $`& $@$$@@ o߬ ah@y e?$8 `.  @ Q@g O`H&`&`8&` $@ * 2``6`<6`<`&` &`%   פ@ h@7 &"  2 < $ߐ!p ۔ &  $ & $@O0@ "@8@O@O @O 㿘`(`H&`$ @@$ / @2`L`  `@f@ &`( `0&`&`& 㿘  ` @O  8 6 @O $ ?   " @  @O@O @O @6Ɛ@1"㿘 $@8 `@ `4`@@ +4`<`'`<* 2  !@ * 2``94`<$ ߐ!p 6  $` @ 4`<$``> "4`>*2  Y`"  >$ @ 0 @" > "l  " @z$ 4 <` *$$@k $  @ʔ? "#@ >`4 >$ `"\$` $```2`@   $$@ D$``R@N`8 2`@$  F $ $ 〢 2$`@O * 2``4`<$  ߐ!p Ś  $` @] $`4`<`> 4`> 4`@` $  J /@  /*@`(`@ڒ`HS$@N `8?2 @N@6"$F `$* `82 `>$ 25`)  $ ` @ ͦ` @"$ $$$͛` `2``ߖx@ ? $ $$$`   4`<$㿘 6`@@  "㿘` @@װ  I"@" $@2A  <  ; 29   "@e@2  $& $  8   J`/ $ @& ߐ!p ה @& Y % ! 㿈 @'H  HH`\  @|5 <%  2 $ `  ?`  4 ''쀥'H 2 '@@k  H2 >@R%  >' @K5 >'@  ' $ J?`/  $B  / *  8#"@'    2 `L` .2 `L` ?` ` `@`   `@ )@ `@ " @ @M_@@: 5 < $ @& $"ɰ "   $  '@ "$ 8$  ` $ $   4 <$ 4 < 6$  쀢 " $ `  "  $ $  H $ #4 < $    ($ @F H H$ @  4 <* 2  *`2  $ &` ``@2 2c $`@Ő耢@Q $    2-- $H 29  8 2   $       ߖx@a?  5 < $@]& $ 2 H   5 <@L@@} 5 < $ @2& $ ?C"  @x( $ `D `@1P "* @m` 2&`@ T"d " @&`  > h>> > > > > (> 0> 8> @> H> P> X> `9 < @ ((&`0 &`, N`H`.&`4N`I  ?`Hc  2`  `2``0"&@``8 6`,  @  @    㿘 ( *@M+$  2 $   "$ @L$ $   "    @E  `"`" 㿘`$ L@J   @`$ ``6 @& & ( Q ?& D@ H㿘@K  㿘 a   @K@B&  ?"  @L&  2 &   "& @K&     H" "  2 H""  86㿘   @8   ( $ .    "? ?`0@`,@@а? "؍@V@"㿘!  "@ 0? ,&& @K@@K  @ 0 @ 0@K0㿘@ (ɒ ?"D Փ ;<   @}  1"  ?(@I H # 8& ,& 8"` ,"  ,@"` В? *  @I&  &   > && (& & 0@/: > @Jߐ 㿘  `@ `; ȹ##``@$@#6 $"    ,*  @$@ ؘ Ң06`ȁ`z`(qs6`-    4  $  &  4  -% %    4      4  ``&$6?"" ? **+ '@` @$$@`6?""  ? ** @1 р@0*'$` $$$`6"?"" " ? ** @ @ @+` `@@$$@$6"?""" ? ** ;&#``@$@#6 $"    ,*  @$@ ؘ Ң0]$@$ @  $`%`$@ 2`?""#@  ? **#@@8``% 2`?""  ? **@  Ԗܒ%ͲX   ` $  @@ @: <  (  >(` :`@?? D8 >` > >> `` "`@Gk`  @Ge㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @[@T?@J kby@9@2?@& 2 8@@ ? c3> '"`. @ . "@2 &  : +   ; &   + : :&㿐\   `#% .> @8 @"A @!@ @C @!@ޢ  @"ɶ@"ֶӢ &@D(@"| ʢ , N@: @ò` `* @@@@ @  ` @2   " @: N @  "@ : N@ 2    @  #  @ N @  @ @ (p N?   ` 2c *:  _"^ @ :[ N@?@   ` 2U;*@  "# @ :B N@ @  2 @ :7 N@?@   ` 2* *:  _"%  @(! N?   ` 2*:  _  . c`$ .  `.`2@ `.> @"Y#\@"d @>0@"a 0@>@" 0@i0 ,,  @ `?, ` ?,   @ & d&@   @Œ@ 2 .` @ @.@ 2 2>, /` " x`/` @>, " & #\e 2ca# ?#$!"#\O F/  > @ /   @ /  "?#\>&@ ,   :, :#\% 2#  :@ , , &@  ::#\  "   : 㿘 @ N * @j   )  @ N@" `   `2  `      ,  `        `0 "  @(? `" `@ `  ``_` @ `  2 _` `$ `@ `  `_{ @ `  {_  {  @є2  @ @Ě]`& ` `㿘  0@ N * @  )  @ N@ `   `2  `      ,  `        `0 "  @m? `" `@ `  ``_` @ `  2 _` `$ `@ `  `_{ @ `  {_  {  @2 2 @ @^`㿘 ك( >+@ @( "m M(NR?~@ Y @o@@_@耦 $@  Z"q &( v82rm   2kf e b( 2a\ 2]X 4YT  ( Q J G((@ @0@@0>@@; #7((@@ 0((@@ *(@((@   >(@/(@@.  @@(@(@0(`X   ` $  @@ @d: <     >(` :`@?? D8 >` > >> `` "`@@` "`$@@`$@@ 㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @{@t?@j kby@Y@R?@F 2 8@0@)? c3> '"`. @ . "@2 &  : +   ; &   + : :&㿐\   `#% .> @8 @"A @!@ @C @!@ޢ  @"ɶ@"ֶӢ &@D(@"| ʢ , N@: @ò` `* @@@@ @  ` @2   " @: N @  "@ : N@ 2    @  #  @ N @  @ @ (p N?   ` 2c *:  _"^ @ :[ N@?@   ` 2U;*@  "# @ :B N@ @  2 @ :7 N@?@   ` 2* *:  _"%  @(! N?   ` 2*:  _  . c`$ .  `.`2@ `.> @"Y#\@"d @>0@"a 0@>@" 0@i0 ,,  @ `?, ` ?,   @ & d&@   @@ 2 .` @ @.@ 2 2>, /` " x`/` @>, " & #\e 2ca# ?#$!"#\O F/  > @ /   @ /  "?#\>&@ ,   :, :#\% 2#  :@ , , &@  ::#\  "   : 㿘  ,@ 0 ( N` @Z  , @ `@A+  @ N@`@C " `   `2  `      ,  `        `0 "  @O ?  `"` `@ `  ``_`` @ `  2 _` `$` `@ `   `_?{ ` @ `  ?{_  ?{  @ L @ `@`@@ߘL& L  `㿘  4@ 0 ( N` @|  , @ +  @ N@ `   `2  `      ,  `        `0 "  @~ ?  `"` `@ `  ``_`` @ `  2 _` `$` `@ `   `_?{ ` @ `  ?{_  ?{  @& L 2`@ג @ `@`@@L㿘>!`+@ @( "v`M) PV~ўȄ@ d ƞ@"y@@o@耠5$@  i"@&("`8@2@ ``2@| {@v `2v@o 2p@i 4j@c `(`` ` Y@T   @ @. @@O@ I/@("F#A@ `@.`@@6/@O@2@(@  5> (@  @@/@@ `.``(  @@@/@@@(`㿘<"e @ @4"E@ `( "`    "  M ֒$1 3c@ ߒb ''@ = @L!'ߤ#19;!ߨجЪȴ'   * ` *J`|`:2 *@Ēc@Ē#@ : X $XĔ@#?"$(@cߒ# $0@ߒ#($,@#0$4@  @ݒb 4Ē#0@o? 4ߒ8@e?20F,$8ߒ@@X?2498$<ߒH@K?$ߒP@A?ߒX$ @t8ߒ#` @t3ߒh @t.ߒ#p @t)ߒx@t$  !,4r ` a/////@?H&Ģ &@Ġ & @?2 @ Ւ  А@ g?, @ c. . Ē@۔?   . Ē@  @2b. *`:  p  , : ?4@s   0Ĕ/@? *`$:  4   aW$@9h$㿘@  @@M "&@`@ 2@   `  ?   >    #@U  ϼ, ,,,,,,,,,,,,,,,,,,,,,,,,ϼ, ,,,,,,,,,,, 㿘 1"0 "@8&"0"", @!`@8$",` ""0",""4 @ ?J:   JJ2JJ@:  :2J0 2J J@ 㿈#\?@ x  'X\'DX 'H'T' ?X #b0 @T !",@7$ g",b0@P",' Ĭ@7$ X      i A'$@s##/ #`+    #T@K찒 ` @@8B@@7Q @  @ H"D!"  c '`+M@  `(8,L \24,, %$@9( $@8 (0ڤ@*M@@$ 4Ϩ  ζ? , L " #"T@ 2ݦ`@= 2զ   U  @7`??w  ?L: ,?#\$ ?  @7 " ?2 :,??J %L  : $ " ''L?`: :, '"@  %$@8$&@ '@7Y @7Q01@$ @x@s@7>?ߒa = X $^$H"@8H 2@7 @ "? @7? D#@    @9#㿈@''`?''  ? J ? ?  &@J `?J@ J JJ|:? ?J:|?  㿘@@㿘1"8 "@d&"8""@"b4"< 㷀  @' ""@b8  @@Mc %"80հ  % -/3 0` 4 "8"4T "8@Mp젒 ` "8 `@@"8 [@c8@%8`%@` @Mǒc %"80J*?쀢`2L"" 2  ?@5?&㿘4 = <?@4 d 2L5? d  `"@@6 d 2 `#?@4?@ dL : 2*@*@`"@?"@@5 2 `?@4Ґ?&㿘 # 2N@2? 0  `N@ x X `    ̒`@А *`: ?А *`: ? *`: ?& 㿘N@ :`N@ :2``@.`.`㿘!  " K 2`  `G$ 3c@"㿐 '`v$ 3c@㿘"H`   @  $bH"L` %D@ $bH2 $"L/ bH* "@*`@"L*` #D "bH@4'bH * "@*`@*` @32$"L $D"L@” $bH*`" *  "L* @D&bH B 3c@"` $` 3c@㿘 @&@G 2 `   @aH&㿘!ߒ"P  "P㿘@ ߐ#@K<c&@@Kr` &` 㿘 @a&@3  & @3& & & 㿐@  ߐ#@Kc؀ &&@@@J  􀢠"@L@ # J?` '@ # $'`@4` ?@F&&` , @LȒcࠒ "@, L "  " @L࢒ ,@`@LȔ "@J 2@`#@4@& ` ` &`@4   &`а?z9"``2& ,*`:  # "" ` *`?2$ @45*` `* &` $ &`@ & $@Lcࠒ ,  "$L  $ 㿘&b㿘2"㿘!b<"\  "\$# 3c@$< 3c@ ($ 3c@" ( $ 3c@㿘 @? @G㿘  @G  $$h 3c@ ? π  ) " " ""@ ?㿘 `2B?=?$ &$@6?  @/$@+@&@` `@)$` ?$&@͒$@: &?, 㿘 `5 2 $` %$@? @ @@$@@@ݒ@$ $@%@$@: %?-`㿘  )2,? ?π 8'?"  `*``*?@    @Q ?@ &@@: &@@E ? ?㿘  )26? ?π 81?,  `*``*&?@    @  2@?&@  &@@:&@@   *&@?     8 㿘` ` . . .  @N `2 ? `2`?*  㿘 #    ```4?@1?@ @$``?` @,@`   ,@?`.@` @@.@`.@\`"㿘   &?` *`  * *@֒ 㿘@Ŕ@㿘`,`2*?@!@`  0  H "'@ A   .'  '@&* '@?㿘`$` ?0 '  '@&@@`:'@ " '@ "  '@?㿘@d@" $ $% 3c@㿈'HN@ r'D wHJ`   "@/ '  {耢  @0c 0 ` @#U` L   ` @#v t@0C"h H3 `  R @ ` `HJ@ rU耦 "ߐm M I耢 "a AD#c@ ΐ ` @#HJ@ r@^'0@^yH!" "`3 `  @#h""h`  @#㿐  ` @s#"h   2  ``  @_#$?"h"@`  @R#@] @” ?<`" @/??HHHHHdHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH㿀  P 'P'T'X''L   +  ?#`L "@  "` + "@!E  @1/ x  P 'P'T'X''L   +  ?#`L "@  "` + "@  @0 㿀  P 'P'T'X''L   +  ?#`L "@  "` + "@@  @0Ȑ 㿘!͐?p  '  N @Y( / L' @.  @%  ?#` '' @hf   h@ @ $ p`  '''''' ؔ D@ /,`@,!h`=@# *` € @  **@`2*  ?#`)`$`* @l$ a > ``@ Ԩ 2M  ` " @0 ?  J H 2* #2HJ㿘 㿘 'H'L'P'T'X"PH㿘@X `@Zu @XY` @XT`  `cĒ` @    㿘@@X_ , ?@ 28  @   % @,  &@ "@vz` @R  @ @ @-c@&@㿘 :     @  "2 J "2 J   "2 J  J 㿘'H'L'P'T'X@H㿘!  "`@u"  "`@uא"@Lߐ"@uВ` (P㿘 (   V? "?=#  `ۃ@R @" ( P    ? #`    0 @ :f ` < :@ f `  "  :@ F` L㿘 $ 3c@$  3c@$ 3c@   ' L@ /2.. L` Ϡ`@fq$ @ϒ$ b@fd$ @@fZ$ 0 " > ?" /5@V / @$@#@ϒ$-``@&J?`/#,.O j@ e@ b 2 \*? /@ * T"@@Kݔ$  [`2L `G < ( 8  ʔ# &5 ,O /.    *? /@P * "@`L`/`#x,,@K$#o@e$rJ /"*  @-u#㿘   `   " $@*l$  @ ?@+L  J " $ 3c@$  3c@㿘'L'P'T'X@ LttttttttttttttttttttttttttttttttttttttttttttHHHHHHHHHHddHHHHHHH||||||HHHHHHHHHHHHHHHHHHHHHHHHH||||||HHHHHHHHHHHHHHHHHp|tPpppppppppppppppppppppppppppppppppppphpppppppppppppppppppdddpppppp<pppppppp\pptpppppppddd0pp@plPpp\p ' `   0   ` a ?"a   @ `?   `  " %!   & &  4@W 2@  @  ` 2 @2   @ z`#,  €  4@WА  @` ?& & d`ޢ`@ h2ڢ``ע`@ l2Ӣ``Т`΢a̢`@,* ƦР ^ ` hY  Uh R P @bI bF   @ h? d2n@``f*``22`@2a2 ``= M:J" "I?E??   `   `    b@W? #b %  ? &  &@W-  @  ` 2  8 @#,  €" d  @@W& @$`@$& &@ @! Өخ"?d/ J #  ?& &   4 @Vϐ  "0 L@`  ?& &  @  4 @V 0 L@`  ?&  ,&,'"?d# #   & &`4@V| 2g `@  ` " X?&  ,&  4@VU $    `  " $-,8!T@Y ?Հ`MS!ȓ*` €`@ @ @@T/,@ #ē-`4R (,@  #ē-`R `` 34,@@+,@@  @$@ꀤ@ ,@ , ? &  &@U 2@  @Y x Xd@Md$h,@k @ `   `2``@:2a2`2``2z*v"8!t@8 ?Հ`:2 ܓ*` €,@@"',@ @ $ ,@P @@ `,@ , ? &  &@UY 2@@@ 5 @ʒ, e E@ @d$,@ߒ `2`":"$ "? "֐  @)# @^` @ `  ( 6( " * @- `]** @]6` -* @ 㿘Ւ  J `  Ձ0   `"a ?"a &&@@h@@T&$@   $]$@8@L"@&& D d d d d d d d d T T T T T d d d d d d d d d d d d d d d d d d T d d d d d d d d d d 4 d ,H#bl'H '@~@ @%B $bl@`]bl  ?ض   ''J`-#̓*` € 'Đ 'K ` c' 'J`07K  X x2' ! Ē#@\  "G'  I䀢c@_@u@O7H 'J  0"쀢 ,  M    `,*   ?+` *  ?``'J`/9逤`H[ H   *`J: @N H 'K`@ 0 `'J`0π 7e 얂( `,* `4?+` * ? `,*   ` +` *    'K Ѐ 쀢e EQ``2 쀠2쀤"' 'N + -Є  'J`Ѐ 40 `'J`0π %А ' K *@  *`@ 'J Ѐ/9" "" 2 ` '쀤`SVHT`2H'쀢N"&iI >'n8'c@@^p쀢 0?'cH@^g쀢  ''('ܒcP@^Z쀢 J`( c@_   ''ܐ#?' '''&@` '#`B ?a8* @'&`'D#`BD?؀`;$@@n 26$@`H#`  !8.` &؋'D?ؠ" @  $@a8, @&@&ؑ.`' B@&' B?؀ !8*` &؋'?ؐ$@@O  !8,  &؋'D?ؔ4: ""' 'H ؒ 耊*@&' B:??, 'ؒ *@&(' B?ؚ @ $@#?'`'\'[  !8,  &؋'?ؕ:J= 2 j ؒ#*@&' B:?؀ؒ k* 2 "@4''ؔ?* @'ؔ?* @"#X B  =?ؒ ""`H`@\˖ c'#9B;  ː@t  Q@t 00Y`!ؠؐ @9   @ 4 k" ?*@ ) 2&   '$ ؀  2  ؔ  ?  ? 'ؐ?$   {`@؅@s?@cXD?h@\ #h!+'`cp$1%  ؀"  ` #p cx#pc#B'cB`&'??@l? B! @)?,@'??@?' @ؒcD?ؐ  #@ 2'Ԁ?'ؐ?e% <'0-c+"'#7F' B'@`" '`#`B&`'' "'?@H? @D?؀# @  `F"'   @# c 0# @r@r @r @r@q`   *@{ ؔ@t_Ȁ  '@r  `     ̀ @ & Ȗ"@ ?<3 6"  @ 4  $$@&`@rϒ @rm䠒 @q'䀤` @s  '䀤@r  @s @s @s^  % @s= R`   ؀ 82T''ЅD?؀ G ""@qd@qb@q`@q^@q\H`"@Ā ؁#؁xx㿘`&ǐ#0*` €& &@& `&@3& `**` & ""&& #?&&   &p   ''' '''ؒ@QƘԐ ?0 $ #`#d:  4?8#` #d#` `   ( "``#㿘  'H   ` `2 -+L  L0 L x XL )0  ) #?)  > Ö   $ `%E    # I "m B  @ @  ??"1 + R<@ !b @ @   1"?# ?2<@ B   ` @ `  ` @ `  ` @ `  H  H"@㿘     ` `2 -+M  M0 M x XM 0  >?? ??   ( O !@ @  뀠? ""? ?<@ B    `   ` `ͦ `   ` ` `   ` `  `  '㿘 0 @2@$ #$ 0" 0"`  ,< & ,`@   @xH 0&"@ 0 " ?㿘?w?"P` @tR `  +`0   `"` a ?"a` 2`0   R?N?" ` @uܐ  ` &` ?6` &``  6` `0@  `` &@  @&@*``"&`` ` ?߀ 6` @@ ( ` 2`&@``@@&`<`0&`8"`0 "``B &@&`.`B ǐ$| 3c@H;j&. ㉘ `v  " : "" " 㿘  (0 3`+ +` `? @@ # > `@@w @r &@ @l`@?@ @w{㿈 `'`2*@`*2*2222 ///////*2@ `? @" /@ `(    @ z#㿘Ɛ   . . 2 .  .   >`P>@>`>`>`>` >`(>`0>`8>`@>`HX< (. .`&5ک x@  @@0`(`@@:1@V5 - @  ۪@@5`-`@Ą @0os@ 1 ) @Ȅ =_㯂@@0`(`@̄@@*5 - @Є * @ @5`-`@Ԅ @?Q@1 ) @؄ `&؂@ @0`(`@܄@"=@㯨5 - @ ?ք㱪@@5`-`@ @"W5@㾈 1 ) @ "@@0`(`@@?f@ᓨ5 - @ )P㎄@@5`-`@ @m@!1 )  =@b@@0`(`@@ @0,@ 5 -   @Q@ @5`-`@@@:m㪈 1 )  5Ą@]@@0`(`@@ @S5 -  6(y@@@5`-`@@@9Ȉ1 )  xs@@@0`(`@@ @0ք5 -  =5C@ᇪ@ @5`-`@@@V 1 )  *x@@@0`(`@@ @?;5 -  @٪@@5`-`@@@#J1 ) ?B@@0`(`@@!} 5 - gX"@ @5`-`@@?yN 1 ) )/D@@0`(`@@5 - =҆`@@5`-`@@/p1 )  &߆Ƃ@@0`(`@@:I 5 - 5;̆@ @5`-`@@" 1 ) 6u49@@0`(`@@95 - 蟆@@5`-`@@1+e1 ) 1= H@D @@0`(`@0@ʿ㗄5 - 5*@㧄@@5`-`@5@?$91 ) 1Vք@Ä@@0`(`@0@#3 5 - 5?@}@@5`-`@5@!aф1 ) 1@O @@0`(`@0@?95 - 5(P@ @@5`-`@5@ᡄ1 ) 1=߄@₄@@0`(`@0@/N5 5 - 5 ⻄@@@5`-`@:ᴄ5@㑄1 ) @ % %%%$ 3c@%# 3c@㿘!  " V  V 㿘`, ,   ` 2   `@2  `@""    `,@2`,*` @ .  2`,?, "``,"`,@ `,` "``;`# `,"` 㿘!  l 0 e 0㿐`- ,`@(.`@"`    @2    @2   @  & >   @ @ `2 㿘&@  @6&   2   @w<  &  &?  @ 2?  "   ?& @ `2&@2 &@ 㿐!   0Ô  `" 0%0 3c@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  @@@x@d@l@@@@@P@@@@@㿘@`@ @+Ƞ` .`  А  *`: ?А *`: ? `*`: ?` `2` ` `  ϐ# ,` €?, ?".` ,  ,  ,   , *`$ @$.`.@㿘   @ "p  @qV    @ :, @  h .",   @ ` :  , ,  , @ 뀤,"p!  'P'T'X'`#`ذ ''" ` ` @o!?"77''''pP*  @Đ#㿘@n4 xJ ? * ``J ? * ``㿘"    ` "`@ "! b@"@ *` *  `  *`@ # b`  @b"@ ' _L@BЀ ", `@&Lb @b@"@ `'@tڐ @qu 2,  `@ ?`X  'L'&` #&`m  N : /@B / 2 `P@K 2  N /@B .   2N X "?N :" N /`?`% h"?@t@t #$@R `$@7$@7@Ba . 2 `ђ  2i? ?a#@ސaH  aHY?4&`N&` IG #? Ԓ@"#? ̒"? В"? Ȓ"? Ē "? $"? ("? , "?`̒@@?`В@@?`Ȓ@@?`Ē@&@@?`&`@@?`&`@@? &` @ 2` 뀤!` $․2ހ$&X, @*` O`@ @6(```t$$``@  @6`"ؔ@ *` ``@& ` @6` N$  $  `$ ` @``@ `  @ ?@ *` `@ ?`Ԓ@@*@@ @6` !@`$&$$ @`@ ` @2L"`  A"` ``@` @ 6`2L"` -"```@`` ?@6M``,`+ @ @  &`@&`M $& @ ` -`@& `L-``?L $`M 2`M 2`` !4`!? - @ 2` `2`  ` @ 24`? h  @ "@`?   @   #@ `` +  `@ &` ?    @ ``?* @@ @ `@  ,``*` @ $`@ 6&``4"`? ?bؔ @  `,`@*# ` ``@( ` @ &`,``?+ `@ *`㈒@ "@d hlp@  t"`"`"`"` +   * &`@"x| "   " " " &`` 8 @6`"ئ@` @?@ " `,` \` Ӑ ``@& `? "ؤ@`` @#   ,``*` >  <`@p @l?   @m 㿘  `5  @1/.`+ .@* *`@      @  @ @   @   @nX`? JJ Ѐ ,-+2 JJ 2  " JЀ   ((+ Ї8   JЀ  & "@ 㿐 ܖ $* "@*`@*`&@N :  ˖ ; *@" * @&@N :   < 2@  &@㿘N -   + ’   @ &@㿘N J M &@`* !?В &@ `   "0 N .  ` w  "$ N . `      &@` !ma 2N  / v` &`㿘 `  d 2   ! 2  "  ""   * * "@*`" *{ ;xT!u* * "@*`" *k ?- @ *`@ * @*`" *" *       &@ d d,`@*`@*`  :@``: @.`"@  &`@ ,  + - @* *`    &+  * "*"@ *` `  @p7!'N <  >L >2r?$ l$L 2ђĠ "b? G 2&@L / < ` >L >2K?$ E$L  , ;  2L5?Đ1'L 2L`!L , ;y  ࠒ "?L , Ƞ "?L 2?Ą# &@# &@# &@  #&`#&@#&@&@"ت@ ` &`'; ĔȀ$ $$.$..$.`` &``  d 2  ! ,  , *@ *`" *" * @ ` $`&` 2?  `@"ؐ@ * ㌕* @ @ `㈐@ #bؚ #@ @ @ @@6  * * ``  @9 "؆@@ @@ @ ` * *  `( @ `2*   2""@#* * ` ``@ؘ # &@ #### &@ # &@&@&@ &@&`# &@ # &`#&@&@  &`&` &` ` "8? #@@Lb@@L[ 㿘!#Ȓ  #Ȓj 㿘a耢 ?"a! "Д  "o㿘!͐!ː!㿘@k! #ڞa耢  @k :@no!@ $a @L !L 2#"" #""" "@c""@K"0b  L :b b㿘!v!t!㿐" ' d* @ ^ @'" ?* " !xaaX *@ *`@ *`*` *  *  *  * "@*`"@  *` " ' ?*  ` Y   ,`@*`* ,`@*`* F&@ # #  *``@ #   : *@ 6 & "ؒ? *` #, @  &  c  `*"@ &(㿘!!@ !㿘a" , " 㿘#aa쀢 ! "a!a!В@>`  !X&(㿘 ޔ㿘a" ,o " 㿘Ɣ㿘  < % d&!!88㿐 D  !! * 2.  4  *     *   @2   @   ?   @ɑ*''Taː,`@*`" *" * &$!n ` ?'@# ?$" * *  *  $@$@'`   d 2  ! . .@ 6Đ,`@*`" *" * 'ᅠ%T! DB'n,`@*`" *" * $&@ T! ?"  @? Q  a d 2  [! ,` ,`    I d 2  C! ,` ,`& @  2u  / d 2  )! ,` ,`@ Ӥ&@l8 V &ʐ?ǐ'xN   "@@ &  & &ܒ.&.Ւ <& <&`   d 2  ! ,  , * ` &*``*`&& 6& &$& 㿘&@h@| "  2` "  2`㿘@ &8ws8@"&@㿘@ &8`\8ѐ@"&@`` ` ` `@ ('P&@ `'H`'L'` '`'`'`'`'` '`$'`('' ' < o?В < g?  `?ܐ' W?j'l Q?Ԁ )!n%_? 9؀      d 2  ! ,  , @@ `'Ԁ!n('؀     ђ d 2  ˒! ,  , $@ 'Ԑ  Ԁ!nݢ'"@ 'Ԁ  ''ؐ  ?ؤ*    d 2  ! ,  , * @Ԁ@ؐ8 ̰?Ȁ`;'''l'4'ʒ?ŀ ?' ;'''Ȣ  ?,`"cK8@"!`? , c* @c@@  耢@2-`? (/ * @耢@@ " 'LH  Ȁ 2耢@츇?전?Ϩ?]?4`4 @ :`: @@''@4'LH  ? ``&' @?'@`$耢` xH  @' 2"' ?LH P "@㿘e  [ 㷐 'Lx? "  & Lٖ`"  && א"@"! 6 *" *?  "ؘ  * `2" - #@ <  6J?#-@*@ * 28 64# #,@ *` * @ @-`?"@  && Lm`2 "@  " `?&& ؕ,-?㿘!!Rא ^b!㿘 ?& 㿘 2" ؒbXH 㿘 " >bX  *` 㿘_'DDD&㿐V'DސDD@'ِD"@@ `'D&@ &􀢀 ?0'D&@ 4􀢀  p  ' 2  _ "ax@E=`!*`!(@ ` !*`!D@ @@h. !! #h #\#` #d ?  W" @ !㿘 㿘b("p H>  H zz{,{|z||`t|p|}lz|~~ ~t<z{l{| |@t{l|}} }}}~~@~4HL㿐:' p@ "`2*? *H  'Lr`%hL`zbݐ#*` €[``"*` |  x@{I``"*` `  x@k9`` "*` 0  x@[)`` "*`  x@L`'l  @Qb '` '"` `@ ` `@ ``@`  " `@Ͱ` `@ݖİ``@Ֆ` ԐВ " `@–``@` `@ @Ô` ""@{ w @`@t`@'`'` '`'`'`'`'` '`$'`('l'ؠȒ Đ@OF# @vD` `?:"`@P7` " `@E,&% i `'l`` +!7?2! 2m!+!'$ d 2n!!! 2mn! ! !m!! d !n!!! !m!n &? $?&   4` -` - 5-:  V g `@ '   @՚ ``` "    `@}``@ulbb '` '@fd' '`'l  @Q`'l  @H`( @r@` D`  ` @ @c9` 5`$`6  !@Q < <* ,  <, .a@# b  . L   @ Q!㿀# `' P@ ` @ 8!@ `@  (*@  㿘ܒ dؒ d d d dȒ d  `d ?`   ․` ! `  & `㿘N@ `@d[N    2N@  2N?$@\x4PlH " `!''!( @c `' @c'''@c'@c''Ā`' '8 h@cߐ'!@ ?В  ` `@Q @ D!H㿘ؐ @b"" 㿘#? 6 !X 0и  (@  !h` ""`  X"@@ %@! # ؕ2 ` @   $  ` `2  3  `(.  ;-( *  \ *` \ "&[ah& %   X"  & X"@$% (*( !pA  ( ! `? 2(``  ` @cB $?$ X& X    (2 X!  X (@!  㿘А  ( !)'ؠ \2`( *`  "$!h$ X  " & X"$ $ `(  㿐Ю  ,6` @@ h8!˒ #@? @!  `X#\   @\O??` "` ! # ؕ2 ` @   $  ` `2 ( A  (  *  \@1@`+ @b  1 %@$``X"%`X@\ ^ "Z @\ Q8(*(."*  `@b]   "@%`X"%`X@\ 0&  #  @\w 0#\   @[??` "` `X ( !  H  'B Ф   @" (" " ```    !} ?  ,Ҕ  2z@^"# o`jLđ* : `>["*` €`(* !U"`(!R"`(`(2 M"`(J"  F"`C"  ?"`<" $8"`$5"  1"` ."  *"`'"  #"` "  "` " $" " "  "` "  "` b l 1 L  `j``  "` @_ $ ,'#\   @Z??A? @a\ @aW@`>!v*  " $ $ $ #\   @ZƘ?? $ "P" $  $ آ  T"?` ? ,@#` 8 $($ & @a!    @"h㿐 #@*` *` #\   @Z??P  @"  @[-  :+  *@ 2*`*" 2@ @*`" @  * @ *$@ `"  *   *`  !h   * "@%  &  &  & &  㿐` 2%`#\   @Z ??%  @ "  `` &`" $`& \ X`` "` " @Z X@$ 㿘  *  6`U # 6`*`.`" 2  @  @ *  *  * *#@  @"` ?$ 㿘 ,  ?(8?! ?@ 6`*`.`" 2 @  @* *   2 *@㿘 ?"x    &@ & >` .`"    "   .`2* *"2` @ * @*@@# "`㿘ؔ q   `f )  6 6   : 6 * 2 %46 6 & @_ 6 Ԑ  & "  $ & = 2@*6 6 6 6 &  ` ` .` ?2 * #@ `" @  2*  (   #@` &`" `"`@& "G@㿘Ц  , (8!/  ( `  6`` >```*`   ] 2{  "     3ذ  "    ,``#3`ؕ2 ` @    &` ` "  G" `2   $?",`    :?2 @2`4& *`  4 `"  "` "@?`": *   ,    @X 㿘` @"   (?.  2 "ȑ2*   2 "u0E( #   ` 4  *    2  @ $@" "@*$ '` "` " 2   `2  @^[  C  $ "  & $ 㿘jФ $?#"  #? @ 8?   T  T"$`" @^ " $ " $#$ @ $@ @X4 $$ " ?`( $@X& 0 ` ``$" $@`$$@ @X 0`}`   @X 㿘 2 ؒ "# "  `@]̩ "㿘1   ` @]  `#~ ̎? " 㿘̅  `@]` #(؀ "` !- !   $  0# " $ `  @]o     :#J " C"㿘`  ?@  `` *  Q $$ c x#X $ !#h  #? $" @]   " ؒ`$" "` ` `$? " @W%  ? В09 ` @W ߐ ` ! # ؕ2 ` @   $  ` `2 *`(\ " r #80㿘˚ 2# ` @\`#x؀ "`` @\#l 0!   $ 85 $ ` @\h"㿐 А  ߰` ` 2 $#8>Ѱ ?#" @*@F  "?@`` *  @  $@#h  $$@1@ $@ @n@m@@i@  d@#? * $ V@$ #\  @U??  @" @V+ i%`5̒2@"@ $`" @[  " $"  $ @[Ԑ$@ " $A%`(?%`   $$ "@U 4%`@4`@` @` &`$$@@U  @ `U `  ` 8@WC0㿘z  `@[` #؀ "` !- !   $  0# $ `  @[e   `  /#? " 8"㿘2  `@[A` #؀ "`| ?P ?#@!؀ ?zԒ` @[ `#   /"!   $ 1 0%|n  $ `  @Z   `  Đ# " "㿘2 `@  *3 " & 㿈# ` `  % ?'  @Z ?쀢  , ,` , , 8   '?''Ė '''''cȔ @V?' @H\ @ @ ''' z r? r  H 4X\Ӑ    `@F"m! ` ? d@  `@$`X  `2@" *` W`6   $$$`  $`  ?$` `8$`$`$`$`\$`T$` $`(@Xs$`$ '''''`X@!Z @ ђ ,``<`€$`P 6$` '  n  '@!  b~o$`@$@ $! $##$ `> 9 㿈`'' #\g  'D'H  '`(\'L'P'T'X?'X`@'d'``$'``('d@ '7''`8&`8``€`P`X3`€H D@ € PL€ 2` &`, ``€'T@`X `v6T `h  &`,&`0  Xd  &`, #'# ' 'T''?/ضb@!b? `#* $, ` |A, {  " ` ?/``^``Z 'p`  't?ppt'` 'd&@>&`,ހ   "5``"`Ix x"@|'p"`'t@?pp@'ht@'l@?hhl'` 'd&`&`,o \ @`\'\ {^  ǿ`"@  Ƕ`#"s`ǰ &`,L&`0(k``X``@ 2e`@ @E .@`,`, XD@ `€   &`,&`0  %@@ɒ`,D@  @  X'X @''&`,`,   ɐ  ,"@0"`4"`㿘  " 8 8@% X("$"($"(""" "  "" """   㿘   " <z < `@ 8ljLX@4XX㻀  ` ' !u,# &@ߐ G"#$#d#` #\  @Ú   @$@Q  )"c@p 6 "c ` 2`#ԓ*` €     "c?  0㿘`  !tǐ#@}    "#~ " "#N J .Jd?`2J J .`? 2l@ ^pl2  ? @f 4a㨮   2 L ;`:"6L 0L@E 4@%`=7㨀 "   " `2 ``  2`""`  `" ?@ ?` $ ? $㨰?㷀  '@Ӑ `"#'?@Vǐ?"N .2h@Rk , #\@($4$`  P㻈  ` ' #sה! @2x @S `7 2p l@g`p f@ ZJ?` '#O@R, L@  @? `   ` "`;,@@] 0  `L@?   ` 2`L@ "`1J ? `   ` "*$@3ɐ @&  @ @&    xH` `d !sG#@  "#?`  @ @p6 H4 *` * $  >*` a ?$ 'F'$@]?2[?$@Ԑ@8 ̰.2 @.2  @  ?4  <$@` @ @  @ @  @x 4  $@` @. , @l2 . @h2  @i /`2 @a ` @Q)4 &㿘` #!r & @)?  )@@.@?# .@62  . .`@   @& @# `   &6` 㿘.`  .2 .   ,,`6 v2 Z6 , 4 vR6` ,`6  Ԁ2 " ` ?* @   @( 㿐#@Sa@SX2`#2  @2 @SM2 ?c  2! 4 a 2` 75 - 91 4   *  `!@S#퀥`   ,,`2   , 4*  2` , 2  ے` ,2`f 6`6(%Ԁ  @SW( J  @ ` ? @' 6 ҁ㿐 9 `!/  @ $v`!u `aݕ   В@ *`6 Г2`4  @*`72` `ҰHӐH Ӑ    㿘`  !qu#c$h qm#,` ` ,`㿘` #!qX   6 M I ?#̐ @ @2  @2      ' @@3  ""   0?#   @ @2 `"  @2  㻈  ' %@˜$ $@@x* `4 @s* 2  ` @  "      ?㻈    '% #? @$ @@7* `4 @2* 2  `   Ő X  ` ''D'H!Ж p#D'@4 ?",?  'H"$  '  <''Ā@ '  ' @  `   @? ` *@  耢`"  ܤDH`"*` €   )4ݰ?    آ `'  %   ` @ J`؀ @ܒ   ?$䀢 $`"`ؔu=܀   "`J@HD ''''`ؒo H`  7ֲ`ְؒ  ֲ@"@*` 7ր @ 6)Ā`& @'u @K* 2 'ؠ 77@"7ր`ڣ ր  g@^1 "b* &7֑* 2 ""`ؔڂ ֒"@*` 7 @   آ`  %    @ "  @"ܒ   $䀢  $` *@@  "  $ 1   ` ܀ 1  ܀  D`ؔt}܀ # & D `@7HH ܀   /'7`ؒtg & "D `ؚHnH  *s@ *@.`"* *  tӐc#`ؒ '7 tC  ``0O L'"!'а`ؒ t=Ѐ <' '@` $ (o ` (2 DH `    2   *@o@!h "@    " @`'S  `a @Q  쀢`  D`ܚH`1"*` €   )4'? D"ج  `@'@" Ȁ`? = "? <""?   z 㿘!  ؀  s?   $ " ""㿘?   @`G  .&`)?0C@ @??(@`@.` , \ . \2 (@@:)?(@`(@`<   !`?( `@ &  ? ` (@!㿘@    @ 2`  `B ?@x  ;:,*`" 7*  ?@$@`$@ .񀦠\  ,  $ "? >*@*,2$? $     ? " ?` `  ` *`P 㿘D`4 ` "' 8?, ., \" Ȑ  < ` "&`."  `?*  @ `Ц &*?J .* J." .`.`Ѐ    Ѐ -_2 `2J 㿘N * N  .   㿘N  % ߀ ] `.`\ " N`  ߀ ] `.`. J߀](J    ( ( (*`  2 *`*@2 2 2 *`*@*`*` (P㿘@ 㺨  ` ' !l>#c#$hl6  ''   ` @ à@ @ܐ  ` %a̤ P?  xaĀ2%a|aȀ@ %a| %a2 @aĀ  aȀ  @ 2` %@` 2` %`` 2 "%`  5 -`5`-`` %`@Jސal<*@ a'  %alb%`  @,2%ah:#〢 2B @K# ;`h@,#!M`h '%`L`P" `d "NN` `  .  $  ' N`` 쀢` NN    2 .$  %`%`@ *c ' c@+ߔ /'e%`c"@ ֠@Jn, c @  .O c(@  W5Oƀ  RPƲ c0@c8@Ɛ.?%`%`N `.5/ `' @@Ŕ   $H@  ?$ ,`N `  ?@c0N  ``ܐ`?2`  %`%```@P?%`P@  (Oƀ  #c``2YN "  " N K I`h!@+C@ gcX 2.<'c`@b  2@Oƀ  : @;   ƨ N    L y b f*  ,  L y b f *  " Ӱ ch@  TOƀ  Ocp`2N "  " N ـ נ`h!@*ѐ@ 2.M`h %`L`P `dN   . " $   N    N   2 .$ 'cp@Ĕ 2Oʀ  2〧`N "  " N   J` `@ `  `"*/N [Oа @ ] c*J :  @*V VOЀ  ) 5  ?0?8  ?H?@'0'8'$03s$ &$$` 2!$`/``@Hǐ$ @F˔!$`/``@H `" $" " " `$ "@Rc@3  OȀ   NN "  " N   ;#!  `@ `  `2N N`" N@b؀ 2NN`;瀢`N.@< R / ap"@   "@ 1at.   `   `  * N  ; 쀢?*: .@   $@,@', $@,@',at"@  *` % &@ @_%  @ Y / @*` "  ####Ƞ@## ̠###.   `   `   N  ; 쀢?*: & ./ @? @\  ?    4,, *,``  .c@9   Oǀ  c@l@ %`4%` al **` %al@$M`h @;  @- .  `h@(ڔ!`#`hM`h  %`L`P%`P  `XN  .Nd`2N @  . $ `$ `  %`@H# @c` %`   m# 㿐`  #h.!ТN #'*`:  N "  " cА@  ' @ YVK? `   ` @ F+al* < <$al@w  6c@@p  `* c@e ` $c@[ `(`@Q  `  `@F  2N` $`N   2 N  0 ???㿘 @2  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*㿘  ` ~| 㿈  ?'  @I: ?? 4\㿐@ ?㿈  , : ?   `  0   N x X     , :  ?   `   k=,  ?Г:` ":  ?   `D , :  ?*   `  : . 􀤀E $ =? `   ` < $:` `2#*` €?#!耢 * #?#耢 쀢`* *`  耢 쀢`*   *` * `2&@ 㿘  0 @ @H'? /"㿐N  / (  @ " @* @*`@ $2,@  ,@ .2 `,@ N ް   .@.`.`.` 㿀  ' @C N :   N :"Ny P N   `H ?# @  8@  `",ܮ )``:`.2J N ː ȑ4, ,    7  @3d  -`N`   8" 4, , $  4 ? % **  @D  `  P   (8 J2J " 2J@ "J`  2J@  ` (  *88 " (" 㿐  ?&   `     @ ` "` @ @ @`  @ # 2 @ 㿘 @? @$㿐 u? `  @A 0@`   @@" 0   0" 0   `"V "a"aV &  &   3\@> `!  ?`2  C  6 & & & &` "%!2(" & 6 &  &   & & & ` ">>@@! 㿘` = "U `  k0   `"a ?"a8 4@  - 1 O-  @B  `"@"&&@C4,"&&@C(@̤, "㿘 @C!@Co ` @Cd   2 `"  @CU @D "   @&㿘!”    㿘@ !`@sap&@@` &` 㿘 @V&  & & & & 㿐@  !`@Oap &&@@@ג  􀢠"@L@ # J?` '@A # $'`Ғ` ?@B}&&` , @ax ,@`L@L@ "` "`a@ ,@  J 2@`?#@4@*`2 & & ` 2` &`Ւ   &`?v<"` & @x&*`:  % "$ ` *`?2$ g*` `* &` $ &`@ & $@x " $,  "$L  $ 㿘a㿘+!㿘!a5 (   (㿘 H* D  # "?& H& D 㿘  `Ɛ 0   `" a ?"a  4@ 2M&@ @A    $&@  @ "6 & 1&   @@   $ & D@A &"@&  P $ D@Au@ ئ&@ D "l &@ " c 㿐@H 2 @<  _L! 6 $ # ?6 g   "???"DbT6 6 & $& ,& (& &    @> 㿘 @  `  ?6 @"㿘!  "  6  ("P`@= ( a `   G`J C`F @> @"  P  ƀ ?  2  ` ";?7?    0 :@ d   < :@  d   " : @ DE       S "?2 @; h ˀd?"䀦2 V  & rA 2  <   (6 А$& L6 2V  r( @B2$ 0 @"   P  ƀ ?   0 @ :d " 0 < :@ d 0`"   :@  D 8 <" @d  "@ @d   @2* L4' L@@!@D 4%@2 L@%@$ 0&& @`  @@" 0  0" 6 `b  L  :  @  ƀ?2 & &  0&`  @@" 0  0" @ ?6 @   @ "@&& `- @= ` ƀ?2  02  0` "??`  @@" 0  0" &   ?&6 ``"  㿘 ;   J H ? 2H  J  㿘   @?`  ` `2 @ - +L@  L@` 0 L@ x XL` ` 0   + #e $ $`   - , "P %  ʨ?"% dF" #"?d5  @`? @ `  ?ʠ? @ `  ? @ `  ??` &@㿐@&    "  2 @> 2  @ \ "x   ?''D'''  ܘ @Az      ܮ  ܘ @Ah ܚs  j   2e `   ` `` ?@` `` M`Б.2 `  @/? ;     * @" @   ? @    + " @   ? 2@`2@@@ + *  ,D "0ϐ"* %  İ? @;ܤ     2  6 2 .  %` `%` `@= `. `%`  @=    ? ?%` ?耢8 А@= `%@ ig .2 `  @."Z U`` %`` %`%`   * @" @   ? @   . @"' @   ? "%` "%`@" %`@ @  @;F@=6@ Ց.%@ܨ *[ R䀥@ D%@""H 㿘B㿘@@ː N @=0 p!'!' ' "!''''''"    @8: @H԰  J  ,  ``" 4 @# # z`" 4 `@` `/ '@f@ "  㿘  'H   ` `2 -+L  L0 L x XL )0  ) #?)  >S1 Qn   $ `%E    # I "m B  @ @  ?"1 + S<@ !b @ @  1"?# ?Sݒ<@ B   ` @ `  ` @ `  ` @ `  H  H"@㿘'P'T'X@P㿘@ `@&`h  <'"" #ג#` :  U#`Ē((  (6'$ ƀ & 6$` 2` 2` "&``ɚ & 6$` "`Ɇ & 6$`   :,  , *` A$-+:  % `%N m`% @LT cM & 6$@`N % `` `. . $. *` Ƒ: .@ & 6` $'@$c '''' [g `  `` @@_@@– "?|`7@C@Mآ#''ܒ [/@@  ?c`7"'؀? ` #  X  >@ 7 $$c0 ''''Ȑ[`Ӑ   㧐#8㿘?"& `?&&    '2   v ?3& g ?-`  )  ? j ?/???????????/cH7@ h`o j? `~&& ` P#X㿘 2&& "&   &㿘`Z?&& & 㿘 Z !  '''" ` ` @7!`#`? "77''''8Ґ*  #h###""#""##l########㿈 !`€@{ 8xܒ!! W&@ `< !̓*` €@4+ǵ 1&@ @ ȐǢАǚǍ  ` 8@~! (  8!3y  8㿘 "@)Ucȁ "x * 㿘 "@)?b㿘#`  #`  !ڐ @2 ! 86!  8ʐ ! 8*! 8 * * 㿘ϐ "@)cȁ  * 㿘!!8@  !8㿘  `"@ J@  "@ 2N@@@  㿐 "   / 00@  `'' # `€@€  @€        >@  㿘V  *? E"`  Y 0   `" "a"a  @) `" @  &? " 0f  0`  @@" 0\  0" D "& T& D& & 6 ` "!㿘`? "`@  "@@" 㿘  ` ? & @  &` 㿘 0   `a ?"a@  ? ?$  @`$㿘  @(㿘"P`@& a$  2 0  v? "  @V4 "  @(u O? $  ?4 $   4 ` @@" 0Ѽ  0" <`$  8 3$  2 @%} ? 4 @.h! ?* ` 4 @(>  $  $  ?Ȑ*@$  4 2 @ 4 4 $ ? 㿐# @7  W~  ``  @ " @% " 3  `?!3 ????"DbT3 # $# ,# (#  # 㿘N r   w a  0 0       & "  "N + b @ N  +@   @ &@ hThphphphphphphphph`h`h`h`h`hphphphphphphphphphphphphphphphphphph`hphphphphphphphphphph<hph4㿘  * @@? "@`@ *@  @  @ H  2  "@ *@) @ z  *` " `&  ? ("" *:` (: ` *`2   ?( 8`?㿘` < 6 >`@ 8@ >` `2  , & ?"*"` "2@"㿐\`@"x  "@ '`'`+0 5 ``@G @0` ` >``  2   *  `2@ `  `* @ ܐ` @ ') U 2$  *`@ ? `  @ ݒ   ' @! 7  6:"@' $  P%@8 `@ `>`4*  @ * @  %@ @֐  ` %@ `2 P  '>%@ "" $ &@ G@ %@@O㿈?  ' '@a @] 5&8#bL'H'L'P'T@(@+ ΁ $bL@ bLL  '''''J`-!4*` € 'Đ`'K``  ' 'J`0"K` X x2 LP@'Ē`'쀢`'' 'J  0"  L M   '   -`*   ?(*  ?`'J` / 9逤H[ H    *`J : @NH  @ 'K@ @  0 ?`'J` 0?π 7 e ?( -`* 4(*  -`*    (*   `'K`?Ѐ  e'Ԁ ES2 2`  'N  + -?Ж  'J`?Ѐ 6 0 ?`'J` 0?π '?А`' K`- @*` @ 'J Ѐ / 9" ""''ԀԒ '''LL؀`@  N& i I 7' n 1'cH@ (?'cP@   ' 'cX@ L P'`"J (L@cT' '' ` Ԓ ` ''` '`` 0 0 Ē"@'Ȓ 'Ĕ'Ȁ" 4 '`hB ?a8* @'&'DhBD`5$4@ԀԐ#`?#\  L?P ET sk쀢K4- ??b(@  5 !8* &Ȑ#\#`'LP BT?? <A "Ԓ <$8* &,Ȓ#\'#`P T BL&'ۉ BԀ! a8* @ &Ȑ#\#`'LP T??ے 쀢 "  $@`E `!8* &' B"~?<`` !c' @ ' B2 `@' *  * '2 `U  而`, @&' B<`` G?6E? `!8* &' ¢"8?<`` !0c' @ ' B2 `@' *  * '2 ` !`, @&' B<`` ?@䔒 i'"@  ' @v''L@  $7 @ 4&@"@   '@ A'' '䀢?  P" "`P"@''" " @: '@x '2  ' " "? !''''̐ '% @Ȗ'Ѐ6 4 @')'Ѐ` !' @' `  *`?   * @֐@?  'P'䀤` !C'쀢 ` ' !'쀤`6`5؀`1@/@  ǰ @@ $ ']` ؀!䀢  "'쀥` !'쀦@ !'` `  ''"@' ' '쀥@؀`` 怤`` ['  *`  "@ @  ' !'  '@ܒcp  ? `'̆  '؀  `  P" '' ?M?々D`??  '#9;菠FȀ'?4Ȁ &'!''`  '2'` ̐ 0"'̨ '?䀠 @6'@ @# ''"'@ ܰ `&  @ а @Ð4*`@ @W '؀K?` `, @@@@>@ ?'5'@ے  }'?')'А@˒ q'? 6 ؒ, @@@@@؀   ' '@k ` ' @6@4Ѐ@@&؀ #c Bą!   ̐' x  ؀ @^@@@@@    *@# @`  `*` @" "@@ Ԁ`   Ԧ  &&@"'@ "4$ $@ & $$@@ " @Y "ܰ @$@` @   ΰ  @@ "  @ " @ " @C  ' 4  2 ؀`2䠧@  @͒ ' @ "'P@L @J@H@F@DL@H  "   "20 0 "+0`2'@'LP"L @`T:`'*` ' ?"  *"L  "2@" " ' ""L`P "؀` P" ' `   0' @' ""H Ā!'T@@㿘#bP`2@!@%  $bP@-bP" 0`@& ` @ 0"`@ @" `    )`     @ @N  2 @ @ " @ `A 02  0" " 2   " "   `2     `2  " `  `2 "-   P p4`  + -2   " @    ? @   > 2 * *   ? 󀊀 2  `&&`s W`   0 0@ / $$ "    @  @@@< <  :`@~ &  $?*"@ "@:@*" ` &$?  <  `@X ߨ      `2 " @ $ 2 %     @ * $%< $@ , @"@ $@d ?<`*   `-@@ ` @S 2 @p 6 `$@ %`$ `@0   "" M "@0 ` "   0 0  ?@   0 0  $%&` b& "u"@ذ P "n"`? `@<`*` `  * 2`@ `$`"Q&`     `0``@ 2 ` "`"4   . @?2% <*   * 2  ,`@@  "@ 6  @ `] &&㿘 Fj  *` @9  & & & `   LР @ &L  LР @ ߶&L㿈@q !@k?` " * " @` '*`  ' '*` " 'J@H@Z$ "J@ `" :`*`(  "   *" :`  ` *2 (    *  􀢀8  :`" (+ `  ( " 0  "" * 8" " 㿐* @@    @ `@  @ "`@ @@'    (+  2 " 2+J " ?  * * 2 "" *㿘" 0`2@@@>`* ``$@    # (  L  `2= *@6 @@@; $@  ( L  02/ L  x X2)   8$ # (&)$ )  L)F @(   $@@ `*  $@  @. &@l@@`$@$($ ` " ?2@ % 2 $  * @  㿘!c" c" "c 㿘 `@@I  I  & `?*`#@   `@    22 @ 3@3` `2 @  `" * @?#@  2@ 3@3` `2 @    @  @  2   *@O` @6  *` " `& (``   "̒!ܠ ?$! $!;,?$! J` !N   Ā@`@  ` @ K0  " $! !$! !!?!q2o O!a@2i O ?  !  €# @ " Z O (C @ʐ 2[   D* !8  *@ :@ *`$!@̒   `@!$!0@!@$!0  ! @ ?$!$$!4 $  %k @ܐf%"'%''(&"a@t ` & & & & & & & &  & B!êC" 㿘 ?@ Û㿘 " ? !?)? "( !` ! @$ $ $ $ $ $ 4$! $ 8$  D @P  Ē @L @` ? :  @ U$ $ - " @ K *@@@ $ $  2$ 4 2$!  2  ဢ@ d"$ Ұ   "$ @  㿘 4Bɐ  & @   *  D# *#  * ,& $& `@Ֆ " ?!.`2 ? & ,& < & 0B& (@  , @4& @㿘!4@!    !؀ !!ؐ?* &! !??&!!@X 2!e! 6!!8, @ "!¼! , ! "!±! "!«!?A£ 9?"㿘` 0 "?"? !4  @   2 ?@  2?&!0 㿘!4 4aa!  $$  #$ @!! @ ?! ?  ? O"$!,!8 đ. ` . @ @  2?  .  㿘 @F  "&!,?㿘  "!  !   "&!,?  @㿘  !  @   "&!,?㿐 @ @ɖ ?P ` ` -` G`   % 2  `@ @  G`   @ "s ``݀@z +2 `'@* 2 `@~ "W ``  T?` ` @ F?F ` `C `! ``+00 `6 `,@  @  & "@&@ 2 `@Z  `?@  ?0 @ ?? ` ?-`㿘 "!$ "$!,?  $!$ $!(!$   $!($!$$!  ! !$ $!( ( @ "j?$! @ "  ($!$?$!$\  !(`$!(@@4!$!(*  `2@ *@ @ǐ $! $!(`  @ `!$$!  $!$"! @ "! !**`     @՘  ?0! `@   &@@ ? " &`(! 2   &@  "@& 㿘 (  4  0& (!@   @  *`*`!@0 "+?&   !ؓ,` "  ?!! `&!&! (@ h    D*` + "&  ,  & ,& 0@㿘n  @&@, M$㿘! € , (  0㿘    $!؀`$!  .@   ?2"   *** !ؐ"@    `7 ``22`)8(* * * * * * * * ؔ 㿘,` ``$, @2 `@,`2`6 $, 2 @`,`2`,``2 6**`@6$ 2`2`㿘`. `@I"?. "  ,(* *`@`2 `" @ @@4(*`22@22(2$(*   @4 248?$8``.`㿈  @'   @ 2 j?- .`3 3`@c Y  - `  -`@<`` , @ '2$'ǐ2%* "@ , 2 $ @ @2@ "@44 @ '" "'`@ʴ@ "* 2``**`4@@% 2`@* 2   - ` ?-`p?*2`@   ?* 2   #\@! 2?܀؀*,`2 ` 2%`# + 2**4' 2*`* 2 2`@f c  @V   l  i,`,`2  ' %@ '`' `# '`2#  * @  `@ } @Ӑ "q #. * @  `@ ]@ 2"?O .`* 2`@  *` `8,`,`2  *F @ے 㿘`- *2  "3  * @ *2  `%*2   @ ` N @ ?@ "\?``"    ϖ*``ˑ*  *  @  `@ `@= 7 `  *  @  `@  ̔`@0 "`?@۔`  .` 8` & 8 (=` 4 $ ڐ?㿘 4@@ `2  & 4 & 4``@W.`,`2 `@9  &` ` *`*2*  2224`㿐!  6@  ?6` {6`  <@?*  D@ 6  *@  <?  @ ?*  D@  *͑>  @A? K?  `? OB"6@`2  @ 2  6@ ?6` 26` ဢ@-`"@ :  &@?'  .@ .`.`.`` 7.`.@@  `@?7 .@.`` 㿐!? @ 2h?  ဢ@,! "@ :  $'++ + +    @ 7 **  <@b?*  D@ 6  *@  <  @P ?*  D@  *> @?  O"?㿘P !!<   , &! @  " @?* $ ĕ.2 !8.`" $      (㿘 D, `$* : ?=@ 1 8. @@m Ā2 * ?  $* ? @  :  ? ?e` *` Ց. ,D@  %$@   "@ * $@ g$ % *` ,$   ?$   * ?2% ``m, Y  2m ` g $Z% * ,$  , ?$   :** %  * @% , ;V  :**$   * @%  9t*` $ ?%$  D D .  4  ?* D@$@ g. .  6 cȔ 1Q  " 㿘`2 ` '*  D@  $&& $ !8 : +`*`   @  :**$   * *# @L㻈  ', 2@x   $#?o? ?"'@K @?&!`! @Ҕ  @< ! ?`  㿘,``$4, @2 `@`$ 6, 2 @64`4`` *`$ @2`* 2 㿘!@6  .`!8$ .`     0  2c 㿘`*  m* 2 *`*  4`$ , 2 @s  +  +  42*`4$ 2+ * 2 4 `|%0+   &@2 @ ,$@,`4 2 @94 5?%@*"@2* 2  2` `.`*`@`?`*  H* 2 @ @"**  4 $@ ,`2 @ +  +  42*`4$@ 2@*  2 +  4 > 2`?+  4 `` .`*`@`? 㿘`  * 2  ( `*  ` * ?`*` .`2`@Y M`   +  ?  `22`$`%?$`?2  + *`2 "  2 ` *`@ 2` ` ,`  8 ?$ 8㿘`,  " *`2 (  `$*, 2 @ & @ $@``" *2   **2  ?,  @א ??㿘 @+  ? @Ȑ "    +  @  `+ &@  㿘`.  `2.*  ? @ "t?`  .  `*  ? @ ^` ?* @   2  "?@p -,`E?  &" !&  * !$  &!(&!$&!  ?@S )&!  &!(`@ 2# !$&!  &!$ ,`2 @?&  !@ ! & "?㿘`   "@(`! 4G A&!, &!( * ?@ 0&!  `,!$&!  &!$* @ Ĕ $?,` 2 @ ! `@(@ 0 "?㿘@  ?&! &?㿘```? * 2 "@ ` ! ې 0$!  ,&?@* @ ΐ ,` 2 @ !``@͒@ 02 "?㿈\'P 2d?9@ P* 2`` 4 P@U $ L?$  `"`` *``/`` *` 2`6 *2 *62`6@2`* 2 P$$  `` *` *  *` 262*`@2`P  ?6P"$ $ " @ ` ?  2    (  㿘'L'P'T'XL˄ˤ$X< H2 2((  H (㿘@٠ " N   0  @ ` ʒ  &㿐?\2 '@@?`22!*` €@2  '<)' ' 8  XD?@2  ':'c' @  c' P @>g@"  @ W   *8* *`2`'` 8`#?@ *@ @ :  @ @'@@?*@  *N  J?`"  N @2E $ .J*:J㿐\#\S+dd0`(#;``0 `?2    2  ?2    #2 ?    ?   㿐"T?' @/  à   `        ` @"9  (  @ . *I @2@  0 3c@2" b??㿐#\@ #@#&HH`Ӏdӄh?'L`'T *@ '@''@  T#` "?\ p \  ? B T "\  @ְ@:覒 2' ? *@ <&' $2   @"?*2@   "*@'  B?;͔  ?@ '? '` DHFBL ' B#?  '!8-  &' )?'ܲ#    ''@%''L` 8'LL 'L L  'L4 * €?'?  '؀$ ' 'ؠ ? ' @2 d`  &  a8* @= "`#!` ” ?` 耎`, @$% B>`` !?`a8* @?`&`' B?" 苠#`, @&' B>`` ?܀ ` 9'  `ȅ B??'ꅠ?0H ЍD'  ' ؑ¸   ?'  8}?؀`Aa8* @H`ꅠ$'ȇ% `0 ?, ~) 0 6U?LLB '0?, e  0 :?a8* @ $ %B(`ț)D  N?'0, F  \ 0ȁ 9?L 0"( F??  쀢 g e!8-  "#   ؅ B   1 .ꍡ ` F '0L?.H  B ?L' 0L 92.   ,̤ ȍB` ̕B '0 L?,H̤0آ'̀ Ѐ 3 6" @V @ ` `4%@%$@䀢`؀@ ̐@E " @@ " @*  Ԁ@ "z L  ؀` ?@ @` Ԁ *` @ݠ` $`   "  ? @@@ "= `@ "5 ܀@  @z \?؀  @p " 4L``ؐ @_ A@  18 1.  `@f " `'@  !̐  *@ @R  "ް  ! @)  ̀  @  'ɰ @ '̐ @ "  @̢ 0@h@~ "   @Z@``L` ``  ``95`4`y,& )`L%`` !` ` `@  "w @( 4`2W,`"T,``:  9N, `9` 9,5D,,  @  @ 0,  *@  q@ 4 `L  1L 9   ,.  L 0"@  ̀@  @ @ ,T "@\2"㿘   *`` @  " 㿘   *` *  *` * `2&@ 㿘? ?* & @& 㿐'D` `y D-`'    `-U 4     ! @B   bb  $  ` DD "D"`D@, 2`    -` ?@D    bb  $  ` D "D" 㿘  ` !`  "X,`  " *,``2` "&:  ! *` "n*` 2$  $ $   !$ $ 㿘   ! <0  א! bX*@ &"@   ̐!@, 0"@& 0"@" ?  0 0 0 02 "@0  "@㿘>   >`  @B&  , P  2   *@` , " & ?  * ?<* 0*  *   㿘   & &  㿐 `@6  `  ` -E ' , `,`$*$@  @#@ `      @ B B $  $@ 􀥠@$& "&㿘`  !ԕ* : "T >``P!#`)   ` !#` t"q $#9 $@ )  !) ' 2 % @  a$@ " `" >`O "  >``2@㿘>`@ *  @ `-  `"? * ` " * " 2@ ` " " ?& P`(` " ?8 㿘    #I#    2# <  ` `* , @   @@  b @b #@`  @ `:@ b #@   `@ 2#@ ?#㿐  * @?X " &@ " 4 ' ? "@ ,2  ? " 3 , @' ? "@ 4 +  '''㿈?W  G  * ?2`* '耤 '' '얒   " *@ & 2 '&   $`   &  & &     5͐&"@  &Γ.`@&.`"@& @ @ (*`㿘` ` ` 2 @@ "@y ? "`  ` `, $$ ڤ`" $&`ְ `s "` `@  @2` :` ``#. ` *. K` ``&@$`$`$@$`` "`*@@`@"@$`$@.@` @֔@@@$@ 2` `` `,` $u` ` @`@"@$`$@`" $&`b   `  ` @ "@  `@ ` `@ @ @@@@L$@ +0@ `,` 0   @f`@"@$`$@2`@,   `" $&` ` ? @4` 㿘"P`2 @a 2  $ "  0`  @@" 0[  0" &   ?6 &  6   2  " @b?@   &  &   &  㿐  C & & '&@%5  >  C  & 6 & &@! `& & & @V  2` 6 (T  &&6  &< А`?`&$&@(&@ $ L( (?"䀢@"$㿈/ / * @*`"* "@*` ݐ '<   ?" "? 0" c```` `(`0`8`@8@8`8`8`8` 8`(8`08`88`@`H8`H`P8`P `0!`0" `0     !'@m'`X?ֈ!㿘"P`2@r%M p #    V  X 2 %:`p # %1`p a" "a 6 %*`p?6 && & & & & & D& H 0" 0"` 0` ` @!㿘@!  `" `  `@`"@`@ 2@`M  !$ p  p"@$"㿘?@֐#㿘$ܐ#bP    0aؤ $@$$     @Ҕ!`X!>@ɐ!  $P$#㿐@ߨ?`W% `  @T      @n  9 2$ #\   @??(T 2$  $ $ $ $  ' T $ $ $T" *@ *`$ ` $  "`"`@8  "  @C㿘  㿈@y #`R xT` 6" x .,`*  `# "' 2?' ' '@   $ @  @??< 2  x? % xbT" %bT@%bT㿐@`D `  @"T   #\   @(?? $  &[ $ $` $T"@   $ $ $ @  @㿈'XX#d#h#\#` L Ł㿘T   P > B< P ?Đ*@4 㿘 ! V  %  ?Ē* 6 V @1㿘T   %?  2  ?Đ*@4   4 < P㿘(V 㿘  @@A `  XG  u? "@  "X8㿘T` `  ` `@" $@`$`` ? @4`  $`` &  4`, 㿘!  XҐ W(8 '  @      "q   "j'0p r 0} k {  0   "ђ π z ˒ 0|   u  0t u 0 g 6' L   q j j k 0G > E a 0"C1! d"$ e ! 08 f 0y !!] 0! 0'&耢 ? d5 p &耢 ~?|g  d % ` ^   !l!j$U S 'X'N            $?ؐؒ  @! ? DB?  =?2   ?'ؒ  @  ?/?@/&:&  0'''ؒ  @ ?0  ''s?  " ؔ @ݚ ??㿈 |` |   '?   @Ě ? |? |`!  '@8 @  !㿘 `q"  `  ?2  X@V+  2     " *@ `2 "@ `2 *@ `0* @  "2 2  "? *@2 ?"@? *@ $ #       $((()(*(+ (,!(-"(.#(/"   " "` "`"Y V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @*J@   J@J`  㿐#\#`  Ij 㿐#\#`  I\  1 , !#@8'"(   J? J J  2`J=ސ `@   㿐J'J@=2`"@("H@ @ q_ $ L X2, ! , "* @(, L X , @ @ > .@`@,?(?% "#?q `2$?0"*!?q`?0#!  q` ??²q "?㿘  ? 㿘㿘 | 㿘u 㿘 m     ` /' hp1ഐ! *? # *`-ഐ  % ?h'd  d @m നഒ -ത  `` `-`  O @-  ` `, , ഐ*  @"?"&!` y"㿘q!`  `Ḁ "ḁ㿘!  @  @㿘  `@ `t ` ?  *` `` `-`  @-  ` `, , *` @㿘%  @a?"aഞഐ (ഖ   ` + *  *ഔ  (ഄ ,   ` + *  *ഔ  (ഢ +` +  *  *ഘ (ഔ ( + *  *   @i㿘  `@]7`#%`'ἐ? $  , ` `  ,` , ` , . @3㿘   8 .  1Y 1 (    ` +  * @* ` 㿘 @ŔW `oN I   < ; <"b@> <:    2 "-  ?`#E \*` €#?###    (",&  &oo "?Y V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @* J " $2 3c@$ʄ 3c@$J 3c@%2 3c@%8 3c@㿘 # ? ' T` 2??`X2㿘   "   "     6@ !ؐ?*@ ,  ?!0    2@$   `?孚  ,$ ! " "@!&& $! "㿘!! @ @!`"@`"@!$@$`&!`"!!  ` 2    2 ! &!!   ` ! @2`     m $`  a ! |?z&!@"``@"` 2` ` "n$` `@ *  ? ` 嵘 2m ` "``  !ؑ2*  !0  * * " *"` "=$` $`  27$`  23$`  @ *  ?     y 21 $  , "` "!`$ !$!"  "@ `" $` $  `  `" $` $`&,` ,`!Ē!$`$@&!`" @ :@`! "!""!㿘! 4 !/   `    2?`"  "     " "!2  @"``"` *` @`"!"`!"@! ` 㿠%s: %s not compiled in instbinUsage: %s ..., where is one of: %shostnamedmesgexprmvsleep-shshkshsedmkdirejectmtrmmount_mfsnewfsinitfsck_ffschownchgrpchmodgzcatgunzipgzipcpedmount_ffshaltrebootdhclientftprouteinstallbootmknodsha256fsckmount_udfumountfgrepegrepgrepmount_nfsmorelessdateping6rtsolsysctllsifconfigcatpingcpiotarpaxdisklabellnsttysyncarchmountdfmount_cd9660dd!#0 P!#( t!#  !# !# @@!# !# !" !" D !" P@@!" lskipseekofobsifibsfilescountconvcbsbsout of memoryunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdconv option disabled%s%s: illegal numeric value%s: %s%sstdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%s: end of device%s: short write on character device%s: short write on tape device%zu+%zu records in %zu+%zu records out %zu odd length swab %s blockblocks%zu truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryA.%sskip reached end of input!'!'!'!'!'!'!'!'!'x!'p!'h!'`updaterdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaegjo:Rs:session number is %s: %srealpath %scd9660%s: Filesystem not supported by kernel%s on %smainusage: mount_cd9660 [-egjR] [-o options] [-s offset] special node ,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'hiklnPt:only one -t option may be specified.-h and -i are incompatible with -Pretrieving information on mounted file systems%s%s is not a local file system%s mounted as a %s file systemempty type list %lld %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s @Y Size%-*.*s %s Used Avail CapacityFilesystem1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted on 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*lld %10lld %11lld %5.0f%% %s @Y df: %qd: %s usage: %s [-hiklnP] [-t type] [[file | file_system] ...] ffsext2fssoftdepsyncsynchronousroot file systemroread-onlywith quotasnosuidnoexecnodevnoaccesstimenoatimelocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasyncasynchronousffsAadfo:rswt:uvforceonly one -t option may be specified.updaterwrqnoautogetmntinforealpath %sunknown special file or file system %s.root_devicecan't find fstab entry for %s.malloc%s has unknown file system type.:@nfs/var/run/mountd.pidr%dsignal mountdmain,/usr/sbin/sbin/statfs %s%s on %s type %.*s: %s already mountedexec: mount_%s %s fork%s/mount_%sexec %s for %sno mount helper program found for %swaitpid%s: %smountfs%s on %s type %.*s%s%s (, %sunknown flag%s %#xs, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmaxmfs%s%s=%lu %ssizemsdos%s%s=%u, %s=%uuidgid%s%s=0%omaskshortlongnowin95direxeccd9660norripgensextattprocfsversion %dlinux) prmountempty type list%s,%s-ousage: mount [-Aadfruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node ufs%s: fstab uses outdated type 'ufs' -- fix please%s: fstab type %s != disklabel type %smachinesparcaksOpenBSDusage: machine [-a] usage: arch [-ks] !4!4 !4x!4p!4h!4`!4X!4P!4H!4@!48 !40!4( !4 !4 !4 !4!4werasetimesuspstopstatusstartreprintquitminlnextkillintreraseeol2eoleofdsuspdiscard!4!4!4rprntflushbrkoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d :%lxcflagiflagispeed%ldlflagoflagospeedttyspeedsizesanerowsrawostopostartospeedoldnlnewlcaseispeedextproceverythingekdeccookedcolumnscolscbreakallillegal option -- -%soption requires an argument -- %scols %srows %s%d %d %d TIOCSETDTIOCSTARTTIOCSTOP!9!9!9!9!9!9!9!9!9!9!9 !9 !9#!93!9#!9x3!9p2!9h3!9`3!9X#!9P@!9H@!9@@!98@!90!9(!9 !9!9!9-mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5!<!<!<!<!<!<!<!-aefgaef:g%snot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZmainusage: %s [-a | -e | -g] [-f file] [operands] Ffhns.%s%s/%s%s: disappeared%s and %s are identical (nothing done).linkitusage: %s [-fhns] source [target] %s [-fs] source ... [directory] RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffsABEf:hNRWb:cdenp:s:tvwbckmgtBCKMGTValid units are bckmgt %srioctl DIOCWLABELunknown disk type: %sioctl DIOCWDINFO%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aBootstrap doesn't leave room for disk label%.*s|Automatically generated label:\ :dt=%s:unknown%d:se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:A?P>>=p %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%c boundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] sizeoffsetw # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: editsh-cVISUALEDITOR/usr/bin/vi%s %s/bin/sh duid_parse# line %d: syntax errortypeIDEline %d: warning, unknown disk type: %sflagsbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsdisklabelduidline %d: bad %s: %sbytes/sectorsectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sgetasciilabelsector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %lldwarning, partition %c: size %% cylinder-size != 0warning, partition %c: offset %% cylinder-size != 0this architecture requires partition 'a' to start at sector 0partition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %lld offset %lldcmplabel usage: disklabel [-c | -d | -t] [-Av] [-h | -p unit] disk (read) disklabel -w [-c | -d] [-Anv] disk disktype [packid] (write) disklabel -e [-c | -d] [-Anv] disk (edit) disklabel -E [-c | -d] [-Anv] [-f tempfile] disk (simple editor) disklabel -R [-nv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) %sdisklabel -%sw [-nv]%s disk disktype [packid] (write) %sdisklabel -%sR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s installboot(8)RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffs !\8!Z!\0 !\( @!\  !\@@ !\ @![ @![ %-![/home/usr/obj/usr/src/usr/local/usr/X11R6/usr/var/tmp/@!\8 !Z `N!\ @![_!\8!Z@d!\8!Z !\@!\!\out of memoryYou need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.This platform requires that partition offsets/sizes be on cylinder boundaries. Partition offsets/sizes will be rounded to the nearest cylinder automatically.Label editor (enter '?' for help at any prompt)> unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%swunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?yunable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.cannot open %sOriginal label and mount points restored.Last change undone.%s expert mode EnteringExitingUnknown option: %c ('?' for help) editorcan't get mem sizeeditor_allocspacepartition to resizeThe letter of the partition to name, a - p.Command aborted Partition must be between 'a' and '%c' (excluding 'c'). No such partition Cannot resize spoofed partition grow (+) or shrink (-) (with unit)amount to grow (+) or shrink (-) partition including unitAmount too big Amount too small Partition %c shrunk to make room No room left for all partitions editor_resizeNo space left, you need to shrink a partition (need at least one full cylinder) No space left, you need to shrink a partition partitionThe letter of the new partition, a - p.Partition '%c' exists. Delete it first. partition to namePartition '%c' is not in use. You cannot name a filesystem of type %s. partition to modifyThe letter of the partition to modify, a - p.partition to deleteThe letter of the partition to delete, a - p, or '*'.partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. %s: [%s] %s: [%llu] %lldRounding to cylinder: %llu getuint@Y Error, partitions %c and %c overlap: # %16.16s %16.16s fstype [fsize bsize cpg] sizeoffsetDisable which one? (^D to abort) [%c %c] has_overlapChanging device parameters for %s: disk typeWhat kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).IDE"%s" is not a valid disk type. Valid types are: "%s", label name15 char string that describes this label, usually the disk name.sectors/trackThe Number of sectors per track.Invalid entry tracks/cylinderThe number of tracks per cylinder.sectors/cylinderThe number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.total sectorsThe total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) edit_parmsfailed to sort partition tablesdrzwdfdFLOPPYxdxyhdCCDVNDsvnd!jP!Y!jX!Y!j`!g!jh!jp!jx!Y!j!Y!j!Y!Y!j!Y!j!j!j0123456789Possible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx duidThe disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. Treating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. Available commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize a partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary./dev/%s%s%s%c %s %s rw 1 %d mpsaveStarting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. This architecture requires that partition 'a' start at sector 0. The offset must be in a free area. Size of the partition. You may also say +/- amount for a relative change.The size must be > 0 The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left fragment sizeSize of fs block fragments. Usually 2048 or 512.Zero fragment size implies zero block sizeblock sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).mount pointWhere to mount this filesystem (ie: / /var /usr)none'%c' already being mounted at '%s' Mount points must start with '/' Can't stat deviceioctl DIOCGDINFO[d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.dBIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. %llu%.*f%cOpenBSD area: -; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg]  ?GA0TH)-Dϒ5aA3pO6yK` gIEVTŋ)YE"@wx@ 5oލ~y1~},:?BQq|vt<9rJd@ۼK<%w+sMmc lL\yT)mb{6U,iN%VeX 浹 '27l^y6Bz|4[ZemLfӉ5vu=iBm4MU!`tѤ*紒P)e6Yü4]GR{O,$ON?rgh ")\$c/t|jeZvJkE,y7K.g+ /f;oWxz΂QH+}-+#԰/YkĥZzlVִ \-6 +gü*q#QaS>` 5MeSK"fD6:" ܅ռn&`)iYzK7c8\~;e#TCIUuow!.$Z}aȻ:bnrdPZAY~=1Uyؙ`Vs޲V% *l62 % , yEPߣZ8!Tx3W"F[S4("C2jѹiH96:y O"yC|H:Yb,ͫxneX \ŻUEj+JД0`S`e~kˌߙfEDmDZ,ժC?8ʰw01lt4qiBe*]bQg"Xwt/r'X qeexԍvI *NLhh ڹ\^3چڤ#H8|XTv-aaO 1Mɶ0`jq31E5;^*c91G &-_|E4lj(ٖa?~:?[ZFb [*D;P% N2D'ت[Wg81 0K%1I,P`'Ͼ|~8bJن}Mo̝tf2VϷeFPm߅vPcmM"I8u0@YB!;x@1VG!WtY7OAОݣxFC(q;qr'艢/ͪTk0Tpo^[zɊ N8(gz3-E!dNt,0`JUרsV14 7L0mҋ jyܟ[^ϒ;r4K~xh/mr?P  PKڛpj7e?N@OIke=:׀%Am'z@Bh֡kbhUD)sC4Q:֢Mq@Dˀ/ K͛XQx,58a(y(g˖cw*IǴy iQKK/uk){[;@,$v UXc1^#9Q+4{cyTY]04+S?Hڃi@\cYx h00BFD`0/c$*RqJvu;CL/Yl$,lh6 `ut&ǠjbDbۮ~z0)yQ͇Q>YTm 1:@8@xFڎG\l6l)739z0V)1? OȄZ*tK kBG_@ˍ ]>ۻĜTBI&p쌋0k)$q?[U A |ά`KI\q_F QLU-i;q br_W9}>^/fhv&?mFݍG\J(q-ŕNrkH0wp i&UfI$H¹8+]l5@/Wn"Bۋ1Řr"q@:T7V֠dH ƺIOiӃyܴJTWh90]gi]RI QD Ўe?܈DnJ `^,Lxgӝ(K zEh[S .6,\C@;9ږS{Ae @<dWʧR98w^97ʒ2NrxvQ*WR驁$š5#JEyT|ێ3tJv]HgL_^tV*.aR` Bx ~8ual1RjUX)CZ&ROZ #c\W+=#GA/L0-u_"GHEn!dݎgӁ<ޓk:w&ys=xܻS>GNzL P=!$EyG[>p:B9 ~LR6H \sڭSQ~@n˅J'wOS!L\q::4В`(Uȸa3A%sc>XXm{Uh* o5oDȳT-uHz)A$sƒDԳWf90;*TH|/6vU ︬#~]J,oUb j?NA xХCEzq]@1L!hakfpDw7(pb,*Y# VOD}P,sch!0]j3IJ>9i{00u^010 Ȥ`1%hc[bҔFbj'1ߏ$DDn_l"y3tʪ{ѮwZbu sDZ`{"u}+ǠD| sy C-PRO0NBWmzVJSSڄ~~;b3 ʮebƽ۠=,!+\Q0 WޑN݂S #B(H\.ꯢ@$bf븪ܚ6ȧv(]`p6ҳD]t.i"#ջͽ,~@$<3.wf/hl3u(?`J߂|r ݐu[- so6i p:Utfb1H 67\](";)1un> =iXDMBAs;#, 直͎t nTG٬A/&3/MbZ=7CmO]6k*zad—h+P kHBbwG(D o# K Pz a)O#Z!!ϻFw 7PK6yiE@8P\:>NMvl>7%>4(lOEQcq]%c 8:aXV>9¦̝X T4W$'?mmyAG߸:`$u2R\ Q9&ljmb@bP5.U˪\Y9CTƃݹ}mA ؔELiFPר劣t` [>hD-:&ec\0!gU[;MNi[69a!d6gW?C4N~N=0,q_di0.d 1}ՙIؚUW8صpKQFMJcb`D@U$Ah&-z-w(an1 X`ṽ.յ)!aN&77ܝf #J&K]&W&%gXSW"||-"?$??xng値kB7C&cYEЃNI`t\QܿU5"F u?CgR-NT 1a5EI^$Cjxn,P_"h{V+P3GHRP /9te/a@2i0fLUPSAJ2v-%{.>pdы385*[;vS3oXY9]ф^41+~7 %PkVfdF:@ sk|B>lR[ ldVrʵGC:v{Eoo'ɓgɳ;L`ɶI!d?F_Jt$#N>]cZz۬c(_POѼO:Fum#Y g6@1#||\}v|2$@.(a[gB4?U5#F0vmd`䓰՗ctџb~W!F}j'jzѿ0ȁ%<`#Whu;lfy2s̟ {gι'-9!Iy}m} mL}4iVT޽1\]"5  T"׃r[ݔŘF :4HeKEvgvGU&gvה]oh>8*cLA ;K-a8M m*k 6lvspCC8~PR(,16!RSW[dF"8:^3T^>̈́lPꔜ8n#}wgK чs/^& t'8j>P>"J;RTd!&N=֕ 2 D/RC ]9LȚ_WJU@ꡕXξr/QR1;5ͪ4w̮k cm"UN_4*Dh59ǛU)HƆB$[H*7Nug唨Ԁq{CAqc;%@ͰjiY[۞o)wzΖA/ChRmr%菐F-s*+O7eLGTSQ+XW -< N#pXjip uϼ|u/,< 9kp*XFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. cpio%qu blocks tar%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %d blocks.Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %d pad blocksget_physUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again ar_nextcould not pipecould not fork-c-dccould not exec %slistCannot chdir to %sCan't fchdir to starting directoryextractUnable to open %s to readCannot mix current archive format %s with %s%s: Reading archive to position at the end...done. appendarchivedirectory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %scopyPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFailed stat on %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache table%luTRAILER!!!cpio_endwrCpio file name length %d is out of rangeCpio file name in header is corruptedCpio link name length is invalid: %quCpio link name read errorCpio link name is corrupt070707File is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %scpio_wr070701070702File is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %svcpio_wrFile is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sbcpio_wrUnable to create %sUnable to close file descriptor on %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfUnable to link file %s to itselfUnable to remove %sCould not link to %s from %starcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)node_creatUnable to remove directory %sCould not unlink %sUnable to obtain file stats %sAccess/modification time set failed on: %spaxUnable to set file uid/gid of %sCould not set permissions on %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryFailed write to file %sFailed seek on file %sFile changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %sset_crcUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:%s Can't fchdir to starting directoryCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %s%b %e %Y%b %e %H:%M%s%2u %-*.*s %-*.*s %4lu,%4lu %9qu == -> ls_list%s%s %s ls_tty%s: unknown option %c %s: %c argument missing ustartarsv4crcsv4cpiocpiobcpiopaxab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0Invalid block size %sbzip2Invalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedb:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578Unable to allocate space for option listcompress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8-I-rUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPE/%sabcdfijklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory usage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: cpio -o [-AaBcjLvZz] [-C bytes] [-F archive] [-H format] [-O archive] < name-list [> archive] cpio -i [-6BbcdfjmrSstuvZz] [-C bytes] [-E file] [-F archive] [-H format] [-I archive] [pattern ...] [< archive] cpio -p [-adLlmuv] destination-directory < name-list Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %srep_addEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:%s Pattern select out of memoryPattern list inconsistentRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s tty_renameFile name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s rep_name.Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal maskUnable to set up signal handlerUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memorychk_ftimeCannot allocate memory for interactive rename tableNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to allocate memory for directory timesCannot canonicalize %sUnable to store mode and times for created directory: %sadd_dirustarwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %star_wrUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00nobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sustar_wr/dev/ttywrFatal error, cannot open %s %s: : %ssocketsetresuidDEI:LRS:c:defi:jl:np:qrs:T:t:V:vw:number of packets to transmit is %s: %s%sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %stos value is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sunknown host: %s-f and -i options are incompatibleNo audible output for flood pingsmallocbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %i bytes (default %i)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrommainA??zG{A.ping: sendtoping: wrote %s %d chars, ret=%d pingerpacket too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %x --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet loss round-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms summaryA@YEcho Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set (MTU %d) frag needed and DF set Source Route Failed Network Unknown Host Unknown Source Isolated Dest. Net Administratively Prohibited Dest. Host Administratively Prohibited Destination Net Unreachable for TOS Destination Host Unreachable for TOS Route administratively prohibited Host Precedence Violation Precedence Cutoff Dest Unreachable, Unknown Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo Request Router Discovery Advertisement (%d entries, lifetime %d seconds) Router Discovery Solicitation Time to live exceeded Frag reassembly time exceeded Time exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply (Mask 0x%08x) Unknown ICMP type: %d Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xusage: ping [-DdEefLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-V rtable] [-w maxwait] host benstuvusage: %s [-benstuv] [file ...] stdoutstdin-r%s%6d malloc!W!ݸW!ݰW!ݨW!ݠW!ݘW!ݐV!݈V!݀V!xV|!p[!h`!``!Xa\!Pa\!Hb,!@b,!8dd!0dd!(f!h4!il!e$!jP!jP!jP!jP!l!l!m!ܰV!ܠ!ܘd!ܐx!܀!xYl!hYl!XYl!HYl!@Y!8Y!0Z! Xx!Xx!!!!!!!۸!۰!ۨ!۠!ې!ۈ!ۀU!xW!pW!h W!`W!X@W!PW!H!8p!(! !@!@!<VWPlladdrinstinstancemode-mediaoptmediaoptmedia-link2link2-link1link1-link0link0destroydescrdescription-inet6rdomainnwflagtxpowervlanpriomplsrtlabelprioritypowersavegroup-autoconfprivacyautoconfprivacyeui64vltimepltime-tentativetentative-anycastanycast-vlandevvlandevvlanprefixlenbroadcastscan-chanchan-wpapskwpapsk-wpakeywpakeywpaprotoswpagroupcipherwpacipherswpaakms-wpawpa-nwkeynwkey-bssidbssid-nwidnwidmtunetmaskdelete-aliasalias-debugdebug-arparpdownup!8| i@ivVvU!0h|$ ixivV0vXinet6inetinterface name '%s' too longcreate%s: bad value'%s' requires argument'%s' requires 2 arguments64SIOCDIFADDRSIOCAIFADDRsocketstrdupgetifaddrs%s: no such interface SIOCIFCREATESIOCIFDESTROYSIOCGIFFLAGSSIOCSIFFLAGSsetifflagsSIOCGIFXFLAGSSIOCSIFXFLAGSsetifxflagsinvalid %s %s: %s%s not allowed for the AFinterface index is already filledcould not determine link local addressmtu %s: %sSIOCSIFMTUbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xSIOCS80211NWIDsetifnwidmalformed BSSID: %sSIOCS80211BSSIDsetifbssidpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYsetifnwkeySIOCG80211WPAPARMSSIOCS80211WPAPARMSsetifwpawpa1wpa2wpaprotos: unknown protocol: %ssetifwpaprotospsk802.1xwpaakms: unknown akm: %ssetifwpaakms!h!`!X!P!Hwep104ccmptkipwep40usegroupwpaciphers: unknown cipher: %ssetifwpacipherswpagroupcipher: unknown cipher: %ssetifwpagroupcipherSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKsetifwpakeyinvalid channel %s: %sSIOCS80211CHANNELsetifchannone%s%s ieee80211: nwid chan %u bssid %s %u%% %udB nwkey %d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep) %ddBm%s (auto)HIDENWIDNOBRIDGEieee80211_statusBASIOCG80211ALLCHANS %4s %-8s %s freqproperties %4d %4d MHz passive scanieee80211_listchans no permission to scan SIOCG80211ALLNODES none restoreieee80211_listnodesnwid chan %u bssid %s lladdr %s %u%% %udB powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACKCACHEBSSAUTHASSOCCOLLECTBASIOCGIFMEDIA%s: no link type?init_current_mediaonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandsonly one `mode' command may be issuedinvalid media mode: %sonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %s ! !`!!!!CARPTDMIEEE802.11FDDIetherEthernet!!!!#!#!#!#!$!$!$!$!%!%!%!x%!p&!`&!X'!H'!@(!0(!()!)!*!*!+!+!,!,!,!-!-!-!.!.!/!x/!p0!`0!X0!H0!@1!01!(2!2!2!3!3!3!4!4!4!5!5!6!6!6!p7!`7!Xc!Hc!@d!0d!(e!e! !!!!!!!!!!!!!!!!!!!!x!p!`!X!P!H!8!(!e1-g.704-crc4e3-g.832e3-g.751e3t3-m13t3e1-ami-g.704e1-amie1-g.704e1t1-amit1OFDM72OFDM54OFDM48OFDM36OFDM24OFDM18OFDM12OFDM9OFDM6DS22DS1DS11DS5DS2FH2FH1CDDIMMFMulti-modeSMFSingle-mode10GCu10GSFP+Cu10GBASE-T10GT10GbaseT2500SX2500baseSX10GBASE-CX410GCX410GbaseCX410GBASE-SR10GSR10GbaseSR10GBASE-LR10GLR10GbaseLRHPNA1HomePNA11000TX1000baseTX1000T1000baseT1000CX1000baseCX1000LX1000baseLX10FLFL10baseFL10STPSTP10baseSTP1000SX1000baseSX100T2100baseT2100VG100baseVG100T4100baseT4100FX100baseFX100TX100baseTX10AUIAUI10base5/AUI10base510BNCBNC10base2/BNC10base210UTPUTP10baseT/UTP10baseTmanualautoautoselectmasterfh11g11b11a!! ! !!!!!!! ! ! !`!`!!!!x!h!` !X!H!@!0!!framerelay-ituframerelay-ciscoframerelay-ansippphdlc-crc16turbomonitoribss-masteribsshostapadhocdasdual-attachtxpauserxpauseloophw-loopbackloopbackflag2flag1flag0hdxhalf-duplexfdxfull-duplexunknown %s media subtype: %sunknown %s media mode: %sunknown %s media option: %s%s media mode %s %smediaopt instance %d6 physical address inet%s %s --> %s phys_status!G!!!!!!!!!!!!ݸ!keepalive downinvalidunknownactivebackupno networkno carrier[#%d]%s: flagsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTXREADYNOINET6INET6_PRIVACYMPLS rdomain %i metric %lu mtu %lu lladdr %s status: %s %s: no media types?malloc media: supported media: status inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime %s0infty vltime in6_alias vlan: %d priority: %d parent interface: %s vlan_statusvlan tag %s: %sSIOCGETVLANSIOCSETVLANsetvlantag0123456789invalid vlan tag and device specificationsetvlandevunsetvlandev%i%i: bad prefixlenin_getaddrprefix %s: %s%s=%o%s=%x%s: %sin6_getaddrusage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] %dd%dh%dm%ds%lurandommalformed link-level addressSIOCSIFLLADDRhmac_sha1pkcs5_pbkdf2COLUMNS1ACFLRSTacdfghiklmnopqrstux %s: %s: %s: directory causes a cycle%s: %sfts_read%u-%lu%llddisplaytotal %lu %*u %*qd %s %*u %-*s %-*s %3d, %3d %*s%*qd printlong%s%s/%s ls: %s: %s -> printlink%*s usage: %s [-1AaCcdFfghikLlmnopqRrSsTtux] [file ...] hw.ncpufoundhw.disknameshw.producthw.modelhw.machinekern.osrelease%s=%d %s nusage: sysctl [-n] name adDFO:adDfFm1O:kernel is configured not to accept RAskernel is configured as a router, not a hostmainfailed to open a socketfailed to initialize interfacesfailed to initialize %sfailed to setup for probing routersselect: %sifconfigfailed to get link layer information for %sinterface %s was already configuredmemory allocation failedmake_packetlink-layer address option has null length on %s. Treat as not included.memory allocation failed for %srtsol_check_timertimer expiration on %s, state = %d%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %ld:%08ldrtsol_timer_updateillegal interface state(%d) on %sstop timer for %sset timer for %s to %d:%dusage: rtsol [-DdF] [-O script-name] interface ... rtsol [-DdF] -a usage: rtsold [-1DdFfm] [-O script-name] interface ... rtsold [-1DdFfm] -a <%s> %swarnmsgmultiple interfaces foundreallocstrdupprobing %ssockopenmalloc for receive msghdr failedmalloc for send msghdr failedff02::2inet_pton failed for %ssocket: %sIPV6_RECVPKTINFO: %sIPV6_RECVHOPLIMIT: %ssetsockopt(ICMP6_FILTER): %ssendpacketsend RS on %s, whose state is %dsendmsg on %s: %ssendpacketrtsol_inputrecvmsg: %sfailed to get receiving interfacefailed to get receiving hop limitpacket size(%zd) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpected IF(%s)received RA from %s on %s, state is %drtsol_inputSIOCGIFXFLAGSSIOCSIFXFLAGSinterface_upioctl(SIOCGIFFLAGS): %sioctl(SIOCSIFFLAGS): %schecking if %s is ready...get_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedinterface_upinterface_statusioctl(SIOCGIFFLAGS) on %s: %sioctl(SIOCGIFMEDIA) on %s: %sinterface_statuslladdropt_fillunsupported link type(%d)get_llflagsocket(SOCK_DGRAM): %sgetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflagprobe_initmalloc failedsocket: %sshutdown: %sdefrouter_probelo0ioctl(SIOCGDRLST_IN6): %sdefault router list contains a non-link-local address(%s)defrouter_probesendprobeprobe a router %s on %ssendmsg on %s: %ssendprobea:b:c:dEefHg:h:I:i:l:mnNp:qRS:s:tvwWinvalid socket buffer sizenumber of packets to transmit is %s: %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %s-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dtoo many intermediate hops%sgetaddrinfo failedsocketbindgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)setresuid-f and -i incompatible optionsNo audible output for flood pingsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> %s pollrecvmsgnew path MTU (%d) is notified main?A.@@sendmsgping6: wrote %s %d chars, ret=%d .%c\%03odnsdecodeinvalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%g ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%x%d bytes from %s: refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOP???%s%s, (refusedunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%lupr_pack@@ HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] ? [%d]%s pr_rthdr-%u %uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap truncated no address %s(TTL=infty)(TTL=%u)pr_nodeaddrpath MTU for %s is notified. (ignored) --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's duplicating packets!%.1lf%% packet loss round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms summary@YIPv4 addressDNS labelIPv6 addressUnknownRefusedSuccessNo Route to Destination Destination Administratively Unreachable Destination Unreachable Beyond Scope Destination Host Unreachable Destination Port Unreachable Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceeded Frag reassembly time exceeded Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirect Destination: %s New Target: %sNode Information Query, NOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(%s)(invalid), invalidNode Information Reply, %sBad ICMP type: %dpr_icmphVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphIP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESP TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ... patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xff02::2:0000:0000nigroupusage: ping6 [-dEefHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops ...] host ad:jnr:ut:TZUTCcannot unsetenv TZsettimeofdaytime%a %b %e %H:%M:%S %Z %Y%s mainspecified date is outside allowed rangeCould not get local time of dayadjtime???date set by %sillegal time formatusage: %s [-ajnu] [-d dst] [-r seconds] [-t minutes_west] [+format] %-*s[[[[[[cc]yy]mm]dd]HH]MM[.SS]] LESSSECUREmore-E-G-L-mMORELESS--WARNING: terminal is not fully functionalCannot allocate memoryraw_modeLESS_TERMCAP_ltget_envLINESliCOLUMNScokrklkukdkPkNkh@7kDTERMunknownhcamxndadbutsgpcksketitececdcl cmsoseusuemdmembvbbsbcho|^ll alsrget_termNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread error%sch_ungetchar overrunseek error to 0%cESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off /?_-(P)+! [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found:%s helpCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar-%s"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%s/bin_fileSHELLr%s %s %s%s LESSOPEN-LESSCLOSE-c...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSm%*s plinenum~ Calculating line numbersInvalid mark letterCannot seek to end of fileMark not setlLine number is required after -l/%sless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops ,%d and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for help%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeDon't use keypad modeUse keypad modeHorizontal shift %d positionsHorizontal shift: Show tildes after end of fileDon't show tildes after end of filequotes: Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminal0123456789,Tab stops: Highlight first unread line after any forward movementHighlight first unread line after forward-screenDon't highlight first unread linePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modeChop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters directly, processing ANSI sequencesDisplay control characters directlyDisplay control characters as ^XNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptUse the LESSOPEN filterDon't use the LESSOPEN filterDisplay a status columnDon't display a status columnPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesQuit if end-of-file on first screenDon't quit if end-of-file on first screenOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileAssume dumb terminalAssume intelligent terminalRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffersMax buffer space per file: %dKMax buffer space per file (K): Search skips displayed screenSearch includes displayed screenBe less helpful in promptsBe helpful in prompts%s: %spostoalinenumtoainttoaiprint_intiprint_linenum?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) .?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataap_posap_linenumap_int?-fileNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned off/dev/tty"6"5"5"5"5"5"5"5"5"5"5"5"5"5"5"5"5p"5h"5` "5P@"5H"58"50"5("5 "5@"5"5"4"4"4acdirmaxacdirminacregmaxacregminacnfsv2porttcpsoftresvportmntudprdirplusnfsv3intrdumbtimerconnbgsyncupdateforcerdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquota23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %srealpath %snfs%s: Filesystem not supported by kernel%smainhostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT PRCMNT RPCbad MNT RPCfork/can't access %s: %susage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node ,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'bin_file(standard input)(fd %d)%sinvalid file typeusage: %s [-abcEFGhIiLlnqRsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] 0123456789A:B:CEFGILRUVabce:f:hilnqrsuvwxyunix-byte-offsetsline-regexpword-regexprevert-matchno-messagesrecursivesilentquietline-numberfiles-with-matchesfiles-without-matchignore-caseno-filenamefileregexpcountbyte-offsettextversionbinarybasic-regexpfixed-stringsextended-regexpdevicescontextbefore-contextafter-contextline-bufferedmmaphelpbinary-files%s[[:<:]]%s%.*s%s[[:>:]]%s^(\()\)$r%scontext out of rangegrep version %u.%u without-matchUnknown binary-files optionCan't use small fgrep with -w%s: %sfts_read(standard input)r%s%s:%u %s Binary file %s matches -- malloccallocrealloc%d%lldafh:t:vonly one -t option may be specified.nfs/%s: not currently mounted%s: not a directory or special device%s: unmount from %s %sCannot MNT PRCBad MNT RPCumountfsgetmntinfoempty type listusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]"@0"@ "@"@"@"?"?"?"?"?"?rdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotausage: %s [-o options] special node openo:realpath %sudfmountmain,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'Can't get resource limit to max data sizeCan't get resource limit for data sizedvpfnyb:l:T:t:-b %smalloc failedonly one -t option may be specified./dev/%s: unknown special file or file system.rorwrq%s has unknown file system type./usr/sbin/sbinufsffsfsck_%sstart %s %swait %sno %s fork%s/fsck_%sexec %s for %sexec %swaitpid%s: %scheckfsInvalid option stringempty type list,%s,%s-ousage: %s [-dfnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] %s (%s): %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. %s (%s)/r/Can't stat root Can't stat %s %s is not a character device malloc failedrealloc failedstrdup failedCan't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s SUNEXPECTED INCONSISTENCY:%s: %s (%s)%s, disk %s: %s %s in fstab more than once!usage: sha256 outfile w%s mainmkfifom:invalid file mode.node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%susage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p _block_size_block_count_block_tableusage: installboot [-n] [-v] [-h] [-s isofsblk -e isofseblk] [-a ] a:vnhs:e:sysctlSUN-4sun4csun4boot: %s proto: %s device: %s architecture: %s sun4mUnsupported architectureopen: %sproto bootblocks too biglseek bootstrapwrite bootstrapnlist: %s: symbols not foundnlist: %s: wrong typefstat: %s%s is emptymalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x %s: a.out header %s left onstripped offproto bootblock size %ld room for %d filesystem blocks at %#x %s: devread: lseek%s: devread: readstatfs: %s%s: Too many blocks%s: %d block numbers: %d ffsufs%s: must be on an FFS filesystemfsync: %ssuperblockNo memory for filesystem blockinode%s: block numbers: %s: block numbers (indirect): indirect blockxresolveswapstaticssthreshshowsendpipesarttvarrttrejectrecvpipepushproto2proto1priorityprefixlenpopoutnostaticnojumbonetmasknetmtumplslabelmplsmpathmonitorlockrestlockllinfolinklabeljumbointerfaceinet6inetinifpifaceifahosthopcountgetgenmaskgatewayflushexpireexecencapdstdeletecloningchangeblackholeadd"NxG"Nh"Nx"N`"NX"NX"NX"NP"NP"NP"NH"N@"N8"N(keepalive downdowninvalidunknownactivemasterbackupno networkno carrierbotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show dnqtT:v/dev/nullsocketsetsockopt(ROUTE_TABLEFILTER)must be root to alter routing tableno such interface %spriority is %s: %sroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) write to routing socketgot only %d for rlen %-20.20s done king bula sez: set_metric with invalid keyset_metric: %s is %s-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplsnetmask missing%s %s %s: gateway %s (%s) not in tableentry in userouting table overflow: %s 064128inet6_makenetandmaskinternal errordefault%s: bad value%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybad label: %s is %sprefixlen is not supported with af %dprefixlen %s is %sactual retrieval of interface tablesetsockopt(ROUTE_MSGFILTER)readgot message of size %d on %smonitorso_dstso_gateso_maskso_genmaskso_ifpso_ifaso_labelso_srcwriting to routing socketread from routing socketRTM_DESYNC: route socket overflowRTM_IFANNOUNCE: iface arrival/departureRTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Route[#%d]routing message version %d not understood%s[rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture#%d, priority %d, table %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8d%cprint_rtmsgnoneconnectedospfis-isripbgp route to: %s message length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s %s use mtu expire%8llu %8u%c %8d%c sockaddrs: locks: inits: sockaddrs: %s%s: link %s; %s: inet %s; %s: inet6 %s; sodumplabel too longinvalid table id: %srouting table %isetrtableUGHRBD M@dmCXLS1@2 3cJPTroute-sysctl-estimatesysctl of routing tableRouting tables spd-sysctl-estimatesysctl of spd Encap: %-18s %-5s %-18s %-5s %-5s %-22s SourcePortDestinationProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIface %sLabel%-6.6s %5u %8llu %5u %5s - %2d %-5.16sp_rtentry InternetInternet6EncapMPLSAppleTalk %s: Protocol Family %d: %s%-*s %-5u %-*.*s %-5u %-6unone/esp/ah/ipcomp/ipip//use/require/acquire/deny/bypass/dontacq//in/out%-*s %-*.*s %-6s p_flagsdefault(%d) %sroutenameinvalid%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%dillegal prefixlen%s/%dnetname6af %d: %s0123456789abcdeflink#%dLOCALPOPSWAPPUSH?%uExtra `@' characters in usernames and passwords should be encoded as %%40 <>"#{}|\^~[]`Can't allocate memory for URL encoding%%%02xunknownreceivedCan't allocate memory to parse URLhttp://ftp://file:url_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sout of memoryerror in base64 encodingCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file%d%s: %s(unknown)Trying %s... socketconnect%sr+Requesting %s (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]80:%s %s%s Writing HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: ://Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %surl_get http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}cdNLST-wRetrieving %s/%s %s/%sgetmgetauto_fetchCan't allocate memory for URL decoding:/unknownftp%dftpgatehttp%s: bad port number `%s'%s: %sTrying %s... socket(unknown)connect to address %sconnect%sgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. hookupNo control connection for command. QUIT%c%c%c421 Service not available, remote server has closed connection. %s:getreply receive aborted waiting for remote to finish abort. receivedRETRlocal: %s remote: %s -local: %s./REST %lld%s %smallocnetin: %slocal: %s: %s%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomeEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)bindlistenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnSTOUSTORproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s abortrunique: can't find unique file name. Forced abort. The connection will be closed. Lost control connection for abort.%cABOR abort_remoteftphttpFTPSERVERPORTftpgateFTPMODEpassiveactivegateautounknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpTERMdumbemacssu46AaCc:dEegik:mno:pP:r:tvVkeep alive amount is %s: %s-retry amount is %s: %smainusage: %s [-o output] ftp://[user:password@]host[:port]/file[/] ... %s [-o output] http://host[:port]/file ... %s [-o output] file:file ... %s [-o output] host:/file[/] ... /LtenexEebcdicimageIbinaryAasciiusage: %s [%s%s | ] Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.typea+wwRETRgetitcan't get cwdSkipping non-relative filename `%s' mgetCWD %sCWD command not recognized, trying XCWD. XCWD %sQUITnmap: unbalanced brackets. Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamfile8binarySYSTRemote system type is %s. 215 UNIX Type: L8Using %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. anonymous%s@ftpName (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.ftp_loginTMPDIR/tmp/unable to create temporary file: %sftpXXXXXXXXXXwLISTNLSTarcan't find list of remote files, oops. can't find list of remote files, oops.remglob2%s: not foundSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. .Unable to determine real path of `%s'fileindir KMGTP... %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d: %02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterA.%lld byte%s %s in %.2f seconds (%.2f %sB/s) sMK ETA: %02d:%02d:%02d ptransferA.>?P/etc/dhclient.confsa == NULLking bula sez: len mismatch%s: %snew address not one we setinterface address deletedinterface downinterface departureFAILalias_routehandler: %sroutehandlerc:dl:quifi callocclient callocconfig calloc%s.%s/var/db/dhclient.leasesasprintf%s: no link .... sleeping got link /dev/nullcannot open %s: %m_dhcpno such user: _dhcppipecan't open and lock %s: %mwcan't open %s: %mPREINITsocket(PF_ROUTE, SOCK_RAW): %msetsockopt(ROUTE_MSGFILTER): %m/var/empty/chroot/chdir("/")setresgidsetgroupssetresuid%susage: %s [-dqu] [-c file] [-l file] interface ARPCHECKcheck_packet_to_lease failed.REBOOTREBINDRENEWBOUNDold_new_bound to %s -- renewal in %d seconds.DHCPOFFERBOOTREPLY%s isn't satisfactory.ARPSENDdhcpoffer: no memory to record lease.Invalid lease option - ignoring offerdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.DHCPNAK with no active lease.No valid media types for %s!Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %dNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping.EXPIREDHCPREQUEST on %s to %s port %dsend_requestDHCPDECLINE on %s to %s port %doptions do not fit in DHCPDISCOVER packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDECLINE packet.lease file not openlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } script_init: no memory for environmentPATH=/usr/bin:/usr/sbin:/bin:/sbininterface-T %drdomainmediumreasonip_addressnetwork_numberbroadcast_addressfilenameserver_nameno space to %s %sprepend optionappend option%dexpirypriv_script_write_paramsunexpected msg type %ureceived corrupted messagefork: %mwait: %mexecve (%s, ...): %mscript_set_env: no memory for variablescript_set_env: no memory for variable assignmentillegal character (%c) in value '%s'%s%s=%sdaemonInvalid IP address in option %s: %swarning: Only 1 IP address allowed in %s option; length %d, must be 4Bogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xwarning: hostname %s contains an underscore which violates RFC 952option_as_string: bad code %d\%03odhcp option too largecannot fork%s [priv]poll erroregresssocket errorno interface in group egress foundioctl SIOCGIFGMEMB: %mget_ifnametoo many interfaces in group egressInterface name too long: %mInterface name too longget_ifname/sbin/dhclient-scriptrCorrupt lease file - possible data loss!expecting a statement.semicolon expected.expecting hexadecimal constant.hexadecimal constant too long.string constant too long.expecting string or hexadecimal dataexpected option name.%s: unexpected option name.%s: too many options.expecting semicolon.expecting interface name (in quotes).expecting left brace.unterminated interface declaration.no memory for lease.unterminated lease declaration.wrong interface name. Expecting '%s'.expecting lease declaration.expecting identifier after option keyword.no option named %sexpecting string.option data buffer %soverflowoption data buffer overflowexpecting number.expecting identifier.trueonfalseoffexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.parse_option_declExpecting media options.no memory for string list entry.expecting IP address.no memory for reject list!parse_reject_statementgetifaddrs failedno space to remember ifp%s: not foundNo interfaces availableInterface %s: rdomain changed out from under usNo live interface to poll onpoll: %mreceive_packet failed on %s: %sInterface %s no longer appears valid.got_oneCan't create socketinterface_link_forceupioctl(SIOCGIFFLAGS) on %s: %minterface_statusCan't allocate timeout structure!interface_link_statusget_rdomain socket: %mget_rdomain/dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %mif_register_bpfsocket(SOCK_RAW): %msetsockopt(IP_HDRINCL): %mCan't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't set filter-drop mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mCan't install write filter program: %mCannot lock bpfsend_packet: %msend_packetoption %s (%d) larger than buffer.rejecting bogus offer.Can't allocate storage for option %s.Can't expand storage for option %s.cScpretty_print_option: bad code %d%s: Excess information in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of array\%03o%ld%d%xtruefalseUnexpected format code %cdhcp option too largepretty_print_optionDiscarding packet with invalid hlen.DHCPOFFERDHCPNACKDHCPACKBOOTREPLY%s from %s (%s)%s from %s%s from %s rejected.eof in string constantstring constant larger than internal buffernumeric token larger than internal buffertoken larger than internal buffer"x"p""`"X"P"H"8"0"(%"""" "" "&""""#"""$"x"p"h"`"X"H"@ "0 " !"" token-ringtimeoutsupersedeserver-namesendselect-timeoutscriptretryrequirerequestrenewrejectrebootrebindprependoptionmediummedialink-timeoutleaseinterfaceinitial-intervalhardwarefixed-addressfilenamefddiexpireethernetdenydefaultbootpbackoff-cutoffappendalias%s %s line %d: %s%*c^ subnet_numberbroadcast_addr%d bad IP checksums seen in %d packets%d udp packets in %d too long - dropped%d bad udp checksums in %d packets" """"""""""""""""x""h""X""8""(" """" "" """" "" """""p"h"P""@"8" """"""""""""""x""X""H"h"0"""""""8"""""" """""p"h"P""8"" "8"" """"""""""8""8"x""X"P"@" "(""""""" ""h""h""h"" """p" "`" "H""8""(""""""""""""""" ""h"x"h"h"h"X"h"H"h"8"h"("h""""h""h""h""h""h""h""h""h""h"x"h"h"h"X"h"H"h"8"h"("h""h""h""h""h""h""h""h""h""h""h"x"h"h"h"X"h"H"h"8"h"("h""h""h""h""h""h""h""h""h""h""h"x"h"h"h"X"h"H"h"8"h"("h""h""h""h""h""h""h""h""h""h""h"x"h"h"h"X"h"H"h"8"h"("h""h""h""h""h""h""h""h""h""h""h"x"h"h"h"X"h"H"h"8"h"("h""h""h""h""h""h""h""h""h""h""h"x"h"h"h"X"h"H"h"8"h"("h""h""h""h""h""h""h""h""h""h""h"x"h"h"h"X"h"H"h"8"h"("h""h""h""h""h""h""h""h""h""h""h"x"h"h"h"X"h"H"h"8"h"("h""h""h""h""h""h""h""h""h""h""h"x"h"h"h"X"h"H"h"8"h"("h""h""h""h""h""h""h""h""h""h""h"x"h"h"h"X"h"H"h"8"h"("h""h""h""h""h""h""h""h""h""h""h"x"peoption-endoption-254option-253option-252option-251option-250option-249option-248option-247option-246option-245option-244option-243option-242option-241option-240option-239option-238option-237option-236option-235option-234option-233option-232option-231option-230option-229option-228option-227option-226option-225option-224option-223option-222option-221option-220option-219option-218option-217option-216option-215option-214option-213option-212option-211option-210option-209option-208option-207option-206option-205option-204option-203option-202option-201option-200option-199option-198option-197option-196option-195option-194option-193option-192option-191option-190option-189option-188option-187option-186option-185option-184option-183option-182option-181option-180option-179option-178option-177option-176option-175option-174option-173option-172option-171option-170option-169option-168option-167option-166option-165option-164option-163option-162option-161option-160option-159option-158option-157option-156option-155option-154option-153option-152option-151option-150option-149option-148option-147option-146option-145option-144option-143option-142option-141option-140option-139option-138option-137option-136option-135option-134option-133option-132option-131option-130option-129option-128option-127option-126option-125option-124option-123option-122option-121option-120option-119option-118option-117option-116option-115option-114option-113option-112option-111option-110option-109option-108option-107option-106option-105option-104option-103option-102option-101option-100option-99option-98option-97option-96option-95option-94option-93option-92option-91option-90option-89option-88nds-contextnds-tree-namends-serversoption-84option-83option-82option-81option-80option-79option-78user-classstreettalk-directory-assistance-serverstreettalk-serverirc-serverfinger-serverwww-servernntp-serverpop-serversmtp-servermobile-ip-home-agentbootfile-nametftp-server-namenisplus-serversnisplus-domainoption-63option-62dhcp-client-identifierdhcp-class-identifierdhcp-rebinding-timedhcp-renewal-timedhcp-max-message-sizedhcp-messageBAdhcp-parameter-request-listdhcp-server-identifierdhcp-message-typedhcp-option-overloaddhcp-lease-timedhcp-requested-addressx-display-managerfont-serversnetbios-scopenetbios-node-typenetbios-dd-servernetbios-name-serversXvendor-encapsulated-optionsntp-serversnis-serversnis-domaintcp-keepalive-garbagetcp-keepalive-intervaldefault-tcp-ttlieee802-3-encapsulationarp-cache-timeouttrailer-encapsulationstatic-routesrouter-solicitation-addressrouter-discoverymask-supplierperform-mask-discoverybroadcast-addressall-subnets-localinterface-mtuSApath-mtu-plateau-tableLpath-mtu-aging-timeoutBdefault-ip-ttlmax-dgram-reassemblyIIApolicy-filternon-local-source-routingfip-forwardingextensions-pathroot-pathswap-serverdomain-namemerit-dumpSboot-sizethost-nameresource-location-serversimpress-serverslpr-serverscookie-serverslog-serversdomain-name-serversien116-name-serverstime-serversIAroutersltime-offsetIsubnet-maskpadsemicolon expected.filename must be a stringno memory for string %s.expecting a network hardware typeexpecting semicolon.Expecting numeric lease timeno space for numeric aggregatenumeric aggregate too short.Bogus number: %s.Bogus number: %s: digit %d not in base %dvalue %s%o exceeds max (%d) for precision.-value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dnumeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.expected colon separating minute from second.numeric second expected.buf_open: %mbuf_add: %mbuf_close (connection closed)buf_close (short write): %mbuf_close: %mbuf_read (short read): %mbuf_read: %mcorrupted message received%mreceived unknown message, code %ddispatch_imsghaltdlnpq%sreboot???halted (with powerdown) by %shalted by %srebooted by %s~shutdownSIGTSTP init/etc/rc/dev/consolerevokesetsidopen/bin/shshSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): mainusage: %s [-dn%sq] p"p"`"X"P"H"8"0"(" """@"""""softdepforcereloadupdatesyncasyncrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:realpath %sffsmount table fullfilesystem not supported by kernelfilesystem must be mounted read-only; you may need to run fsck%s on %s: %smainusage: mount_ffs [-o options] special node ,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'cannot seek temp fileout of memorycannot read temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileinvalid pattern delimiter p unexpected end-of-file& no previous commandout of memoryrcannot open input filecannot close input file%d newline inserted newline appended out of memorycannot read input filewcannot open output filecannot close output filecannot write fileunexpected end-of-filestdincannot read stdin%d \  \abfnrtv\*usage: %s [-] [-sx] [-p string] [file] HOMEp:sxcrypt unavailable ? ? interrupt? invalid filename%s warning: file modifiedscript, line %d: %s unexpected end-of-filenumber out of rangeinvalid addressinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimiterawcrypt unavailable%d ! unknown commandno matchfilename too longout of memoryshell access restrictedno previous command invalid mark charactered.hup/ed.huphandle_hup..invalid pattern delimiterno previous patternout of memoryunbalanced brackets ([])trailing backslash (\)number out of rangeno previous substitutionout of memoryno matchinfinite substitution loop out of memorynothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: %s%s: directory causes a cycle..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).fts_readmalloc%soverwrite %s? readlink: %sunlink: %ssymlink: %scopy_linkmkfifo: %smknod: %sutimes: %schown: %schmod: %schflags: %slchown: %susage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory """ p.gzdeflatefghqrcfhlNno:qrtVv123456789ab:cdfghLlNnOo:qrS:tVvzcatzipcompressunknown program nameGZIP GZIP is too longoption -a is ignored on this systemillegal bit count -- %s-o argument is too long--o option may only be used with a single input filemay not mix -o, -c, or -t optionsstdin%s is a directory: ignored%s%s%s: %s%s not a regular file%s: unchanged%s already has %s suffix -- unchangedstdout%s: unknown suffix: ignored%s%s: name too long%s: input: %smaincompression not supported%s%s: won't read compressed data from terminal%s: unrecognized file formatrcrc errordodecompressfchown: %sfchmod: %sfchflags: %sfutimes: %soverwrite %s? .-_taztgzzgzZmethod crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) @YOK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out @Yusage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfhlNnqrtVv] [-o filename] [file ...] usage: %s [-fghqr] [file ...] 1.2.3put_header `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     error #+3;CScs !1Aa  0@`@@""""и"Ш"И"Ѐ"p"X"incompatible versionbuffer errorinsufficient memorydata errorstream errorfile errorstream endneed dictionary1.2.3HLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %sinvalid file mode: %s%s: %s%sfts_readuser is %s: %sgroup is %s: %susage: %s [-R [-H | -L | -P]] %s file ... modeflagsusage: %s [-fh] [-R [-H | -L | -P]] %s file ... owner[:group]group %s [-fh] [-R [-H | -L | -P]] :group file ... lost+foundwrong type to dirscan %d dirscanDIRECTORY CORRUPTED%s NAME=%s %s=%s DIRFILEfileerrorUNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED) ADJUSTmkentryUNREF %s (RECONNECTED) RECONNECTNO lost+found DIRECTORYCREATE (CREATED) SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY..DIR I=%u CONNECTED. PARENT WAS I=%u linkupmakeentryNO SPACE LEFT IN %s (EXPANDED) EXPANDexpanddirDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS ckinodePARTIALLY TRUNCATED INODE I=%u%siblockbad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot allocate memory for inode cache cannot increase directory listcannot find inode %d %s %sDIRFILECLEAR (CLEARED) I=%u OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%12.12s %4.4s %lld %s I=%u BAD STATE %d TO BLKERR CG %d: BAD MAGIC NUMBER dfpnNyYb:c:m:numberAlternate super block location: %d conversion levelmodebad mode to -m: %o ** lost+found creation mode %o usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... -%c flag requires a %s starting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing The following duplicate blocks remain: %lld, The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** /ffs ***** REBOOT NOW ***** checkfilesysphase 1, inode %d/%dPARTIALLY ALLOCATED INODE I=%uCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:cannot read symlink convert symlink %d(%s) of size %llu bad direct addr: %ld bad indirect addr: %ld LINK COUNT TABLE OVERFLOWCONTINUE%sINCORRECT BLOCK COUNT I=%u (%ld should be %d) (CORRECTED) CORRECTUNKNOWN FILE TYPE I=%ucheckinodeBADEXCESSIVE BAD BLKS I=%u (SKIPPING) DUPEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.phase 1b, inode %d/%dDUPphase 2, directory %d/%dphase 2, parent directory %d/%dROOT INODE UNALLOCATEDALLOCATE%sCANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORT%s %s: LENGTH %ld NOT MULTIPLE of %dDIRECTORY%s %s: LENGTH %ld NOT MULTIPLE OF %d (ADJUSTED) ADJUSTMISSING '..'..BAD INODE NUMBER FOR '..'pass2.BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (REMOVED) BAD TYPE VALUEBAD STATE %d FOR INODE I=%d pass2checkphase 3, directory %d/%ldphase 4, inode %d/%dUNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%d phase 5, cg %d/%dDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATEXPANDCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d CG %d: BAD MAGIC NUMBER BAD STATE %d FOR INODE I=%ld FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPSpass5%s (%s): %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. %s (%s)/r/Can't stat root Can't stat %s %s is not a character device malloc failedrealloc failedstrdup failedRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffs  @Can't open %s: %s Can't stat %s: %s %s is not a character deviceCONTINUE** %s (%s)NO WRITE ACCESS (NO WRITE) cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d clean = %d %sile system is clean; not checking f** F** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED) INCORRECT BMASK=%x IN SUPERBLOCKFIXINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area BAD SUMMARY INFORMATION%scannot alloc %u bytes for blockmap cannot alloc %u bytes for stmap cannot alloc %zu bytes for lncntp cannot alloc %u bytes for cginosused cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead setupMAGIC NUMBER WRONGNCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKsuperblock mismatches offset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATE%s: BAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) ioctl (GCINFO): %s %s: can't read disk label bad file type 0%o INTERNAL ERROR: GOT TO reply()CONTINUE %s? no %s? yes %s? [Fyn?] cannot allocate buffer pool deadlocked buffer pool WRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY CANNOT %s: BLK %lldProgram terminated UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) SEEKREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld), %lld,WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:CG %d: BAD MAGIC NUMBER /?..returning to single-user after filesystem check catchquit%s (SALVAGED) SALVAGEUNKNOWN INODESC FIX MODE %d /dev/tty: catchinfo?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@init: %s init: already running initinitial setsid() failed: %mrootsetlogin() failed: %msfunrecognized flag '-%c'ignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't open %s: %mcan't get %s for controlling terminal: %m/bin/sh-sh/dev/consolePATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartingsingle_usersh/etc/rcautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode~rebootsession database close: %ssession database open: %sinsert %d: %sdelete %d: %s %s%s/dev/asprintf%s %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %m01getty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %d shutdowncan't exec %s for %s %s: %msome processes would not die; ps axl advised ,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'forceupdateasyncrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotamfsinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size is %s: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %sspacetime%s: unknown optimization preference: use `space' or `time'.file system size is %s: %sffsnewfs_%s%s/newfs_%s/sbin/usr/sbin%s not foundswap%s: %s%s: getmntinfo: %s/dev/%s is mounted on %s%s: unknown disk type%s: block device%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %lld%s: no default sector sizewarning: changing optimization to space because minfree is less than %d%% mainioctl (GDINFO)ioctl (WDINFO)%s: can't rewrite disk labelusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special %s: initializing cg %ld/%d siginfocallocmmappreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %dreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %d bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each super-block backups (for fsck -b #) at: cannot allocate I/O buffer %lld, %sfsinit1 failedfsinit2 failedmkfs>inode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0fsinit: inode value %d out of rangerdfs: read error on block %lldwtfs: write error on block %lldisblock bad fs_frag %dclrblock bad fs_frag %dsetblock bad fs_frag %dCOLUMNSilog2: %d is not a power of 2 can't get physmemwarning: fsck_ffs will need %lluMB; min(MAXDSIZ,physmem) is %lluMBdfiPRr%s: %s%sfts_read%s: is a directory%s (inode %u): not overwritten due to multiple links%s: mallocrm_overwriteremove %s? override %s%s%s/%s for %s? check"." and ".." may not be removedusage: %s [-dfiPRr] file ... weofretensionstatusrewofflrewindofflinefsrfsferaseeomeofdensitybsrbsfblocksizeioctl MTIOCGETejecttf:TAPE/dev/rst0no remote support%s: unknown command%s%s: illegal count%s: %s76543210WriteProtectMountedSCSI%d: unknown tape drive type %s tape drive, residual=%d ds erblocksize: %d (%d) density: %d (%d) %s=%o%s=%xusage: %s [-t] device usage: %s [-f device] command [count] m:pinvalid file mode: %s%s/usage: %s [-p] [-m mode] directory ... unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw command%s: %sread commandbranchlabelempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform command\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])RE error: %s123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangeno wfile specifiedbad flag in substitute command: '%c'compile_flagstransform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthunterminated regular expressionexpected context addresswhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'Eae:f:nruusage: sed [-aEnru] command [file ...] sed [-aEnru] [-e command] [-f command_file] [file ...] stdout: %sr%s: %s"%s" ..."stdin%ssed: %lu: %s: %s %s: %s%lu \%d not defined in the RErstdout: %sflush_appendsCOLUMNS\ \ \abfrtv%03ofirst RE may not be emptyRE error: %sunable to allocate memoryafree: %p not present in area %pLPrestricted shell - can't cdPWDOLDPWDHOMEno home directory (HOME not set)-no OLDPWDdon't know current directorybad substitutiontoo many argumentsCDPATH%s: bad directory%s - %s%s can't get current directory - %s-nRnprsu,ne-p: %s-u: %s: %spvpvV%s is a reserved word is an %salias for exported alias %s= is an exported traced undefined (autoload from %s) function is a%s shell builtin special is a tracked %salias for not found%s is *GOK*L#R#UZ#fi#lprtuxponly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U %s exportreadonly%s[%d]=dprtUx#p#h-taunaliasalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzbgjob control not enabled%%%*d %*s %s%*d %*d %sbad signal `%s'--ls:usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %d %s%s%s: arguments must be jobs or process IDs%s: %smissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGlm# X# $# # # # ߄# # \# # # # ـ# # # X#x #p p#h p#` bind+fg+bgwhence+unalias=typeset*=readonlypwdprintlet+kill+jobs+getopts+fc*=exportecho+command+cd+alias%s: bad numbernothing to shiftSugorwx%s %#3.3o bad numberaugo=+-rwxugoXsbad maskc_umask%s: %snot foundprsu,-p: %s-u: %s: %sREPLY%s%s is read onlytrap -- %s bad signal %s%s: bad value%s: cannot %s%s: can only %s %d level(s)##-setfv%s%*ld.%02ld%s%s%*ldm%ld.%02lds%s real real user user sys system :ptime: -%s unknown optiontime: -%s requires an argumentm:invalid file modeusage: mknod [-m mode] name b|c major minorusage: mknod [-m mode] name p#X 8#P ,#H #@ #0 # # # # # ,# # d# D# H# l# # D# # ,# +#  # t# xmknod*=unset+umaskulimit+truetest+read+=wait*=trap=times*=shift*=set*=return+false*=exit*=exec*=eval*=continue=builtin*=break[*=:*=.-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$[]missing ]-tinternal error: unknown opunexpected operator/operandmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operator#!#!#!#!#!)(!-a-o1%s: %s%s##t##f#"c#"d#"s#"l#"m#"n#"xpprocessesnofiles(descriptors)memory(kbytes)lockedmem(kbytes)stack(kbytes)data(kbytes)coredump(blocks)file(blocks)time(cpu-seconds)usage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s unlimitedinvalid limit: %sexceeds allowable limitbad limit: %sunlimited %ld COLUMNSLINESx_modefileglob: substitute errorFPATH;|&()`+@!IFS"#$&'()*;<=>?[\]`{|}\ d#* X#* n#*p o #*` n#*P NX#*8 P#*  N#* P#) ]#) ^`#) X#) Xd#) n#) Z#) d#) Y #) L#) L8#)p b#)` m4#)P n#)@ o$#)0 a#)( a#) b#) c#( V#( ^D#( P#( ^(#( Vl#( P#( X(#( X#(x Z8#(` n#(X X#(H u\#(8 V#( W#' Z#' m#' e@#' d#' `#' m#' m#' c#' o<#'p oT#'` w#'P w#'@ w#'0 s#'( t#' commentset-argupcase-worddowncase-wordcapitalize-wordexpand-filecomplete-listyankexchange-point-and-markversiontranspose-charsstuff-resetstuffset-mark-commandsearch-historysearch-character-backwardsearch-character-forwardprev-hist-wordup-historyno-opnewline-and-nextdown-historynewlineforward-wordforward-charend-of-linebackward-wordbeginning-of-linebackward-charyank-popprefix-2prefix-1quotelist-filelist-commandkill-regionkill-to-eolauto-insertmacro-stringgoto-historyerroreot-or-deletelisteotend-of-historyredrawkill-linedelete-word-forwarddelete-char-forwarddelete-word-backwarddelete-char-backwardcompletecomplete-filecomplete-commandbeginning-of-historyaborthb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /&.&_606162636465666768695U5u4L4l3C3c[O%A"BCD I-search: x_search_hist nothing to yank yank something first%s%s = %s '%s' cannot bind, not a tty%s: no such functionCPOSIXsubstituteexpand(NULL)%S%s: bad substitution%s: %sparameter null or not setunable to allocate memory%s: parameter not setfunny $() command: %s%R%s: cannot open $() input.*+?@! HOMEPWDOLDPWD%sPS4%s%scoprocess already exists%s: %s_builtin: %s: not a builtin:pcommand -p: restricted%s: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s%s: not foundEXECSHELL/bin/sh%s: %s: %sshcomexec: %sFPATH%s%s %Rcannot %s %s: %sopencreatedupcould not finish (dup) redirection %s: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %s#/#/#/REPLY-rreadPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():end of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variable%s: %smissing )zero divisormissing :missing ]history functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,- $_-%c%stoo many argumentscan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e-16 %d %.*s %s cannot create temp file %s - %serror writing temporary file - %s_${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %ssubstitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrink%s: internal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againbad file descriptorfd not open for readingfd not open for writingillegal file descriptor nameno coprocess/tmp%s/shXXXXXXXX3(#6#6x#6Pargument must be %job or process idambiguousno such jobj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlexchild: XPIPEI and no last_job - pid %d%Tfork failedcannot fork - try again/dev/nullchildexchild: execute() returned[%d] %djw:last procwaitlast: no last jobwaitlast: not startedjw:waitlast%s: %sjw:waitforjob not job-controlled[%d] %s%s| 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumeYou have %s%s%s jobs stopped and runningjobsnotifyasyncj_async: job not startedj_async: bad nzombie (%d)zombiej_waitj: tcsetpgrp(%d, %d) failed: %scheck_job: job started (flags 0x%x)checkjob%d RunningDoneDone (%d)[%d] %c %s%5d %s%s (core dumped)%-20s %s%s%s|%s%5d %-20s %s%s %s%sj_printremove_job: job not found (%s)no closing quote yylexhere document `%s' unclosed \$PS1PS2\%c%a %b %d%d%T%l:%M:%S%r%RPWDHOME/~/%s%cdoppromptmissing ] MAIL_%s you have mail in $_IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }whovishsedrmprmvmakemaillsgrepemacseddatecpchmodcccat-tUlogin=exec loginr=fc -e -local=typesetnohup=nohup integer=typeset -ihistory=fc -lfunctions=typeset -fautoload=typeset -fususpend=kill -STOP $$stop=kill -STOPtype=whence -vhash=alias -taliastypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"evalOPTIND=1PPID-iHOMEPATHSHELL-xKSH_VERSION-rtypesetksh/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin-sh/shSH_VERSIONPWD.$ # PS1\$-c requires an argument%s: %sCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENV#>`#>X#>0#?#>8USERroot?include: %dshell: %dUse `exit' to leave ksh node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%s: %sxdigitupperspacepunctprintlowergraphdigitcntrlblankalphaalnum0123456789 |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF#Da#C#Cc#C#C#C#Ce#C#C#Ci#Ck#Cl#CxX#Cpm#C`C#CXn#CPf#CH#C@#C8b#C0u#C #C#Cp#Br#B#Bs#Bh#Bv#B#B#B#B#B#Bxxtracevi-esccompletevi-tabcompletevi-show8virawviverbosetrackallstdinshrestrictedprivilegedposixphysicalnounsetnotifynolognohupnoglobnoexecnoclobbermonitormarkdirsloginkeywordinteractiveignoreeofgmacserrexitemacs-usemetaemacscsh-historybgnicebraceexpandallexport%-*s %sonoffCurrent option settings set -o %sgetoptionso:A:o;s%s: bad optionparse_args: `%c'%s: is not an identifier%s: bad numbergmatch*+?@! %s%s-%c: unknown option: %s%s-`%c' requires argumentunlimited%s'\''%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: flags %xshf_read: bsize %dshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: flags %xshf_putchar: no fdshf_write: flags %xshf_write: nbytes %dshf_snprintf: buf %lx, bsize %d0123456789ABCDEF0123456789abcdef(null %s)shf_vfprintftoo many <<'s too many redirections let%s: bad identifier forselect%s: invalid function name #I#I#I#Ix#Ip#Ih #I` #G #G #IX #IP#IH#I@#I8#I(#I #I{#I}#I#I#H#H#H#H#H#H newline|&((;;||&&[[!}{timefunctionindonedountilwhileesaccasefielifelsethenifunexpectedunmatchedsyntax error: unexpected EOF %S%R?%dsyntax error: `%s' %s aliasexportreadonlytypeset||&&!()#J0#J8#J@#JH#JP]]<>ERRError handlerEXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T||&&! [[ %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %Twhileuntil%;do%;%T{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T%s< <<- << >> >| > <> <&>&%s wdscan: unknown char 0x%x (carrying on)/dev/ttyNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s3(#N #N#N#N#N#N#N #N #N #N #N#Np#N`#NX#NP#NH#N@LINENOTMOUTSECONDSRANDOMMAILPATHMAILCHECKMAILVISUALEDITORHISTSIZEHISTFILETMPDIRPOSIXLY_CORRECTPATHOPTINDIFSCOLUMNS%s: subscript %ld out of rangebad substitution0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzstr_val%s: bad number%s: is read onlysetstr: %s=%s: assigning to self%0*s%.*s%*s%.*s%-*.*sENVSHELL%s: restricted @(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QB/?^y$%s %d%sfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-usage: %s seconds if%s: destination pathname too longmain%soverwrite %s? override %s%s%s/%s for %s? rename %s to %scannot resolve %scannot rename a mount pointcan't remove %sdo_move%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set times/bin/cpmv-PRp--%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fi] source target %s [-fi] source ... directory %d|&=<>+-*/%:()syntax error%seval5non-numeric argumentdivision by zero--%d %s M:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUF%susage: %s [-M core] [-N system] ssethostnamegethostname%s mainusage: %s [-s] [name-of-host] IN-ADDR.ARPAgetnetanswerbf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpagetnetbyaddrgetnetbynamegethostby*.getanswer: asked for "%s", got "%s"-_/getanswerbf%u.%u.%u.%u.in-addr.arpa%x.%x.ip6.arpagethostbyaddr/etc/hostsr B/q7Dۥ9V[Y?^[$1U }r]tޱtiG$ -,oJt\vژ>QR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqxj gg?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL[:<:]][:>:]]__elf_fdnlist#z#y#y#y#y#y#y#y#yx#yp#y`#yH#y8#y(#y#y#x#x#x#x#x#x#xx#xh#xP#x8#x #x#w#w#w#w#wThread ASTUser defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0#z#y#y#y#y#y#y#y#yx#yp#y`#yH#y8#y(#y#y#x#x#x#x#x#x#xx#xh#xP#x8#x #x#w#w#w#w#woption requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %sPOSIXLY_CORRECT0123456789abcdef0123456789/usr/src/lib/libc/net/inet_net_pton.cinet_net_pton_ipv4n >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" udptcp%ugetnameinfoip6_parsenumeric%u.%u.%u.%uinet_ntop4%xinet_ntop6asprintf%s: //dev/null%h %e %T ...RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffs/etc/disktabb0b1sfsentnsncdtscsubssbpxbxfxoxtxdx%s.dbtcgetentr:\|:cgetnext/etc/protocolsr /bin/shsh-cexeclexecleexeclpPATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin:.execvp: : path too long sh/bin/shexecvpxdr_array: out of memory %s: : %s   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~...realpathvfscanf<Ҳ؉9I#ը32D=%[όh(doCnfinityanA@??AA?5?55?5MD5PadsnprintfGMTabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual page../etc/localtime/usr/share/zoneinfo/tzloadmnposixrules,M4.1.0,M10.5.0TZ?SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec??? ??? ?? ??:??:?? ???? ???%Y%.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s asctime3#h#`#X#P#H#@#8#0#(# #######H###########x#p#h#`#X#P#H#8#(# #######%a %b %e %H:%M:%S %Z %YPMAM%a %b %e %T %Y%m/%d/%y%H:%M:%SSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJan%c?%02d%2d%Y-%m-%d%03d %H:%M%I:%M:%S %p%ld%lu %d%e-%b-%Y-+%04d_fmt_conv-0 error: %p wrterrormunmap roundmunmapmalloc cache underflowmalloc free slot lostmalloc cache overflowinternal struct corruptmap roundmalloc cache/etc/malloc.confMALLOC_OPTIONSmalloc() warning: unknown char in MALLOC_OPTIONS malloc init mmap failedomalloc_initregions_total not 2^xpp & bitschunk info corruptedchunk overflowmodified chunk-pointerchunk is already freemprotectrecursive callout of memory in malloc():bogus pointer (double free?)bogus pointerguard size in free():free() called before allocation in realloc(): in calloc():stack overflow in function %s__stack_smash_handlerclntudp_create: out of memory clntudp_callres_query%.*s.%.*sres_querydomainHOSTALIASESr__hostalias __res_nameinquery__res_queriesmatch__res_send  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/&/etc/resolv.conffLOCALDOMAINrbf;#family inet6inet4domain lookupsearchnameserver%usortlistoptionsconfRES_OPTIONSenv_res_initndots:debuginsecure1insecure2edns0tcp01234567890123456789abcdef0123456789ABCDEFinet_pton6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/etc/servicesr ,/invalidtoo smalltoo large ((((( AAAAAABBBBBB syslog%s: unknown facility/priority: %x_r<%d>%s[%ld]Error %d /dev/console __vsyslog_r/dev/logconnectlog_rvsnprintf%s: %s; errno = %s; low version = %u, high version = %u; why = %s(unknown authentication error - %d); s1 = %u, s2 = %u ... #h#H#(#######`#@#######hRPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code)%s %s: %s - %s %s: %s ###h#P#0###Failed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OKclnttcp_create: out of memory bindresvport_saxdrrec_create: out of memory : perrorlibcUnknown error: Unknown signal: NLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGC_catopen##x#X#H#0########h#P#@#(########p#X#8#(########x#P#0#######h#H#0#######X#0######h#P#8########x#`#8# #######X#@#(#######h#P#0# Not supportedNo message of desired typeIdentifier removedOperation canceledValue too large to be stored in data typeWrong medium typeNo medium foundIllegal byte sequenceAttribute not foundIPsec processing failureNeed authenticatorAuthentication errorInappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisk quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0####x#`#P#@#0##########p#`#P#@#(########p#X#@#0Thread ASTUser defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0xdr_bytes: out of memory xdr_string: out of memory  !#&(*-/14nfinityanA@??A<V0123456789abcdefABCDEF%$sniglet^&HASH: Out of overflow pages. Increase page size TMPDIR%s/_hash.XXXXXX/tmpopen_temp0InfinityNaN`InfinityNaN0A??҇coCa?Ɗ(`ȳ?DPy?@$@@?CAy7FnM8O?ZwH02uOs<<Ҳ؉9I#ը32D=%[ό (doC?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒisatty# # # # # # # #@#8#8.ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789arc4_stir/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin!p!"(!"4!"$!"9 !"U<!!V!!V!!u!!{4!!<!!<!!<!!!!=|!!I!!0!! !!|!!p!!xK8!!pR!!hR!!XG!!PZ !!HZ !!@Z !!8u !!(@!! !! !!8!!! !  ! \! B,! B,! G! LX! و! ! ! ! 5! 5! 5! p?! h ! ` 0! P 0! H w,! @ ! 8 ! 0 ! ( ! а!  а!  а!  p4! s! ~! ! !unblock and -DNO_CONV?@!-0!-(!-!-!,!-!,!-!,!-!,!-!,!-!,!,!,!-!,!,!,!,!,x!,x !,h!-!,X!,P@!,8!-!,(!, !,!,!-!-!.!.!6]H!6]h!6]!6]!6`!6^!6^\!6^x!6^!6^!6_!6a@!6_!6a@!6x_!6pa|!6ha!6``!6X`P!6P`!6H`!6@a!68a@!G!G!G!G!G!G!Gx!Gp!Gh!G`!GX!GP!GH!G@!G8!HX!HP!H@!H0!H(!H !H!H!H!G!G!G!G!G!G!G!G!G!GP!G8!G!G!H!H!H!H!H!H!H!H!H!H!H!H!Hx!H!Hp!H!H!G!H!H!Hh!H`/tmp/EdDk.aXXXXXXXXXX!Y!Y!Y!Y!Y!Y!Y!Y!Y!Y!Y!Y!Y!Y!Y!Z!Z!Z!Zx!Zp!Zh!ZX!ZP!ZH!Z@!Y!Z8!Z0!Z(!Z !Z!Z!Z!Y!Y!Z!Y!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z!Z abcdfiklnoprstuvwxBDEGHLPTUXYZ0!(n0\Hnrb,r^0\\LHJ! L`(\H``b b,b@^0\\LHJ!ne\Hf@i4b,i\^0\\LHJ!nef$f@i4i@i\^0\\LHJ!( (l(LHJ!(XLLHJ38uO.? ;!!!(! !!!vVvUvUvUvV@vXvY vXP.3@!@մ!0մ! մ!մ!մ!<.Ad"@"0" "`"X"P"" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)33"'@a3x`"0("0b3@xD"/"/B3x("/"/pc3x "/@"/ ".d3AxP".".e3x".".".hf3x@".P".0F3x"."-g3x8"-"-"-Ph3x"-0"-HAx0",",i3x",",",pj3x",`",8J3!x",",lHL3x,"+"+m3x4"+"+"+n3"x"+"+h"+Hp3HP34"+8q3x"+"*"*r3"xT"*"*x"*8s3!x "* "*S3!xL")")u3"xh")")")xV3w3"xD")P")"(x3(H"("(X3Ax\"("(xy3x$"(`"(8z3xX"( "("3"'~3!x"'"'?3#3xd"'"'p.3Ax<"'`"'Hx` (press RETURN)... (interrupt to abort)"1"2"2h382 ":"`#>X#>H#>`#>@#>8#>0#>(#>`#> #>#>`#> #>#>#=#=#=#=x#=h#=P#=8#= #=#<#<#<#<#<#=#<#<#<#<#<#<#h#@ #@ <#@ p#@ #@ #@ #@ 0#@ d#@ #@ #@ #@ 4z1P _xx:xx:xx:xx:xx:xx 0000000000000000#[#[#[#[#[#[#[#[#[#[#[#[x#[p#[h#[`#\#\x#\h#\X#\P#\H#\8#\0#\(#\ #[#\#\#\#\#[#[#[#[x#[`#[#[#\#\#\#\#\#\#\#\#\#\#\#\#\#\#\#\#\#[#\#\#\#\BKMGTPE@5MS7) zP#mp#mP#m@#m #m#l#l#l#l#l#l#lp#l`#l@#l0#l #l#k #k#k #k#k #k#kp #k`#k8#k(#k#k#j#j#j#j#jp#ox #op <#oh p#o` #oX #oP #oH 0#o@ d#o8 #o0 #o( #o 4 #r#rH#r@#r8#r#r@#q#q#r@#q#q#r@#q#q#r@#q#q@#r@#q8#q#r@#q#p#r@#p#p#r@#px#pp#r@#ph#pH#r@#p@#p(#r@#r@#v#v#v#v#v#v#v#v#v#v#v#v #v #vx #vp #vh #vX #vP #v@ #v8 #v( #v #v#v#v#v#u#u#u#u#u#u#u#u#u#u#u#u#u#u#u#u#ux#px #u`!#uP"#u@##u0$#u %#u&#u'#t(#t)#t*#t+#t,#t-#t-#t.#tx.#tp/#th/#t`0#tX1#tP2#tH3#t@4#t85#t06#t(7#t 8#t9#t:#t;#s<#s=#s>#s?#s@#s[#s\#sp\#sX]#sH^#s0^#s _#s_#s`#r{#r{#r|#r}#r}#r~#r0\:P?#z#}#}#}#}#}#}#}#}#}#}#}#}#}#}#}#~#~#~#~x#~p#~h#~X#~P#~H#~@#}#~8#~0#~(#~ #~#~#~#}#}#~#}#~#~#~#~#~#~#~#~#~#~#~#~#~#~#~#~#~#~#~#~#~#~#  5450123456789abcdef 33##(,<+,,,D000001l25H5677\7l75@56X677\7l75@<<=,=>$>?D?@p\X{}{33TD{3PTD{ 3TD{833##(.shstrtab.init.text.fini.rodata.data.eh_frame.pltpad0.pltpad1.gotpad0.ctors.dtors.gotpad1.bss.note.openbsd.ident LL``XX!pph%3C4Gc4Pc44 Wc@@^cHgtX l44 . install.md set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in "?"|L|l) echo "Available layouts: $_layouts" ;; default) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done fi } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } scan_disknames() { local _n _oifs=$IFS IFS="," bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -ne "$1") IFS=$_oifs } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_ifdevs() { ifconfig "$@" 2>&- \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_drive() { ask_which "$1" "contains the $MODE media" "$2" "$3" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | grep '^ [a-p]: ' \ | egrep -v "swap|unused" >$_file _parts=$(sed -e 's/^ \(.\): .*/\1/' $_file) set -- $_parts [[ $# == 0 ]] && { echo "No filesystems found on $_dev." ; return 1 ; } if isin "c" $_parts; then resp=c elif [[ $# == 1 ]]; then resp=$1 else cat /tmp/parts.$_dev ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | grep "^ [a-p]: " | egrep -v "swap|unused" | sed '\''s/^ \(.\): .*/\1/'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { set -o noglob stty -echo read -r resp?"$1 " stty echo set +o noglob echo } rm -df /tmp/lock lock() { while ! mkdir /tmp/lock 2>&- && sleep .1; do done } unlock() { rm -d /tmp/lock 2>&- } retrap() { trap '>&- && kill -KILL $cppid 2>&-; echo; stty echo; exit 0' \ INT EXIT TERM } rm -f /tmp/update ( while :; do lock if test -e /tmp/update && [[ "`dmesg`" != "`cat /tmp/update`" ]]; then dmesg >/tmp/update kill -TERM 2>&- $$ || exit 1 fi unlock sleep .5 done ) |& cppid=$! retrap _ask() { local _int _redo=0 _pid trap "_int=1" INT trap "_redo=1" TERM lock; dmesg >/tmp/update; unlock read resp lock; rm /tmp/update; unlock if (( _redo )); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap (( _int )) && kill -INT $$ return $_redo } ask() { local _question=$1 _default=$2 while :; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " _ask && : ${resp:=$_default} && break done } askpassword() { local _oifs=$IFS IFS= while :; do askpass "Password for $1 account? (will not echo)" _password=$resp askpass "Password for $1 account? (again)" [[ "$resp" == "$_password" ]] && break echo "Passwords do not match, try again." done IFS=$_oifs } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return ;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue ;; root|daemon|operator|bin|smmsp|popa3d) ;; sshd|uucp|www|named|proxy|nobody|ftp) ;; [a-z]*([a-z0-9_])) (( ${#resp} <= 31 )) && break ;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full user name for $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed." ;; *) (( ${#resp} <= 100 )) && break echo "Too long." ;; esac done username=$resp askpassword $user userpass=$_password if [[ $sshd == y ]]; then ask_yn "Since you set up a user, disable sshd(8) logins to root?" yes sshd_disableroot=$resp fi } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (( $# < 1 )) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." echo -n "Which one $_query? (or 'done') " [[ -n $_dyndef ]] && echo -n "[$_dyndef] " _ask || continue [[ -z $resp ]] && resp="$_dyndef" isin "$resp" $_dynlist done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } showcols() { local _l _cdir=/tmp/cdir set -A _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [ "$_l" ] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi (cd /dev && sh MAKEDEV "$_dev") >/dev/null 2>&1 } addhostent() { local _addr=$1 _name=$2 _delim="." [[ -z $_addr || -z $_name ]] && return [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].*[ ]$_name\$/d" /tmp/hosts \ >/tmp/hosts.new 2>/dev/null mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin $_f $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2 ;; done) break 2 ;; -*) _action=rmel ;; *) _action=addel ;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done done set +o noglob COLUMNS=$_col resp=$_selected } configure_ifs() { local _first _ifdevs _ifs _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(vlan$_vl: flags=0<>*) ]] && break : $(( _vl++ )) done _vd= while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifdevs)' \ ${_p:-'$( (ifconfig netboot 2>/dev/null | sed -n '\''1s/:.*//p'\''; get_ifdevs) | sed q )'} [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs rm -f $_hn if [[ $_ifs == vlan[0-9]* ]]; then _vi=$(ifconfig $_ifs 2>/dev/null | \ sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | \ sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while (( (_vi += 1) < 4096 )); do ! isin "$_vi" $_tags && break done fi _ifdevs=$(get_ifdevs) set -- $_ifdevs while [[ $1 == vlan[0-9]* ]]; do shift done ask "Which interface:tag should $_ifs be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifdevs && [[ $_vd != vlan[0-9]* ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if (( _vi < 1 || _vi > 4095 )) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || \ echo "up" >>/tmp/hostname.$_vd ifconfig $_vd up ifconfig $_ifs destroy >/dev/null 2>&1 ifconfig $_ifs vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_ifs##vlan} == $_vl ]] && (( _vl += 1 )) fi ifconfig $_ifs 2>&- | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_ifs $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_ifs ]] && \ ask "Symbolic (host) name for $_ifs?" $resp _name=$resp v4_config $_ifs $_name $_hn v6_config $_ifs $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn (( nifs += 1 )) : ${_first:=$_ifs} _p=done fi done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down -group dhcp 2>&- rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } hextodec() { local _d _b for _b in $(echo ${1#0x} | sed 's/\(..\)/\1 /g'); do _d=$_d.$((0x$_b)) done echo ${_d#.} } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' > $WLANLIST cat $WLANLIST } ieee80211_config() { local _ifs=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_ifs -nwid -nwkey ifconfig $_ifs -wpa 2>&- && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_ifs | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_ifs | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | less -XEN ;; *) _nwid=$resp ;; esac done if [[ $_nwid != any ]]; then ifconfig $_ifs nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" [[ $_haswpa == 1 ]] && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_ifs nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_ifs wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } v4_config() { local _ifs=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_ifs inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then set -- $(v4_info $_ifs) addhostent "$2" "$_name" echo "dhcp" >>$_hn makedev bpf$(ls /dev | grep -c "^bpf[0-9]") fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_config() { local _ifs=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up if rtsol -F $_ifs; then set -- $(v6_info $_ifs) addhostent "$2" "$_name" echo "up\nrtsol" >>$_hn fi return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -n $(ifconfig | sed -ne '/[ ]inet .* broadcast /p') ]] || return [[ -f /tmp/dhclient.conf && $nifs == 1 ]] && return [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _f _gw for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [ -f /mnt/etc/$_f ]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do (( nifs += 1 )) if=${hn#/mnt/etc/hostname.} (ifconfig $if||ifconfig $if create)> /dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" makedev bpf$(ls /dev | grep -c "^bpf[0-9]") ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ -z "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) if [[ -z $DISPLAY && ! -d /mnt/etc/X11 ]]; then isin ${_f%${VERSION}.tgz} xbase xetc xshare xfont xserv && continue fi isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && \ _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at " echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/' echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col echo return fi resp=y isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" [[ $resp = n ]] && return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp [[ $resp = n ]] && return shacmd="cat" [[ -x /bin/sha256 ]] && shacmd="sha256 /tmp/h" for _f in $THESETS ; do isin $_f $_get_sets || continue echo -n "Getting $_f ..." rm -f /tmp/h case $_f in *.tgz) ftp $FTPOPTS -o - -m "$_src/$_f" | \ $shacmd | tar zxphf - -C /mnt ;; *) ftp $FTPOPTS -o - -m "$_src/$_f" | \ $shacmd > "/mnt/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." elif [ -f /tmp/h -a -f "/var/hash/$_f" ]; then if [ "$(/%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } startftplist() { (( nifs < 1 )) && return set -m ( ftp $FTPOPTS -a -o - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$FTPSETDIR" \ 2>/tmp/ftplisterr > $SERVERLISTALL echo -n $SECONDS >$SERVERLISTSEC ) & ftppid=$! set +m (sleep 12; kill -INT -$ftppid >/dev/null 2>&1) & } waitftplist() { local _dot # XXX [[ -z $ftppid ]] && return while [[ -n $(jobs $ftppid 2>/dev/null) ]]; do echo -n . # XXX _dot=. # XXX sleep 0.2 # XXX done [[ -n $_dot ]] && echo # XXX } ftp_time() { local _ftplist_sec=$(cat $SERVERLISTSEC 2>&-) local _time=$(sed '/^TIME=\([0-9]*\)$/!d;s//\1/;q' $SERVERLISTALL 2>&-) [[ -n $_ftplist_sec && -n $_time ]] && echo $((_time + SECONDS - _ftplist_sec)) } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd _mirror eval local _server_ip=\$_${_url_type}_server_ip \ _server_dir=\$_${_url_type}_server_dir waitftplist ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp if [[ -s $SERVERLISTALL ]]; then _prompt="Server? (hostname, list#, 'done' or '?')" sed -n "s,^${_url_type}://"'\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $SERVERLISTALL > $SERVERLIST set -- $(sed q $SERVERLIST) _server_ip=${1%%/*} else echo "(Was not able to get ftplist from ftp.openbsd.org, but that is OK)" _prompt="Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$_server_ip" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue less -XEN < $SERVERLIST ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -n "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } _server_ip=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) _server_ip=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done eval _${_url_type}_server_ip=$_server_ip set -- $(sed "/^$_server_ip/x;\$!d;x" $SERVERLIST 2>&-) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (( $# > 1 )); then resp=$resp/$FTPSETDIR _mirror=yes fi ask_until "Server directory?" "${resp:-pub/OpenBSD/$FTPSETDIR}" _server_dir=$resp eval _${_url_type}_server_dir=$_server_dir if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi _url_base=$_url_base$_server_ip/$_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp $FTPOPTS "$_url_base/") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp $FTPOPTS -o - "$_url_base/index.txt" | \ sed -e 's/^.* //' | sed -e 's/ //') fi install_files "$_url_base" "$_file_list" installedfrom=$_url_type://$_server_ip/$_server_dir if [[ -n $_mirror ]]; then package_path=$(print -r -- "$installedfrom" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/\1/packages/$(arch -s)/!;q") else package_path= fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { get_drive "CD-ROM" '$(get_cddevs)' || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" '$MTDEVS' || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zonefile=$1 _zonepath _zsed _tz _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitftplist if [[ -s $SERVERLISTALL ]]; then _tz=$(sed -ne '/^TZ=/s/TZ=//p' <$SERVERLISTALL) [[ -n $_tz ]] && isin "$_tz" `cat $_zonefile` && TZ=$_tz fi [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue ;; "?") grep -v /. $_zonefile | showcols continue ;; esac while isin $_zonepath/ $(cat $_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols ;; *) _zonepath=$_zonepath/$resp ;; esac done if isin $_zonepath $(cat $_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } sane_install() { local _q=$1 _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue resp=n [[ -z $_q ]] && ask_yn "Are you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d _locs="disk ftp http" echo [[ -s $SERVERLISTALL ]] && \ _d=$(sed -ne '/^method=/s/method=//p' $SERVERLISTALL) ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $(get_cddevs) ]] && { _locs="cd $_locs" ; : ${_d:=cd} ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" : ${_d:=http} if ! isin "$_d" $_locs; then for a in http ftp cd nfs tape disk; do isin $a $_locs && _d=$a && break done fi echo "Let's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -n $method ]] && _d=$method sane_install quiet && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin cd $_locs && install_cdrom && method=cd ;; d*|D*) install_disk && method=disk ;; f*|F*) isin ftp $_locs && install_url ftp && method=ftp ;; h*|H*) isin http $_locs && install_url http && method=http ;; n*|N*) isin nfs $_locs && install_nfs && method=nfs ;; t*|T*) isin tape $_locs && install_tape && method=tape ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/svnd*|\#*) || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] && _opt=$(echo $_opt | sed -e 's/ro/rw/') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest _msg _fail while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp _msg=$(mount -v -t $_fstype $_async -o $_opt $_dev $_mp) || _fail="$_fail\n$_mp ($_dev)" echo $_msg | sed -e 's/, ctime=[^,)]*//' done 0 ]] || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } apply() { if [[ $sshd == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $sshd_disableroot == y ]]; then sed -e "/^#\(PermitRootLogin\) yes/s//\1 no/" \ < /mnt/etc/ssh/sshd_config > /tmp/sshd_config cp /tmp/sshd_config /mnt/etc/ssh/sshd_config fi if [[ $ntpd == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local if [[ $ntpd_server != default ]]; then set -- $ntpd_server sed -e "s/^servers /#&/;/#server /a\\ servers $1 " /mnt/etc/ntpd.conf >/tmp/ntpd.conf cp /tmp/ntpd.conf /mnt/etc/ntpd.conf fi fi if [[ $x11 == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi if [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]]; then echo "xdm_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && \ echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } questions() { local _d _xdmask=y _def ask_yn "Start sshd(8) by default?" yes sshd=$resp ask_yn "Start ntpd(8) by default?" ntpd=$resp if [[ $resp == y ]]; then ask "NTP server? (hostname or 'default')" default ntpd_server=$resp fi def=no [[ -n $DISPLAY ]] && def=yes if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" $def x11=$resp _xdmask=$resp # if aperture was n, do not ask for xdm fi if [[ -n $MDXDM && $_xdmask == y ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} ask_yn "Change the default console to $_d?" defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n ;; *) CSPEED=$resp ;; esac fi fi } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi if [[ -n $package_path ]]; then grep -v '^[ ]*installpath[ ]*=' /mnt/etc/pkg.conf 2>&- > /tmp/pkgconf print -r -- "installpath = $package_path" >> /tmp/pkgconf cp /tmp/pkgconf /mnt/etc/pkg.conf fi echo -n "Making all device nodes..." (cd /mnt/dev; sh MAKEDEV all for _dev in $(get_dkdevs) $(get_cddevs) $MTDEVS ; do sh MAKEDEV $_dev done ) echo "done." md_installboot $ROOTDISK populateusrlocal [ -x /mnt/$MODE.site ] && /mnt/usr/sbin/chroot /mnt /$MODE.site cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter 'reboot' at the command prompt. __EOT [[ $MODE == install ]] && cat <<__EOT When you login to your new system the first time, please read your mail using the 'mail' command. __EOT md_congrats } ROOTDISK= ROOTDEV= package_path= SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" FTPOPTS="-V" SERVERLISTALL=/tmp/serverlistall SERVERLISTSEC=/tmp/serverlistsec SERVERLIST=/tmp/serverlist WLANLIST=/tmp/wlanlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot FTPSETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && FTPSETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") nifs=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed) md_consoleinfo THESETS="bsd bsd.rd bsd.mp $MDSETS" : ${DEFAULTSETS:="bsd bsd.rd"} for _set in base etc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="${SANESETS:-bsd} base${VERSION}.tgz etc${VERSION}.tgz" COLUMNS=$(stty -a | sed -n '/columns/{s/^.* \([0-9]*\) columns.*$/\1/;p;}') [ COLUMNS -eq 0 ] && COLUMNS=80 : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR COLUMNS cd / umount -af 1>/dev/null 2>&1 for _ifs in $(get_ifdevs dhcp); do set -- $(v4_info $_ifs) [[ $1 == UP && -n $2 ]] && continue ifconfig $_ifs delete down -group dhcp 2>&- done cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT set_term if [[ $MODE == install ]]; then ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig (( nifs != 0 )) && startftplist echo while :; do askpassword root _rootpass="$_password" [[ -n "$_password" ]] && break echo "The root password must be set." done questions user_setup set_timezone /var/tzlist echo fi while :; do ask_which "disk" "is the root disk" '$(get_dkdevs | sed s,^$,none, )' [[ $resp == done ]] && exit [[ $resp != none ]] && break done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b b7c845899e6baae92762489a2cab56b002ad8521ef0536d06da9ca5b88b1b122 9ca67a8f6736aab5f807da96d094fb28e6223dacc3af75df022ddc052ab0ae29 08cc7ce2cb98c5d7afb52570abc37ffab444e4fb13e249c4e0fb683755dfe716 7954ddf0308520b71a0d4bb1b893a53372ecacb1e321c1cd25a1cf732f6bcece MDTERM=sun MDXDM=y MDDKDEVS='/^sd[0-9] /s/ .*//p;/^x[dy][0-9] /s/ .*//p' md_installboot() { local _prefix if [ -e /mnt/usr/mdec/boot ]; then _prefix=/mnt/usr/mdec elif [ -e /usr/mdec/boot ]; then _prefix=/usr/mdec else echo No boot block prototypes found, you must run installboot manually. return fi cp ${_prefix}/boot /mnt/boot sync installboot /mnt/boot ${_prefix}/bootxx /dev/r${1}c } md_prep_disklabel() { local _disk=$1 _f _op disklabel -W $_disk >/dev/null 2>&1 _f=/tmp/fstab.$_disk if [[ $_disk == $ROOTDISK ]]; then while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in a*|A*) _op=-w ; AUTOROOT=y ;; e*|E*) _op=-E ;; c*|C*) break ;; *) continue ;; esac disklabel -f $_f $_op -A $_disk return done fi cat <<__EOT You will now create a Sun-style disklabel on the disk. The disklabel defines how OpenBSD splits up the disk into OpenBSD partitions in which filesystems and swap space are created. You must provide each filesystem's mountpoint in this program. __EOT disklabel -f $_f -E $_disk } md_congrats() { } md_consoleinfo() { } ELF@4/[\4 (@@/Z 65P xHP rHP nHP jHeHHP ^HP RHP XHP RHP NHP JHP FHP BHP >HP :H  H H H  H H  H  H H H H H H H HP EHP HP !HP "HP #HP $HP %HP &HP 'ޡHP (ڡHP )֡HP *ҡHP +ΡHP ,ʡHP -ơHP .¡HP /HP 0HP 1HP 2HP 3HP 4HP 5HP 6HP 7HP 8HP 9HP :HP ;HP <HP =HP >HP ?~HP @zHP AvHP BrHP CnHP DjHP EfHP FbHP G^HP HZHP IVHP JRHP KNHP LJHP MFHP NBHP O>HP P:HP Q6HP R2HP S.HP T*HP U&HP V"HP WHP XHP YHP ZHP [HP \ HP ]HP ^HP _HP `HP aHP bHP cHP dHP eHP fHP gޡHP hڡHP i֡HP jҡHP kΡHP lʡHP mơHP n¡HP oHP pHP qHP rHP sHP tHP uHP vHP wHP xHP yHP zHP {HP |HP }HP ~HP ~HġHP vHP rHP nHP jHP fHP bHP ^HHHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~HP zHP vHP rHP nHP jHP fHP bHP ^HP ZHP VHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP  HP  HP  HP  HP  HP  HP  HP  HP  ޡHP  ڡHP  ֡HP  ҡHP  ΡHP  ʡHP  ơHP  ¡HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ~H 5P HP  rHP  nHP  jH eH HP  ^HP  RHP HP  RHP  NHP  JHP  FHP  BHP  >HP  :H   H  H  H   H  H   H  H  H  H  H  H  H  H  HP  vHP HP !HP "HP #HP $HP %HP &HP 'ޡHP (ڡHP )֡HP *ҡHP +ΡHP ,ʡHP -ơHP .¡HP /HP 0HP 1HP 2HP 3HP 4HP 5HP 6HP 7HP 8HP 9HP :HP ;HP <HP =HP >HP ?~HP @zHP AvHP BrHP CnHP DjHP EfHP FbHP G^HP HZHP IVHP JRHP KNHP LJHP MFHP NBHP O>HP P:HP Q6HP R2HP S.HP T*HP U&HP V"HP WHP XHP YHP ZHP [HP \ HP ]HP ^HP _HP `HP aHP bHP cHP dHP eHP fHP gޡHP hڡHP i֡HP jҡHP kΡHP lʡHP mơHP n¡HP oHP pHP qHP rHP sHP tHP uHP vHP wHP xHP yHP zHP {HP |HP }HP ~HP ~HġHP vHP rHP nHP jHP fHP bHP ^HHHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~HP zHP vHP rHP nHP jHP fHP bHP ^HP ZHP VHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~H 5P  HP rHP nHP jHeHHP ^HP RHP HP RHP NHP JHP FHP BHP >HP :H H H  H  H H H H H H H H H H HP HP HP HP "HP #HP $HP %HP &HP 'ޡHP (ڡHP mHP ҡHP +eHP ,ʡHP -ơHP .¡HP /HP 0HP 1HP 2HP 3HP 4HP 5HP 6HP 7HP 8HP 9HP :HP ;HP <HP =HP >HP ?~HP @zHP AvHP BrHP CnHP DjHP EfHP FbHP G^HP HZHP IVHP JRHP KNHP LJHP MFHP NBHP O>HP P:HP Q6HP R2HP S.HP T*HP U&HP V"HP WHP XHP YHP ZHP [HP \ HP ]HP ^HP _HP `HP aHP bHP cHP dHP eHP fHP gޡHP hڡHP i֡HP jҡHP kΡHP lʡHP mơHP n¡HP oHP pHP qHP rHP sHP tHP uHP vHP wHP xHP yHP zHP {HP |HP }HP ~HP ~HġHP vHP rHP nHP jHP fHP bHP ^HHHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~HP zHP vHP rHP nHP jHP fHP bHP ^HP ZHP VHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~H > ;8;;;;; ;(;0H )@`  > !  > ;8!5 > 0+0;"+*+0΁`#@ 0΁1 !>&;8>0)@09`")@)@0΁`# 0΁1"; >  9`9`9`9`9` 9`(9`09`86`@!`xH )@` !!! P -@ @ @"P/> P->  %)> # %"+/> -> +cP> !`"!#t@> !;x ;"`;" @K@ Ҋ@@2 @ 0P -@ @ @"P/> P->  %)> # %"+/> -> +cP> !`"!#t@;x҂@ ;Ԃ@`;"k  ւ@ ؂@ " +?P `* -` @Kjt x ``-`܁ @K^ tx Ӂ )>"@"P -@ @ @"P/> P->  %)> # %"+/> -> +cP> !`"!#t@;x;;>"" ;`#h#l;;;;@ ޖ``htx ;`#h#l;;;;@ ``htxr )>(#@)>) P -@ @ @"P/> P->  %)> # %"+/> -> +cP ;`@;h#t;x;;;;;`@ ;`htx, /> -> +cPۜP -@ @ @"P/> P->  %)> # %"+/> -> +cP ;`@;h#t;x;;;`;;@ ;`htx偌 -?P @c-@-P -@ @ @"/> /> /> 6PP->  %)> # %"/> /> /> P;x> !`"!@;,/,;@ ;`,;h)> "L#p 8% 8H  p@ @ `E < 0x  +?P`-- -?P%-?P0P -@ @ @"/> /> /> 6PP->  %)> # %"/> /> /> P;x> !`"!@;,/,;@ ;`,;h)> ݨ!P#pH  p@  "`@  0@@ `x) `E <P -@ @ @"/> /> /> 6PP->  %)> # %"/> /> /> P> !`"!?P * * ;`@;h09P -@ @ @"/> /> /> 6PP->  %)> # %"/> /> /> P> !`"!?P * * ;`@҂@ Ԃ@;h ւ@ ؂@@I<`h ?P `*  P -@ @ @"/> /> /> 6PP->  %)> # %"/> /> /> P> !`"!?p " ?P "  ;`@;h@ `h ?p " m @/>  @̀->  $)> # %-> +cP-> 4 VP @ H ,@`#> b$` (08 @̀;)> "0+0;"+0+0 `# @ 05-! % >&t 8 >0-@0=`"-@-@0 `# @ 05-"Y  -> %- +cP ;`@;h #t;x;`;;;;@ ^;`htx -> & 0Ʀ! H,@` !`hpxX (08@HP @̀H,@`%>  $!> "`8 (0 @̀@ @̀  H ,@`#> b$` (08@̀ᄀ29?@ @̀;'> 0/0?"/0/0 `# @ 05-!$>& 8>0-@0=`"-@-@0 `# @ 05-" ?  H,@`#> b $`!> "`8 (0@̀ -> 4  @wP-> "/> 4ɐ  ! H,@` !X (08@HP @̀>  `?* `"" * `@"> 3  * `@&* *  ֊@* "``@!>% Ԯ$'1@'0@ )>+>%@#'> T$$3  > b"@%> $   c d  mt@ >  > ""|@t@ >  @@   >  @@ K#>%> cT@%  '`@`@ 06  '`@`@ 0, *H Ѐ(H+ `!Ђ* ր  Ԡ҂2`*`D4`@ D֠ 0 !Ђ* ҂2`*`D4`@ D>%c`@> "" *> ""!`> ""H(  /  > ==> СH > ""> " > a@ ,"@!> $",H``> "b$ !>& @!>' D$ $ >& \ *> " > " > "!> "!<>#"">#"#>#"#X>#"#>$""4>$""\>$"">$""0>*"!@ t'@}d#@+`;h;p;x;;;;;;;;;;;;;@L@P@ `hpx gP    "%> > > "  "> >@ >  ">&b# ">&b# J@*@ ` `*@ ?"@ 2"# @ `*@ @ `*@  "  ?J*@`8  ?"@ 2"> * >  >@ *>  >&#@" > " > "   > 4``6 > >:H"(o  (5$`!4"j j ` *@  ( !> !(` (08$2㿠@ w> b` Ъ@@>€"Т@: H" H*/  dh> >'b " `2 `2`2" " ?" ?@>'b" Њ@" "@ 6 :@ 6 `6:   6  J?*@``";" " J `*"J*@ `"" "R2@ `4"R2@ `"" ""@ `""@ `":@ `""@ `R2@J *`2J*@   6 " J"`*@`"(" " " J"`*@"" J"`*@"" "" R"`2@"" R"`2@"" "`"@"" R"`2@2J?*> b>(\` #` 6 J *@`#`  `"<" " J *@`#`  "J *@"`" "R 2@`8"R 2@"`" " "@`" "@"`  :@ ` " "@` R 2@J *`#`  2J#`  *@#`  #`  H@ `*  @ : " : : : : : (: 0: 8: @: H: P: X: `: h: p: x 2@ *  @ 2* H@ `      ( 0 8 @ H P X ` h p x H ?P *H ?P +*?p` "@?p`"@@* ?P` <@ "@$@% #@%"$@% #@%&؃%"@ւ"%ւ"&؃"@  >) "2 J "2 J   "2 J  J  @ @: `  : `z Z@  r R@  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@> ? @ 3 > #d c@  Њb@&""""  > `@ @> b$ ``44: " longjmp botch `&"`㿠>*@w"6 0㿘``@`€Ő  ``€  `€ <`㿘``€  *`,`€ ``€  `€ >怎㿘 ͖  Ȗ Ö   ``€g ```€ _ ``€Y @€` ```€ L ``€F    .@€` 2```€ 3 ``€- 耤 ``€$   㿘M e  ` [ V  Q L ``€ ,D||||LXdpHtdddddD ,8DP\ht44 t`<<=8>D?H?X????@@<@p@LMlKMlMlMlMlMlLMlMlMlMlMlMlMlLMlMlMlMlMlMlLLWWXX$XPPPQtQQQQYYQQRRR0YTTU`UV(VTTYYYYYYYYSSYYYYYYYYYYYYYYVSSSSSWYYYYYYYYYSYYYYYYYYXZpZpZpZDZpZ`Z`ZpZpZpZ`Z`Z`Z`Z`Z4ZpZ`ZpZpZpZ`Z`ZpZpZpZpZpZpZpZ`ZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZpZ`Z`d[$[[^_ _|__``@`h```aa0aXaaabffbbbccc`ccdepffffffeef`fj4kgHglghhhkkkkkkkkkhki<ki`kkkkkkkkkkkkkkkkkkjHjHkkk8kkkkL`" !Đ ."`2N!!!  €aS 2!!`€ ` 2 !!`€  ",!! _ !` H ! `@ А@  $  ?7'@.@2 !6!6!6!!@ &!! _ !`  !!`  ! `_`P 2? ( /` 2"$6!! @ > ! _   $ ( < @&!&!&!&!&!&!?А /     &!&!&! &!  &!&!&!&!! _!` H!`( H!`  H !! `@! ` L ` 0">  P  > !">  ` @> !> !>  ! !!!!!> "c$! _e!`  !`! !`  !`( !`  G `!> !> "c$ <.!("(3" " d! .!>  !Ѐ 2> > !ؐ!> "c$""!    ""  d! .!>  " 2> > "!> "c$! `v€a id> #@@> > "> $"> $> $ " > (> $"0 @@ !@ @@| !    ! av€a  ̀id> $@@ > > "> $" > $> $"  > (> $"0 @ @@9 } !`!€  ?`*`>+"L €> ` @@! > "x> "c$ ! (> "> "c$  (> "> "c$ > "> "c$  > "> "c$ > "> "c$  <.!.!! `v€! > @? $ ;$! ` €!ē2``  >  @?є <($.! 7$!*`"  !Ā@ +.!Ē  !>!>!`"!@!  !` @? d!!   " ! B  z _Z@!  0!/  #@?ϐ !`€ @2 @ ! `"> @> @ 1 @? d # @? !`€?!   !`€ `2 `) ! `"> @> f!`  @? d!!    ! @  !`  ` #` € "%!@?_ d?< !! +> c€&!!  !`  _!`€ !   !`  ! _!`  ! _!` H!` H!` H!! `@@?  d!`  ! `_  #?  `@> !`€ 2 `"!! `"> @> 0 h`! ( ` € @  `! !`€ `  ! @`€ ` @!2 `-(! #` .!` @!`€ .2! !! `.! `0  !! `.! `@ !!!!  0! "!?А / !  @! `@ !` !!` !!` !!` !! `"!@! @ @>6 dР##> @>/ d?<!! `@cH@=֒ 04!`€ А@  $ '@*7д2!! 2 _G@ ђ $7b </)!77Ґ7777'77@*Ѐ2!7"@2!/#@2 !Di!@"!! `"ڟ@> #`ҐԔp#\@=q 0!`$  !Ȁ "! ! _3А /3(`v`_t9> $    @=M#  ] ! ` % 8%8 "h4!5 ?#??!đ2  + ,, @*` @* 2 @ 2`    @ 0 $ "p"r2  07А777777'7@)7@>  @<!    "! * `А /$ 9>   #@<Ҙ  _ ! ` %  8%- 2 8 8 "h4`?#!đ2  + * 2  * 2  @ 2 *`@ 2  ?@ ൒ $ "p"r2  07А77777'7@)q7@>  @  @  "@<<!@ 9 $  ?7'7@)Ѐ@>  @< X'!!Đ  &!* > &!Ĕ@; @@  $!А"@ '_7!ē6`2 7Ҁ 77֐ 7րP2 7!đ2  77Ԑ 7`'@(’! P _@2!@< ! !Ā @ ْ $ 4!Đ ?7'7Ґ@(@ ̒ $  7'@(@2!! _7"@2 !>  @;(!!đ2  ` Ҁ`  %6!6!6!6!6!6!> !`#$>  >  !> !H#\!#` #d@;h! _D@!!* *`!  ! 2 > ܔ2 ܐ@;O !*"!* #!* "! _! "! "!@ "@!  "!!  "! "!  "!@2  > @; !> ! " !!!@: ! _8!@  $  7'@'ؐ@ ! `?@0;! :6!!>  @:Ҕ@)"!  `." `       !@2   &!! @)В !   @)Œ 0@*ɐ㿘! !> !@:$ǐ@I !@ ?"@! 0"!ē2` `! _@Ő0@<0@h!!   2!Ģ`!đ2 Z! ! `.А@ u $ 27 7 7 ` 7 ` 7@'5'5@ ] $ 67 `7@ 7@' 'Ѐ!@ I $ 572` 2` `@ 7@2 2   ?7@''Ѐ> @3`2 23`#\(   `@: @  $ 37 7 `7@&'Ѐ >   ``@9 0ې@  $ 177`7@&'Ѐɐ@ɒ !   2!@ !? G@ ޒ $! S `7А  @!"t "v 3 07ސ7777'@&7@ڐ&"(@ ݷ $! R `7А !$ 2 "r"p7ք7777;'@ ݙ $!  `7А  @!7"v "t7'7@&R7@Rڐ&"(@ x $!  `7А !$7"r "p7'7@&17@1&" " &"$@ U $! J? 7Ѐ 7Ґ 7!? Ґ 7Ҁ  '@& @> @9 "  0."h.*  !* Ш@  $ 07 .2`@  7'@%@> 2  71@8 ,* ` 2``t`!Ē 2   `@  $.,  8@77Ҁ 77 ` `2 * @7>  2 #\#`Ԑ Ж@8 '@%#@ ܼ $ 8@77Ҡ'77@%Ѐ*@*  72!   @ ܜ $@ 977 7 7@%^'@2! , *  2  "2 " *  `@."""  `@."0 㾐> "'D!'d' `@ T' d/D   1  ῀ ?# @1 DD@!!* *`!  D  1 D Ēa2 1 `?# @1 D!đ2 ? #ߒ @1   1 d`* 2 '@ 1 `> D' @7$$1 d *`  1 d> `@D'@7ؒ  1 d*`  1 d>  hD'@7ǒ  1 d ) ) D!ȑ*2` 2  }1  `1  `2 Daa* *`a  D  1 D a ?А /ODD  Ȑ 1   @   D @ 0 @  1 @D ! 2  ?# @(1 ?c 1 d ``D @  1 @) CD!Ȁ  d  D D  1 Dd` "D D 1 DDaD* a!*`  h $@ X'  ' 87jD7h7l@$7nh@dD ᬒ ) 1 < (?P }?Xz\\3 X'@7 X'0T/`T'$X+2P'4'* 'D/ 7`@ D'L04\P'<2 P*$*`3 ' ' ',@   X'   P3 37`X7 '  3'H7 7`X X7 7`  '8'('' 1 O> ) ?) /) ) ) ) ) ) ) ) ) ) T\#\_)  ) W) ) D@6':PT@ P> D@6 > T 2*   7`/ 3   *`  2 ?Ж+ 7 7`1 ) ) ) ) ) ) T W) ) > D'@6k D ` $ $!  1 $> D'@6U D ᾐ ` ! ! @  1 &> D'@6? D "p2"t D "r3 "v  3 @5  D1 .1 (1 *1 ,1 01 21 41 6D>  '@60!x2`  > Dh @6'D@'axd! 0D@B2'h@  $d `7h 4@@7l 27trp c'd 7n'7v  D> @5 D@"ВD!xh* '!x > Dc@7Ɣ ` > D'b$'b 'b(b  0/b> " > @#`> "'D!Hp'D' $@ 'd  'd 87JD@"7HH@LDađ2 D 2D?# @2Dđ2 D? #ߒ @7 D` 7` @ ٚ' 1D * 2 '@1 D> `D' @5h$$1 D*`  1 D> hD'@5W  1 D!đ2 H $@ i'd$ϐ 'd B7bDH@"07HH@N1 D`! \D`!ȑ*2` 2  }1  `1  `D \ ! \DDa ! `    ` "  ` 0   ? ! ` `    D 1 XD> 'Ȗ @4  ` ?! `D? D*@Ȁ` ! d` @! dD!Ȁ(D d ! dD a1 Z (?0 }?8 z8<*8'$3<' / 8'47`0'4* 2''܃+7 /` @ $',<'02`* '2 ' '  \8'   03 37`87 '  3'(7 7`8 87 7`  '''' ! \/> ) ) ) ) ) ) ) ) ) ) ) ) 4<#\?)  ) 7) ) D@4V':04@ 0> D@4J ;> 4 2*   2 /`7   *`  \2 + 7 7`! \) ) ) ) ) ) 4 7) ) > D'@4 DD  `1  !$1 &> DD! ` ! ! @ 1 $> D@3 ;> D bp3 bt br bv2 \  `3 d5 1 .1 21 61 81 :1 ,1 01 4D> 0 @3'  4*`bt4 bp*br(bv,`#\345 #lD> #`#d#hp23 3`@3 aĀ  > D`@5 D!x2`  > D'h @3(@D"axD! 0@@DH@ ת $D `7H 47L` 27Tdrp  c7N'd'h7V 2`(*`D> ȗ2#\3 3`@3i D@ UHD!xH*  '!x'"$'" '"("  0/";> b > @Ҩ 㿘! `,` 0@ _ ` 2 `` >+"d*` €`0 ?   0@ H `0 ?"`0`a݀` > "!' _ .`2`@ .`2`@[ @  @ ,!Ĕ R6/ `?$4 4 44 > a @@4ޖ 2!!x2`  > h @2ܖ(m!@&!x!! 0@@D@  $! T @77 47 27a   ''7@7@ `@@DA!Ā > a @@4 z 1> (@2 q??* @*`\@ >+"*` €> NH> K`> H3` > #\ `@2k J > 8> 5> ( @2] : > `> &>  @2N - > Ж @2E ,  ,> 2 @28  > 8> `@2-  + > 2@2# ? 2!x*@&!x" > @m#pА@ ) $! o72  $77.`76  7' '@7?@` 3>+#*` €> Ґ@1ޒ 1 * +, > Ӑ2@1В 1   > Ґ@1Ē 1 > P@1 1  , > А3`@1 ЁpА@ ƒ $! q72  $77.`7a ?b''@@  > "!p'@ ՞ $! d`_7p#7 7r!@2  $7r7.`7r47t 27| ? ` 7v7~''!x2`  > h @1M)C@&!x@4p@ !x*@&!xI?! _! 0@B.?.* *`   6&    0@@U?.* *`   6&  !x*@&!x  > @E pА@  $! j72  $! _ $7Ҁ 7 7.`7Ґ 7 ? '@@?f?! _/Ԭ ܻ3 ֯0 /`*`0-5* ޚ     5`- 6@   -4`, @ @ -`,` @ . ܺ ֮3 /`*`-5*0 ޚ 0    5`- @   -4`, @ @ -`,` @ 6@   @ 0'D!> 'b> ' @0J!D> !@0D)D   )> 5B#4'>  #4'D@b' 2  @"@ 2`@ `D!@08 2 2`  2 2`  4m #4''@0k **"@ " *`"@ * " *`@ *  *`"@ * " *`* #@ #+`@ +  +` + @ > D#\P#` @/ۖ $e6А"?@" b@@ b>e6@ ?D ;ʀ@@ ՞#-@ ?D e6;ʀ@8@ @ Ջ#&n @2   > Dx@ ӳ $̒  '7D@|@m?D@2  23 D a  ? " 8  *  @"? *`  *   D"` `2DᲑ* *`C %     2     D a _ ~'D  2D  ? "?#@ ?# o ? "o+ 3`@4`, +`  @5`- @  ,`.-` .`     -     ?  2`*   4`,  *`4, ,`@, @ .`@  - @-` @  @ @ ? ??  `0*`  ' ? @  ' 2/   @  @  D'  `_@   @ D  > D@.!k? ?"??c@  #D !`/4@ ґ $̐ ]`7 q'D'@V7@"  D> @.Y @  " D>  @.I  "> c(*   ?@> D(  @.3!D!  (  , #\ D>  $@.#!> D@.! >  > @o" >+(* > "(> "8> "P> "`>  "h>  "x> "> "> "㿘!2    > @-ܒ ?2`  2`   2`@ > 2`   > 2`  > @3 > @- °?> @-! 0'$- 2 + `0    2   ~> 0 @- ,` `*`>+#H € $ @+O  ? ?*  T  $ * ? @ $ o  ?  + @@ ??  @ @ $ $ @+# # @$ $ R `$ @+ *  ?# @ @ $ $ =  ? ?? #*  @@  @?@ #$   2 /`0?*  2@`$ @*5`~"    $   c $  $ > P@, @/,`2 !Q 8($ > 'D"!''2`  2`     2`   D> / ~- D>  @,Ȕx @ 0$"@D> !^+> @, D> !T+> D @, @/4DD> !E+, ! 0'T#"4 > D@,? 7+ 'P`2`@D ᾀ  PD 2    Pء2 D  @2   D> !+~@,]D ?2   D ᾀ ؀D 2`* '*`'?  2*5-@'* ?2+ @ @ '|' ?x ?3`+'@ 't+`+?| x3 +@ +`+  ?t?p |'l+`+ l'd ?htl * d'\?` d\ +?X-\@@ + @ ܨ@ ??   @@  ?  0@?ܚ# . ز@Ȓ ?@  ?в@7 'Є @ 9?Ȟ ԀЖ`?  P `?3`D> `?#\@+ @. D?   $??#  `*`   $$>  D0@+f!Y!  ?`0K@2H ̀@2C  2? 2; 2$  @ 22 ` @> 5XD @+&!? ? %   @ @ % ??  @ * @%  ! !C2   2 !` @ 2 " > Dx@* -,  0@  ?@? ? #@  @ @$??  @* @$> 3@ДD!<< @*T *` 57  0$"> " > @ H)> !> "'@* @ ’ `4#7Ц!q 4 `0 3 4  ` B 4 ` B 2 ! 4 4 4 $ 4  @A@ Η $ n 777 2 7&%77'@R'@ @?  " > @ɫ (> "!''0> @*@ ! _ @ U @ ,` )/ 'Ԅ ?' 4` $`4`4` 4`$` $`$4/@$`(o@ B $`,$`0$`4` B !$`8 $`<> a  @@+/@>Ӓ@  /  !q!,`,`4`/@4` @F< %/P!Ā` > a(@+۔ /@  @@  $ T @77/2 7`/7o B 2 7o B  7'@'@$?@ aH @@+` > X@)  ?!Ā > ax @+'  > @!@'D> "> !'!'@)|2`  2N?2`  = 4G 2`    pА&"@> D6Dx2`  > Dh @)U,D@"x 0%D# a`_  D   0D&#!x*  $!x @ 0D"$@x* $x2   D!x?*@%!x 0@!(D '@A  @    "!D> @(Dx*@%xВ pf &@І< ?  'Ē(7' @    Ȓ`a'ȑ*` `ȑ* `> D@(ƒ > D'ĔP@(!'Ā 5ȕ,` ` *` * @@ '̘Ā +  * *`  ̐ 2 Ā đ+ -,,> ̔xD@(!Ā''Ā@6/DȔ (  @ * ` *`  '> D!@(k?̐ D>  > ̔@(W!`0`0  ' ̐  !'Б,  0@ ``@ %?̐ !+-  0'@D @2` ``'݈@ 1? ?#   ! @>  ? %@̔D@( ! 2`*  2*@  '- '| 4, ''5`,@? .'t '̭7`/ -`?*`?'?*|?x@''l?' 'd |t @ ??p??t6.`@(. @  ?? .` ?/`@? ?.` d ?  @?h?` ld?-*  а ؒ @   @  ܨ??/?̐2  @   %? @"  %?  #\#h#`#d#l#p  #t #x > #| #'D@'$!D@ր  ? @ @ ? @ !! 2   D!x> * %!xD!ɖ- 2`*   '\0(*`  4`, \'?X  ,`'4,5`- @?,'4('L\'TX 4 0 ?0(?-`4','$T ?P ?(@'DL@ ??H?@?\ L+`$.`D?  ?@ @ ?@'? D  ?'<.`?, $,`<-?8.` +`   @   @   @  ?? @ D D D> 0 @&P'??  @ @ ?@  !!  '1 ?ܔ ?# 0 2  *, !   @ @ D2 D`> > 'ԔP@&! ? !'Ԕp@& ! ? !А 0 " &' 0??И c"  (   b2  : '    А 0>   #\̔ @%Dpb > ̔D@% dȔБ- 0D'@ր 2   PD!x> * &!xD!g.E 2`*  2*@  '- ' 4, ''5`,@? .' '̭7`/ -`?*`?'?*?@' '?' '   @ ????6 .`@(. @  ?? .` ?/`@? ?.`ܘ  ?  ??@*ܢ  -ܖ  @ز@     ? ?О 03'2   -`В@@ 2 @  @2 H@ 2  @  @  '"% @ '?1?̖  ! @# @,9 *@ 9 ! > ̔D@$!TГ,@ 2  ?":#\#d#`#h2>  #l ̔0D@$ 3Р`00? ?# @ @ *@ , @! 2 DD> ̔x@$k!@ ?  #@> ̔@$`! ? #Ġ 'Dx* $x2`  D> ! .D!x> * %!xD!-@$8D  ? pА&%@> D@$*! ->  > @{ 㿐!@2   (@??c% @2   D4  !@2   6: @3.6@,`2 W 2!    !2!,`> @#Ē 5?262 . !@2   2!? > @# ?@?."  #\?> . 8@# ?(> !"'@ ǡ <!x`4 7 `"!4` !3 4`  a B 4` !a B 2 4`4` 4` ? @ 4`3 2 4`` 4`> h @#P/!&!x! 0@:/@ _ $ n 77 47 27&% b ''7@7!x*&!x ?  > @r!h(> "!'!x`02   > h @#/&&!x@  @ , )/   4?'!$  44 4 44$$$o/@$(o@ B $,$0`$4 ` C  $8$<@7@  4/  " 5 5 - - ? @ :`- ! : -  @ - o@% @>o@ ǒ @ Ò $ T @77/2 7`/7o B 2 7o B  7'@q'@!x*@=&!x@54!Ā > aH @@$a  !x* &!x> #X`@>!x  *    &!x> @"O!?  > > @"D! @"> ? > @!؁㿘.`?2`#@ a @ 2   * 2  ` * 2  ('a@2   *2 (*2  " * 2`@    * 2   `2 `0  ` 6 8> b  *'$$,`4đ2 R 2   > @!̒ G   ,4 >  @! /  ` *  ``V  /(0 h! 0-  > @ @!a -` `2   g h"*`0 $,a e@ ŝ @   . , ,4 , @%` $$ *2`  `*@*  , @ @ H  : @:  @@"ٖ > `  5 _ @@ V   , ,, @%`$$  ,֐  2  :  `` `  @ ' @ ,` _  ,@   ,@  ,@,@ _   J@ "  `?",` "   2 J`   $d̑- *  h"   4` ` `  $d" ,` ,`54` _-` 04`? @ 4`0  : ,`2 *`2`!2` @,` ` ` ,`2 `2  4`  ,` ` 4` ,` ` ,` w@ ŭ#* `4  4 _!@84@!  > x@ V  $,1 f$``@ g"@!Ő$, > J@ $ 2 $  #` @ /#\` g$$ 4 > @v"pТ@ 1 $` >+#`.` €> Ж@  ]? ! _>   7 ! `7Ґ 7 !   7 " 2`* " *   7В`,"'@ @&?> @ƒ  ? !#`_ @> K8 ` :`!@2  $77ґ.`7 ..` 7   7'@ 7@?> X @ " *2 " *  `@,"۰  ` @  2 !>  _> @n ư? " !2 ` 2  .`77  7 .`  @ .`$2  . @7  ? 7'C7@  ! ?` ܐ ! ? ! z?2v ! q?)m ! ` g`_e b!72``$7`'@ @R?P ! JHc C >?: ?"6?04@ ǒ0 ?Ð# ? 22 멘 > 6?3#`* 62`2딘 `@逢@"0?㾰> " ' "(. U',:.!"`B 2)>!"8 6"<  "< !`€.4@  !  <"V @ } W> @b!.> ȗ2@a  !2`@Q D> ! . 2` @@2 !"2   2!"2   > 4@< ! €!Ԕ !! _!`  !! /!`€!"(@ ',> "( @ ,&"(!"(',!  02%!! 8!! !`€!!`€!Ԣ@@$!@> H@ !`€!Ԫ,&",IG! _ ?А /8!@ d!`€!!` ` €,'! /!`€ !`€   @!> ,`B >!#\x @&","0 2L!, &"0@4`,! "l*  .@  ? ',`'(@ ͔! @ _ `@(!Ā > ` @@O ```"@'p!Ā > ` @@;J`$@)<!Ā > ` @@+  6 .@  . " *!6" @, `",,, >  X3 @ #\> `@ @@  @,` ` `` `'(` % >  @H! > @ `  > a @@Ж ` > a @@Ɩ !`@` > (@ 2"`` > `P@   @ > `x@  @@ Đ!`,!E,@  $ , "$2` `$``"*  ."  $ ,!   _  ``  `$ `  ``` `    `_ `$`  ! `` 2, F`>+#*` € (! `>   $ 2  #\@9  $ ,! _@( ,@Ԗ( , 2 ! F 2! $ ,! "()$ (  $ d!̑* *  @ "  "$ d  "  ." 2$ (($ ($ ( >  ,  $ , 4 >  $( (@ؒ @. $`  (, F$ , , 2 $ $ ,> @Ē !Ā 2  $> b@ @ $$ (> b(@ @ , 2 $ $ , $ " !! `!Ā 2  . ,  F &" F 6   W 0  . ? ( $8 >  2  $#\ ( #` F #d#h ,#l@l" "/ "?6"/ 0" @ } @  ,,`!`,!!`€!"&" @&6"! _ !`( H,! `@!`  , &"(&"0> 0.@ "B@.>".> " > @j"@p!   2 '! ` €'ԡ.`4 >  @P@?ߐ#@`H >, *` €" ԕ2*  " *  `@." @"!   `."` !@ 0"@! ?""2    &"86"<@ @ ?> )`> &!`€!> Ԕ@ 0h> ԔА@ 0a> @ > [> > @@ ! `€ hd&.`7> @3.`> h@l !@ ;"@! 7"!@"'"@> @Z !@$"@! 7> @M !@ ;"@!("!@ ="@> 2@: " ԕ2* " *  `@."eԐ!a'Ԑ!N^'Ԑ!['Ԑ!X'Ԑ!U' >  @"`B I>"!> @ ?"@!ඐ 0!#" ``."@!汒  @ǔ !@2   ' !  "d*@ "!" ,!&"d> @֒  ">  `!`." ?#!@ڐ 0!"@@!t I ">  `!`." ?#!@ 0"@@![ 0 ">  `!`." ?#!@ 0"@@!B  ">  `!`." 0"#@x!,  @B !2`   p$"">  @]!  @' > @M! "  !."  ?"! @ #>  @4 k! `€> @$! ؐ, 4 `&>+#*` €> 8> X@  > x> @  @є o?> @  > @   @" `!`." ?"!@ 0!"@! _>   > > @Ғ" >  4 @ʒ Ԁ!2  ԑ:  ,`!  .`2@ ``! ` `ꀦ`$"%> آ@ @8 "&6""`B >"㿘`T>,!4*` €> X> x@| # "`B >"@ d@@> @ސ> @e @2 @ @Z ?㾰> ` "+'>,"* €` b2  > `$` 2 ` Ȗ @: , b$ &,&*` $2` 2  > #\z  > `$` 2 ` @>  @@` a> P @` "> ` @ؖ` $> p @ϖ` (>  @Ɩ` @>  @ݼ` @>  @ݲ` @>  @ݨ>  @ݢ``> А @ݙ` >  @ݐ` >  @݇` >  @~` >  @u` >   @l` @> 0 @c` > @ @Z> P @ > `$` 2 ` X#\ @t $& >  $ 2   @f  "$2  d  "*  .",`2$ &,$& >  $ 2   @D  "$2  d  "*  .",݀` > `$` 2 ` Ж @( , bϐ `>  &(`$` 2 ` k  > `$` 2 ` a  > `$` 2 ` @W  > `$` 2 ` hM  > `$` 2 ` C  > `$` 2 ` 9  > `$` 2 ` /  > `$` 2 ` (%  > `$` 2 ` P  > `$` 2 ` x  > `$` 2 `   > `$` 2 ` Ȗ @ N, > `$` 2 `   > `$` 2 `  ! ``2 " $@(,   #\> "8> "@#`> $˔,&( > `$` 2 `   > `$` 3` `  > `$` 2 ` @ > P@M , > `$` 2 ` xF #\@>  (.F&, > `$` 2 `   > `$` 2 ` {  >  $ 3`  `@ ! "(, `$$! ` ?ȑ*` *  *@ 2  ` * *  @ "  "$ d  "  .", "&,b >  $ 3`  `@ ! ", `$$! ` ?đ*` *  *@ 2  ` * *  @ "  "$ d  "  ."_, > `$` 3` `  `@ R,` (> > #P#` >   @h!@2   @  $! b72``$704`'4@  , +b'  >  @s , b  >  @f , b  > ` @Z , b &,b > @#؁h``0>,#8*` € > `$` 2 `   > `$` 2 `  @, , >  $ 2   @  "$2  d  "*  .",` &, >  $ 2   @  "$2  d  "*  .",ɀ` > `$` 2 ` Ж @ ,  &,` >  &(`$` 2 `  > ! @̒ , 2$ &,$& > ! 8@ ,` # @ 2 2` `` ` $    #\> "8> "@#`> $@ o, &(`$> !` 2 ` P` #\ @ @#`, "^&,0\` (> > #P#` >   @qh!@2   А@  $! b72``$7`'@ , 0 .&, >  @J , # !&, > !  > ! @8 ,   &, .F> `@* ,  &,㿘.`6``)@u > !@ 0@ $$ (  , F! " """?6""B@>"p"T   4t  &q 0l "<@"!6"Vd? _ !`( H! `@!`  А@ ݒ $"T "` 00 0+"X 6"X7@`$7"@3@"X``6"X7"X"\@* @7ҕ3  6"X3  7"X"\"@* 3@7ҕ3  6"X3 76"\`"V&"`?6"V"T`7'@  㿘! > # > !! !@-     `? o-  `  ? ` ` "< *!  2 45@ `! ` ` 2!6"T&"8" ."! _ !` H ! `@@`#p> !" `'`> #  > !!  ^@  > $6@%!-     `? o   " `? o``   > $6@@Ӓ @ b6@ "< /> $*@ 0@! @ @4@5@` !   6"T&"8"! ."`_ !` H ! `@@@ @ @0 %> $* "<H*`4@3  @v` !   @n" ."`` "! >  > #<`2 @> $`@! @@A  @"*` @ X@UN> $@"@%F> $@"8` @,@#8> $@/ @/0> $ 2> $0!` ,> $*!` &> $$!`  > $!` > $!` > $!耊 > $ "> $ "> $"(0@׹  > $@@ܒ  > $@/"hp! !@  $ i 7'@@ *  @$@㿘"    < @,``" "* `!*@  ." .`*  !* ??c#    2` А @ > $$ x @uw`@  $ 2` А (74'̑2` g 87 ?!a @4  @7@7@"    2 * @7 ? * (@4 > $ 2 #\#`Ԕ @7'.`,`@7Ғ'@2+`̀ 2 "2 " *  `@."  $  $ ֙.`ԑ2,  *@ * 4 $ '̐ @Д̢``y  *  2` 2`  `""  `@."0` X.`*  !* @@2` @* *@ @8* $@!|  * @$@!    $@ 4`! ` $ 8!  4`,` ,`,` ,`   *` `  "` ` !Ȁ @29@@ @ $@!Ȁ @2-@А@  $ % ?7'r@@  $@`* @2  *@ * $@ 2  * * @$@@!> 3` #\ ` 3` #` ` > #d ` P#h@ ` #l !@N @> 3` #\@3`2` `#``3`#d`#h ! @8 `???ì#c !)>  4  $ , 4 4 !  (  # ``2! 2    ` 2!Ā`  !Đ? : @(     * 0 *   , $ , #\ 2  #` #d  ؖ@ 㿘!2` u@* $!    k, $4 4 4 , 4 !! < !4 < (!Ȁ !4  ?*@4 !Ȁ @#  ` @ 2`   $!Ȓc@&!&!!Ȁ" > $! !ؐ@ ! !:   $2 !> $@ !!: !Ȁ! > $! !@r ! (!:( , (  > $0@d !!:(㿘!  > !@S ="2   > $H@D c!!đ2 "*!ԝ"2   "  @.""2   K> $h@' ! _ !`  =!!`  6! _ !`  !!`  ! ` !`_!`  !`! !`  !`( !`  ! 6"&"d,@ @< @S $ " $ (!  $$ ( $ ,@ ϐ!*"d㾐> !"_' @ !      =   @ݐ `!S@2! P" !đ2  j?`> $ "> $@u > $@m U?   @ ` > $@Z B?> $@P 8?!  @! * @ $ `   @_   ` @T@P   @= @$ b > $@j#㿘!!Ē`02   ! @`   I  S> $`P" !> $@  +??2  c  ??2  *  *` 2  2 @  `> $@  ?@ђ㿘!   @  !`  @  ! `  `@`!đ2  2 ` f 8`?`f a `&56* 2 <   !  @ Ɛ !`€ !`` @  !`€ !` @  !`€ <ӑ<6 *`6!  @  !`€   6@  !`  @  !`€ <!`  @ r !`€ ?# @ `*`2 @6㿘! @   ##   `@ N !`€ @`?!` ? ? * *@ 2@ 2 @&&㿀` 8!2 `  `@ * * @$@!Ȁ(2``  @$@`,` `,` `,` @` ? ` $@!   4 `    $@` @2  * * @$@` 2  *@ * $@` @2  * * @$@` 2 *@ * @$@` ~,`` !> ` *` 4``!`*@ 4``>  * @3`$@ `#\ ` 3` #` ` P#d ` `#h@ `#l @ h @!3` #\@3`2` `#``3`#d`#h>   ` @ P %> ` 2  * * @$ `, ` `*` 0 $ `, !  `  ,  2`   p,2   ($ 4 ` !4  $4 ` h4 `   4 `   4 ` @  4 `2     4  4 #\ 2  #` #d ؖ@   <2*  *  @$ , 4 ``` 㿀.`*  !* 2`8 `**`  $!Ȁ( `  * @$` `,  `,  , `  `  $  2  * *  `$ 2  * * @$@2  *@ * $2  * * @$` ` `* @4  `! 3`* 4 `#\ !> #` 3` #d #h>  #lP ` @ B!> 3` #\3`2` `#`3`#d!#h  `@ +  +>   `+  2  * * @$ `) *` `+   *  p@" `* `*`4 (  !4  `$4 ( ` (4 (   4 `(   4 `( @  4 `( 2     4  4 #\ 2  #` #d `ؖ@  <2*  *  @$ , 4  `i 㿀.`*  !* 2`8 `**`  $!Ȁ( `  * @$` `,  `,  , `  `  $  2  * *  `$ 2  * * @$@2  *@ * $2  * * @$` ` `* @4  `! 3`* 4 `#\ !> #` 3` #d #h>  #lP ` @ !> 3` #\3`2` `#`3`#d!#h  `@   +>   `+  2  * * @$ `) *` `+   *  p@" `* `*`4 (  !4  `$4 ( ` (4 (   4 `(   4 `( @  4 `( 2     4  4 #\ 2  #` #d `ؖ@ U <2*  *  @$ , 4  `i !  $  ( ,2   : ( $2   ( ,"  (:   $, ( ,'     22  (<??  :  (     2@ : (㿀` `/``+``(` `  `-   5`@ 5- @@@-`4,- @ ,` @ @  @ᬒ > % '@7   @ >(ᾀ ?А /E<?` `/`` +``"(`! `#  `$-   5` 5- @@ @ -`4,-@,`% @ @   @  > % '8@o7    @ #?@ > '` ` * @6Ȁ$2`` ` * @6`.`.Ȁ(2``* @6@2` ``* @6` `*`  6`  ` , ` ,`` (, #\#d#`$ > %X @'> %``*`  `+ `@ `+`` #\@ > %`'`&*` 6 `+`**@ 6 `+`*+ `'@ `&*@ @   *` * ,`   ' . /`' ' '? '*`  '?ؒ ?? !?' '' Ը ?? "3`؆ '*  3`̄ ?ț* '  ?ԔП3`(3`(  '' ?̨ȃ4,@@@?@  0 ( @ *`/  !@ /` + @+`  #  @ +  @'D "*! , #`@ #d> %@ #\ @D'> % 1( 0*  5 2* 4+  6@ -*  , 7+` @ @ .( 3+  @ + /,  @*+`#`D @ #\@  -  . +` (      5` 5- @  -`4,-,        6`" ?`( 2 `"?`(  ?`(  . +` (  !  "-   5` 5- @  -`4,-, #       6`" ?` 2 `"?`   ?` DS'  *`7`DȀ$D * @7`D!Ȁ(D  * @7`DaȀ@2 -  * @7` - ,* @7` 1 0* @7` 5 4* @7` x88x0 `H8888㿐">i  @."a&!T 0&!&!!P$ 0$ 4! ` ! !$ 4 4 !>i!Ԓ `` &!P"4 4 "! < !(+< ! 4 " 2  4 2 ! *@6!  2! !P"0"4  22"$2` `2 2$ ̒ 2  *@6!! @ ' є!    `' ”@BI! E @&%b@@@  > '@ɖ !    @ В  '`@ 㿘 <?#@@& <@m㿘 4 !  > #X`>i!x #`#!P#!x$2 (@*`@!*` @   (!: > @<0/#X`<!x ?#!x a &`;# `?Ȗ*`2 (* @ @ " 2  "  "*  `@+"* 3@ !""!! "!"@㿐 >k 4aP X@P@Q a g  b2   4Zax a _ a` 0a` u b2   ! a   a` ?  _ a`  4 a   +  b a  @,b` a`  ax ` _ a`   axa   ax2`     @6& ,@02ax@nax ` r@> %@ 0p  2` /ax$ax@gax * @ @$ax0Z⭐ f"-ax g eM0M h"3 0H   X@ #> ` @  & bad 2b> %$adb@f 0(> %2  ``*` ? $ax @Y0> %    @N X>l`@f@'   & @6@w㿐Q f   g e  ` h2` &`,@503` "  `!@  k` @T#蠄?2!`2!`   "`,`,  &`,㿘 @  +&    4@ X *@&  @> % `4@@Ԓ  * & @5!x2`   $!x> %h@’ @t8> " '4@֐@ "a  > %@ 0p@ > %@ 0f & a@    > % @ @*@%& '$> % ^ $` > %a > % @c@ * & & ,j0L @Q  @* &   X@ #> `\ @e  & @ɖ " @o+"@& @ K @ , /  4 $ ` ?, @a`a$b$0/> %H@  @E" > %@]#h㿘> %x@ 㿘> %@ 㿘@ ! _ !` 0!` @㿘  4@ f*> % g e"L ,0P h"0 0K > %   @  @ X>kaP@А @ #> ` @ː% @ ax2  *  $axV0> & > %  @ X>l`@@f   &   & ,@㿘@!x! ? `&!x &!@  "@! "` > &@S 0@㿘!x `!  &! j"@! "` > &@3 㿀`+>h".` €! s!Ā/n?>` , * @  !.`* @@*`@ ' `%  "" @"` ` 4*`` " P` ` ` *`0  (  ! *`@ "#   " > & ( > & !( > & !( > & > &!`.`* @ > & `#\#`0> &`@ 0 > &@ 0!x> &2  ``*` ? &!xx!x! ? @@` &!x>lbt@!x &!x@ > &a?*@&!đ2 6!> 2` 2!`0   "`:  (*`24> & 0*@2 ?   @*@ &@K @Ր?##3 4` "  > &в#d?> & ,@ #\#h#l#px@&#`%0 4"Ğ  !> &!?> &#`, #\#d#h#l?#?    * ? #@-&!2`А" o0:  *` 2 2!> "Ğ 2  #> &b> &#d #\#`#h#l#px>  4   !> &" > &#` ?#>  44   / !> &"(?> &#d, #\#`#h#l#pbx 4   !> &"8?> &#`, #\#d#hI#l?#*4 (? , 2&2> & Ĕ   !> &"@?> &#d*#\#`#h#l#px4 L>  4   !> &"P?> &#`, #\#d#h#l(@5 01> &"`> &> &"x"@% 0!! `€!     ! ` €* * , > &23 @  㿘'P'T`'X!Đ /@ > & @Ŗ"@ŮP> &@Ő"!x2 "!x H(!p"!p"!hH !p "!p!h"!pH㿘). > "#4* * 沔a  "#41M"`##4" `@ "#d#`沆;``*  ( (( ( (d( 8  B  #㿐` a""V!x$ @ H# ;(&!x !> &@:!x@a (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx "`@"!xb"`!x$ 7*&!x @:'!x @  !x"} d d!x""!!x"2!x`@* !x"$> &#8> &#H"T> &  6@!xb&!x㿘!x("@"`!x"&!x!x"!x㿐@ 0#'#@ * "@*`@*`'@;h # " b4 a (bd(0 `(0*0+`a0*?bd0(""* a0 *0 b4 `"  !@("d *``" ! "d*0*   (0  ?` !@*`"d 㿐! !П€&" " '"$'"h* @&! `   '@  `&` &@ > "'> &P6 (/(  )> &'> &/( Ŕ#`@`  Ŕh@ `$/(b > &@j#p> "'> &  @/pp)> &'> &   h@Ö`@2  #@/pb > &@5#㿘!đ2 U'H!@2`  H2`  4!Đݬ  > &D@2`  > &2`  4!> &5ؑ2 - ݐ > &!(  ݃ > ' !  v > 'H! @ /(0> ' hy!?8!?#`0 ;> '9> '7> '5> 'Ь> '> ' > '> '> '`> '> '??> 'Ȑ`В ؔ??????# 2 > ' @> ' @ 2  #\#`   * +#d > ' @#h  * #l  @#p  #t #x #| @#`a 㿘! ` ;`_!`  !`  H09!`  ! `@!`  !`! !`  !`( !`  0!`  ! `@!ą0 @* `* `* ` ** `* `* `*!ą0 @* `* `* ` ** `* `* `*!ą0" @ `㿘ɔ!đ2  "``?# ? ** @2@ 2@ &!đ2  `. ` ..` . !đ2  `  6 ?# @2 *`@6 !đ2  `  6 ?# @2 *`@6 !đ2  ` 6?# @2 *`@6!đ2  ` `?# @2 *`@`` 6 `$   * ?# ??   !đ2  "  *  *` 2  2  !đ2    *  *` 2  2 #`$?؄㿘.!đ2  "``?# ? ** @2@ 2@ &!đ2  `. ` ..` . !đ2  `  6 ?# @2 *`@6 !đ2  `  6 ?# @2 *`@6 !đ2  ` 6?# @2 *`@6` @ /* 㿘Ք!đ2  "``?# ? ** @2@ 2@ &!đ2  ` 6?# @2 *`@6` `. `  . ` `. ` . `6 *   '* 㿘!đ2  "``?# ? ** @2@ 2@ &`.` . !đ2  `  6 ?# @2 *`@6 !đ2  `  6 ?# @2 *`@6 !đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6 `(`,`   * !đ2  "`$`$?# ? ** @2@ 2@ &$?# ??`(  !đ2  "  *  *` 2  2 #!đ2     *  *` 2  2  ,`?؆㿘ڔ!đ2  "``?# ? ** @2@ 2@ &!đ2  ` 6?# @2 *`@6!đ2  `  6 ?# @2 *`@6 !đ2  `  6 ?# @2 *`@6 !đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6 `(`,`   * !đ2  "`$`$?# ? ** @2@ 2@ ?&$# ??`(  !đ2  "  *  *` 2  2 #!đ2     *  *` 2  2  ,`?؆㿘!đ2  "``?# ? ** @2@ 2@ &`.` . !đ2  `  6 ?# @2 *`@6 !đ2  `  6 ?# @2 *`@6 !đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6 `(`,`0` @``* !đ2  "`$`$?# ? ** @2@ 2@ &$? # #?!? (!đ2  "  *  *` 2  2 #!đ2   @ *  *` 2  2  ,!đ2    *  *` 2  2 ` 0  ` `Þ 㿘J!đ2  "``?# ? ** @2@ 2@ &!đ2  ` 6?# @2 *`@6!đ2  `  6 ?# @2 *`@6 !đ2  `  6 ?# @2 *`@6 !đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6 `(`,`0` @``* !đ2  "`$`$?# ? ** @2@ 2@ &$? # #?!? (!đ2  "  *  *` 2  2 #!đ2   @ *  *` 2  2  ,!đ2    *  *` 2  2 ` 0  ` `Þ 㿘q!đ2  "``?# ? ** @2@ 2@ &!đ2  `. ` ..` . !đ2  `  6 ?# @2 *`@6 !đ2  `  6 ?# @2 *`@6 !đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6` @ +* 㿘 !đ2  "``?# ? ** @2@ 2@ &!đ2  ` 6?# @2 *`@6!đ2  `  6 ?# @2 *`@6 !đ2  `  6 ?# @2 *`@6 !đ2  ` ??# @2 *`@?#6` `??@ @*` @* 2 @ 2` #` `?.`.`.`. ??@ @*` @* 2 @ 2` #` !đ2  "`,`,?# ? ** @2@ 2@ &,!đ2  `0 60?# @2 *`@60`2.2`3.3!đ2  "`4`4?# ? ** @2@ 2@ &4!đ2  "`8`8?# ? ** @2@ 2@ &8!đ2  "`<`<?# ? ** @2@ 2@ &<㿘!đ2  "``?# ? ** @2@ 2@ &!đ2  ` 6?# @2 *`@6!đ2  `  6 ?# @2 *`@6 !đ2  "` ` ?# ? ** @2@ 2@ &  `4` * !đ2  `0 60?# @2 *`@60`2 .2`3 .3  * 4㿘???#`  !đ2  "  *  *` 2  2 #@!đ2   @@ *  *` 2  2 # `ؚ`㿘u`` ?!? ?#  !đ2  "  *  *` 2  2 #@!đ2    *  *` 2  2 # !đ2   @@ *  *` 2  2 # `  š` 㿘9!đ2  "``?# ? ** @2@ 2@ &!đ2  ` 6?# @2 *`@6!đ2  `  6 ?# @2 *`@6 !đ2  `  6 ?# @2 *`@6 !đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  "``?# ? ** @2@ 2@ &   +   * 㿘!đ2  "``?# ? ** @2@ 2@ &!đ2  ` 6?# @2 *`@6!đ2  `  6 ?# @2 *`@6 !đ2  "` ` ?# ? ** @2@ 2@ & !đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  "``?# ? ** @2@ 2@ &!đ2  "``?# ? ** @2@ 2@ &!đ2  "` ` ?# ? ** @2@ 2@ ?& #`$$ ?? ` @*` @* 2 @ 2` #` 㿘͔!đ2  "``?# ? ** @2@ 2@ &!đ2  ` 6?# @2 *`@6!đ2  `  6 ?# @2 *`@6 !đ2  "` ` ?# ? ** @2@ 2@ &  4 * !đ2  `0 60?# @2 *`@60`2 .2`3 .3 4*  㿘]  . ?#`!đ2  *@@ @ 2 *`@3 `*2㿘!ą0@.`..`.!ą0` 6?0(6!ą0` 6?0(6!ą0` 6?0(6!ą0` 6?0(6!ą0` . ` . . ` .  ``(`0` ( !ą0` 6?0(6!ą0`.`..`. (!ą0`  6 ?0(6 !ą0`" 6"?0(6"!ą0`$ 6$?0(6$!ą0`& ??0(?6&(  !ą07@0(7@` ?0  !ą07@0(7@` !ą0`8 68?0(68!ą0`:.;`;.:.:`;.;!ą0`< 6<?0(6<!ą0`> 6>?0(6>!ą0`@ 6@?0(6@!ą0`B.C`C.B.B`C.C!ą0"`D`D?0(6D㿘aą0 @@?0(6aą0` 6?0(6aą0` 6?0(6aą0` 6?0(6aą0` 6?0(6aą0`  6 ?0(6  ``,`4`<`D`P`h` @  (  @  (aą0` 6?0(6aą0` 6?0(6aą0`  6 ?0(6 aą0`" 6"?0(6"aą0`$ 6$?0(6$aą0`& 6&?0(6&aą0`( 6(?0(6(aą0`* ??0(?6*,  aą0@60(6?`?4  aą0@60(6?`?<  aą0@60(6?`? D  aą0@60(6?`aą0`L 6L?0(6Laą0`N ??0(?6N P  aą0@60(6?`aą0`X 6X?0(6Xaą0`Z 6Z?0(6Zaą0"`\`\?@1?@.`(6 6`&\aą0"````?@1?@.`(6 6`&`aą0"`d`d?@1?@.`(6 6`?&d h  aą0@60(6?`!ą0@ 2?0(2 ` * `*  +     +     +    +  !ą0` 2?0(2!ą0` 2?0(2 ` * `!*!!ą0`" 2"?0(2"!ą0`$ 2$?0(2$!ą0`& 2&?0(2&!ą0`( 2(?0(2(!ą0`* 2*?0(2*!ą0`, 2,?0(2,!ą0`. 2.?0(2.!ą0`0 20?0(20!ą0`2 22?0(22 `4*4 `5*5!ą0`6 26?0(26!ą0`8 28?0(28!ą0`: 2:?0(2:!ą0`< 2<?0(2<!ą0`> 2>?0(2>!ą0`@ 2@?0(2@!ą0`B 2B?0(2B!ą0`D 2D?0(2D!ą0`F 2F?0(2F!ą0`H 2H?0(2H!ą0`J 2J?0(2J!ą0`L 2L?0(2L!ą0`N 2N?0(2N!ą0`P 2P?0(2P!ą0`R 2R?0(2R!ą0`T?0(2T㿘!ą0@ 6?0(6` .`. (/ /!ą0`  6 ?0(6 !ą0` 6?0(6!ą0` 6?0(6!ą0` 6?0(6!ą0` 6?0(6!ą0` 6?0(6  . . (.㿘”!đ2  "``?# ? ** @2@ 2@ &!đ2  ` 6?# @2 *`@6!đ2  `  6 ?# @2 *`@6 !đ2  `  6 ?# @2 *`@6 !đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  ` ??# @2 *`@?#6`  !đ2  2 @ 2 *`@2 !đ2  @2 @ 2 *`@2`?㿘!đ2  "``?# ? ** @2@ 2@ &!đ2  ` 6?# @2 *`@6!đ2  `  6 ?# @2 *`@6 !đ2  `  6 ?# @2 *`@6 !đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  ` ?# @2 *`@?`#6`  !đ2  3@ @2 *`@3@!đ2    @2 *`@2` 㿘!đ2  "``?# ? ** @2@ 2@ &!đ2  ` 6?# @2 *`@6!đ2  `  6 ?# @2 *`@6 !đ2  `  6 ?# @2 *`@6 !đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  ` ??# @2 *`@?#6(,0`  !đ2  2 @ 2 *`@2 !đ2  "` ` ?# ? ** @2@ 2@ & !đ2  "`$`$?# ? ** @2@ 2@ ?&$# 5??`0 !đ2  "? ? *  *` 2  2  !đ2  ? , @*` @* 2  @2` $ !đ2   0 @*` @* 2  @2` !  Ä 㿘!đ2  "``?# ? ** @2@ 2@ &!đ2  ` 6?# @2 *`@6!đ2  `  6 ?# @2 *`@6 !đ2  `  6 ?# @2 *`@6 !đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6`.`.!đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  "` ` ?# ? ** @2@ 2@ & !đ2  "`$`$?# ? ** @2@ 2@ ?&$0(# ,??`0 !đ2  "? ? *  *` 2  2  !đ2  ? , @*` @* 2  @2` & !đ2   0 @*` @* 2  @2` `$@  `Ä 㿘s!đ2  "``?# ? ** @2@ 2@ &!đ2  ` 6?# @2 *`@6!đ2  `  6 ?# @2 *`@6 !đ2  `  6 ?# @2 *`@6 !đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  ` ??# @2 *`@?#6`(`,`0`  !đ2   2 @ 2 *`@2!đ2  "` ` ?# ? ** @2@ 2@ & !đ2  "`$`$?# ? ** @2@ 2@ &$?# #?!? (!đ2  "  *  *` 2  2 #!đ2   @ *  *` 2  2 #`,!đ2    *  *` 2  2 #`0  ` Þ 㿘j!đ2  "``?# ? ** @2@ 2@ &!đ2  ` 6?# @2 *`@6!đ2  `  6 ?# @2 *`@6 !đ2  `  6 ?# @2 *`@6 !đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6`.`.!đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  "` ` ?# ? ** @2@ 2@ & !đ2  "`$`$?# ? ** @2@ 2@ &$?`0`(# !? ?`, (!đ2  "  *  *` 2  2  !đ2   @ *  *` 2  2 #`,!đ2   @ *  *` 2  2 `#`0   `Æ 㿘!ą0`  @@?0(?6`  !ą070(7 !ą0`  ?0(6 ?`!ą0@60(6`!ą0  ?0(2!ą0 2?0(2!ą0 2?0(2!ą0 2?0(2!ą0 2?0(2!ą0  2 ?0(2 !ą0  2 ?0(2 !ą0 2?0(2!ą0 2?0(2!ą0 2?0(2!ą0"? @? @*`(2 2` "!ą0"? @? @*`(2 2` "!ą0  ?0(2!ą0 2?0(2!ą0 2?0(2!ą0 2?0(2!ą0 2?0(2!ą0  2 ?0(2 !ą0  2 ?0(2 !ą0 2?0(2!ą0 2?0(2!ą0 2?0(2!ą0"? @? @*`(2 2` "!ą0"? @? @*`(2 2` "㿘@` . *   *  ?#`!đ2  *@@ @ 2 *`@2 `㿘@S  ` @ +@  .  ``㿘@1  . 㿘@!???#` !ě+ 2    @@ *  *` 2  2 & `㿘@` . *  %$,<@`i * ` .  *    !* a$.$  !%*   "$*   ",*   "<*   "@*   "`* bh.h  "i* 㿘鰔!đ2  "``?# ? ** @2@ 2@ &!đ2  ` 6?# @2 *`@6!đ2  `  6 ?# @2 *`@6 !đ2  `  6 ?# @2 *`@6 `.`.!đ2  "``?# ? ** @2@ 2@ &!đ2  ` 6?# @2 *`@6`.`.`.`.`.`.!đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  "` ` ?# ? ** @2@ 2@ & !đ2  "`$`$?# ? ** @2@ 2@ &$!đ2  "`(`(?# ? ** @2@ 2@ &(,  ,* 㿘”!đ2  "``?# ? ** @2@ 2@ &!đ2  ` 6?# @2 *`@6!đ2  `  6 ?# @2 *`@6 !đ2  `  6 ?# @2 *`@6 `.`.!đ2  "``?# ? ** @2@ 2@ &!đ2  ` 6?# @2 *`@6`.`.`.`.`.`.!đ2  ` 6?# @2 *`@6!đ2  ` 6?# @2 *`@6!đ2  "` ` ?# ? ** @2@ 2@ & !đ2  "`$`$?# ? ** @2@ 2@ &$!đ2  "`(`(?# ? ** @2@ 2@ &(!đ2  `, 6,?# @2 *`@6,!đ2  `. 6.?# @2 *`@6.!đ2  `0 60?# @2 *`@60!đ2  `2 62?# @2 *`@62!đ2  "`4`4?# ? ** @2@ 2@ &4!đ2  `8 68?# @2 *`@68!đ2  `: 6:?# @2 *`@6:!đ2  `< 6<?# @2 *`@6<!đ2  `> 6>?# @2 *`@6> @* `* `* `* `* `* `* `* `* ` * ` * ` * ` 2 `"022`" @*  $ @ ` * `  * ` * ` *   *   `"㿘@5`` . * `   "  @* `* `* `* `* `* `* `*`2` 2 ` * ` * `* `* @* `* `* `* `* `* `* `*`2` 2 ` * ` * `* `*22 11111112LW[|[$[PZ``XXZ```````````````````````ZZZv vTyxz0ssrs{|H|H|Hrprqr    2     2 㿐> 0c@~]% 2%(  @D &%%( 2%  @D &%(% > '%( 2%D> '@Ő!0O > > '!@ 0G"* %<> '@"%< @ H  `.  . %<*"@ *`"  *  , @ 7* %D . . ꀢ`   &  ` & @.%%B  6 h6 V6 j& x& |@   H'> @> c` 0*"@ @}*`㿘  @!> "Ԁ!> '"  @f!) ؐ .%`  "Ԁ! > '" @V!* .%   !%D` W> '>!*` € ؒ    ؐ`  %H` &%H  %H` &%H   %H  ؐ  &%H. .     .     ؐ`   ؐ`   ؐ`   ؐ`  %D @"0 ؐ`   ؐ`   ؐ`   ؐ`  %D  `  㿘 @> '"`@Œ > bԀ!> '"  @!q  .%`  㿐> "Ԁ`> '%"x@!> "؀ 2%> > '"b#\ P  @  $"% 2  & & & !@ $ ܖ D!"@ ܖ`@0< .%6% "`, @ ܖ -*! #   $ ,  "`, @    @ $@" ,@`,   2  ܖב*А ܐ! &% &% ! :  %L   ; `!`*%O*** ܀@`! .%Ԁ!> '"  @! ؒ .%   %D  a0 IӐ#0А"0 .%@+㿐` ` , !` > "Ԁ` > '`/"`M`N@ .%`` 2%D`А"@ >  @ h#> B`#`= @ ^# @|C`%D 2 "Ԁ!> '"  @"t ؐ .%`            * %< @ + ,`"* %<@ #* &`%H  %D  2`   `2 %H"?%H  %H     ؔ   ؔ   ` "r`M%H Y`/`D &%8&%4`'%4%8 @ `  ؐ`  倊 @2 %D  ؐ` %D  `  %D "Ԁ!> '"  @"  .%`  "Ԁ!> '"  @ " ؐ .%`    @0`D@`/"Ԁ!> '"  A@" A .%`  A0۠  %H "    `  ` `D`M.`,`,*`N *`D  `..`.%H p 2o  &%8&%4' %4%8 @ `  ؐ`  倊 @2 %D  ؐ` %D  `  "Ԁ!> '"  @" ؒ .%   `!% @6%.%"Ԁa> '"  @q"̐  .%`   "Ԁ!> '"  @_"ΐ  .%`   @0E @t "Ԁ > '@G#"Ԁ!> '"  C@?"ߐ C .%`  C0)`!% @6%.%"Ԁa> '"  F@'" F .%`  F0"Ԁ!> '"  B@" B .%`  B㿘H /d * % > "@V&` H 0㿘> 0 ` `" H / * % > @"H 0` P@ J>`a@zE`  &`  㿘  4%> Ԁ  > '@#Ԁ > '  #( @  * !  ,``  1$  @@ /> #:"H /d * %  ""` $  " ,`` " H 0q 2$  & ,@0J b$  $ D $  $ H  /  $ D $ @ $$ H, LH /d * % $ $  "@%   $ %`@]H 0` @  @ݐ @  @Ԑ㿘> "Ԁ`> '@#8"3 %> ' @ "`H /d * % @ ېH 0` "%  bԀ @ڐP@ #贆2 ذ 㿘> "Ԁ`> '@ǐ#p%`" > '@3#    * ! `  @2  @? ` H /d* % ,`      #> $  @?  H 0 :`"`"` $``" ,` " > #`" ""``      `  H 0z`=, M  2 H 0k*@`  *`2 @   *`22 > '@#* **#@ , NH 0     *` &  Ԁ` ` "`&  ?"$$  ?$ & 0 "> ' #@  2 㿘``/  * !> bԀ  > '@#@ 7  .`/  *`,`,``  4   #&`D&`@&`H&` &` $,        2, @ , $  @2 0 &@ " & &  &`` `&` % 㿘``   * !,      a> bԀ  > (`,@Q @x``L (2 `, > (*`4 2@B `, b`L,`F` @  $`, $`,`L > 2`H`H$`(Z0R$`(bԀ "`(`"`,> (@ P`,`2> (> ( `4@ `@ p@: @2 `,% &  .%1`, 2 `  2`  2`4 , "  `"  "`  ? "$ $ @?Ȓ `В`@ %㿘`  ` * !`  2,``  ,`  2  > (> (> ( @2`M*"`M `N*`  ""> ( @ ?*`  ?&` @``"`& `?@"&@&`㿘!> "Ԁ > (@q "Ԁ!> '"  @i$ ؒ .%   %  + 㿘``> (0%(&%0%(%0@@! ؐ@€ %D` * ,`  '>  ؐ@€ , &   % `   ؐ@€ , ؐ@ € %0  '>  ؐ@€ , & %0@&%0Ԁ  > (`!(> (!@> (!H%0@ Ԁ "%0%0 @ > (!> (%(!P@ %0`@ *%(> (@!X%0㿘!> "Ԁ > (!`@Ԓ"Ԁ   > (#> (@@ɐaP &@> (@!X  ؐ`@ %D 2   ؐ`   & ؁㿘eD   ee@  e* * > (!p@`!>  ? `*  !`@*``       `` `    ,eݰ `.@  > (!@Z`!> ,e$` ````+`e<`@  . "* e<@ ؑ* & eHeD  ` 2`` "?eH  `  `ؔ  `ؔ    !> "Ԁ > (" @%p"Ԁ!> '"  @%p`ؐ ,e`   ee @ ` @"Ԁ > (" @%r"Ԁ!> '"  @ݔ%r`ؐ ,e`   ee @` ,e4e@ $eH>$e"Ԁ > (" @%{"Ԁ! > '" @%{`ؐ ,e`   ee`@ "Ԁ > (" @%"Ԁ!> '"  @%`ؐ ,e`   ee`@ 4e,e 㿘> "Ԁ`> (%0@" %0 2% > ("H@y 0"% > ( @n"p%&%0 `.%"Ԁ > (%( @b"% "Ԁ!> '"  @W% ؐ .%`  %(%0> ( @I"0%0` > (" @>%"Ԁ!> '"  @6% ؐ .%`  %% 6%`A3.%% %( %(  ` ` `  ( ` ` ` `    `  @`?`""Ԁ!> '"  @%ِ  .%`  0"> ( "@ޔ % &%0  > )!x> ) ` %(  *  @!"N>"* €"Ԁ"> (@"% 6  @ X` %> (#@ &% ! % $H" ( .%"Ԁ"> (%@#% @"{ "%L!2%> (` #0 @ "Ԁb> (@|#X"Ԁ! > '" @t& ؐ .%`  <   ,`    *  2  \  M   N*` ",N" ?*,N,M *U"> (` #p @: % `.%  ,  %H`  ؒ   ؐ`   ؐ`  0%> (` # @  , `$,"Ԁ" > (@ #%"Ԁ"> ( #@ %"Ԁ"> (@#  $%`.% !$ "Ԁ"> (@#%$@%$H"Ԁ"> )@ې @&%H&%"Ԁ"> )%( @ΐ %( `  " `G"Ԁ"> ) ` `@ (%( ` O" `,%(   `,,%L "  " `|("%<@ G` > )@ H%`2  , `,"Ԁ > (" @&r"Ԁ!Y> '"  S&rc @ } , "* %<@ }* & , "* %<@ }* ,@ `  @ |@ |!, @*`@*`" > )@W X%`21  %L@6 %O,   ,  `,"Ԁ > (" @<&"Ԁ!> '"  &@3 ؐ .%`  %% @`.%6% ,% .%  `+ %< @ | ,`"* %<@ |* &`%H%D    2  "? %H      ؔ   ؔ   %> ) @Ӑ x%( ` 2L,  @, +@ %<5 @ |V ,`"* %<@ |N* &`%H%D    2 `` "? %H      ؔ   ؔ      ,@ $` > )@{ ""Ԁ""> )@r @ ` > )@l "Ԁ > (" @d&"Ԁ!> '"  @\& ؐ .%`  %% @a`%( 2> )%`2 > )  S%%(  > )!8@5 "Ԓ6%  @%!x@( "Ԁ > (" @ &"Ԁ!> '"  @& ؐ .%`  %% @` > (" @&"Ԁ!> '"  @& ؐ .%`  %% @` .%6%% "Ԁ!> '"  @&  .%`  "Ԁ!> '"  @Ӕ& ؐ .%`  % .%&%0㿐> "Ԁ`> )%!@% % @% "=%$"Ԁ!> '"  @' ؒ .%   6%)&%$ "> )"Ԁ > (%"@'"Ԁ!> '"  @' ؐ .%`  %% @%.%@ 6%! @y'%$ 2%D% %    * 6%6%6%&%$@"%%є ǀ"%%"s  %” "%%    % *%*`* %a* %*  %* %`&%$  , 怊  , %< @ z ,`"* %<@ z* &`%H    2 %D  %D  `"?`%H  `    ؔ   ؔ   ]%    ` %* *%*`%*  %* I&%$% > )" @ǔ'8 ` % 9*@ > )" @'A   M%* N%* (&%$ % .%*@ `  * !  ` , , *@   %  *@ *@  %.%*@%&% %D 2%$ % %$"Ԁ!> '"  @t'  .%`  0U%P@8 ؔ%$ '%  @ `  ؐ`  倊 @2 %D  ؐ` %D  `  "Ԁ!> '"  @3' ؐ .%`  "Ԁ! > '" @#' ؐ .%`    @x> "Ԁ`> )%@ "0 @ 2 y  € . @€ %D ` .  ؐ@€ .  ؐ@€  . `$`" @ 쀊 2! &%Ԁ > ' "  @  쀊, @€  Ԁ! > '" @' ؒ .%    % > ) @"P^   > )"h@  0@Y  퀊 @( @€  Ԁ! > '" @' ؒ .%   R %  2  "`, @"-%%  .%߰ %> )% %"@`%  ؐ@€   Ԁ! > '" @Q( ؒ .%    % ` .% € "A  @?2 > ) @0" @ 2  퀊2* % "& % 2%% > )%$ " #\ @  퀢 2    ?H#\> )% @#0 퀊 B> ) @#% `Ԁ > (" @(UԀ!> '"  @(U ؐ .%`  %% @` > (" @ϔ(WԀ!> '"  @ǔ(W ؐ .%`  %% @`.%6% 쀊` "%6%Ԁ > ) # @ ` ؐ@€  Ԁ!> '"  @(_  .%`  Ԁ!> '"  D@(f ؐ D.%`  D%?`s>"̓*` € ",`  * !`? 2!  2 4 `8*`` " `"  "`  "@" " @65 `2% "> )@` > )@9#`  %* ! `.% ` ,`% 2> ) @%# `> *@ ѐ> *@ @nH  T"`,W& %?`h>"*` €> * @ 0t %  > *@ `> *@ X%%   € > * @ ?#> * ؒ € @Ր`Ȓ ?   %6% 6%6%.%Ԁ > *@ @nS $ " & &  $ `$ & % `.%> * @ `SG   $%(%D "%( > *   % #\@ : .%Ԁ > *!8@} ` "%H%`.%Ԁ!> '"  @m))  .%`   % " %%D 2%% .%% > *  @O!H  0  2;> *2> *@!x`   * !`$>"*` €Ԁ!> '"  @*)S  .%`   ! ` 2 % M 2%> *U! > *P! ` Ԁ > (" @@)bԀ!> '"  @)b ؐ .%`  %% @`@.%6% ` D %O,`,`% .% M`Ԁ > ("!@ڔ)jԀ!> '"  @Ҕ)j ؐ .%`  %% @:a > (" @)lԀ!> '"  @)l ؐ .%`  %% @`Ԁ > ("!@)oԀ!> '"  @)o ؐ .%`  %% @a.%6% t&% %H " %8 @€  f @€   > * !  #`#\@j Ԁa> '"  @b) ؐ .%`  Ԁ > (" @R)Ԁ!> '"  @J) ؐ .%`  %%`@ 6%.%Ԁ!> '"  @3)  .%`  !%H !%8 > *  " ` #\#`@ !&% @ &%H.%u&% "P @ Ԁa > '" @) ؒ .%   ǐ % W  `.%> * " @  %0> *"@ڒ %(%0 ?,L%0%(@Ԁ @ > * #@ɔ > * ! % $H" ( .%#@ &%0Ԁ!> '"  @)  .%`  0> *#8 @ А % 2> *2%> *@#P   "0 @z @ > + h! > + h> + hԀ @> *@n#h&% Ԁ @" > *@c# 쀊/%D   2%Ԁ!> '"  @O*  .%`  %` .%Ԁ! > '" @<*  .%`  $ > *% 2 % > * # @% % %%@ ߀ .%ƒ`?   # @  ]&% > + / @D ؐ@€  Ԁ!> '"  @*)  .%`  %H W/D &%8&%4`'%4%8 @ `  ؐ`  倊 @2 %D  ؐ` %D  `  Ԁ!> '"  @*7 ؐ .%`  Ԁ! > '" @*: ؐ .%`    @ D/Ԁ!> '"  @*>  .%`   &% Ԁ @> +%@z 0Ԁ!> '"  @r*D ؒ .%   %%P@8 ؔ%' % @)&% > +@V H%D 2%Ԁ!> '"  @J*M .%   %%P@8 ؔ%' % @ &%  ~$     ؐ`  倊 @2 %D  ؐ` %D  `  Ԁ!> '"  @*Z ؐ .%`  Ԁ! > '`"   @*d䀢   .% ؀   `   @S  @> +@א X%`.%Ԁ!> '"  @̔*j ؒ .%   &% @ rL0  .%* @X%<@ sE 2В@@@ '"@  ? @ 2 @A@ @$  $ ذ 㿘` 'А @&`&`  @ ;% !'!> "Ԁ > (" @s*"Ԁ!> '"  @k* ؐ .%`  %%`@ 6%.%А"@@ #@ r'> ` > #`'@ r#`@hǒ0 sx  ` `4*`a@ۨ  ؒ € ؤ  @ > + > +  > + % #\#`%#d% #h%#l%#p% L#t #x@ HH /d4 * % @  > +@!(J 0!> +@!0 $,j   % @> +@!8`   `*  $ H 0㿘> #}H /d * %  ܒ @9 0*`! -`?6% 2!  2 4 `8*` " `"  "`  "@" " @0y  2 ܒ@̑*`H 0@h <㿘 ؐ@€  . @€ %D ` .  ؐ@€ .  ؐ@€  . `$`" @ 쀊 2! &%> "Ԁ`> ' "  @E (l8TTT㿘# 6#\ P #$( 4"Ȣ"ȴ +> +.`4 @ {`, 2 .* 2. 0m +> +@&@bh#X@"> +> +@"x@" ?%#4#  @( #$%2  ?# @2 *`@# (`#$!.`2 2g".#_g > + "#@> +" .#_ .#_2@'0> 4a@g1  #_&@:@??@ # @2 *`@&@:@?@ 4 0 >>>?#b,(" @$$$4\$$ $@ʐ@ڐ# (`#$ ">>Ḓ 3 @>>>#\ da̔&"&#&#&##_ > +@d"#\?`6*`>! €#X@(@k# (`#$ 2#X@???@ܚ #   " @ @ " # @  # @# @8# ! (@#$!2 #  &#P#$ ( 2 @ : #  X#$2`@ / 㿘#X@ P"?@?"@?@o@ 㿘#  " #$ ( 4  ?# @2 *`@>  # 3> +/> +@  @ " @ǐb @Đ  `` &#(@ +  ?4 @א     ?# @2 *`@ 2`, > +X* > +@#> +<, @㿘#  "#$ (#2  ?# @ `*`2 @# ( `#$  p5> +2 4`5   X3> +/> +" @Xb @U    @  ` &#(,`X* `@> +# ,`> +#H> +#X> +@3#8> +<@㿘 ?#  P#$c# %     * 2` 0   `@$@n#^  # (@ #$ 2 4   !4 #^ 2 #   ?#4 # (`#$"2  " , ``$ #^?   `* `$ # # #$ ( 2`@  #  X#$2`@ ߐ # (@#$!2#\      #_&@:@??@ # @2 *`@&@:@?@ 4 #\ 7 ( 4   ? 2`*    ? 6 ?# @2 *`@44 4 #X@"@{#  ( #$!2 6 *  x 4  6 *  p 4  ?h 4 @"@   4   H4 @\`@ {@U5\#   P#$ (!2# #$R`\ `\!?0(R`\ `\!2㿘"@I 㿘#  ( #$#4` "   @4`# 60  @4`# %  X#$ 2`@#$#  (  2@#   @4`㿘#  ( #$$4`  ` ?# @ `*`2 @`   ?7?# 2 , @4` ' . 4`H##X@k(# @#$#2 #\   `?# @ `*`2 @`  ??? # @2 *`@4`  @?# @ `*`2 @@  `?# @ `*`2 @`  `?# 2 *@ 4@ 6 ?# 2 *@4`# (`#$!"2@q 0# (@#$$2 `;>!ܓ.` € #^   *`   4` &#\  4`0   ?# @2 *`@4` ##\  ?# @2 *`@4` ##\  2D# #  (@ #$#2   @?# @ `*`2 @@  `?# @ `*`2 @`.`  ?# 2 *@ 4@ 6 ?# 2 *@4`-#  (@ #$ 2   `?# @ `*`2 @`?` *.`? # @2 *`@.`4`$## (`#$!2  㿘#X#  #$@ΐ"#&`# g&`" &`#\ S O P> +# 1 (@#$##2 `?# @ `*`2 @`#  (@ #$! p2> +"<* 2&`# (@ #$$2 &`@  ` ?# @ `*`2 @` ("# `  &`&`> +#\#`@ے 0# (`#$!2 㿘 \c $@ @fc$!܀ !! 2 !! Z  2 > +@)#!€ @V @V '!€ " " `e$ `B > !܀!! 2!!    &!&!$ !?&!@㋐`  ?# @ `*`2 @@ 0  c_`:@??@ # @2 *` c_ : ? 5  \$6 \ % ?@V& !€ #5 !܀ !! 2!!    &!&!$ !?&!  cR:`@??@ # @2 *` @cR:`@?@ 5  D @x H/` /c\`   6?# 2 ,@5 ?<#5 c^ %>  2  %  ? @ @-`@⍐ 2   2  5 ` ?-@o 2 -2H 0 `B >   c\    c\    @  ?# @2 *`@ `@ΐ!@  "!@!܁㿘#  ( #$$2`  `?# @2 *`@`# (`#$!2 2   " @v 㿘# 9#$   ,`   薂B@b> +#\`` #T`B c> #P %8%&#P&#T@M#\"#T `B > @ H4  ;6   &#T#\    `2#\㿘?#  P#$# ) &+  @2 *`@4`  @/ \ {4\  @ "!h 4`` @2 *`@`  2㿘#  P #$#\   ?# @ `*`2  @#\    @@2 ` g@~ 2```B 3<``D`B <` @vj @|  a #\   ?# @ `*`2 @    @@0B  @4 ?c?#    * 2` 0& #  ?#c #    * 2` 0 ڐ  $㿘 P> !̀`$> +c@ Ґ L,* @ "@   @(H`4@_b  2L `  ?"@$L & `& & & H/` /\`  `O @捐82 ^> +@'#  @  @   ? /@ *@`)@  2 @"@`@ $ 2 @2@` @ @ *@`@ @   @4  ?c?#     * 2` 0&  #  ?#c %     * 2` 0   `@$H 0㿘 H /f * '  ! "* \! <0!50 !61 \ 6 \ ` %А@Y P&`4 @"@  2 \@L \ ?6 \ `@` `4`4@ P`4  \ @ @  H 0㿘H o*@ g H 0㿘> +  @bc B< 㿘#X# #$@7"#\ 2 # (`#$!2 4 4   4   @4  ?c?#     * 2` )  $  ?#c %     * 2`   " ~ `@$#  P4 . 4 #  (#$ 2`@K #  X#$ 2`@?!h 4   x4   p4    4 @㿘#.@} ? c  . 2 @ 2  @ . 6 㿘?# ##$ c)    * 2`    `} d2`2#^> +  #   > ,  @ 0 㿘#\  "Ő 2' # ` #$?# @2 *`@2  "#  ` #$? c *2`   㿘H /f * '   4,#, 2   @݆( $ 4@\ϒ H 0㿘H /f * ' #, 4   "@:$ &#L@]H 0  $? 0*   ?0(2  $? 0*  * ?0(2# *` 2`#$? (0 #$ 㿘ʒ  ƒ  ?㿘  * ͒ @    >㿘#  #$`($2#$2` ˔  ǔ Ô  x u T o  * 2 I  c  , { *  2 8 Q 0 # (`#$!2 㿘# ! #$@($2h t  p l h  d `   # (@#$!2#  ( #$#2  ?(0#" ߒ` 6 ? @0*`2# (#$!2`㿘 ?#c #  `  * 2` 0 `{  $(((((((( "X"`"h""p""""""x$%%%%$$$$.//////..0.H.`/.///X////2020040@2,2,2,2,0P0p0|002,01 112,202,1ԝh> b 'H#,'H!& 0@&<` 77€а > -@B '> Ԕ x@@S> -@4H`x ?&0H 7`\$&%'a  'a(?`x'aa 'a!"> -`X@Ȕ #> -`p@” #7> -`x @9 )+6 )6   d6   6  6 . ..arch catdatechmodchgrp cpT ddd dfp ed|exprxhostname%^ ksh sh ln lsmkdir$ mteject mv pax tarcpio rm8sha256sleepstty|sync ... . .. binmdec[sbin[share[ . .. ftpgzipgunzipgzcat sedgrepegrepfgrepless`morep . ..bootbootxxbinstall installbootcloseallnfs_mountobp_xmitoopenbendbootfile__ashrdi3crc32nfs_statinflatePrimenoioctlreadgateipnetif_putpeekcharfile_system_ufsnfsysprom_nextsiblingstrncpyprom_initnet_closesocketsufs_seekarp_listfilespanicbp_server_portsendudpinflateResetmemcmp_uremxdr_inaddr_encodeinflateSyncfile_systemufs_readmemsetmainarp_replyufs_opengetcharinet_ntoanfs_seekifnamereadudpprom_findnodecd9660_closecngetcstrcmpzcallocsocktodescxdr_string_encodegetdevtypecrc32_combinedomainnamelenprom_open.urem.rempmap_extractrpc_pmap_nummmu_initxdr_inaddr_decodeobp_recvprom_getproplendvma_mapinprom0_closenetif_getdbufprom_boothowufs_readdirnullsysin_cksumprom0_xmitkdoprntexit_divufs_writestartfile_system_nfsbceaprom_getpropstringarpwhohasufs_stat__muldi3netif_closeinflateSetDictionarystrlenopenreadether.umulprom_firstchild__data_startinflateEnddevswprom0_iopenobp_closeinflateInit2_dvma_freepmap_mapcloseprom_bootfileget_crc_tablefbufinflate_tablefreelistrpc_pmap_putcachefree PMok0 < @ Mok0D(P  Mok0P@@<@T UMol4yMol4AMok18Mok xMok x H=AMok1% Mok1% Mok1%  ͷ>AMok1 W$Mok1 pMok1!U AMok1 W$Mok'Mok' OAMo\ Mok%׾Mok%׾ +|mMo]/Mo5MokPX`hpx t7Pnm%Mo]0Mo5MokG*oMo\ Mok%׾Mok%׾}Mo]0Mok%׾Mok%׾EU n0m7Bd8+@}mAx*RcsD4)HvXqe,?xr6h'rc&2.<Rb-mNT ~?bSPY]xl=}u#F*Z+wl`}1}DQL%s ֜*Xem x19u{Q3bkrI蘆sKzrOR#z`h6X E&,,tF&+vH3R~p XT/#f(2t T/S$ 07+-17^2fС^"wO!c5ۂ=qJp ,}86)%W-M,B$0٤}]OULUlAgcd|SiW9;qيũNǠ%{{>c*- iG!\Bj45Z{Xse#.)l˻:Sc}٦OD)KR%W >&pU&EKU*f 6aR:HigZ ~,+3_٨J(=јd!oQf5ELlO)Vl.x15~{l"FOs7 (^A @n],j#*iy1yva ^<ˉI{//UY{";۷kip'!,?&Nr$|T> G>"yGfD,zK <ЋXSzA<'A--EC>CjO LV )\mvMAmeL[v-@G!|jEl_MZ AR%F`ae\N lqլ4  W>0&93i$9*TZC\t'#E^tZi:3t LP~H%J^A\؄kkStT*i #K q2SuAUhy4w`A@Cm"YViz99=էJZNt Uq>JBI.21cD8'.^%lTJpH) )+/Ӡ+EEA FiW`_XMnECc!`sr~L7uRl ;#> :]Ԟ\S1ԥU;rR^"9G(@L P"_*w(e"i#]M o|4ٿJ@Ng7^IE-L;*>tUILfL{S3tl]4.*`OL~y{7!7`m)um3qpLkFi# x(9``@!` #``"Ф" $@```d@#XbВ@2`"` H*/+"b 0 " @`?"cX? Đ`IJ@` @ ?㿘#X& c (1?@+!1?㿘 #@!#X㿘@ " ݒ㿘 @Ӓx  ?`a"`8"쀣  "@a `$ "c\  "`"d  [aa |`#!#ah@} @* 㿘7സ?\ 73c`?c`. ư &@ d1? dƮ` ?d1? dƶ`??$#d <7@Ħ @ `?`??7@"#d   Ԃ6  ?*("@ P#h#\ @@@ p ؖ   ؘ@@Ԑ `   * &@ 㿘#l` @e "a #@ #l $#l㿘cl ? "cl@ca㿐%@?4!('@@!@q 2'a0@"1#b(!$@ҖbP 2!$@'bP@"0!$'@bP  # 2 !㿘` 2"#p"`"`"`"` "`"`" @E`  "c?   ? 㿘  ; < 㿘  @@ @   @"&  ?  㿘@  `  @cc`Ȕ<%` %`#" `( $ b€ c c `h%` %`%@ b@E"X0Ub@ %`&`   ``"`" ` " `" `" " "  +b@"p0/  `a `'#a` " ` "``$ " " "  " " " """ ""`! %% 㿘#b`   ``*  `b   '@`2`0`,6 * '@ 㿘  & `& $& (   € " '@ 㿘 ` @ " `( ( @0@ 㿘   2 i @ $ ?`$ *㿘"` `0`4 㿘"` `?`8 ? 㿘  ,`@L"?@ `?㿘 ,`€㿐 ` "    "O! #?  `$ *`P `/`$*O O /O㿘㿐" `      O ? X/O O /O㿐"/  0T@㿘  㿘"`t€㿘@@y@㿐b    "X" p@     Ċ@@*`#X `# .@ .` .` .` .` .`b` `€0  @@b|@㿘"` !`@@c@c ' c(@  @c0   !D`!DN@J@2J`N` " 2 㿘 " !#8@O@Ē @V #8 㿘# 2 &#@G 2&#@#@㿘"`€㿘"` € 0#X@˘ 㿘"`€㿘!#Ֆ ??" #.㿘"@€㿘"  8 |@ϐ |€0@㿘@# `  ?` $$   $ X "  "   #02  ?  : $$ $   / #@QSb9cȢ @B## u@N .`M*  @'  @" 0㿀`  @nb  )   c"%""L' ) L`  -2*@"@ (*`J@ @ *` c""%')L  *@L` ) *@b `""``+`J@ -& @ *:  c` d a "J@ s "J@  "$"#b @ #"J@  @`  A$ܒ`PL ``@K  h@2ߐ@2   $@z x $ $``@,   `@$   $`$ @\ *@% $ଁ㿘' ?M  @`"`$ $ $ $ $ $ $ $ $$ ($ ,$ 0$ 4$ $ $ $ ` @. + @" ``+  `@7 $ 0` "`$ 4` " @$  @ 2&  $ @ ذ 㿘#a  @ 4 "$a & 4$a㿘 *`@  @! !        !@ɒ` ` @  8 <?*   آ&@  `  @㿘?(,1\&" H L` T ` X P d l$ p  t @ .@㿘   , @*  6? ? /+  *  2$? & ?`&   8"@ "b "@ "@ @?ږ?㿘@(  +#  "P,  #/)>(!&@  @ ? ?@ _  @  ?2@2@R#`" "@ b  P 8$b b "l?b ?44 @ #4*`Y?# !8@֒!! 2 "@   !  &@@@ߐ㿀!@!`Pa €" "@!x@""#@b2 * `"bL@ 5!5%3-+1)/79@y $ @pab@ )Mb 2%@g!#8@ M#8 2@] ݔ਀ "b1   "P.  @   ("c)  "c?#2   @i  :d뀤   ? ?@  `@J 4? 4@!#`"""@Pc@>@" #`""!@;#@Ր O'$#b8@   OĀ   O @ 4 "c   ?@`"@@"  #㿈,,'D'T@>@ dD P ?' ? 2Dސ"HD@єӐ"X,@E   19 2 z `2 2A`= "p"x"@W   @dD  ?2 2  @E"# "D@@ @3"# b"@ E   a2  2a"  􀢀8'@* ` "@ @"  " @ @ ,h" @* ~ @ @'4 @Š   @dD  ?2020@ϐ"#`""@% @0,* @UD@"@#`_`"0@ E '7   `@ " `( ] ? R I G """@t   @dD % ?22 @bb D@@@O# "b@  @@@06@ E $  ?@ 0(  @  2@ #@`   4& &6*6,@ 4 T """""  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*H J2 "/*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@J@   J@J`  @@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  㿐`@<0@ `:` @9 *  x` * d`, `0 200@"x ߐ*  @4?ഐ"? 6"?  =%0@㿘 `  .` 8@ ^&  @   @`&@``@@6``,`G D& h`?  ,` @@!  @0$@     d ,  0 2 0 2 %@` ,`Ő,`& 㿐   <P @u 40*:  8  20 @8 0<D @L@ @  Ȁ)n 2; @Q0$  " @  d  *  0 @$ $  $@&@&    b 8   @   " & 㿐`  <@`@-5 2& :@ "   2    " *@B<@@` ڐ2 ``@Ӑ 㻀@Ր Ц @) &`@@$`   `  @2 %\F!T@  0@@eg0    t,   $@  'Y L@  @5<`/2L@`L@ /"`L@"y   נ  / ``4k `L@  /`,@P谒 \,@$ W(  2LL@ $H  E;@~%( 8@v"@< 0 K䰒 *@x`  d*  0` @UO / ' 'Ւ L@  @   0@5 @/@, Ё㿘 &     . @ "  @0  .  "  @0 @ @  а 㿐 @ @&B<@@`@@ ``@0 2&     ":?"   ? @ : ` :?  "`"`"`:`8㿐`  8 `@@2.@``@.@+?) @ " " ""@@C <@  @ @ @ B <@   @(*`  p j!(1a"'А $  $ $ ''X@Ғ 2V?b,??"b,4` $@!#`"#@ #\ @  !@a#;?##c@#*`4c' @2 `@H#@"?'ܠ a0"@~܀ ?"H`H@t܀  ?b0@܀ ? ? J M!a0?@G 2B?A@> 29?b,?"b,6 "&#`a#@b#\ @     H"c''@( ?@I ?#'@ ? ?㿘`&"@  &@  㿘 &   ? @&@ .@&  @""#d d " e" f" g"#" ?  +d +e +f +gd"@# @ ` J@(8(8    `J/`? `2A ` `!J@(8(8  . ` J J#   J@;..2J`;2 , `J@; @Є 8 <` 㿐@ ( ( @ `  -``( ( #h@     2` * @h *`  * +` **` +   h  (@ g@ o@ `-`  ` րϰ    *` *   *  M `/  M /" M MJL *  2D     !*  *` * @*@  @  @ L  *  "M  !   L  *  2 M  : L  *    g2 @ 2``  `-`( U(  gh 8  *   *` *   @ @@ ˀg@+ @    >>>&`>  * *`   * & +` * +   :>@ 0  @  @ 㿘  @ &  㷐^  [ @4 U  @P2 *@    @ ,`  ( 6h" 1  '"@@''   b 4  @   " 'w@ X@B< 22&     ":?"   ? @ : ` :?  $"`"`"` :`8   㿘  ,  ". /.".+."&  "!".._ 0Z X ?U 0R @͠LL *L0F 0C 0pؒ  @ ( 8 'p@ t    $ #`a#\b` @  ?  H "c؀`@   "#?㽠P  x@   'P $` $` $`  $$` ($` ,$`$` 8 @ wt$`     h #`ab`$#\ @ ? # x 0  &,& &&& D& &(&$@ E㺈 ` ($ a b????#\#`  @ ? # `  dh@ d .@  ?0  '  $  $  (  ,     $$L#`a $b (#\  @L ,? L `" H"#?@T@ߔ0 #p@  H"c?㿘@(  "c","",6 & 2?c"c0 "!"0" ?㷈##` @ ѐ# N  m `/2N N /" N a  0 ] @R x  <$N O  N  /  .ؔ A.0 0㘢" 2; $+  (@M;@IO`/ 㘀@9 x@5 x  @. x N  &`  @ x@ x㿘  "& @  x&  㿘' #!%@    ? c2  " @ !  ; B& > @ 2&     D  "; ?  ?  @ ;   `; ?  0 ( 4 "`8"` <"`@"`D :`8 㿐\@?<6   '?'?@ ? '?` '?`@""?'?Đ #`#` #`#`#\ #`xvc|$ #@? ` @``2"@# H"c?㿘!$#@P  @ 2?`2 ?`` $##@r ??"@?2( 2  2 2 *?  #  ("# " " " 㾐a"@2 o'Ô?'' "p #\#` ""   C   p'–0 !#@k?@  H$#9 9,9t9t9\99t9P9t9t9t9t9t9t9t9t9t9t9t9t9t9h9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t989t9t9t9t9t9t9t9t9D9t9t9t9t9t9t9t9t9t9t9t9t999999㿘``1w"*` €10 (1- @1* X1' p1$ 1! 1 1 1 1 1!1!81 !P1 !h1!@ @!X\@**@X"X㿘#!"a`$a\x P'P'T'X@Z$!Xa\!X *`2*X&] @-!J?  .@ 7Ɛ(   , 4 , 4 ` 44 `~4 `x4 `x4 `b4 `4 #\"Đ .@U @!? 2a( a(2  a( @ 0 ? @ ??"b( $`㿘 H@k 5㿐@!"#  5@2?@ 2?`(2?`&2?` 2 ? `@  ??x&$`$` $`$`$`$`<* @ *@@ &  ,`,` 4` $`  $`@4`  6 4 4 `'`'` '`'&$`,` '@4` 4 쀣?&$`$`$`  $` "Ѐ    `'"0'ܐ@Nܖ@ژ( @?!@:x@ް yހ( (  s?@Ēn?2l?2` 2g? 2c?2``<`]@l 2Y? &U?``  2M?` &@ʐ  4 & ` 2>?` "6`` %@!0? ,  $ $ ' '`'''4 @.  ?$$ $ $ $ $$ $ $ $ ` ??㿘\   ) <+`%#(?@ @b@,`4 2 #   $$@Ӧ` l J` Є * (Ж  (8. 53 ".?" 8" ?#  0 `(?`d((  `d(h(*  ?#㿘@㿘!y,@  .   0,@% "  0,@  0,@,@6 ` "@(* 8("@ Є (@ 㿐 "< N ,N`$* `.! ؒN*`? @ . ɒ?N*`# @ .   J `   `&     ,` ` `   ( `߀` ܗ(2 ?# : :* 㿘 3` 3` 3`  .+`+`+`+`3` +` ??㿘汒  @,   bH@%  "` ?` ?70ဘ :  0 *@ `  *@`*@`*!" @ ` ?  2  㿘a'H'L'P'T 'X @"a@H@"@9㿘"H㿘"P , @` @ , 㿘R@q㿘@ 㿘 D " ? 2  H1 L&#@h  $ # `$ D?$ @ L$ ?$  @`$㿘אԐ* А* ̐?. ?$`@㿘"ؠ  , @     & &"   & T`?& & S`?   2?  ?B& @     `* ??w?2? o  e  "  D Z   D  ?& @㿘@k?7`5@ X!. `%"   >`P>@>`>`>`>` >`(>`0>`8>`@>`HP?@! @ `@ &`L&@Z&`H0 @ ѐ`@ X@̐?㿘  "c?"P. @!.   @  L@@ X@㿘!.   @?? ?2%  ?% @%   T "<   8 @a    "@"% %% %  "  @* 4 #`% D " %   &   B @ B = = % DW  D  L!$#@ % # % D L%@ '% @  P@ " % P  P ?% @ @   @  = =   @  % P @ 2   D 2   2x T  P@ "  % P&㾘  "P- @@8!-  `T @?2*$`(&$`" ` o lk @ F`2.``)  @ ?V @`L  <`P<@<`<`<`<` <`(<`0<`8<`@<`HP?@Ԗ @$@$`L$`H`4 `5`@1`@ f )`' a !ɒ: @  bd 4 `0 b"c?? ? * `:```? b "b"    ?"  @ @   @ *0   @ *`㿘. "P @  @   $"c2  " @      @ $"#` "#?㿘. "P@ @   "    b :@B: b"c? ?   ` 㿐"P @  `  `  D"c$@$`$` ' 8@`` / "`J `)$@&$` ! @  ! € ` `!  `" ` @"#$@?㿐. "P @@   ,"c" @% * 2`       "c B< '  "c&?999:::::::9::::`::9::<:::t㿘c'H'L'P'T'X#@ H㿘c#@ N@`N@`%` N@``!*` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @N N@ @E N@ @< N@ 0 x   ?"X0(  @ 0,  ?L?hN@@ `N@ % X lT㿈"X릒 @,?  ?L?㿘"耢` ! bpJ@ Q#!O  (#L@ "쀢@  'h@@B`@ ` L  $L"xƒ  .א 7Ɛ(  , 4 , 4  ~4   44  4  4  4 hc4 j4 h#$@#\ . ? hl'l" ` `4` L4`  $L4`㿘H/(㿐E-"#(2*?@ 2&?`(2"?`&2?`  @??#L*@ *`@ `S  ??㿘@ /`(+`&'` # `7   `6`6`` ` 6``6``6`6` 6` 6`   .6`  `6` (6`: ::::::::: : `: : : : : |: :::<::4::t:::::: ?$2"0    888 0 "L"""" " "(","0"8"<"l"P "? $  `4? <   ?(  8 * " <" 8 㿘 N 12:?@ 5?2 (1? $ {"$ ($ 0 , 2 ({"$ , (  0 0 `?$ $"` >` "` 8 ,"`$"`4?€ 0$ $㿘 ⸒b  " X" L" T" P㿘 $ 4 2 ( $ *@ (  0 $ 4>  ( 2   $ * $ ($ 0$ ,  (&@@    4)"@  ($ 0%$ , 0" @8 4  "@@   4"@ ($ 0$ , 0 ( $ 0$ 0 , (@@$ , 㿈 ɺ $ Ŧ  "? 2  2? 2  $   8< `!l*` € ` $"&  @?*``` * 4 a  y  u4 $  m * $  @! $& 8  $ ¢ "k&  @?*``` ?c4 4 *` , $& 8   $   & & & &$<$8  @ $& 8 $`";&   `$@4 $"0&  @?*``` $4      4 $  $ $#`&  $4[ `$@` 4 "&  @?*```?c4  $@   $@ Ā88 ܒ @%"@$@@%'@"&  @?*```  a$`4  $d4  $\4a򀢠 $$hh\@#8 p"&  @?*``` h *@*`3 $h4\ hp0lT#8(*`0  $h $T$L$l @   c#`#`&  $ $$h`dh :pT * ?L * @@7`񀢀7  "N&  @?*``T*?L * @@7`񀢀7  @   ".&  @?*`@ ` $@4h*`3`i$h !  @   "&  @?*`@ ` $@4h` *   45 @   "&  @?*`@ ` $@4  4h @   "&  @?*`@ ` $@4  4h`d Q?? ph?*`2`?$h`dh *QT "0 $L$T$ll` pT@ ` l*``p$P$Xd  @X y $T * ?L * @@7`񀢀7  "t&  @?*``T*?L * @@7`񀢀7 - + 7*@* 7 2` "H&  @?*`` 2 L* @@7`7$@4$@4$@   z$ @ u$2  $H$H @   "&  @?*`@ ` * @? @$@4 $@  $X * ?P * @@7`񀢀7  "&  @?*``X*?P * @@7`񀢀7 ` , 7*@* 7 2` "&  @?*`` 2 P* @@7`7$@4$@`@4 $D `$H$H @   "&  @?*`@ ` * D? @$D4 $@ ,D"@i $u&D"0 4($ ""@@ @&@8"$@% @?.@``@ 2 $H  C.@$` 6`8  ":&  @?*``` &@B > $@Β&@$& 8?c4 4 *` , #`&  b$   $ ?M?& & && $8$<(   8   ђ  $3?  '  B& @B > >   $ @z"@$& 8 <@ " & 4`"?㿘 ? $` ,2`40 `" ,€ 0 ,  0€ $$ $㿘 ";? $ "7?  ` .?`   @. @+  ?[   $? ( @ 4"@  ( $ , 4 "$ , $   " ? $ " ? "?" "`0  @  @0#   ( @#@㿐 P?`$ 2`0J 2 < D?   h <  8 " * % <%% 8  ;*  8  <2`?% 8 % <  % h@```@ @B  " %`%@=` h?` `3  =`=`  % "? $ 2 ?   <`?㿘 `"h?`$ "d?`("`?`, 2`0Z? 0  2 4Q?   $ * `( `0 2 @`0`,€?0=@' >`> `> `0> ` > `(> (`0> 0`8> 8 L%0@ ,@zА" ?%0@$`L PzВ"@ e0@ $`P l:А" ?%0@$`l $ * 4$`4& $ 㿘?4`c @@c@@ ? @ ? ` " ?@@`?c@? @c* @! F?"P  ![@@`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ ϲ`㶒#㲒#񀦀ðL(7@@`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ β`" !?@@`!?g#c#. @@'X'D'H'P'T /```0 TH) @ ( 6T  ?, "?8 2P @ // 70 0P&@00P T:     + "  *   /`.  b``(/`  D X 2?7   ``0@`  DH) @ (@(0@X6 0  HD X 'ֲ!}'?T' P( D'      ?e ° ? 'X) '@ /67/. @/7 `/7, , /`7 @(3`0,626  ( 5@FX*`H(@ X" '@ @ + ,(& *.``@ . & 4`D, @eE P- (P(P#8z0 @//+` '7  P  /7 (3.0626 ߀P  T&@T% T     "@(   ( 00? #  P0P㿘#P`1!㿘`_ #P`G8!@6  * `@@  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * 6  ` !@6  * `@ 8`  `2`` 㿘  $ 㾘;;n # '  x*`"``*ߒܐ`ɐ.6 > ʐ`.6 > ޒ 2@ : :*:   㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ߩߥdvma_mapindvma_mapoutobmem %lx L!%lx %x %lx %lx map-pages%lx pgmap@ %lx L!boot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s promprom0Can't open device `%s' Can't open network device `%s' xmit: not a network device %x mac-address drop swap 6 cmoveielefdxyxdstsddevice_typeblocknetworkbytenameno PROM root devicenode %x property %s length %d > %d makememarrmakememarr: hope version %d PROM is like version 2 memorymakememarr: cannot find "memory" nodeavailableregmakememarr: cannot get propertymakememarr: no memory foundcompatiblesun4cpagesize %x l! sun4msun4dUnknown CPU type (compatible=`%s')Invalid controller number prom_iopen: "%s" error=%d prom_mapin: length=%dprom_mapin: invalid maptype %d2.6Loading at physical address %lx >> OpenBSD BOOT %s can't figure out where we have been loadedbsddevice[%s]: boot: Booting %s Cannot load %s: error=%d read header failed: %s read header shortELF=0x%lx lseek phdrread program headers%s%lu+lseek textread text+%lulseek section headersread section headers%s%ld [lseek symbolsread symbols]bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d CD001nfsread: short packet, %d < %ld nfs_open: must mount first. nfs_read: hit EOF unexpectantlycallrpc: error = %d recvrpc: reject, astat=%d, errno=%d getport: %sbad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentUnknown error: code %drarp: bad socket. %d No response for RARP request sendudp: bad write (%d != %d)readudp: huge packet, udp len %ld sendrecv: short write! (%d < %d) exit1.2.30123456789abcdef|/-\arpwhohas: overflowed arp_list! arp: no response for %s`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     error inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@ 9,990999d9ɘ9΄9Π9<9D9м9֨99 999d:.P990998:.H9d909x98:/:/:.:.:.:.:.   :10@` 0123456789abcdef/:N9:@X:CX99:CX99%983:C`;:C\F:CdN9|]9p:Ch9 v:Cl9:Cp90:E9:C:AD:C:C:C:C9d:E9h:A:A,:B8:D99I9T99Z9b9L9g9g99u9989999(99T9999 9999&9t-9P49D;9hB9I9P9u9`99\9p9L99999D9 9 989t9h9&9-949;9B9(I9P9@u9949999$99P9999 9999&9p-9L49@;9dB9I9P9u9t99p99`99999X949( 9L99|9&9 -949;9B9<I90P9T9V9a9k9|y9 9Ô9999Ȁ999999T999499ߠ:E99:EX:E\:E`9@ 999|:Eh%9<99`,:B03:E999 ?:E9p9J:BS9\9d9q:E9t:B9X999p99x:E::::::$:p:D:":(:CP:CT:(:E:+:+D:,p:,:-99$9/9<9A98L :LW:c9<p9 y99Π9 :M :J` :M9x9`:B,9ߠ:B9$ :L99t:A@99\,9ڼ8 :J?9@Q:A] :Ji9мu9ɘ9 :K9999: d :K:B99h999:@ :M 9X:@9@9D'9h- :M$49`>9M :LU:]9Hb9Tj:A<p99 :M(9Ō:@ :M0 :J:B 9t:BP9d :J909 99<:CL9$9.:@6:DG:@N :K\:0m:@9 :J9:9֨99<99 999:D:B9%9@/9H79T@9J:BW9t`9pi9s9|9p :J :M:,p:)|9d:d99@ :N099P:@:A 9\ 9Ô 9 9 :I (9 1:B : :NP @9 F :K U9| ]: j9 q9 w9h : :I 90 : 9L : 9, 9 9 9 :N8 94 9 9΄ 9< 9 9 $9 /9 A9 L:+t Z :NH h90 r9 x9 } :I :L 9 9Ǵ 9h 9 98 9 9 :J :J 9 9 9 9 &9h .9` 39H 89 B9 H:@ X:BH ]9$ p: z9d :, 9@ :4 9 9 9 9 9h :@ : :A 9 9x : 9 % :I .9 4 :J B:)P P :K8 U:" c:B l9 ~9@ gcc2_compiled.base_vapmap_map4pmap_extract4rcookiesun4_mmu3lscookiepmap_map_srmmupmap_extract_srmmuobmemopen_countnetif_promsaveechopv_putcharsun4_idprom.81dtabrootnode.94stringbuf.107filestore.120bootstore.121prom0_fakepromdev_inuseprom_mapinprom_mapinfoprom_mapinfo_cntprom_devmappromvecstore.134getphysmemloadkrelseekLstdLmul_shortwayLgot_resultLnot_really_bigLnot_too_bigLdo_single_divLend_regular_divideLend_single_divloopLsingle_divloopLdivloopL.1.16L.2.17L.3.19L.4.23L.4.21L.3.17L.4.19L.4.17L.2.15L.3.15L.4.15L.4.13L.3.13L.4.11L.4.9read_inodeblock_mapbuf_read_filesearch_directorypnmatchdirmatchnfs_getrootfhnfs_lookupfhnfs_readlinknfs_readdatarpc_getportrecvrpcebuf.24sputcharsbufsbuf_endsbuf_lenrarpsendrarprecvbuf.39numberdigitsetherbuf.30paniced.24gz_magicget_bytegetLongcheck_headersstoppos.36arpsendarprecvfixedtablesupdatewindowsyncsearchLetextcrc_table_emptyfirst.24make_crc_tablecrc_tablegf2_matrix_timesgf2_matrix_squareputcharprom_getpropdvma_allocprom0_iclose_remprom_ioctldomainnameinflateCopycd9660_writenet_openalloccd9660_readprintfnameipprom_sihostnamelenelf32_execrpc_fromaddrrpc_portstrerrorcompatprom_findrootrpc_pmap_listsnprintfrpc_pmap_getcachehznodevether_sprintfnfs_readdirbstartrarp_getipaddressnetdev_socknetif_debugcd9660_statcd9660_openprom_getidpromerrno.mulocloseintoagetsinflatebp_server_addrversionnetif_open_udivbp_whoaminfs_closeolseekpgshiftswapipmemcpynbpgdevopencd9660_seek.udivrootipsendethercd9660_readdirrpc_xidtwiddle.divgetsecsndevsprom_makememarrip_convertaddrmyipbp_getfilekprintnhostnameprom_bootdevicenfs_stat_typesdvma_mapoutrootpathobp_strategydebugprom_getetheroreadlseek_rttarp_numbzeroufs_closepgofsetinflateSyncPointcputypnfs_root_nodeinflateGetHeaderfile_system_cd9660fdloadfilepromvecxdr_string_decodeinflateInit_nfs_opennet_mountrootprom0_recvprom_interpretnfs_readnfs_writeprom0_strategyrpc_calladler32netmaskzcfreeinet_addrvprintfsendrecvdvma_initdonottwiddlegetticksH5 ``@! ` # `` g!" $@` ``d@ f# ga@2`"` H*/+ e g"a| 0 "#@㿐@s# g a "a  @ " e e!@֒c@  @ e  g!|@@K㿐 ec@  e e e!@c# @ D e?# c' e/ e- e+ e,`2 @   # #@@#@`b @@?@2 @a aa @`#@Ȳ@  `? f"c؆? Đ`IJ@` @ ? f?"  f 㿘@ " 㿘 @1  㿘@  e#` @ِ g!| ` g €ax  $€ax 2$   g!x e@9"@0   f$   $`$` 㿘# ga|`   ``*  `a|   '@`2`0`,6 * '@ 㿘  w& `& $& (   €n " '@ 㿘 g!|  @@ 0(@  㿘  @ $ ? g`$ *㿐 g!|/  0T@㿘  㿘 g!|`t€㿘 e#` g@ g!| ` g "x  fc g"!xJ  *@J` )*@㿘' g ?M   g@@"@$ $ $ $ $ $ $ $ $$ ($ ,$ 0$ 4$ $ $ $ `  e@U"X+ @" ``+  `@7 $ 0` "`$ 4` " @$  @ 2 &  $   e@+"x 㿘# ga  @ 4 "$a  & 4$a 㿘 e#*`@  f e"@ْ#Ę  f f#L         e"@’` ` e# @  e#8 <?*  Ș آ&@  `  e#Ȱ@㿘?( g,1 g\&!| H L` T ` X P d l$ p  t @ g .@` * @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  f̖̔ ? * `:```?  fcД "c"     f̐?"  ̝㿘 ga'H'L'P'T 'X "a@/H e@"t㿘 e"5555@5@5@5@5@5@5@55@5@5D55@5@55@5h5@5@5㿘 a'H'L'P'T'X"t@ H㿘 a"t@ N@`N@`%` N@`` d *` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @N N@ @E N@ @< N@ 0 x   ? e"0(  @ 0,  ?L?hN@@ `N@ % X lT㿈 e" @,(  ?L?㿘 f#Ԁ`  g! e bJ@ ^#!\ @ @   @ *0   @ *` (%s: can't open device%s: alloc failed%s: block table corrupt%s: read failure%s: short readpromprom0Can't open device `%s' Invalid controller number prom_iopen: "%s" error=%d prom_mapin: length=%dprom_mapin: invalid maptype %d exit0123456789abcdef|/-\bootxx585@555505555   5555555555$5(/5<5I5T5 b5m5Lz555555055,5@55|5\5 5h'5.555<5C5DJ58Q5\X5_5f5m5t5{5555555555  5'5.5h55\<5C5J5Q5X5@_5f5m54t5p{5d555555@5555t55\55555@ 5@ 5585 55558"5*5H05l8 5xH5DT5a 5g5l5r5z5 5|5x5 5 5@5t555555555 555!5,,58 5E5M5R5X5e5 k5Tw55 555hgcc2_compiled.base_vasaveechopv_putcharfilestore.54bootstore.55prom0_fakepromdev_inuseprom_mapinprom_mapinfoprom_mapinfo_cntprom_devmappromvecstore.68Lgot_resultLnot_really_bigLnot_too_bigLdo_single_divLend_regular_divideLend_single_divloopLsingle_divloopLdivloopL.1.16L.2.17L.3.19L.4.23L.4.21L.3.17L.4.19L.4.17L.2.15L.3.15L.4.15L.4.13L.3.13L.4.11L.4.9toppaniced.24pos.36putchar__maindvma_allocprom0_icloseprom_ioctlprognameallocprintfprom_sinetif_debug_udivpgshiftmemcpynbpgdevopen.udivtwiddlendevskprintnprom_bootdevicedvma_mapoutobp_strategydebug_rttbzeropgofsetcputyppromvecloadbootblock_countioprom0_strategyvprintfdvma_initdonottwiddlecloseallprom_initpanic_uremmemsetmainblock_tableprom_open.uremblock_sizedvma_mapinprom0_closeprom_boothowkdoprntexitstart__data_startdevswprom0_iopenobp_closedvma_freeprom_bootfilefreelistfree 6 6  6 6 6 6 "<6#`& 77Ƞ€  '?c * 2`  6  6   ""    `#,F \#, :@b_&`&be@# &D!#`@&c'&   c  @$2 !& &   aj $(&&  b && !@# &$&  #,<O 77€  H̀ "H &H!  , @YĐ#@ b T<#,aƒ 77€ $?# @ `*`2 @8   6>>#> -%> -    6  X  6>>#> -%> -Xတ@J   @N ! @I  $ @A  ( @9 !" @1  `#  @' ! @"  $ @  ( @ !" @   `#  @ ! @  $ @  ( @ !" @  `#  @ٖ ! @Ԗ  $ @̖  ( @Ė !" @  `(  @ ! @  $ @  ( @ !" @   @  @@xbАb'bx@7b|@7`&@c  /a#,@@ '>  > -@\Ր / $/܀2d/6 ? @0*`2/ $/܀4h/6 ? @0*`2㿘/  0`\    $/ 2d2@ /܀ `4`h/  ?<#2  $/ 2d2@/` /܀ 0`@?# @2 *`@/܀ 0`@  $/܀` 4 h/`67 ߐ#p2  @֐  $/`4h/@  !2 @v  $/`4h/@  "2 7 /`  $/܀` " D@?# @ `*`2  @ $/܀`"D  $/܀` 4 h/@  (2/ @0  @m  $/`4h/` ?2 @  $/`4h/@  $2   $/܀` 4 h/@   2  $/܀` 2 d/`6 *   2a  @ / $/܅*` ?(0 $/܅*` P! #, 0`€ /` #*` g @’  g  @˖( `]$ `  @ D R? Lc *`2 @ '2%> - 2  " <  > -   > - ,,  <  @a 0$, D * 2`   @T 0 ( #, ` @ $ "$    @ D 2`4 #?c 2   @E    @N( `(   $"$ =$ `9ܒ  * 2` >  > -  2`*  @!0 DtQ < <@  <@ > -@ߐ!``$ @Q$ 08 *  @@>?@:?c * 2   > - 2`*  @!0p$ $ t t  s  #,   @ D *`B@ד<`0?c 2*     2`* > - ɔ  $ #,$   @ . ,``B <`X 2 @/` + *' $  @ 2 @ < > -!@= @D``B /<`  @ @١? `2 `D@ `D @l  ` #`@0@  0 \`2 \2 Z @:  @: 㿘  @V. < 0 \d%H /f * '  #,<@  @ H 0> -!@ǒ 㿈 #, 0`€ * `2  @ ?a# 2 + b.   + @ 0_`] * 2` ?  #B ?,`$#c,   /$`5@  @ `*`2 @/` / 8p@ @2 *`@ 8p@7<@8 7@? $@ˢ`      >`㿘???## /` / @ `*`2@ @ 0 @ t#??2/    > -"@   < $/܀`  /`6?#2 .@ 2 $/`/`6?#2 .@ 2 $/` /`6?#2 / @2/` /?#@2 .`@a "`$?#c2?# /@  /܀  `0`  2 /܀  `0` '  @  * 2` @ 4h 2@  tE ??2/ 6   > -"0 @~c <㿐 ` / 4 ,#t"c?? @   @  6/> -"h@~; 0`&/ ?c1  #,< (777€㿘  `#//  * s //#*@ s㿐  `?` @@! #,< `(` < `# 77! #, @` !@ 2װ ` @ 8 2ϰ /@   $/܀` 8p@?# @ `*`2  @ $/܀` 8p@$    $`8p?# @ `*`2  @ $`8p`@  6@6``  $` 8 p*?2` / 2`?@  `  #`@  $]6` `X?`@"`  @<*@F 0I@BD@D `?# @ `*`2 @`>#*` €         ?#  *`2 @a?# @ `*`2 @ 4@` !*  2 !4`4` 4@`4` h`? ` * 2`    #  777 ?`@  @. @k@"Z``77` @ `*`2 @` N> (*` €          5* <`( 77` !*  (2  `  #`   ? # `"??#  *`2 @7$ 7 < `# 77`-7#d`*`  * 2 #,` Ȧ̐@ Zג &   7Ȑ|$7ʒo`€ 8```[ ` @X 8  Q  $/܀` 8 p/`@?# @2 *`@ 2 $/`8p/` `?# @2 *`@(2@`  $` 8 p*?2`/ܒ  2  #, @`!!@   㿘68> -      @{ؐ"^   $`/ܑ* /`6?#@2 .`@ 2 $`/ܑ, /` a?#2 .@a" ?2`$#, 70/`/ @  * 2`  `0 @ `qT 2/` < 㿘 8    $` 8 p7 ? / ?6 㿘n 6 2   $` 6 l7 /ܖ 3   $/܀` 6 l/`  "4 2 $/`6l/`6 V"x31 6 "/M @    $/܀` 6l?c * 2` 4   $/܀` 6l@"4@   $`6l?c * 2` x  $`6l"x@r 㿘! #,@  @ > - "@zs a"?c $/` / 0`@  ( 0`@  `pd 2/`6/K <`  $/܀` " D@?# @ `*`2  @ $/܀`"D & $/ `4`h/@  (2 p 6 4` @:  $ / 6l2@2/ܰ 0 d@ X 0<` 177  \@  #,`€01 \"5 \"  ,*   @  mk `  @ X| d c,,  7㿘`?  0@* 0@"` @"W4@ ^ 0R@"`@"`J @"`  @w@"``< @ʐ@ 04@"^`ఐ-@"` C%@*@"`! @ؐ@\ 0@" ౐@'@"`  @ِ〢@"` ` `@ l #lޔ 0` @   `*`2 <@ `   *2 0  * 2 ` 6  * 2 ` 6 ` * 2 `6 ` 2`*  6   @  * 2 `6 ` 2`*" 2`* # 2`*#7 @` * 2 `|6 ` * 2 `q6 ` * 2 `f6  * 2 `\6  * 2 `R6  * 2 `"H6 ` * 2 c\=& ` * 2 cX2& ` * 2 cd'& ch l D0   * 2` `? #`&#` & *`2@ > -"@x  `> 0  @ 'H /f4'Đ* ''     !> -!"@F @ ! " H 0ā 0!0@ ,$B a@"[> @"%>  !@1ꀦ@ <a @ba@z3a@"O> aҀ@aـ@%0!@>  !耦@Ӕ0!@O0a؀@a@" @a5@aҀ@ a@"  a怦@Ya瀦@0!逦@0 !6@pߖ0!ր@ؖ`\ 7`\ `   #,`€@Gސ0ˀ 4#,`€À 4`\ ?P`\ P!P `4< ! 777#,   !  `<   77#,7`€W`\#,@W`\ @"W`\@ ӐW`\ w$@p @|$i|$ f@"/ `!8@ "E 4 ?a!7@/ c#,〢@A#`@ W#,@B R#,#`j T +O5@@!? @ U DF#hjw D> 5@ ?# @ `*`2 @/5`  5@` @ * %5`  @ `*`2@  5`5@ ` !" ` *iؐ` 5@#,`€i$`0`@   4  @$h$ Ԁ 4@ ͚`?-@j+  !7@",`4 ab #,@V% @@R+  C@K@H {#,@〢@/ s#, @` * 2 `4   ` ,<@  @ x 4,`€o!  `id e 4`\ `#,r+ 2 ?@- S-@ @K@% C%@C ;C@(3@ +` + #,`€ ! `\Ā  @#$h#$  `\ @  ` @   4X$`0`@  4  @$g$ 怦 4@ `\  #  g !Ұ  @ݐ$<A" 5`5@#,`€  `?c  * 2   @ !``'  2 *@ F !g>`0`@  4  @ !' !g  4 @ R# #@6 z 4 @  Ƞ  ?@ Sג &4 < `77 *`7 h #,`\`U 4@O 4>`0`@P F 4@ R@@ ;>`0`@> 4 4@ .@ '(`0`@, " 4@ #@ x>`0`@  4 ג  @$<5`?# @ `2 *`@5`  4`\  #,@ꀦ 4 @$<!" 5`5@#,`€ "`Ӱ ?# @ `*`2 @6  @Ր$<B" 5`5@#,`€ " ` . `. `. `. `. ` .>`0`@  4 ` 4`\ !  2 `2 #,<@  @  @$< 5@c 5`5`5`#,`€ l 4"ؐ"ܢ>c@I$!> #`@ S d* #`@ Sܒ * @I#`> -* "*@B]!F>`0` @I > ` @x2 @=$"<5@ 5``,!"  *gg`  5@ 2`€ 2  `    > &w@ Rl |`!?4`#4`  4``4`4` 4@  2* 4>4@` 2,R,S`  2* g(,`  2`*  4\` @ `*`4 @4^ `<   7 n      ,t`2,B  C B + B` `,B 2 B ,x@o  2 x ,x@e |  &@* " |@  | @ @2vu@L r 4 `l6(g  @r$< C" 5@5`#,`€ 2T `?c * 2` #\ H$  D6>`0`@F < 4 `"V3 (/*`@#\ $ $ <C\ 77 ?# @ `2 *`@ 7, `€ @O@v(0 4 ``\ @  `@̒  "@ƒ * $@C-H 0ā 㻐!" `c(& `"# /$2 ,<"77€ 2  2  > c`"ܠ@ R9 * @H0 " > -@r#!"@B&X/ 0 ]'H /f4\* '\ @ @ߐ % !?# @ `2 *`@ #,<777€7ز 7ڐ 2`*  77Ю<`  2`*  777Ȑ < @ `2 *`@777< @ `2 *`@777< @ `2 *`@777< @ `2 *`@777< @ `2 *`@77/h#\ < @C `2 *`@777€/ @< - @ `2 *`@777€/ <" @ `2 *`@777€#ch  ?@ P &<*4 c7j7l  nd7h € "'#`"   `# @ ?@ O &< 4 * 7B F7@d7D €!)#c7  &@ Oؠ ?< 4 * 7c87 d7 #,) ?c 2` * #,<` 777€#b  ?@ O &< 4 *7 b 7dx7 € <77 # df da  €   \!< !777`€ #,< 777`€ج/ g%X !?# @ `) 2 *`#,@<  777€7Ȑd < @ `*`4 ౒@77 ȟ€h<తj6 #6     - ) c!4 !777 € ?c  #, 2`* <* 777 4 #,#` ` @ ` &: > -# @pW &/ &: > -#H@pI /@&/@W $`@H 0\ `@ { 6\@Fk <x> "! #'  "@"`& &  &  " " ?>?c #@& @ Nz  "d 2`l2`* / //?c 2` ,   c?〤   ؒ@6.@`.`.` * .`@w8@64`4`4`, , ,  ,@6 " > -@Ih#pp> "'T? @ N``l`2 @* // /?c 2` ,   b〤 `  ؒ@6L@6h@w:@8@6^ @@4``4``4``"   > -#\#@oT ?  > -@I#ЁP d  \$`!܀ B!! 29!! T  &!&!% !?&! H@ M D(7`  &   (@ p 2`  \!2`  @v"> -@o#@ !ܐ!€ Ө@8В Ϩ` h h   5@!"݀@2 bA    ( 77Ȑb2 `b- #X`2# "`X```( 77Ȑb b   `b ސb a  *?b#777 ?7` <7# @7bd!? #a bj aߒ  bl @ b`ܐL%    * 4 7ܤ,  D @ ` @ <^ D#b`  @?# @ `2 *`@! 7ܠ#,  D @ `?@ D7 D?# @ `2 *`@7ܔ ##X` b`> . @n Db`  @ƴ! #,  D @ ` @ . D @Y @ \ d 6 Z6 \#,@!  @ > . @@mߒP/ < `@ LM D/a+ ?# @ `! #,2 *`@(777 @ D`@ <@!  @ > .  @m `? 㿘@d/ !  @D' 0s #,  ` @ `\4`Z {4`\㿘> . @mt S #,`€ `B > 㿘 @"/ǐ/  ?&/@@ KΒ  #,<!  77€?# @> , `2  L*`@ < !  L@"   " @2 `  &쀊    > .&  &!   &@ K #,<! 77€?#  @  `*3 *2 *`3` @ 777@ Kb #, 77`€? @ ` 2 +`@  2`+  ( * ("@* *`@ *`*  2*   777`Q&#v"2I @ K  &<a$ 77€ 8 O @3K .0 K -, K ( K K*`KА Б* +`K" " (* *?А  *** +  *@  *`K ?А &&    > .  @lV0& > .! > - p!  ##\@ K#`#d#@ M@ KԒ d#h d@ M#l> . ؒ@l0㿘/?`#`  @> T*` €        ? ` ``" ` `"     `" `@ 4`@ * @//@  @W 6  6  㿘/Ș```    `2v /6`?# "c "/Z "/U  6  6  6    6  6> /  ``> *` €            6 @       #,@/`@ < x㻐  &`j&` `2:/Ȑ<!D &`" 77#,`€ , ?# @ `*`2 @`"```   `  ` &`  &`` &`` &` &` &`    < <!C" 77#,`€ ?# @ `*`2 @` &`㻐/  ?  ch ] D?#  `  \ޔ f-   * 2` 5   < #5` 5@ #,`€ 2U 2O?# @ `2 *` @<  77 7 #,`€ 23 2-?# @ `2 *`@ < 7 7 #,`€ 2d "   "   #,@ 㿘/h`4 Xd&` > `0&`` @H ?`c    ,  ` @ `*`2@  "\= `  㿘``6 `` 6  #,@ "` "`㿘`2 `/@ O  2//*@&/   &/` #6 ! #,N2` @ 20`2- #V`    ?"@ *`:`! #,*`2` 1 >@ "   #V> .!(@i  㿘/$! : -#, >@ 0 @ "/,` $/܀`  @?# @2 *` @/܀`  @` *`:`?" 6`/@ &`&` 㿘  .\<    2` >*` 2H#  2B#  2<# 26# 2?c 0(2 0(2  (2` I2 c2?#(020c 2#?(0*2 c2?#(02c  c"2?#(02c$ (2 2  㿘`  ` > *` € T#  # z6`?# @2 *`r@ E#  B# ?#`?`#   2 3 **  cc 6 c6 N6 `?# @ `2  *`@* # 6 #6 #6 #6 #6 #6#6#6# #6#6.6 # )6`?# @ `2  *`@  6 6  `?`#   2 * c$ *3 c" 6 6   2 #,`*``8*`2`@ 㿘@ @    ?[]@"@&@@$@㿘**`[H` &㿈!> "' ` / ` * ` * ` *   Җ " > .@Au!@㿘   (`> .!P@g@ F'" ` 4!&$ " p!"? x$" >͒cP@=㿘  %@n> .@g!p%`@ E  6`Zڔ #` ZՔ `Zє ?#2 *`@~6 㿘  '@nx> .@gY!'`@ EΒ 06!?#Z # Z Z * 4 ~6\ 㿘   (`> .!@g)̀ D4̑H /f * ' @= "$'> .@=  @g  @ @ @ `$$/ >   a  \ 2?H 0㿘  (H /f * '  {  @u?;c#c? 0 M L$  ,   @m̐> .@f!   4 ` "`$ "@$   4 $$ "@$ @</"-  @m> .@f"     4 ` "`$ "@$   4 $$ "@$@\  @2 0  @@;͒ H 0㿘   (@H /f * ' ` "`$  ?"&&  6  &" $ $& "Ѐ  > c`"@ E @;H 0㿘   ( 4?Ϣc @< < *`a  **2 ` "`$` ?"@& & `"  "`   "@& &  @ "@ @ aА?$aЁ㿘` ```(   @ G> q D @۔ ,`E !ԓ;` ,`  g `;`*  `2@ `g;`* ` ?* `@ 0 6 4& & "$ `&  "` "& & !В$!АXڔ >Βa@:"@;㿘` q`` @ F *   " ` `  `` @  `?      ('L  'P 6@lV`> .@e7"P0.?#  @ `*`2  @*2  ?'L'P`P` L@l3> ."@ex  P`  x   # 2-"!̀   !Ѐ'  > .@d"H /f * '  H 02" z @;-`2   "f  `g  e   4 #b ` `W   'P @     @  $@ # `  @\@"@x$   > .x"@d~|2   @`' ` @     # `x   @`` @@F4$@ > ."@dS2`  # `   > .# @dD%`@ B ,6!?# W  W  W  @~2`. 6* 4 'L2L,`'L2`L 'Lx   $&.X> " `( ''L'P* ?# @ ``*`2 @ )'LP'PL` 'L'P Ƙ ! /  >   #@j`> .@c#H#2  #@ ` #> . #p@c>  5    8 >  ` , :, </#     " : " : " :  < `, : , < : < `, :, <, < , :&    : < , ; , :?  > .@cN#<  4 6  4> .##X "       > /  2   > / 8@c$  4 > /@c p  `4 @9Q  !> / @c !"`@ A '"~6#?'Lc VW  VS  VO L2`/` 2L.``'L2`L * 4`'L2L 'L &> " > /@< 㿘  (`N    @iА> /@b 0㿘  (`3 2 ` @i> /@b 0 ?, 0# 2`㿘 ?`,# @ `*`2> /@ @by!(` l 2k @> /@bq!H` @2` ` P"=> / "+> / 0   > /I`$ @'> /C`"4> / & )> /8`- 0> /2`> /@bB!PA`@b>!`=`@b:!p9`> /@b5!4`@b1!0`@b-!,`> /@b(!'`@b$!#`@b !`> /@b!`@b!`?# @> /2`"@b ` ` `2 *`@> / "@b ` ` , `< BđH /` * ! `?# @2` ``P( `` "!`0`"0`` `"0Ȕ 0  0 | 0 H 0@㿘B "   " "@7 㿘 @ .- H / * !  ` "@7Đ``;> # .H 0  H 0 㿘`?c * 2`  ( a@ 0 \ T@hu`> /"0@aU0K` #@    `# `?  \ 3@hT > /@a5"`0+H /` * ! ` " \` 2" \  @h3> /@a" H 0@Y @7C``?# @ `*`2 @4`8H 0` `:` =` 沐 @–  4 "6!!@!`@$!#  ; B< ""& `B < &! 2" $!!$! $! \d!@`? > ">' 0   `( @  0!Հ@ ݒ` !Ӏ@ "| !Ҁ@F> /0!׀@ 0!ր@> /0 @  PR  xH /f * '  2`  `Ȕ ` ` KH 0NPRg  FH /f * ' ’ 2` 7X`4 7V`67\`87Z`:RJ/^H 0@ . PR1  H /f * '  " а H 0'  H 0X6`@6`H 0@  <Q  > ` ?@4̐<'<J  Q۔ Ф '`H /f4* '`& h  "@`R `47F` 7H`67L`87J`:d/NQ@  @`h@H 0 | Qt &H /f4* '`Y  | U p@ =В |` '`#7#7#7777`47`82 //`6/7`:   //`:   / ,`:   / ,`:   / ,@QA |  &@`||@H 0@^"  > /@8"㿘@  `RJ >>>?&%#pa,4" b&!&!&!6 > & 0! &!  0&!l@T@f## 8&## @!  @ @" #> /@ @@@" > /@ " > /    &#&# &# &# &#&##@] #@e"> /@^(#> /# @^#8# *# *`*  * &#<&#@�㿘H o*@ g@ H 0h ! 77""+`"*"+ "@ "  77ސ 0@L7#&# #4&#,@#3`7&#(S;&#$?* #@#8# 3`7S07?* "7#0 # 6#  #<, ##4@"3`: /7Ԑ7/7֒П # f#  0#@, ##8@"3` /ː7/77Βȟ # f㿘"ؒ  㿘"ؐ  S d"܀`"#@#"؟ l#0#  "ؕ, 2"ؕ4  S d"ؐ  a" "ԟ€ !"?"Ԑ€ !"ؒ !B 6  @ ;6 @ǐ 0"> /#h@] "`@㿘  2b@H @>@2 ; <bД" <㿐 @  2 = @h 08 0 $ $ $  '􀦠.  @A   쀦  @s( `  ( ' $ 8 $ "̔ $&@֤㿘% 2  `B >  t`B >  @I   0@b 㿐# = 2  > /#@\  > /#@\  `B >   , > /#@\  B > #<@*`  " :/77 # " #4,  "Đ  " @&# 㿐Y#$`@ ;=6  @> /#@\  @> 0 @\ 0@h0Q "䀢`"@@ В`B >  > 0  @\}  ЖB>  Ȓ`B > Ȁ`` `"  В`B >  `B > # " #,?&#,#,  , #8 "Ē `"  0@s&#$#, "6 㿘"Ԑ€  ?Q "ؔ  "ؐ  @  Ȓ`B > ( `B > ( > 0 @\ 8)   > 0 @\  P B>  $> 0 @[ h ȐB}>   """ 7 㿘> 0  @Z` Bb> 㿐 \ $@ @ic(+> 0c8,@bĐ  ` \d6 \c,@[c(!܀ !@% ! !!̟€ ! ">$c(  &!&!$ !?&! "2$c( D ",@G ,@c@*`    6 Z0 /77b bؒ  Hc " c,  $c, \$6 \$c(㿘 H /f * '  ! "# \! ;0!5*0 !6&0 \ 6 \ ` W@+Z 0%`4@  2 \B \ ?6 \ 2 @A`4"耢  @" @^I 0`4  \ @  H 0㿘 \!'<6`6`6`6@" @~Д   @b2 *2 @  *@ 6@  2   \ = 6 \ \<"6 \6@6`6`6`㿐# 'N$@㿐# 'N㿐# '@ 9.x> #Ю## ##"'2#@&##Ѐ    > 0m   #В ?.#\ &# 4 @ .#]& 4.#] H I.#^>>ې#b>>۔t&#&#&#&#" #T"?&#h `-&#`#А? 8#\ ", , #\#`@$ #` @  *` ,@ `` M  ,#`>[ &#@Ɛ > 0 @Z)   > 0@3֐!h> #  #̶ ##!# #'&# O#,O !,OԐ# `' !2]&# `X ",  `/>  O d  c   , ,  H,, @, #\#`@B#\#`@@} " I,, , #\#`@$#\#`@@} 2&#   ,&# > 0@3R!㿐` "c  @c̓> ,, , , , >,  ,cЀ` d`"g`4` " @? ` +@@`2` U`4 /`D/` "=@`0  /  3@   /   2  3@  / ׀> 0@W!("@> 0@W!H`2` " `4/ @3@``4   @ c N   @> 0 ah@W`@㿐.2`#d@ ## @####f$@,`4 #\#`@+#l&*6 #\#`@@㿐#Ԓ ##̚#\# #`@#?# @ `*`2 @6 \ "*@ 2 *` 2 *` *`; *` ` *@ 2  3@`0 ?  +@`㿘\ "`.@ @.`.` 2.` .`?`.`  .@ 2 6 0 . ` @  cN? ` @㿘@㿘#Ѐ    #  *`N%#  *`N ?<# # * 㿘>>ܐ# c\>ܠ"Ț 8#&"&#>[>[&"&#̒ @vԐ???@ƚ "쀢   " @n @ "0@ 㿘"Ȓ?@?㿘@x"ȁ 㿘@""&`"&`㿘@h"ȁ㿘@"ȁ#  # `@(㿘#Д > 0!> 0!N.㿘#Д > 0!> 0!N#Ѐ"0# (㿘>>ݐ!a4>ݠ"Ț 8!\&"&#>[>[&"&#̐@ ???@D "쀢   " @ @  "0@ 㿘"Ȓ?@?㿘@"ȁ 㿘@""&`"&`㿘@"ȁ㿘@"ȁ##(㿘> 0aДM㿘> 0aДN㿐 0"@?& 0##d#\> #`!(#P`$    > 0! @W1 0# c ,#d  > 0"0 @W ##h#\     > 0"` @W  #`   #h > 0" @V z#x @  #(#\ (   7,``%` #l#p#(#\ (    *,``%c@]"> 0@VƐ#@# @##$! ?c ? **` 2 2 * #$a  *&  @z0?>>>`""Ĕd#4\$$$$$ἐ $ἐ( @ | >>$< had>"p%`4%`8>>%`<%`@ #8 $#$ P"@@ #0"$ #�#$b?# ?*  *@2@ 2@ # #8 ? ??@ `$ e#0!/ ?#�#$b?# ?* *` @2@ 2@ #@#8    ? ? ??@ `$ 21`$#8 ,$#`P#$ " #$ T#$` "#$ #$` @>>" #`P%`4%`8???@ `$  "" ! @' @F !"@B "̠##>%>瀢``     2@#< &#<@J@] bP@+2 #@+,0D> 0"В@U#P> 0#@U#p #P,```# €c,`#| ,```# €`$,`##h€ ##h€  ##0 ##d ( 㿘 0@ #p , @` # €#, #| #P", @` # € $, ##h€ ##h€  ## 0 ##d ( ?@/?@M?@\@K6㿘# 0 #$!@?c ? **` 2 2 !@ ! @?c ? **` 2 2 ! @ !@?c ? **` 2 2 !@  !@?c ? **` 2 2 !@   @ B B< <  !@?c ? **` 2 2 !@ ! @?c ? **` 2 2 ! @ !$@?c ? **` 2 2 !$@ !(@?c ? **`2  2 !(@  @ B < #@ #@#@  #@#@  #@$#@ (#@ H /f * ' @"H 0#@*s 㿘 #?c?#`@?  **` 2 2 @   I d??2# 㿘##(H /f * ' @z@@` $    > 0#P@S H 0㿘#x  "# `  `(@ # € @$  #|#x& #& &㿘@*J# \6 Z ;`6 \@O"@*@X #l "`# `  `(@ # € @&`c #t#l#p$ $$ 㿘#$#@]#( $  C 2> 0#p@Sl I;# @ $`  , > 0  @ST# 㿘#$#@d#( $   2> 0#@S; I # @ @$`   > 0  @S##а 㿘#@ #$ 4?c ? **` 2 2  4@ 4` ?# ?*  *@2@ 2@ #  4  㿘#@ #$ 0?c ? **` 2 2  0@ 0` ?# ?*  *@2@ 2@ #  0  㿘 #   * :@`@ :# ` #h@  #   * :@@@ :@ 㿘b"/ h`@"* `` %  > 0a> 00 d> 00@ @ > 00         @RP# 㿘##$H /f * '  2@l #`@}@P@``   ?# ? *+  2` 2  $` #h?`0# ? ** @2@ 2@ #h 0$  ` ? # @ ? @ +`+  2` 3`  $ #h?`0# ? ** @2@ 2@ #h 0@ $  6?7#7 #$ $` @$` ??#$  ($+$#8`` ?# ?*  *@2@ 2@ $ $  `? # ? ** @2@ 2@  $`  #+ @   : `:`*` ? # ?*  *@2@ 2 #*@  :` : * @$ !` $ @"` 4?c ? **` 2 2  4 4`?# ?*  *@2@ 2@ $ # c`"@`!c| ?# ?*  *@2@ 2@ c|$ #@'(  \ @ ;6 \H 0 ##$ D#@" "H "P @"T<@ "X "\ "` "d"  " 0 " "((( " "("  "  " " @" 00"! @""""" "  #" "" """"" "$"(""#4''#8@ ? @?( @*`2 2` "  "? "((( " "("   "? "((( " "("   "? "((( " "(" 㿈 0'# '#$x'  #cx * ` *  #h @ #4 F c #? @  (?4`,  +?  *- 5`1?   # ,`.6@ . 6`@-` @ )? ?@6 5 6 @5 @  @  @    @   N# ` ``(@ #`€ @ '@x     '  B@J:`    $   *` C 2:$ $ $ D @;$ @T6  x ` ` O'! #'@`!#| ?# ?*  *@2@ 2@ #| "@ 㿘 #|#x {@ "㿘#x.`@ 0  @ ( (װ 7" "'#!   " #> 1  @NƔ> 1@M6 P `  `(@  #.` #4@D  #? 0   (?4`,  +?  *- 5`1?   # ,`.6@ . 6`@ @ -`)? ?6@ 5 6 @5 @  @ @    0 8`#4 GH,    ` '?  @(?4, /?  @ @*-51?  ` # ,.6@ @. 6`@ @ --? ?6@ 56 @4  @  @  @ H*    8@# `#h  @  |x   `  `' ' 㿘> 1> 1  `@Mp #$#$@$@ 㿘# 0 #$` ?# ? ** @2@ 2@ ` ? Ӑ @ @p 0א   @?c ? **` 2 2  @  E "U  @?c ? **` 2 2  @ <  `B =  @?c ? **` 2 2  @&  `# @?c ?*` * 2 2  @ #& @#!㿘 0\# @T#$@  ?c ? **` 2 2   ?c ? **` 2 2  !4?c ? **` 2 2 !4    @ @ 㿘> 1 @K` B> $? @? @*`(2 2`  ?"0?  @?(( @2 2` " 㿘..`$"   ?2 6 1?#'?" c$  BL  ?  **` 2 2 @``c> 1 @L_ 㿘.#?.`@@#$" `@@ ?*`@ .` 2 6` ?" c$  B @ ?  **` 2 2 @@c> 1 @L 㿘 0# #$#$A"@ 9 ? @?# ?*  *@2@ 2@ $ " % a   2 ` <?# ?*  *@2@ 2@ $ #$`#+ ( >݄d* $$ $$ 0 ? @? @*`(2 2`  㿘`# M#$$ $$ 0=  $085$ $  @  ?#?*  .@2@ 6@$`$ 6 $``@`T  $ @$ ` @$㿘"`(  `$ @/ 0 @"㿘@Ɛ""&`"&`㿘 H /f * '  ! "% \! 60!5*0 !6&+ \  @6 \ `#`4@ 0`4  @ 4`44  `4 @ux"@N 0`4  \ @ @  H 0X# 0 #$ 4@?c ? **` 2 2  4@ \ ǒ =a3 \"  b!3 \F`D`` "? 6""     @RR 2 2 *  %-@ $   ? c% !??  "  *  *` 2  2 #@` ` 4?# @?*  @ ,`@2@ 4`@%@ 㿘ct6`@+ 0,`#lcl "# `  `(@ # € @0$`B <`?&d #l @2#l #tc&\ ;4\ "4Z@ h`\ $@ @@#p@ cl*`' a܀ Naa 2Daa #p@cp''c* @  ''ȟ!̀ Ȁ 2a܀ ''@ ̀ c  ̀ Ȑ#l@ ,@ c&c €'`\$0`\a'̟€ '@y ''@r ̐a''ȟ€ ̸a܀ aa 2aa " `D   a a' a? a`D ''@5o c `  (''Ȕ @  ,''ܗ*''' c@  'c4`DԐ 0 ?  ?  @0( @ `*,` /?1?  ( @ ` # 5-.6@ @. 6`@ @ --? ?6@ 56 @5  @  @ @ ؐ 0   ? :ܐ 4 *      ,?@   c4@ @'? ?0(  #?*-?,, (4`  . 6` @ -5 @ ,`?6 !?@2 5@4 @   @ @  :c `  ch''ȟ@ К` 'd'''ܒ` ,''Ԗ`'؀ #'#l@   '@ cp@ , *`" " #@ c`c$?#? @ @ * *`@2@ 2@" p'@  0`Z@ *` "Ta0*'@ ̐a'̟€ a܀ aa 2aa     a a' a? a@('``B 8`м| HH HH  HHH H HH 㿘"`"D? ? *+ @ 2 @3 @ @ @ @ *`* 3` 2`D@?#??c# D ' #?!?@#"@"`D @**` @ 2 @ 2`  *`*   2  2 `D@#`D0@" D @**` @ 2 @ 2`  *  *` 2  2  D # D=` "@"`D @**` @ 2 @ 2`  *`*   2  2 `D@#`D== "@" D @**` @ 2 @ 2`  *  *` 2  2  D = # D y@"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`6 ""?D# @ *` @   D @ "`D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D㿘"Ī `"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D& >`"@  "?`D# ? ** 2@@ 2@ " D> 1! ` `"@  "?`D# ? ** 2@@ 2@ " D> 1ϐ!H """@  "?`D# ? ** 2@@ 2@ " D> 1!H`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D9 """@  "?`D# ? ** 2@@ 2@ " D> 1!p@D s `"D? ? *+ @ 2 @3 @ *@ *`*@ 3`@ 2 @D*@??#c D ' #?!?"@"`D @**` @ 2 @ 2`  *`*   2  2 `D@#`D9 "@" ""`D 2  2 @ "  D@ ""Ī@"@" D @**` @ 2 @ 2`  *  *` 2  2  D # D9g <"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ @ @ @ *`* 3` 2`D@ D"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D"`"D? ? + *2 @ @3 @ *@ *`*@ 3`@ 2 @D*@ D. 㿐 / .@  ʔ ` @ 㿘O?` g'@( " "x?. 00xg' h``8"Ē"&? @? ?? ` ( . 6` 0'@?` 㿘L?` g'@( b bx?. 00xg' h``8bĐb&? @? ?? "  ( . 6` 0!?`4?`   g"@( b b x?* 00 x g# h 8b" ? @ #?Ӏ㿈"耢 ' "> 1> 1> 1!!!@A 0r@_ m 2 @?#!?? ` @*` @* 2 @ 2` #@   2    2   " 8 > 1#\  #`!  @Af @M 05D  $  <D    @D   $ 0c 4 (_ ,"`" ?# ?*  *@2@ 2@  #!D@   ē* @? @? @*`(2 2` #gĔ ? *"%  2㿘 @bć/ b`@?@1?@.`(6 6`@ !'! ?? ? ?bij/ b@ ((@6 @0@ 'g?bb?1?(/ 6 7 &e  0@h> "?" 0' c  @ c x"*`@  ?`U>"t*` €2 `."``> 12> 1Ȑ@  (@Ґ@  ,`k@:@k2<`x,`k@:  +<`x"" @@X &2 /  > 1 "@ > 1"X> 1"p@@B @ @ >> 1 "@@3 #   : * "@"6 @  "*?2`# @* *`@*2 "("c  @ |c  > 1@"p> !(' 8"@ ܐܔ #\#`$`$ @    > 1 @?" 7("@ $`,ܖ؟   ( @ (> 1"bؔ@?ʒa 7("@ $@@  b#\$     > 1#("@ $` ؘ    > 1# b& > 1#8@? ' 7ؖb& b&   #@  &   $ $ @ۓ  ܤ"@"`&`a `. "(  "#"& 2" ""  "" (# 8"@ $$0؟" (ܰc c # "# *    *`  㿘!> 1@=#`" &@ Oc@!(> 1@=z#"+  2?> 1@=p# " # 2"> 1@=e#  & # "& 㿐'P"P#\ ( (   > 2 @>Ր Y  " € "P.` $"  @ߒ     @(`(@7 7&  @ &"  P  *' 7<(& &&@  *"P.`" 0 " 2 2 P`62 2 P04@? 8 x@" > 2 @< 㿐'P"P#\  Ĕ  Ę   > 2 @>f C  " € "P.` "  @p   &  @&"  P   7 Đ<&& &"""P.`@ 0  "2 2P `622 㿘' @9  D 7ސ @; 7:&& &<?`#> @h&6&H&@&D&L&\&X<#:&&H@d "".`" " b .``0@ "   # 3 3  3 3 㿐   7$  "耢 2 "Ġ?'`"??# ?*  *@2@ 2@  7? #%#6 㿘 " *`  @$"@€ $@", @ ` 㿐 V 7$  "耢 2 "Ġ?':`"??# ?*  *@2@ 2@  7? #%$#6 㿘" #` @A$" @  ` 㿘   7  "`"??# ?*  *@2@ 2@  7? #%,#6 㿘 b"  %`  @$"@€ $@" @ b`  㿘"z 6 "c   " @ " "@$@" &$" @ ; ` #   &"€ @ړ  2㿈"##<& #6 6 ) 7" € 70## "& "#\ c: (     @ؚ  "" !& 㿈"' ' 4> 2A 8"` "@?# @* *`@@""`"`?`* # ? ** @2@ 2@ ``*`@#&' 0``* @ '''% 0@<" 㿈"' ' 4> 2A 8"` "@?# @* *`@@""`"`?`* # ? ** @2@ 2@ ``*`@#&@'0``* @ '''ז 0@;Ԓ 㿐' 0'\ =a4\ $ "Đb4\!'0g@  "?%# ? ** @2@ 2@ "%@  @##%  n &@p  2   #+> 2  @ד  @9`P.ʔ $`&2   "`"?# ?*  - @2@ 5 @&%6 ? \(\[   @0*UUj"&6? @?( @*`2 2`Uj   / Uj⪀( 耠2#  \?c ? ** 02   (*` 2 0 \# \ 㿘 ".""` ""@"` "!@2``> 2 "!@`> 2 @: XҰ "`"@? ? + *2 @ @3 @@ @ @ @ *`* 3` 2`@@@ @"`"< @*`< @ @ > 20 ."  ."@: > 2  @:z "耢 2e""`"@? ? + *2 @ @3 @@ @ @ @ *`* 3` 2`@@@ @"`"D? ? + *2`  3  " * *@ 3`@ 2 @D" D"`"P? ? + *2 @ @3 @ @ @ @ *`* 3` 2`P@ P"逢 @ "@ "  @ " "& "Ę @ " " > 2  @9  b  b v"`\ b耠#b b \?c ? ** 02   (*` 2 0 \# \bb \?c ? ** 02   (*` 2 0 \# \bb 0 b  0`6b 1`"0b`+`0` "(b``@#bb ?c ? ** 02   (*` 2 0 # bb \?c ? ** 02   (*` 2 0 \# \bb \?c ? ** 02    (*` 2 0 \?# \bb@"&""$v"`\""@L"f㿘"Ġ 0"` @"""&"`"#0``? # ?*  *@2@ 2 @ #0`` #&  c`0 `"x@  0 `0 ""@ "c "" p"&("!6 @ 00  "* "'?""f,"#" # 6`0" ``" `"% 0  00 !<  0 ` 0" #:@ 00 !<  0 `0`" @  0"耢 20 "0   0 !< `0   0`"8 @ (0 0  0 "@`" ""`"h"z@@ "" `0  @0   0 !< ""`0 "0"耢`#z`0 !#  0@"`" " `` $@ "`"#( @ , ?c ? * *` 2 2 #( @  $f0"`"#,?c ? **` 2 2 #,#&4"`"#$?c ? **` 2 2 #$#&8"`"#0?c ? **` 2 2 #0#&@"`"#4?c ? **` 2 2 #4#&<"`"#8?c ? **` 2 2 #8#&$""&d""e"`"@? ? + *2`  3 ? c @ @ * * 3` 2` @?# @ @ pU  > 24 =I > 2 ( " u   > 2!@>)> 2@7 0"#\ #`> a( $# `   > 1 "@6 0" ,`ܘ؟  > 1"ؔ`@6 "!"##\`      > 1#@6В ""`   ؟  2ؒ` @ 8&" > 2!@@6 u #$&#( &#,'&#0#8 @& #4& &?>>> 0& 0`8㤘#Țc,!4\$$$$8$ $  `)  0"$<>>HT@`<"ꀢ " # @` ! # @`  & @`  & @`  0 @`  0 @`    + @` `+ @`   @`  @`@+@= "# " 0" ( ܁㿐"c  @ Τ 0 8"*@  : * #6`6c` : * "b6* @ "@ $ `B <ؐ"Ҕ 7k    @ۘ Đ`\`B <@+c` : * "b6* @  ""@  " d2  D 76 `B <8T"c` : * "6**@  ""@  " d2   7 `B <," 2 > 2!h@3 $ $ B<$ ""D  4 &4 D @! 8*   $ 4 $@:q " @ 7"耢 #"` "#?c *`* #""耢 2 "#@ '"` "#?c *`* #""` "#?c *`* #","耢 2 "#@ 'Ԓ0` "#?c *`* #"$㿈+" @c  0 H  " c, @  C , `B <"@ @$@" ` `(@ "€ c  $ & %<  ? & : * #6 4Z"  @+ \ ;4\㿘" @#  0 E  "  # #z*"  `*`B <"@ @p$@" ` `(@ "€ $ &%<  ? & : * #6 4Z" @\ ;4\㿘"` 0"`@2   " @`2"& ` @" \ @ "耢 +0f""% \`@  ! @7 㿘"  `" 0` @#$ @         <" ` #$ @ 㿈#c     k 7c<! ,"@ 4_쀥 1#,  +   ?? 0'`6` 777`&"77,   Y ,  !`, `"?#c ',  7 = ` ( @ ," c   $  "" c< ,   $ & € 7㿘)# @` b@   p 7#<@!,"@ 4db쀦 , , b , zb "@  "6& 6 6 6 ` 6 `&6 , `@ ! , , b@ 1#@ 0,b-z  `2 b `( @ b `#@  @ ,b" # @  $@  "@" #<, @  $@ &b € 7㿐#"*@ M'!܀  ! 2!!`B` "耢 ܔ €!@!@{! €!J 2= \!܀  ! 2!!`"  D` &!&!"`!?&! D `@̔ "* `"!܀`"#4@"?# ? ** @2@ 2@ $6 \#% 6 Z㿘H /f * ' @Y  > 2!@2= H 00H 0㿐"Ģ 0`" ?# ? ** @2@ 2@  #&\""`#>"`'ߒ"Ė"` ""?# @* *`@"""`"?* # ? ** @2@ 2@ *`@#&'"耢 2' 7> 2@0:!L"耢`2"""f#6@'"""%`\`@ {4`\  @$ $ 㿐" `  ` `>"*` €"`" # `# "H"`"2  `"L8"`" ! @! "H""fL %" @"H? ? + *2 @ @3 @ @ @ @ *`* 3` 2`H@ H' ""&H"`"  @ "L ? !"`"L? ? + *2 @ @3 @ @ @ @ *`* 3` #2`L `"L? ? + *2 @ @3 @@ @ @ @ *`* 3` 2`L@@ L !"`"L? ? + *2 @ @3 @ @ @ @ *`* 3` 2`L`"L? ? + *2`  3   * *@ 3`@ 2 @L L'y    "" 뀠n " " 뀠%6?h @? @*`(2 2` h ꀠ "DDD6?l @? @*`(2 2` l ꀠ@"@"@"@ """㿘 H /f * '  ! "% \! 60!5*0 !6&+ \  @6 \ `#`4@ 0`4  @ 4`4`4@0 `4 @Zp"@3  0`4  \ @  H 0㿘> 2 @/!@ h `B > 㿐 0`\ ;2`\""` @"@'wƐR"" "` ""`@" <#61L1\1l1|1112 2㿘`M   : ,@  4: ;?> 3`+  +`@ b * 2`*` B *2 *  `C + 3` ; 2`*  *`$ :@ 0`B :  2@  B * 2`@ , ?㿘 > ܐ . b̢ @ 6 > "l>cĀ  "l `@ 0 2` @V   @P  8 @j@ <@ T l@T 㿘 H /e`* &` ` @  `  @&H 0㿘> 0   G 0* @AH /e48* &8  @j "@$8H 0`t> > #8`$`$`Ԁ $`p$`t@b>  D # c$`$`$`$`$`  $` @` $` ` $`%$`H /e * &  ,`@@hC   $$$$ @  ,  , , , ,  ,  ,  ) ` %"? G ` ` , `  d, #  d, #   d ", 0    `, ,  , ,,    , 2 `t`2`t`@"`t`t $`t ?$`t@ i H /e * & ``t   H 0N <,. 7H 0? > "$`t`!@h " `t $`t ` @dH 00 2`t` @`t > H 0 `l> #@*` 㿘>  0 . @  0 8 l> c@* `@H /e4 t* & t"    < `. ,`@  t@ t ?$ t. H 0@W 㿘   8.  , , `   d 2 d. ,  d, " " d ,      0  ,  , , , 0, 㿘 8`` `t \   @  ,  , , , ,  ,  ,  n`Ĕ :  , ,,  ,  &` %"? G ` ` , ` d, "  d, "   d ",     ,  ,   * (㿘>  0 . @> 8@ l*` 㿘>  0 . @> 8@ l *` > 0* 8 @ 㿘>  0 . >  8c@ l`* @ @ 6@Z  ]@ "h `y@"/ `x@- 0`z@`{@ 0 k@ -  j@0\@V 0sl@m@ 0k  @ , ,`c   ,  @, ,`R  *@, ,`J *   `` 2`@ 2` 2a D 2` ` 2`/&` ` `2 `2 `2  &@   2  @ 2 2 2 2 ,  㿘p> `0 * `( , & `$`"``(@ `  # `@!   "# ```` `2` , , ,  `$@@ %, t +> 2 |`$ |H!a@f  | ??$ |t 2 |`,,= ,,  , , , "` 2 `$`,`$d ! ,0$  ,`,`@@   2    , , @-0), `$$`($`$   @  > lc@* `@€  *@, ,@  p> > " `0'*  H /e * & t C !2H  | 4D  @@ "; @dz H "5  t & t 2  , ,`    H p @zv  ,@ & @ 0 H @z" H,@H 0  , ,`H 0 > 2@*!H4 t( t" tH 㿐H /e4 p* & p& x t& p& tH 0  > 2"8> 2"@`2> 2> 2"8"@#\> 2b@( 㿘 p  @k 8H /e4 * &    H 0 0S 2&  &     & & & t 2 H 0 06@@    . *`H 0 #> >  HcT   "  p x `& p`& x T@ <   l @ * €@* 㿘 8   - @` l 2  *, t x `& t`& x T@ђ <0 ,   @ऀ@ . -  &  @ 1@ ` ` ` `@e .  2  l> c@* `@€    *@. -    @ऀ@ > l#@ *` € t  ?$t |`$> @H> l#@ *` €   H ` @ `H 㿘H /e * & `  '֐ ` ?.@`  'ǐ ` ?H 0㿘H/ / .`c.@: .` .`.`.` .``H 0㿘 . ,   , , ,  ,  d   2  "     .  . . . .  2 `,  `   ,  `2  .   `,  !,  2  ".  , ,  2  ,   Z,   `, `2  Z .  `A*`>  €> 2@(_"H0:> 2@(["X06> 2@(W"p02> 2@(S"0. 2  &  > 2"> 2@(E"0  2  &  > 2"@(9 `. > 2#> 2#(@(.  @`. & > 2@&#H@2     . &  ,   T, . > ax, @>`D <@> b( @s & l> 2#h@&p  ` & 㿘 L ,` ,` ,@,`,` ,` `  ',` ,@ ``  'Р'  `  ?  d `  'Р'  `  ? "  @@`  > 2# @'&  㿐> 2@'#`@ &`&aĐa&a&a̐a&aАa@  @a> 2c@Ȅaa>> \@>   !&``6`>6`R 6`P&`@ &`d`0'>@Ԗ &`㿘     x  `4 > 2 @#@'X  & , Đ@$`  Ѐ   $@!$`!"@$!@  & ,@u0@:!쀤!@`  %> 2 @ ` `@@[㿘` `  !@@n&` @0@I 㿘 4@  Ѐ   Ԑ $ ԰ @ΐ ā㿘 4@   А?`& Ԁ @G @ ā㿐?  2`>  @G |   -  @b Ѐ   $ @ > 3 ؚ`#\   @ @ @  @ @?@$ @4㿘?  2`>  @  |@9! a@4   !@a@% 0/ !@ !@ $  !@ 0@!@]@ @  @@!@㿘@ !Ā`@``"`&!`?@"$@$`@ Ā`2` ' #`  `&@ &` &`   &` $&`   @ h@ &`$ &`$&`$$@!$`!"@&!а 㿘!̀  @     2 2 1  $`"@ (  @h8@ 0      ` ` ` ` `  $ 㿘!̀  @     2 2* ` "`&! ?"$$   $*F" "(` " ",4      ",4` ",x 㿘?  2`>  @ |`A   @!Ā 2@L `A@8!@㿘?  2`>  @ϐ |V`?> @  &`8!&`<@!&`&!@$@ؐ 㿘 <!@֐! $!2? "& @ 㿘 < @!Đ @@ 㿘?  2`>  @ | @ Ѐ "  > 3> 3> 3 `(@@#q"%& @ؐ ??@ !̢ ؠ? `"`&!""" " , ΐ!̀2!Ā" ? `"`&!""" " , !Ā2 ??@ @Q Ԁ  !> 3 Ԕ  `@  Ԁ`@@@=@~& @2 㿘 @ݒ  !&  $!& 㿘 @㿘  @  &+d> 3 +p #> * @*``@` @  &+h> 3 @$w 0i+.` @ +&+  ++ "@ +p`*` *   € L ? 2 $ 2 "" & ++ @       ` ` ( 2 "$"#     ++ "@  h> "'\  +M?>>  0`  @ $`$$`&- ?$`\ .$`XА@A @ỳ ,̒ `@? !`h@H  ̤?$`` €?" ("2?   @?> 3 @#`?" > 3@W!㿘?@2 `@6`2` @Dz` > 3(@#`a@!D  > 3!0@#z @D> 3|!XВ @#q7D2\>@0@H@ ے 'xDHx't@ '''|?'''''p "p'@܄@Đxh̐!2 @G ִ D @"㿐 > 3!@#&`0\#\㿘+p  > 3!@#`0  @- +  \@, 2 @ z \ 2 \+d@ s @ߒ  㿀> "'@ @   $ < ( h $ X@G0  86  (`2  ,(  ( 2 @  (8  (2  ,(  ( 2 (`< 0 2< 0> 3b d !@" b > 3@Q"8㿘+d ^ c r a m M A R C , , , ,, , , , , , , , , , , , , , , , +l 2 2 2  , , , , , , , , +    8 !* "*`@ *  # @ 0,` 1* 2* + 3*` @ 222** **`H@# H`@& 0㿘@`* `**``@  > 3@ "P㿘H /d * % @  > 3"p@" `&+|H 0 +d> 3"+p> * * `   @ 2 > 3"@!` `"@!`h $`X 6` * +  (  +` * * ` B 2`2`2`2 2 2 6`6`,,,, ,,,,,,,,  !* "*`@ *  #  +,    \ !*  "**` #@   \+t`))@m)i`) !* "*`@ *  # + +,  `X4 4 4 - $- %- & ` `@K- '`\ t> 3   !*  "**` #@  *+,  @ x, '@'@%  㿘  @R +p*>  * `    ` @A + ` X 2` \ \  % X} \ ` `*  `* @+` `@ `+  `*` @ * ` PT "C2e ܘ!m2`  \@h a?+d<  7 \ `  `!* `"*`@ *  `# *@ `(*` `)"@ `*+ *  *`* `+` \ @ )   @Ր))+t$)&+t,Ā€ " `(p `( `)*` `** *  `+ @ ܒ  2s X@t @o `> "' ܖ +p> * * `     > 30#* *+`@ + *` @ * PT "C> 3ܘ!m> 3#0@& ``@D  > 3#X@ 3`H * *`@ *    . > 3x .. . X@ J **`@ *  #  P.... > 3#`@  **`@ *     .... > 3@#> " '@.ؐ?`@ 2`2   ?#  ` ,`@ * @@o4   > 3=##>`04  @? 4e X`e @t?   4@?04 @? @4`@4  @ 2-> 4   @  ) > 4 8> 4 h@ ` %@%kp ,~X `2y?@2  @?@6`# @ `* * @4 ؠ`04  @֦? 1@m > 4 @L !   *  * +` @ +  *` @ *  PT "C2 ܘ!m"   4@օ?@4(8  4  24  @. h$$& 4  @^?@4$,`@ߒ @ڒ > " > 4@ 8> > " `'  ' ' 6 $  ```@ 2``2  @ߔ  "X $"@"`  > 4a@C'   > 4 a@C   " $ $Ĕ` `'  @'`   2 ?"$@ `4 `5*  `$+  `% `6*` `&+` `7*@  `' *  @ ?$@ $@{' `@B>  2$2J  ( @u  }> 4 `4` `5*` `6* `7* @ $ `0 `1* `2+  `3*  $ `   `!* `"+`@ `#+   $$      $    ( 2 $$$$$% $      @ @` `   @ @( 2$@$ $@$ $T @  2> 4!@ @   > 4!h!> 4!@Ғ k?2$ 2$  @  !  @ @$\ @Bh `< `=*` `>* `8 `9( `:( `?* `; *  @    ,,<,,,,,, `< `=* `>+  `8 `9( `: `?+`* `; *  2`2`2`2 2 2 ,.,(,,,-,),*,+,/ `< `=* `>* `8 `9( `:( `?*   `;*`@ 3`,43`3`3 3 3 ,5,6,0,2,3,7,1 @A`8 H@) H ,[ D,X,Y@,Z <  D& < $ 2`$"` L `@& L$2W '@ (?? "$?' 4`C` !  `@@ݔ  2@@'@`` ?  **&@ : `"b+ `  `$ `%* `&*`@ *  `' ,?$@2 > 4! @Ƙ? , ` `*`* ` `* `+  `*   `*`@ `@  @ 2!@@  (@@,& ` `+` `+  ` `( ` `(*` `@* @ @:@`2 `$@"> 4!@}  7*`7'@ '@ Ȕ @$'$2O "'    $  @D 2@>  2 `   @@2 2@ ' @' 2@ `@ >  > 4@ސ"@!> ">' 0`\X  `e```e @ט? 2?,` `2?   @ B }C? 4>`?`">` " > 4@"X㿀> "+ ''H @    ?  > 4 @M +  ` `\@ > 4  *  * +` @ +  *` @ *  PT "C2gܘ!m2b $` %*  &* '*`@  &$`     * +   ( * * ! " (+` @*`*  #@   0 @?L  6> 4 *  +  *   +`* *` @   "`   2 8`  ``2w`\`  > 4""p"@4`> 9`4 -> 4`\`> 4@"@: p@` *  * +   **` @ *   @ `+-  "X`Ѩ  @ܒ > " > 4@#㿐#\   㿐#\   㿘> #@` @``2@  @ݐ "@"`#@"`$#@㿘> #@ !2 #@   $#@ 2? "#  @ #@ "$#@0 2㿘> #@  lt    2  㿘> 4c(@o`4> 4`D@kc0> "#@!>&`<@ٽ#h "#h> 4#@@a`> 4&`0> 4@[#h>> `" r 㿘 <@ 4& <@㿘 $8  㿘 "& ,T ",`  * @*`@,h*` @F &,T&,X,X&,\  `@ @R"` ,h,`@*,T 㿘 ,X",T?Ȁ`"`&,\"@"",X2,T @ܒ H4,X(,X``Ȁ` ",\`̆?`""`"`̄ "`H  `H(?"`"`"`"`"`\`"`\ "\H 㿘 "% ,d ",h  , "* &,@ &,d&,x,x&,|&,,&,&,,  &, ,d@ @S"`?`x 㿘 G,x",?p`t"`t&,|tp"@"p"t,x2p,",?p`t"`t&,tp"@"p"t,2p,",d?p`t"`t&,tp"@"p"t,2p,d @" 㿘 H /d * %  l  > && & (& ,& 0& 4> & 8& & > 4#p@` < < p?Ȁ`"`& @"@""7  <2& @& <& p,|& t,|"@$,|,,?`$,> 4@^#@>,H 0㿘H /d * % ?,x ` p` t"`t$,| t p"@& p& t & , $,> 4, $, ,@֖ ,$,H 0㿘@ِ㿘  4 X* @` Ho oTH 0 `2 k> 4#@w`k  > 4kd#В@wpl` 2& , & ,ǒ0z$       % ,l,l,l,lM,l  %";l 5 "+l  , 6`0;",l  `03!`00"!l ( *`0&" l `0`0lܟ@ `0/lll@  `l@ `  lȀ   l& , 4 ] @w  & ,M㿘 u@  v@ -@ 4㿘@m 40" @1 0"%@ : 0b$@Jb#@*H 0F"'@5 0A0 "&@* 0"(@.0 "(@. 010""@ 0"!@  0'@)#@K@@z@ @6 @W@u @2 4㿘X   + @  +d  !*  "**` #@  @ + `@; L &`L@&` 㿘  ?* X 2`P&` d < =*` >+ 8 9,` :@ ?, ( ;(@+ 3`@+` >`d 4 5* 6* 7 *  @&`d !* "*`@ #*  &`d 4 5*  6**` 7@  C2` ଀  &`` 2Kdd *` * <, = ( +  ,  >( 8 9  :+,`+`*  ?@*` ;@   26``(6`e+ 3` +`@ B * 2`*` B 2* *@ c" 6`d` `p@: d`0`@$V* <  2 &`  (* 2@ * ?>`  &`&`` @:ޔ `0@:ڔ   㿘  ?* X 2`` @7 T+d !* "*`@ *  # ` ++@26 < 4 5*  6**` 7@  C2) < ` X&`(` 3`+  +` >`6`6`* <&` (` 3`+  `+` >`6`6` @:|    `@ 2 ` " X㿘`   ^ ` ` @U ? X *@`2`2 C "9`   > 57`8> 53`+  ` \  `\ 2  2,> 5 @Ӓ 0  ʒ  > 5+d  @Ôp0   @  H@  X  + @" d ` `!*  `"(( `#:  딅*`\  *  +  <`"  `\ 2``X`2`\ 㽸> "'(ۖ     ' '  2> 5> 5 p `@_(%`@$ > 5 @T``> 0$ @̘? $He`e` @?   ' $@̔?@!$ ,  " > 5 ؒ`@'(耧     @ B @   @6 ' \$(' ` @9c hF66   66 ` 6 6// / (/ ? / -/ 5/ / / / / ,/ ./ // (/ )/ */ +/ 4/ 6/ 7/ 0/ 1/ 2/ 3 @94  8:  H@ H / [  / X/ Y/ Z@  c r a m M A R C.........  .. . ......... . ..        .3.4.5.6.7.1.2.=.0.<.>.?.8.9.:.;. .!."> 5.#a @8ې@!> 5> 5!H@ > 3 xX@   @-!$@$kd$kp$lP`@8 $kt  @ $k"$k' $k_  > 5 `@Y( `D@`< '  '`< 2`' "``L`@'`L' @% ` `k `@ `@ @ ` > 0  $@|?@ $> "  > 5@ʐ! 㿘@㿘+d !* "*`@ *  #    +, X`" *,2 +d> 5!0`@p0@w D <` <`  ``"`4```@8``"> 5+d!X`p@`h 3> 5> 5 H /d4 l* % l  @`, , <`  p`" `Ȁ`2`2 < <`  p`" `Ȁ`2`2 5c`@ᗒ w$  > 5!`@dh8H /d * % @ 4`\@*  2`L?"`L` %2? "$`@  @ 4H 0@ D> "   ''0 > 5F",P  > 5?"H > 5+d"p@ p'+d !* "*`@ *  #  ?++  X`2 (     *+ > 5" @ @x4 > 5"@Ғ> 04 @? "@4ဦ84e`e @}? Դ , > 5 ؒ@ɀ̔    @ B D44`@ 4`, @> 5,` "@4 d2`* @ *` > 5# @}Œ   ` " +d> 5 @j+d-* * * * * * * * +5@ 5" \+54 @ "` @ `+` `+  `* @ 3`3`3` -- - - - -  - @6- 444444- )- *- ,- -- .- (- +- / `4 `5*  `6* `0 `1( `2 `7**` `3@ *  3`3`3`3 3 3 - 4- 5- 0- 1- 2- 3- 7`8- 6 8d  H`H@,   > 5 @ +d> 5p@#P>* @&,p'0 > 0  4@9?@4> " 0> 5@뇐#x㿘+ +> 5h@63   @c@6  朗 h> `b '  <   @  `` .  ``  @-> 5#$$t @4  $`> 5#`@ѐ > 5#` 2 @ $,` `@&,`P?$p> 6֐ ` 칒 > 6p 8@H 0`   @q  > 6 @6 `d @A > 6@/ p0 > 6  @/4$P`8*`d2`2`*7*6*4*5d *`"*`#*` *`!dg`` 04@ 2d> 5 a@5K @d> 5 @! Hd> 3  Xx@ `  `V$l.?d > 6 p@ْ l q@  > 6 @ʐ `d @Ր > 6@Ð 0` 2W( > 64!@  > 6 @ `d @ > 6@!@0@  "d5d> 6!xp@ d 4 5* *` 6@ 7* ` > 6!@~ 0@  2 d * *  *`@ `    2 2 2 ** * *d *  *`*` @   2 2 2 ** * * @P 2 d> 6!ؒ @4p0р`"j@44>   $@4240$<$D@ '̐@  H/` /& TH 0 >@o H/` /& TH 0 >  p` X`$ 2`` * "  `@ ? ,``2 `@ ,`$d4 4 4 * 0* 1* 3* 2d p@4 /0d p@41  > 6d p@"d4 4 4 *`1*`3*`0*`2d p@3 ې@ِ > 6"H @  $Hhd* 3* 0* 1* 2d @3 p@ # 퀐> >)  D@nP`$>* @^ $tД͖ > 5# @c@p`#" " > 6@"p㿘   , X `+d p@3 2  d$뀔 *`*` *` @*` 㿘   , X `+d p@3 2 찀€㿐     , X `+d p@3l 2`d *  **` @  "> 6"@```@~` @z ~  @`` n``  ! > @` ` _`d !* "*`@ *  # ( 딓,  \#\ ! 8 \#\  P 1d !*  "**` #@   ܚ `  ` *` `* `* @ `2`2`2`+`+` +` +`o  > 5  @i h `> 6"> 6"@` ` `@B @= 㿘`@ > 0' `   @  `@ř?@& `@  `2 `&@㿘 9,`@+ "+d@  +d "+h@ +h "+t@ +t  X)@  2) @  $@*@ $@ @1G-@ߒ 㿘 JGH /d * % +`&,t> @ @/+#> 6!> +x #`+|  +x*`" * @b #2+x@+ "@S i+`  @ H 0㿘` `` ` 0`C" 0@$ 0@  0@    @   @ 0@oP%>  :' @   //////+d`@@1 +d`H@1 +dВ`X@1  : > 6@" `> '"  'd < =*` >* 8 9+ +`*@  : ?*` ; Ē@    G? % Ȑ@띒  ? 2 2 2 ////ː /Ē///% '> В @끐7`/ / 7`/ 7`7  /֣7 7 ////////ڒ///۔  > " > 6@敐# P    p **** *     p*****Ր 㿘  ,Ȓ`4@/    P" P    P 㿘   `?H /d * %  $+x+x%> 6#> , c`*`"  @ڟ #2, $+xH 0@Đ㿘H /4`l* %`l  > 6#(@ ʒ``<  &`l@Ō Ȁ &`lH 0㿘> !̀` > 6c@@    p& p,& t,"@$,>(+`( D@= 㿘 #> 6@ cP  $8#> b'@@@Mb > 6@廐#X㿘@J    ` ?`@ . . h > 6 #h#     #\ #` #d #h #l #p #t #x #|@ #`> 4@ ϐ#h㿘  X, @   +d+d`@/      ,  !  ? 2  ?㿘,l ` &,p!> 6 #@ٽ ,l` 鐒 㿐'D  kd' * *`@ *   > 6@ #lP  $ 2 @> 6J#؀     *  *  * I 4     - /`+`(     5` 5- @@ @ -`4,-@, @ @   @ > > 7@ `@ pE   *  *   >D;  $;`  ;` BDB:  kd < =*` >* 8+` 9@ :+ * ? *` ;@    2'D`$( '   ! (l(l(l(l(l㿘> !̀` > 7` @ , @5  @4+t2  $@8$t  @4t2&  $@8t& 8  p88 28"8& p,& t,"@$,,`B  <, @2  㿘@l >* @2 > 7 8@ > "'D''̒kd?' < =*` >* 8 9+` :@ ?+ * ; *` @  ''  BD4d, < =*  8*` 9+  >+` :@@ ?( ; *  <? `E + 3`@;  इ* ॥2 ঐ ࠟ+ ࡙+  ࢘ ৣ,`, +`@ @ ࣓*(@  e?F+ 3` ;   ̒ '|Ā  ̴  > 7 h@ '| ]Dkd  *` * <, = ( +  ,  >( 8 9  :+,`+`* ? @*` ;@   ) `('> 7e+ 3` +`@ B * 2`*` B 2* *@墖 c" > 7|@ > 7|@ (> 7| p@ D "ll  @@?'p 'd'x't|'   Ā sD   ?Ā?@ D  '> 7 @̒Dy  '> 7 @d@ƒ |x@Ò 4`,  'p4`', 2@ '24`, '  /2('x'*  ''''/4 4 x4 //'/////////'h'l'  d D"" @?X ]t@| |@y  /'' ' /////'X'//////'/ t D"" ܟ@ 3 "" 8H /d * % D"`pD"`t`p"@" qH 0 `` 4 4 4    > 7H @  `"> 7 > 7X̒ @ֳ XVDkd* h* l* p* * * * * Dd ` `*  `* `<, `= `( `+  `,  `>( `8 `9 ` `:+,`+`* ` `?@*  `;   `e+ 3` +`@ B * 2`*` B 2* *@. c"   DĀ D%  D> 5+d` |@p'Dp 9`B ?   Ā D d* * * * * * * * D+d !*  "**` #@  D+ k`X2 D   Dܒ  D> 5d` |@Ԕp@ D @"l㿘+ @, +d  &+&+Ԑ+`p@, ++@ P   >-`X@] $ P@G 㿘,H @+㿘 X           .`"`P" D D " D D D88 D888888``.`㿘5>-7>-9>-;>.>'>'>'>'>(>(>.!>.3>.#`!chؖ  lb4 <a,  &,& &,h&,&,&,&,&,&,&,&,&,&,&,&,. &,㿘B> 7`a@+ kd *`]*`_*`\*`^kd \> ]*  ^+`@+  _  2  @k 2`2`2`2 2 2 , ;, 9, :, <, =, >, 8, ?kd@ \ ]* ^* _ *`@ @=@ .m $l` 㿘kd@ \ ]* ^* _*`@ @%   !*` "* * # @ K*`$l`㿘   $ 2쎐 2+d \ ]* ^*`@ *  _ ?&  㿘 " ,욐 㿘H /d * % +.`@ X# "" XH 0+.`@> 7+d!`p@,@>&+|L  @r H 0x+d  !* "*`@ *  # ,P#?6# > 7++ @X` *`+dp`@@    #@ ؐ @ 2+d ( &,P+d> 7!`p@x@> 7`' 2 d `\ `]* ` ( `!*  `^+  `"  `#+` `_*@   - 5`   ??أ-` @Βب@)  Bظ  @ @ݒ@᭔d@B * *  *`@  $  * @ : E b4 2 :  &`4-`X2 Ő z- 5`  = ; >/ @b># 0# # <# 8# @# H# 40# p# ,#  0(@# 0#  \# D 0`` # `p "`p# # `@ # `@"@d'&`@جEB2 `4 (`4@`4E  @e4`2``H /d * % o H 0  d> 7"(`@1p 㿘  @H /d * %  0(`> 7  "H@ 4 , `$ , & l   (> 7"@s &  0 $ 0 ( 4  N$ ( , 2Q $,$(l . ?2' p p` t"`t$l t p"@$ t$ p 8  "  8 p` t"`t$l 8 t p"@ 8" t 8"`p 8 ؀ > 7"`@낐kx l @H 00 k$,H 0TpàüÌ,ŤXXH`Ƞ``ȠH㿘7>09>0;>0>0>'>'>'>'>(>(!>1#>05>1ᴸ"0bl⸐ ahؘ `l"|bp   &,. & &,h&,&,&,&,&,&,&,&,&,&,&,&,&,㿘> 7bȐ @( +d4`4`4`4 4 4 *`;*`<*`=*`>*`8*`9*`:*`?&,`  +d !* "*` #@ ( #,`㿘    j 2Ԑ " 㿘 " ꂐ 㿘H /d * % +.`  X I &+ >0  €`/`,+``%+` +`` &,p``"+H 0+.`@+d> 7"В`p@#+ "`X,€ >&+|L  @ܡ H 0x+d  !* "*`@ *  # ,P"? 6" (> 7++ @X` *`+dp`@@    #@ ؀       䀢   ܀  > 7@Ɛ#((>0 @ ! ' 2+d$    2+d    2 +d     +d> 7#@`p@  &,P>   @ 㿐 > 7x 2 d * +   +`@  B?   d !* "*`@ *  #  @& 4 "d  >2$`0$`bd @$`0$``0 $`0><` $ 0$`< $$`8 $$`@ $`4$`H $`p$`,$` (> d ` `!*  `"* `#*`@  @㑐 $*@`X`>0 ԓ*` €`0 $`03$`d  !*  "**` #@   Ц> 7#@`轐h -`@`X``>0 *` €`0$`0 $` 4& 4#`* `\$`D@ `0 `@ $`p "p$` l 2$`> 7#@Œ` @`$` @"@& @`@aH /d4 * %      \ H 0  > 7#`@p 㿘  @H /d * %  0(  , $ , ? & l   (> 7#ؒ @h &  0 $ 0 ( 4  $ ( , 2($,(> 7  @ސ# l 2 <@> 8 @F`$ @$ < $ lܟ@ o 0e > 8 @Ð 8 e$,$(l 5 ?2. p p` t"`t$l t p"@$ t$ p 8`!  , " 8@\  8"  8 p` t"`t$l 8 t p"@ 8" t 8"`pL 8 р2 > 8 h @   @  $ @ːkx<@mkx l @ѻH 00 $,  $ @ѫ0@mH 0㿘 )> 8 l 2 < @` <?Ȁ`"`$ @"@""`  <2$ @$ < $ ܟ@ " 8> 8@ 2 lԘ|Ԙ4XdؐHؐؐHd㿘9>3;>4>4>4>'>'>'>'>(!>(#>5%>4'>4>4#`ଐ!8`h#ؚ`  l`Ĥd   &,. & &,`&,h&,&,&,&,&,&,&,&,&,&,&,&,&,&,㿘;   2 > 8> 8`Ȑ @% +d`А @% +d * ]* _* \* ^+d \ ]* +` ^@+  _  2  8 @ 2`2`2`2 2 2 , ;, <, =, >, 8, 9, :, ?  ,h2 㿘   ڐ 2D 2+d \ ]* ^*`@ *  _ ?&  㿘 " P 㿘H /d * % +.`   X D "`  `0  `0&`#   `  ``6 H 0+.`@+d> 8 ؒ`p@ "X,@ >&+|L  @ H 0x+d  !* "*`@ *  # ,P"? 6" (> 8++ @X` *`+dp`@H@    #@ ؀@  @     䀢   @ > 8 @)!0&>3"@ "(&,P    2+d&,P   2 +d&,P   " &,P+d> 8!H`p@&,P@'D > 8'' ' d ` `!* `"*  * `\ `]( `^+   `#* `_  @  '?Țć8 ' @*  $2` * 2@ 'ؚ''`: ;* '''`  'U '> 8͐!D  : Ĕ@ȰؠB  @@ @ٔ Ȇbd@ `B `* `+  * `  * @ B   2@!  @Ӓ`@G @ g4 5` 2`5` `D 5` D- @   = @ڶ@D;`@ڭ@ВB?@ DB : ,`+`hL X`@>3"*` €#\`#`Dx#d> 8@! @"v @" ( ;`#hD#\@Ś  = X T> 8!@]` X @9 C( D#\#`#d#h@ zD#`#\#d#h@ m#\`#`#d#h@x ]#\`#`#d#h@i OB@c??@'H /d * % 쀢`D D:` ` : @"#@"#`8"pp,"t,"#,D` `    DH 0 쀢  㿘  @H /d * %  0(> 8 @! , `$ , & l  > 8" @  &  0 $ 0 Ā "  H@^ < " ( H@n& H ( 4  $ ( ,  (> 8  @p"(㥐$ < <$ @ $ lܟ€ u 0k > 8 @]"P k$,"l$,$(l 5 ?2. p p` t"`t$l t p"@$ t$ p 8`!  , " 8@_  8"  8 p` t"`t$l 8 t p"@ 8" t 8"`p 8 р2 > 8" @   @ $ @b kxӐ"kx@i9kx l @OH 00 $,  $ @?0㱐@iH 0㿘  < <?Ȁ`"`& @"@""  <2& @& < & ܟ@ " 8> 8@(" 2 <㿘 \`  ` d@ dE?$ $ 0$ >6#Ԓ @$ 0$  0  0$ 0 0 >$ 0< $ @$ H$ <$ 8$ 40.`$ ,  \$ D  0`` $ $ p`p "`ph$ $ $ $ $  @ $  @"& @ 4 & 4 㿘 %)> 8-> 8'> 8+> 8  `@I"`@DȢ   Z .@9Т @4bؠ : @"` 㿘 @8 㿘@ 㿘   (` ` lh?? kX8>8>9>>>?>?>@>';>'9>'7>'5>(3>(1>@>0>1c! l(c0 Оa#hش `l!p l l l l l l l l l l l l l l l l㿘^   @)"+t")&+t +d& ( )*  ** +*`@   2 2 2 *+*(*)**& ` ?@ڒ 7` @ 1&   & ` &` & #@Ē !` > 8` ?b @֐ +d4`4`4`4 4 4 *`<*`;*`=*`>*`8*`9*`:*`?@&,` 㿘   4& ` " `@ +& +d```$`"`y(P  &`  #@x +d !* "* # *  @&,`㿀'D   'H'? H /d * %   @N'䀢 'ax@G 耢 "H 0 "$"@  $@ "@`  M$ "@    *  *  * A 4    - /`+`(     5` 5- @@ @ -`4,-@, @ @   @ ?2$  *  *   ?$ H`:  @ V+ 2  M* *` >  2$ ?A $ & & ( < 耤 p& 4",  $$ $ $ $ ` * *`@ *    0!$ $  @$  `B ? 4 ֤0AH 0 @耣 D@ @  @ H /d* %耢 `@e!x耢 @_H 0 㿘8`4   @Ԓ H /d * % @7x@4H 0@㿘     $ "4    . @ݔ  $  2  @2     ( (`hP  " j@   &   @@ 㽰  @U!  : @@@v @ ?@!㽰  @B!  : @@@L @ ?@!p'> '@ 0@׽ В `@׹@@,@S@ @6@:@v @s @p ` > 8@ѐ"x>  " ' P Q*  R**` S@  ( "@ *` *  + *@@ P(? ( )X@  @/(*@ *@@) @& " > 8@҇#㿘  "@*(**@7*  * * * *  *@ P * *  +  ( *iS*iP*iQ*iR  )XS(@(  * * * *  x>  " ' P  Q*  R**` S@  NؤP( @ G`  * *`@ +   (?3 ( )X@%  '  P * *  +  (?"@ +iS (+iP+iQ+iR iX뒔  (@}@ @w `@t @q b > 8@Ґ#(Ю> 8"' p T      > 8#H@`@4 > 8#h@ `> 04  @3? 4Xe `e` @?     4@0?@4怦 ,    > 8#@Ôـ  @ݐ & \4& ` @  h  > d4 5+`6*7 *  3 3 3 . . . .. . . . . ,. -. .. /. (. ). *. +. 4. 5. 6. 7. 0. 1. 2. 3@ݔ d 8   Hh H  . X. Y. Z. [@   m M A R C c r a,` ,`,`,`,@,`,`,`,`,`,` ,` ,`,`,`,`,`,`,`,`,` ,` ,`,`d` ꮔ        ,`0,`1> 8,`4,`5,`6,`7,`3c,`2 ,` ,`!,`",`#,`<,`=,`>,`?,`8,`9,`:,`;@`@!> 8> 8Ȗ#А`H@Z > 8 ؐ`X@T   @>-$#$d$p$P@i $t  @/ $"$& $@@5 ,`(,`),`*,`+  @) %@`V t%i$t   > 8#@ @В  `@ʒ   @ @ `@  > 0  4@"?@4" > 9@r > 8"' '4   ` `> 8]#H@:4 > 8;#h> 04  @۔? 4Xe `e` @F?     4@ؔ?@e4,` > 8# @lv  @ { > 9 (@Z dҖ \ 4 5*  6**` 7@  ?> 9 ` @?I *@闔 B   @R %\4  =%`醔 \  !* "*  *` #@ (+  ) * ** * " *` +@ *   @  * *`@ *   €`@ ) @ܒ 4`  > 0 ? @D @4 > 9@ϔ `> "' > 9` #\   @뿘 > 9   `#\!x@붘 *`?? ,``@`;  2~ v w  p @ $  ' * *`@ *   "Y !'+d < =*` >( 8,  9 :+ ?( ;*`@@ *2  9 @2>B,`b@ ,`*`'Ԑ@  ` ?2,`?" ,`@4`??,`; ?,`    @(Փ,`>Bh`l b > 9@ 㿘 2 <  >B@o  @ >B`le*` @? `?,@@@??,:@ ?,@  @{! "!@ !̀ " @ސ!x > ` b 'p8H`p`8B`8? (P "8 7``81` -   (p`#t   Ӕ x`|  Ɣ   Ҕ @ @ݒ @ڒ " > 9@; ؁ @ `( `* ( ` `" 㿘 @ %4  2>@> 9@Ґ !$ @$ 8H /f * ' @   ,H 00@% 㿘 ,  8@ "`,H /d * % @B 8H 0@㿐 > 9茒 `+d  ` `+  `*` `@ ( @ C ?& 4  +d> 9!`@p``>A @# 0# ; `$# <`$# 8`$# @`(" `4 0 # 0` # H 0# 0@# # H># 4 0 # ,# # +`\# D+ 0`` # `p "`p#  l 2# > 9!8@*` @ #  @"@& @H /d * % ΐ ^H 0  &`, 㿘  @H /d * %  0( > 9 @x!P , `$ , & l   (> 9!p@ؔ &  0 $ 0 ( 4  j$ ( , 2$, $,l . ?2' p p` t"`t$l t p"@$ t$ p 8  "  8 p` t"`t$l 8 t p"@ 8" t 8"`p 8 ؀2> 9! @(&, " 2>A> 9@!& Đ#"@"8H /f * ' @G H 00@ H 0㿘 > !̀`> 9a@l $( l 2 <@> 9!@H`   Ā "  Ȁ 2 ْ kx l @㿘 ,  8 "`,H /d4 * %  H 0 h㿘@!>'>B>B>B>B>'#>'%>''>()>(+>C->B/>C>B!`bT8!chئ  lcd⠐   &,. & &,h&,&,&,&,&,&,&,&,&,&,&,&,&,&,㿘6 > 9b @ +d *`]*`_*`\*`^+d \ ]* +` ^@+  _  2  8 @Ή .2`2`2`2 2 2 , ;, <, =, >, 8, 9, :, ? &,` d ` `!( `"* ( `#(* "` ,h2 㿘   Z 2Đ 2+d \ ]* ^*`@ *  _ =?&  㿘 " bА 㿘H /d * % +.`   X D "`  `0  `0&`#   `  ``6 H 0+.`@+d> 9"`p@ "X,@ >&+|L  @ʅ H 0x+d  !* "*`@ *  # ,P"?6" +` > 9+, @X` *`+d"Hp`@ǖ   " ؀@( @#    䀢  @> 9 "h@4   %> 9+,  X@) &+> 9@"`(>B t@ ! ' 2+d$&,P   2+d&,P   2 +d&,P   " &,P+d> 9"`p@d &,P('D > 9''X 'd ` `!* `"*  * `\ `]( `^+   `#* `_ @   '?Ȓ  8?' @̂ *  $2` * 2@ 'ؚ''`: ;* '''` '׿  '> 9"@`D  : @^ȸؠB @r @@A Ȇbd@ `B `* `+  * `  * @ B   28@̊ @C`@̀C B? bB?АF??Ѐ@  2ԀD 4` 2@DD4` D, @   < @ @fD;`@@]??BB?@ DB ;`  / k-  X " $ "   @`А Ԁ@  `@2`= ` =  Ϙ  (1` `#\ #`D#d_> 9@ﮐ#> cH@  @ (#d#`#lD#\#h#p@  `/C  @"( Ѐ Ԁ@ > 逢@" H @ ` ( #p#`#d#lD#\#h@  =  ϘJ@ ̐ G؀`> 9@L#0> cH ( @ @m > cH @@r ' @%#\#lD#`#d#h#p@ b#`#l#p D#d#\#h@ P `6B  @"/ Ѐ Ԁ@ &@!> 逢@" #H @( ` @#p( #l#`#dD#\#h@c  =  Șŀ@ Ő ؀`> 9#> 9#> 9@Đ#`@   B @" @" ( ;`#hD#\#l#p@# ٨ =  ޘ@ ې ؀` p k > #H@ @ @o @@u @#p( D#\;`;h@ #\ D;`#h#l#p@ۚ D#`#\#d#h#l#p@̚ #\`#`#d#h#l#p@ p#\#` #d#h#l#p@ ^#\ #`#d#h#l#p@ N@Bb?? |'H /d* %쀣` D  ;`D D;` #@"#`"8#`p`p,#`t,"#,D` `    DH 0 쀢  Ԍ㿘   & p섔 p& t"@" < "  @  Ȁ  㿘   @H /d * %  0(> 9 @틐# , `$ , & l " > 9# @ &  0 $ 0 " H@_ < " H <@b@I &  " ( HB& H ( 4  $ ( ,  (> 9  @D#y$ < <$ @ $ lܟ€ z 0p > 9 @1# p$,"l$,$(l : ?23 p p` t"`t$l t p"@$ t$ p 8`&  , " 8@d  8"  8 p` t"`t$l 8 t p"@ 8" t 8"`p< 8   8 ̀2 > : ( @   @ $ @1 kxӢ"kx@Ykx l @H 00 $,  $ @0Ӏ@XH 0㿘  < <?Ȁ`"`& @"@""̐  <2& @& < & ܟ@ " 8> :@ P 2 <㿘 \`hl҈p U`dR Md$ $ 0$ >G H @$ 0$  0  0$ 0 0 >$ 0< $ @$ H$ <$ 8$ 40.`$ ,  \$ D  0`` $ $ p`p "`p$ `$ "$  @n 2?  @D  2" W?" "$ $ $  @ $  @"& @ 4 & 4  @ * 2 > *H   @ * 2 @ > > HcH  `( (#(* ``"#cH > H* >  H `> H* *`>  H 㿘 > . "H`2 ! @Ҕ  &?> > #HcH + @@@  *   +  㿘> #T> a> :@뎐 h0L#> > :   @`  ` `(@ 2 T> "$b ."bܒ`@5   >  >   " 0> #!  @v > 怣`""> :@O 0 ?"T> #`""a > #@#`#"܁? 0   ` > ܀   㿘#`b `  > 怢@  "> "b@ " "b"  " @8 @7 ` > >    ` ј ` b fggfgfggggggggggfgggggggggggggggggggggggfggggggggggggggggfm mmmmmm mruuuuuuurss uurrrrrruuuuuuuuuuuuuurrrsL\lx4`" 2 2<" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @>  &` &`&` &@`6$ $$@  㿘  @>i &  㿘 @>W   "  20   " " "     2 0   " "  ``0"42 0(2<(,",4"< 4, 2"4`(",`( 00 "`00(2 , (""`("0  "4"4(,"(, 00 00(2","("> ," (42( 4"4"43 2"4`,"(`, 00 "`00(2 , (""`,"0  "4"4,(",( 00 00(2","(" ("0`0"4"0 4ݘ  2l4`,42( 4"`4`,("`,( 0`0 0`0(@2","(" ("`0`,(4 ,,n4"k 442`42"4 4(, (, 00 "00(2","("", 0`,`4 4"`4,2 4`,("`,( 0`0 0`0(@2","("m ( 4"`4`(,"`(, 0`0 0`0(@2","(" ,"`0`((4," 44 4 A0",42`4,2"4 4,( ,( 00 "00(2","(""( 0`(`4 4"`4(2 4`(,"`(, 0`0 0`0(@2","(" ,"`0 "42`(2"4㿘`(2`,@`, =( ", ( 2,04"0 "& ( 2# ,# (0" `("(`,",`0"0`4"4`0`"&`(2"`,"`(`(" 0`, 2" 0   0 2 0``0`4"0 "& (2# ,# (` 㿘@   @ $"  ,2 ,",",3 2",`$" `$ (( "`(( 2 $ ""`$"(  ",",$ "$ (( (( 2"$" " "(`(","( ,ݘ  2l,`$,2 ,"`,`$ "`$ (`( (`( @2"$" " "`(`$ , $$n,"k ,,2`,2", , $ $ (( "(( 2"$" ""$ (`$`, ,"`,$2 ,`$ "`$ (`( (`( @2"$" "m  ,"`,` $"` $ (`( (`( @2"$" " $"`(` ,$" ,, , A("$,2`,$2", ,$  $ (( "(( 2"$" "" (` `, ,"`, 2 ,` $"` $ (`( (`( @2"$" " $"`( ",2` 2",㿘` 2`$@`$ = "$ 2$(,"( "& 2# $# (" ` " `$"$`("(`,",`(`"&` 2"`$"` ` " (`$ 2" (   ( 2 (``(`,"( "& 2# $# ` 㿘@   @:i   $&`,&`(&`$ &` `6$ $$ $@  㿘  @:G   $ 㿘 @:3   $ $"  (   2 0    (" ($" ( "  ( $ $ $2 $0 $  (" ( " ( ` $ "@0 @ ""`" `" ` " *` ( > (" "" " 㿘> #  $@ @* & d@/ $&  & #&  @ `> " '@̤ .```\ $`\ *`FҐ dc耢`" d`\@> H `B : dc쀢ѐ > H`B :2  dct> "H  !xB` : > :`@R `` &@ @ , &/ &     /` '/`'`'`'`'>  dt@h`d $NkH`> B:`!D2?V  & `&K `   `@2 ` `@2 ` `@2 ` `@"! ` * &  $` @`@`@`  d N`  d + + \+ D  2H!x`> : @ H!x`> :@! *  *D*\" > :@!> "\' 2// `"''> bH`> 햂B:`Ȑ#@p& 2hcc`> c܀ > !L@ &> H`B : 2c^? `c`*`y* x" 0" 0  u` n> ݐ# > #` > : @8a( @˒ > :@!> @ɐ!L'?> #"`p 0`> cܐ "c> "H !pB`"!p: Ѐ`  X > H?`B :  > :@!H㿘 X *> # t@ % 0`!cܐ?"c 0cЀ  > c 2> @Lw > #> bH`> apB?"ap:`ؐ!L@k |   y 2 㿘 |  %>  " |"& |@C`X?&`X`2 㿘.`   > :> :> :!`ap@3">   "Z$`8 P%> > "H ` 2E ` @2@ ' 2x D ( x \ (x*D*\/  '> :!> :!> :!`@X   @_> :@ߞ!؀  @R > :@ߑ!@ؐB? 2 @ϒ.`" >  |@ע  2$ @D,?> !`@  .$`  <$   <"@ " <`   8 `$  8"` " < "`8  8$  @o 㿘  @"&  @   @ 㿘 .`@ 7  8"2"`""`"`<?""">  |@[ `8 2$> m `@ 2" @ D 2" > @E $㿘> @ ؒ `8"`< "`8 㿘 h 2 p  @*  l q D*  l p  P* 2 q R*`2  m, ' l, & h4 $@z' l @ @ A @ ( @9 $@4 @/  * D ,@ "2 T D 8 @ 4@ 0@ ,   T P@ h@& 2 p>  @׹3   l* = q ,*  l7 p  T*`2  q V* 2 m.' l6$.& o 2&&@&&@> #` > :a@ @ @> :@=! 㿘> !̀`> :a@X @ &< "Z?&1 >  @cL?%  ڒ A?@3>   > bH!`>!|B:!`&> !D+ > bH!x` > : @ݗb> :@!?`t&`&`""`bH  !l B#!l@x; @B 㿘> bH`> B:`!D㿘 $?`$c F &A>  `@<>  `@7>  `@2> `@2-> 뀢(>  ` @#>  `@>  `@>  @@>  `"@>  "` @ >  $`$@> 6 > #`02> :> :"" &> :b@@    &@!> :@Y" "  &@#> : '@Qb`&> :@M"` @`&@G"`"`@`&`'@@b> :@=!?㿘> "H !xB`: > :b@א  @ > :@#! > 0 ">  @ ">  Բ -0  K  0" @0&`@"&0`8`> !` 2 @2  @@`2` 㿘> bH`> 얂B:`  # 8 ``   2  "  &怦`   㿘> > "Hb( +>W)> :'> ``d @"H /* ` ! l`@@b @ @6 @S H 0`㿘 ŀ ?  @  > :> :> :!`ap@۽$(  d> :> :> :!`ap@۳$* c c> "(# `> ccĐ"(> #c# @ $ Ҥ @o$ > #0  㿘> # ? )> '>  X` t#@ @} ɐ`ꀤ > @}!㿘 | %> "( |& | F  `\?"`\ `X?  "`X d#Ȁ"#> # @ "t>  @0# | 2 |h> !̀`> :c(@V  D 2>    4  & "   8#` #\#d#t#x#h#l#p$ d#|#@#> !D €`@z@> . _㿘> !̀`> :c8@Vh @ i ŀ "  d> :> :> :!`apH@ݔ$cА?  "c dc܀ 2 h@GĐ  h`"  `cА? "c h@G  ` #>  `& ` А?  " c܀ 2@G @ԥb ` 2 `@; @u  `"  "`> " x ? "& &  "> @H> !@ԃ> Hl`B "l:㿘??3 > a ' ! `ŀ  `> @|! t!? > c 8 ?.!> @|! a!?? $!`!>  t`$!> @|!㿘`$ 2  @lp &` `?㿘 $   @l&  $  2" Ȁ2" ?" 㿘.`0i> : ` 2` @ڭ#h.`2``]> :@ڦ#x0Y     `* `2 ` " "@ " @$     ` ` *  ` "@ " @   %> :+> : `   @h2`@c `.@]c8`@X` ` 〢6``> :@M#㿘 @ 㿘` 2 ` 2 ``' '   ?`9&>I#*` €> :@# > :@# > :@# > :@# > :@ # > :@# > :#@  `0 > :@#`> :@#؀`> :`$@#` *`&> :@#`"`#`& > :$@א#"> ; &> :@͐#&" @Ő  <`2/ D> ; 4 8  @@ٸ < E` > ; ] "> ;> ; 8@٬ `> ;@٨ H L P X@٢ T E`  ]`> ; 8@ٖ `@ٔ`H D> ; \@ُ P d > ;$@و X㿘  > :@#  > ;@y `  > ;@s h  > ;@m p  > ;@g x  > ;@a  @> ;@[ @ > ;@U > ;@P xؒ"? 6" #h#h@$= $=@ ؀" $9" `b'$9 $9@ ܀" $@" db'$@ $@@ " $A" hb'$A $A@ 䀢"  ," lb' , ,@@g  耢"  (" pb' ( (@ - -@ 쀢"  \" tb' \ \@ 0@> 0  "  X" xb' X X@ ] ]   " |b'" 2k#h *`   `  `"  b"  `*`㿘 $`$@2H `B> ;>J *` € ` @2:  `@25  `@20 @@2+  `@2&  `@2!  `@2  `@   ` H H  ` @ @ @G   * ( (*`00*0?# 3   +  + 2 㿀c> b '@_ 6@ 0R  `*   2 66@ * / `*  2 *  2 *  2 *  2 *  2 *  2  * 2 * ,/`2 2`2w6 > ;@W 㿐 ?'L*  * @' * * * LL `2 `2.  `. . .L@?L @ * 2 B6@㿀#> b'N J `2+@* %2 * 2 * 2 * 2 *   2 *  2 * 2 6@b > ;@ Ё㿘 && l0 &`$>J ( &   &   &  & 7@0@ & !7@ & #7@ & 7@`";"*  4  && &"S  ȀVV &"N ɀD &C && 7@  ({0@& 7@ . .  ( .`*`@@+/`.  * *.  .@J0@& E7@& A7@ & 7@ &  .` .  ( ( *   *  + .   *`*/   @@ .@ 0@ &`7@0@  &`7@0@ p\> `  d'o k ``@@*`` 6@/ @24 ݖ 7@@4 @ז ` 4@* @2 Ζ 4@ ߔ `"0S *   2 4 @ *  2 4@* 2 1  @*  2 *  2 *  2 *  2 *  ~2 *  x2 *  2 q4@I``0@Ж _* 2 Y 35Р Q@ґ* K2 ԑ* E2 ֑* ?2 ؑ* 92 ڑ*  32 ܑ*  -2 * 2 '4@ > ;@ X > 2 , b?Ȭ '  l`#\  @ ! 2 @\ I `  0C`E?4 $;7 `@/` /`/`/`/`/`/`/ e#@ Đ " ^ .@.`.`.`.`.`.`.`ϲ` $ @$ 4 @ @. b > ;@ p> /]x'L l'P*g'Xj' 7^  `  0  ( @*Ē  t |`: .`:|6`8  &`(# > '`&`4&`,> '#`&`   &`&`@&`"` ` ,` L4``$` P@$` L ,,,]PY ( c-   $ , ^\4`4 $ $  4   , , ^ ȩ O> b"@K64 @ @@ /*@@ $@ ,`> #4 ]` 4``4`> #3,`],`4`     X @,1> `X  '//'f b  4 ؒ  @؆ >   (@fY4   @ `,,#\    @z > " > ;@!㿘沒 @,   `:"`( *`:# `"`4"`,  0  ` @ 0`@p    `0&@@```` ` `  " ``@ `?  4  / @+ )   8         @            ?/>J( ( %@     `? `? @  @ @  `?@ @ `? 㿘.`.. 2`2ė2㿘     㿘     2 d> 8" d> d"  d2 㿘 `2 `h! 2`P`T "`P P`> #`> ; @fa> ;d`@Ҵ! > :@ұ! @mpcl`42 8`42 86" ( 㿘 #p"d' ? > ;aH@< ".& 2"&> *  &@a"  &  dM " & cp$? @;1&  &  && cp$h&@@ @&㿘> !  G*  `"$ " $ 2       #p"d'@:  $ $h&@ @&0 ? &2&&@ p$`2 < "  "  < "& "  " 0$@*#@@*#@`*#``*#` `  *#`  ```" 0 "  " "  "" " " 㿐```m?#&`&` &`" `^?`O> w"8H> w"  `@`D `D`@`l  !*>?@*'*`h2`'2@, 2#@`h' @ݘ 2 *2@u 2@ @u 2@ ? `&`@`&`@`&` H> ."6' #\  @  Ā$ @   " ` `` 8  ` (  @&" > ;@!p@>  > b. 6' 7#\ @ؚ  Ā$       /   (  &" > ;@y!P>  > `"``'` `0+ؐ@% * /"@lD' @l -,`@ $*   / "  " " " @l*' (,`<  n$@?* 2  * 8 Ր?"8,`.2 2`@8 @ *  > ;@!㿈 d'& $H  &   "0"ؒ #\#`  #\#`  l @rc#0& > ")> !' %> !>  @  @_(PP @_4  %!P?P P?x`    H  ( 0 8 @?x??????????ؐ@_ ``@_  `l  `@@_ `D@_  @^ `D@^ @_'> w" > a5> "p  #a> ;@!#􀠠"##2`#"#|#2`#|6"@ $: ` *` $@" $F $K*` $F2*` $22`$`2`\? `l `@ `''H`''''''|'`D`, `l v'@ @ `h''@&jh  > "H 8 B: 87 `m "@  "`7`V :"`1`V4`T`.4`V`4`T (4`V @ `̒/Ѐ`'Ȑ @ `̒Ѐ`'4`T4`V4`T`T> `V4`P4`R@)> '``c@Bch:c@@i = 2 9`' d' $@`  @" $A h' $A`"  `m@ l' `$   ؐ` @2 2g  $`  ؐ` @# 2X  $  ؐ`@ K `$ 2 ` @_` @ `$ 2 ` @jn` 5 `$ 2   `; ) `$ 2' ` " 2` 2` 2 ` 2`   `ݖ`   `," `-`pi' " `*`Tr`(  t[' `T   ؐ`, @ 2Z  T  ؔ0`,@# L `T 2 `P @_(`, A `T  `P @i`, 6 T  @0`,– * `T 2( `@ "  2`@ 2`D 2 `H 2`L  `@ `0c`,   `\" `]`x' " `Z`V`X  |' $B`@2!" $C``@2" $J`"$4 `n@2"$4 2" `m   $E ` $D "' $$`@ 2$@ $`  $0`@ 2$@, 0(` $` @ ? @'d Ā ocl ʐ d#x` `m ]@`@ax Qd 2'cp M d8 ,> "@Ř   "H""'@q耢?"H d:   "##d#\#`  @rK &``#'d "#\#` #d @r5 $<``"' ǘ `d@ ''4'@p耢?"H"H7֒`B ="H d:    #d#\#`  @q $8`~$4` { `m Q` O ` K ` `X `      *` (" @T  "H H B: HI7 ` 2  2 ` ` @#\#`#d#h#l $I`h#p`<#t#|`D#`@##x(   $*   2  $`h  : $*  2  $`h  $8`Đ؀  "H ( B: (7؀ & @g`h  ,`r $8`( % $G !  @  "H@ `B 7:@ `s,`sx > ;a@ > ;@1!> :@.! Q $? N$4  `l#\ `@*  "H h B: hl7ĒH#lؘ#`#p#t#x#h#d#\@i d * `o   `q `p*@*`@*`З*#\Ȓ @W@'!> '"@   l `@% H@ '  € # @ H@N   !> '"@  `#`\`ltx#Ѐ > Hx`B :x ``B :`7> !@Ø > p$ h$ d `  dcА "c dԐ " h`"  `cА "c hcԐ "c ` Ȁ 3> cА "c2$G "$4  4 $4@"$4  4 $4@"   4 ? ,  4 4 q*`#@ p* #@ , , 4  , Ɛ 4 m "`  V W O :P Q $ 4X  $ 8 ` ``2$ <$? 2$ < 4" $ < $ < 4` <` >  % `   8`$ 8` l2, E``*  E 4 @ * @?: 4 @ `   8 $ 8 4 X, D$ P, \ , Ő   , , D, , \cc$ $ m 25o €!  0@*V H 1>  €!"$o 0  0 H#\#`#d@* > #`> ;a@1 > ;@ʁ!> :@~!Ȳ o, 뎔  > "H ( B: (7$4@@d> !' & # &' > HX`B :X7h> "H"@   4> #@c  2& ( `B ? (7, h`" dcА?"c dcА?"c ` cА?"c2@d " |"$ |`X "`X``ȶ@`-`@7^2 4 m 2w `  2r $? 2n h  @ , D$ 8` lٕ2* 2 l@* lD 24 B 8 ` @#\``#`#d#h Bl#lh#t@#|D#p#x## > Hp`B :p7/  .` `c`.` ! @)흐 h`" dcА?"c dcА?"c ` cА?"c2@Ւ 㿐 l  D@  2 m D  @ @  @   . r m " l   lr o :' ll   @@ !.2 H @  @. @2  @2  2   H.@2   3` l @#` H `#\  l  D@ !/ 2 L D  @/ @2 @2  2   L/ @2   l `3`#` D L#\~  l  @@ !.2 H @  @. @2  @2  2   H.@2    l#\ @3`#` H `  l  D@ !/ 2 L D  @/ @2 @2  2   L/ @2     l#\ `#` D3`a L  2  @  `Ŗ   l  D@ 2/` D  @2@2 @2  /`  D ` /`2  2ٰ\ " / 2  "ΰ   2` 2  " @   @2  @2   @2  "  l   @`   l  D@ 2 2 D  @2 @2  @2  "  Dz` "7 @x @  `-   l  D@ 2 `2a D  @2 `@2  `@2 ` "L `  DD   @2 @ @2  @ @2 @ "  l @  `   l  D@ 2 `2 D  @2 `@2  `@2 ` "  ` D  h> !@? l%> \''''''耢`"c@Bch:c@@b = 2 9`q'耢 di' $@`  @" Ah]' A`"  m@lR' `$    @  h@O 2f  $` 耦  @ h@@ 2W  $   @ @ h J `$ 2 ` @W @ ? `$ 2 ` @b @ 4 `$ 2   @ X ( `$ 2& ` "耣 2` 2` 2 ` 2`    @`   `,@" `T`p'耢    D  h@ؔ 2Y  T   D0 h@P K `T 2 `P @WU D @ `T  `P @b" D 5 T  @0 D ) `T ' `@ 耣 2`@ 2`D 2 `H 2`L   `@ D`0   \@ xp' J`"x n@2@x 2< m   - 24 ] 20 `   - 4 ] 0 E , `  : @?#@2$`@?`?*`@` ('d   "'p &'@$ ' < 2'>耢 }t t@'''7H`B H(`B :( ` "` 2`@"& ` `` " `횖 `핖 d "@ X ` `!`  ` T2 lX .  -`` 2 *@  `?2  `` *@6`.` ` 2   &  .  ` `* &  -`* & & -` 2  8!6  ` ``  "@` `= `8 d "@ X ` ` `2  `  2`  "`` ```   #@` 2   TXZ d "@  ` *" ?"%A`!ۑ*  `      "@ j 2`@ d d#d#\T#`X@$` 2  -`2 @ *6  $ 4& *`  & &` `     .  ` " `    .  ` "& ` `   .` `2 `  |`" ` J `` 2@> Hh`B :h2 `  .` `  .`. > #"`  (  `  6*`   `  +*`Œ ``(` ` *` ( *`Ő *``? ?  v?"% qA!  k> #`,> ;b@ M ` #\#` o#d#h> ;"p> ;"x#l o @ 2> ;> ;""#p> ; X"0@î@ d d#d#\T#`X@$` 2  -`2 @ *6  $ 4& *`  & &` `     .  `  .`. \ +> D '> `  ` ` @#\#d#`#h#ld $IP #p h#t <#|## l#xd @r D 6 & & ]+> "HaxX> ;b@  ` #\#` o#d#h> ;"p> ;"x#l o @ 2> ;> ;""#p X> ;"0@ @  1 ` *#  2 ?"% 3 A!ۓ*  4 $ @  5   6 #\> ;"@`` 2@bHP`B :P 㿘     .  "    .  "A ` `  .` `26  |``2  +.` ` . .``| " ఐ   7> Hh`B :hA  `2  2 ` ".`  .`. > #"`  (  `    `   (``   `(  *`Ű 0\> `l ` `h`/'7'/`@ `D 77`@ `D77 v& ŀ r` d dH d9 2 d9 2  `@2 @H0H0`q*  D` O @` " 4@`8  #\ #`#d#hB`h#l#t#|`l#p#x##d`@`Dဤ`w`8 @q`4 @k`| "Ő  ` 4@> Hh`B :h  *`D D` ž @A  G`8 @A`4 @;``* 3@ P`2`q@="`P`q `p**  *P*#\#d#`#hB #l#p#t #x$#|`l##dt`  `P @ ` 4@> Hp`B :p * 3X " L#\ #`#d@#l#h#p#t`h;x`l##d`@N`D`q *`p  *8*`#\4* #`#dX #h#t#l#p#x$ #|`l##-d 4P" "<`L`8" "`TX4 "8`@`L "`P*E*]* D* \` 4@> Hp`B :p  2   (  > #` > ;b@x C > :@Đ!* D* \&€  ږ #d#`#\  " @`q* `l@ `p`@+  #  `@+    @ @2  2  @2  + @ + + `l `@#```D#\`l  `q`D*  "  2`h`q`D*     @     @ `h $@ /`r`l` `q`D+ @ 2" `+ `D+    @2 @2  2  @2 +   + + `l ``#``D#\ $ &('Ā  @  b > ;@"`> "`l ```h'/7/`@ ݨ`Dݤ@7`7`@ ݚ`Dݖ@7`7‖ & `ŀ ` 2`d dH d9 2 d9 2  2ذ  ` @`0`H`0`H  2  *  >  + > #"`      *`  @ `q* `l@ `p`@+  #  `@+    @ @2  2  @2  + @@ +  `l+ `@ #\``#```l  `q`D*  "  2`h`q`D*     @     @ `h $@ /`r`l` `q`D+ @ 2" `+ `D+    @2 @2  2  @2 + `  + + `l `` #\`D`#`欒` $&( @   > ;@`#㿘`l. &`m. '`d `h \hl6 $ p`p #@`p* 2`q*` 2 `q #@`p* 2`q*`2 `l 25`p1"`p2`q`p?* &`p *`" `p * "@`@ `p  *`# `p* * ?* &`p *`" `p * "`p *` " `p`@*  &-`q`D*  &' F& `ŀ B  d dH d9 2d d9 2 d `@, d $B`&     > ?> #` ,`> ;c2@ > :@! ?8`m> `@'`D\" ': `   'Ė氚 ̐`(#\#`#d#h#l#p  > `l > Ā`2"#d#h#\#`#l#p o> > # " *`@``q* @`h $ /`r $&(`l  "6`pN `p`@* @  `` `q`D* @  ``͖  /`r `*  ) `2`* `2``  `@*    2` @2 `  2` @" `q`*`  `q`D*    2` @2 `  2` @" ``* `塖  /`r`Ӕ `l`h`?@  7// /䀤 ";  #\  @ۚ > #`> ; @a> ;@#H> :@! ?@ 24> H`B :  *  /''n'#\P ( @ V> #`> ; @ja> ;@#p> :@!r Xh> "H/?'ب 01> ;倢 3 < +" , 7``4` /` 4 `B < #\  @` !x  @'!> ;@w#> :@t!/  3  *  * /値`値```(`:(#\  @(  > #`f> ; @a> ;@=#> :@:! (7L*  /N/O* NH*`2 * 2 8$ `ŀ 4`2`d dH d9 2 d9 2  2  ` @`H`0`H`0   `     "@1   €`6>   > ` *"@@ +> > "H!x`> ;` c@m `@ `l> ;@#`D `l> ;@#g> < @ 4 P`B < P#`> <` `@F `@ `l> ;@#`D `l> ;@#@> < @@`q* @ ( #  (   @ @2 2 @  (@ **``#d#\#l #`#h 䀣  *  "  *     @     @  $@ /`r $  &(*` " +`   @2 `@2 ` 2 ` @ `+`򀢀 "  `**`` #d#\#l#`#h䍚   䀢  `  @ @ `  @w (P@q b #\ @| > #`> ; @Aa> <@ 0> :@!I (7L*  /NV/O* NPH*`2  * 25 $ `ŀ ` d dH d9 2 d9 2  `@  @`q* @ ( #  (   @ @2 2 @  (@ * ``*#d#\#h#l #`䀣  *  "  *     @     @  $@ /`r $  &(*` " +`   @2 `@2 ` 2 ` @ `+`  `* ``*#d#\#l#h #` T䀢  `  @O @I `  @A (P@; , #\ @G > #`> ; @ a> <@\ X> :@Y! x'Ė#\#`#d#h#p#l( > @`q* 䀣  @* @ ) *    @  @ & * Ԁ 䀠 耠*  * @ `` #d#\#l #`#h➚ 䀣  *  "  *     @     @  $@ /`r $  &(*`  2,`*    @2`` @2 ``  2`` @"``` #d+`#\#l #`#h  8 ` @;   @5& #\ @@ > #`~> ; @a> <@U > :@R!  x'Ė (Ģ#\#`#d#p#h#l  > `l > Ā"#d#\#`#l#p#hb > @ʒ`q* 䀣  @*`  * *   ` @ `@`   @ % *@̀  ̑( * @ `` #d#\#l #`#hw 䀣  *  "  *     @     @  $@ /`r $  &(*`  2,`*    @2`` @2 ``  2`` @"``` #d+`#\#l #`#h   ` @  (P @ /O7L*  /N* N 7J7H M$ `ŀ I` d dH d9 2 d9 2  `@ʰ @Ē`q* 䀣  @*`  ,*   ` @2`` `@2 ```  2`` @``(#d#\#l #`#h   䀣  *  "  *     @     @  $@ /`r $  &(*`  ,*    @2`` @2 ``  2`` @``+`#d#\#l #`#h  # 䀢   > `  @ @  `  @ (P@   > " > <@ h> " l` m h'/7/ @  D77 @Ȕ  D77ؖ & `ŀ `ڰ 2`d dH d9 2 d9 2  2°  ` @`0`H`0`H  2  *  >  + > #"`      *`  @  q* @  > :> :> <!`ap@2  @> :> :> <!`ap@Ȁ 2  D> :> :> <!`ap@Ѐ 2  l> :> :> <!`ap@ؔ  " pT h p* @   `Ӗ  q D* @ A  `Ȗ ; *    @( @ (  ( @( @ ,  q D*    +`@ +` +` @+` D  l / r h $@ / r $&( b > <@ΐ 㿘_``)E * 2    277;  7`27@> H`B (: @   !  @     *`  (   7` 7@> H`B : @jh> "'@4 $`'̶ ` `"+ + > $ /# `? @? N? @? I?@F*  >  /  "  " " " 2 >b h`,@PȀ`$%`    < h`T "  @KW  "<@P   Ȁ``8 ?"`8b > <@ h> "'@ $`'̀` `  * /"*   / "  " " " b@P` @OȀ t " 8 ?"8b > <@!X> "' ' ` > < 2 ;> <@Q!  `*;'S&dH` `沔 @   L'd9 @ `? B"'  > #`0> ; qa@#  ,` /$``($dH`@OO؀2P> <`l`T  "`T`B :P`4 1</`0 2$ lbؒ #\#`  Ș @UĀ  > #`> ;a@* > <1!hȀ 2$`c0     2$`   Ӏ! @< "dH > #`> ;a @> <!@@I> :@F!0 @ " !< 2@Ȑ`0`$  !<  H "@ݐ ? $c"!<  H " @̐ ? $c 2 $ l 836 !< " H 2 > <$l`2$x "x `@)ٓ*`6  $ > rca,  "a, > wbT`0 "`0! 9dH@> < l L`" LdH=  l @ &dH@ -'  " ! @ '2dH> <`l`D "`DdH 2&"؀`""`8 ?"`8@ dH@Nʐ " > <@-!H> "' ' ` > < 2 ;> <@ϐ!  `*;&'dH` `沔 @ 0  'd9 @ `? ' '> @ $А ,` /$`$`  $`dH$ $` :  *:#\  @y  24 lbؒ #\#`  @T+  > #`> ;a@ > <M! `  ` `Ā `ɔ c0   ` p  ` t ` x ` lϱ  ` ` U @' L "DdH '> #`A> ;a@j > <!@> :@!05`? ?  ? ? ?@ X4`  l @ dH " dH"H`B:`dH    l@Nv dH 2&@ wdH > <@"㿘     0 :  0z  @ !  `$m 2k `b`@ `@\  "$` [  ` @ M"@`$`$`  @(`` "@$`$` ` :@(  '2@Co* + `$ 4`$   0$ : 0> rc` "`> wbT` "`> ;a` "`> 8(`B :( `$ 4`$㿘"@   㿘"@  " @C    @2 @J 㿈l p> <@"  `%`P> <" *  \$   &D&@&`&L&H&d` `?@ .m.p.q.o.l  .n >@K(6h ?@2x  "    0m 0j#\#\#\F   R%``?@ &D.l&@.p.q&L&H&`&d.o.n 1> *  ( >"H" ($  .m #> ;'> :m 3"l < +"0\ , "yl```"ql`\ d`h 7#\d\`7 ?` 7@ `B 5=   &\"H!x   @a> <@"P@57l #\ ɚ "H!x   @a> <@ߐ"p@ݐ`7 7@ `B > ? 2l"H!x   @ua> <@Ő"@Ð7` 7@ @`B > @ #\  2m!x   @Ua> <@"@7 3 *  * @$.m`Um "% :  0uH 0r #\W   %  2`*`" " &L&XX&H #\ >  % `   "    `7 7@> H`B p:&L-&H #\  a           #\ ?%@v  㿐` \   l` `  ` ` @  B@ :` l   ` `    `"  `B `;@d8  `?* cH`B cX: @@ B <HX`B  ;@@ B 8 G  |` `H `B <` 8@ B :@`2` @ *   `B ;@ @ B 8 ``"`$ `H`B :`#X@ B 8@`2``$ 2`T 2  @  @? `d8`,l`?#\` #``?@?L`T  2  D  @? `d8`\l`?#\`P#``?@?.㾸> "H!h> > b( ''4'L 7V'P'8'H[ x @ x`hX`'`T "`P P`P 2 bH!x` > ; @a> <"@`0> :@!: !27 4 2> <@B# 4 : 7> bH`B :;7V 2 2 bH!`?@ V@ <  '4 PHD@L#l#p#`#h  #\#d >V?2 '> 倢  /?@ 4#\"7> "  s4U :4 `Ѐ " 4D#\ @ * 2``7>V#\4D8 * `7>@d88d'Lh'P  /8 8@> <!;h4#`D#d#\L8݀7>8L$v4@LDr>4D8=* `G7>8 c>@> <!;h4#`D#dR#\V#\4D8* `+7>8 G>@> <!;h4#`D#d6#\ 7>bHax 4> ;a@ > <@#(> :@!*>8* `7>@dH88d'Lh'P  /8 >@> <!;h4#`D#d#\L87>> R8`? %8  !4`€ 4 7> bH@`B 7V:@/x  > ; @Aa> <@#X> :@!84 @ 8ȑ* @48怊 8  L4 $K$@ $FL怊 L##  >8 "> `4" 0>  ꀥ4" 44"`,ꀢ   `4 `: *`:ꀢ   4 `: *`: > L$d`>S4  4 : *:Ldd2LdT"> L$x` <4 L$x2 7>뀢 0 PL $:` P#dH#\#`W4 L@P 8 "P ``PV` d:   P#dH#\#`4@Pܔ @`2`P#\>8L> "& L dHL dH@&4@5& 7>  8>" > <@R#㾸> "H!h> > b( ''4'L 7V'P'8R'Hx @m x`hX`'`T "`P P`P 2 H!x` > ; @&a> <#@u`0> :@r!< !29 4` 2`> <@ǐ# '4 `: 7> H`B :A7V 2! 2 V@   '4  ` `* @ P 7> H `B : 7VHD@L#l#p#`#h  #\#d >`V? >  /뀢 '  l4N :w44D#\ @ U* 2``7>V#\4D8蠚* `7>@b[88d'Lh'P  /8 8@>  ;h4#`D#d#\87>8L$u4@ Dq>4D8Қ* `F7>8 b>@>  ;h4#`D#dQ#\7>H!x`P> ;a@G > <@#> :@!F>V#\4D8슚* `7>8 5>@>  ;h4#`D#d$#\8:* `7>@a88d'Lh'P  /8 >@>  ;h4#`D#d#\L8ژ7>> ,>Ԁ '8 "L € !>L $G`> 7> H@`B 7V:@/x  > ; @Ւa> =@% > :@"!>  8 L @ ֐484@ F8` ``ȑ* @4]  >8 "> `4" 0> 8` ` 怊 4`" 4" 44" ,ꀢ @ ` `  ` 4 `: *`:ꀢ   4 `: *`: > L$d`>4 4 : *:Ldd2LT"X"\"`" > L$x` 4 L$x2 7>뀢 0 PL $:` P#dH#\#`W4 L@Nw 8 "P ``PV` d:   P#dH#\#`4@N_ @`2`P#\>8HL> "& L dHL dH@>&4@6G& 7>  8> > =@Ր @ @ " 0 0`0D : y@? `y2< x `x 5 `  ) ` # ! ?    ?  ?8  * ? `   ?   ' `'y & `&t   ) @# ! ? `   ? `  ? `   ?@  ? C  `  )  `# ! ?    ?  ?   ? `  ?  `   "`" $`$" @8 2@ `8 @8?2  ` (  ?`   ? `" 2 2<" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @ !  &` &`&` &@`6$ $$@  㿘  @  &  㿘 @    "  20   " " "     2 0   " "  `㿐#> > =#\`Pbܒ   @ !> > =#\`X  0  @ > > =``#\ #  @  @#bܒc @ > c"c" 㿘> # > `>  #"@ (> "H)> ='> =%> =ax   @' h "@vp@t@@ `  ((ax㿘!> # *@ > #` > =`h@ #> = @P"@> =@M #@> #`  @#@ @ 㿘 , ?%> '> ` "` "$ $@ @g ,? $@< ` * `2 "` " `" hȒǒ $> #& ( `>  "`>  "   ? "& & 㰀 & 㰐 "` "`"㰐& 㿘> # `"  "`> "# ? "& & >  @ 㿘'D# 2 `< "   @$ 2$@ <# (`R !>  @Ē  &@8 @   &@  7> H(`B :(@> *`!@2 $@` " @`" @ ` * @`2 "#@"`(@" ,> @ #@> ##`"@㰐 "`@ # @"@"` /``, ` (` *  `@  ` ` *  $`` `> => => = `@!(2 2 2@ @5`# @+  ,* @ "@ 2@ %+ @" ",-r4 @i> #` > = @`h> = @> =@  4@% @5 * 5  T/` #-,2`2  @*@ $G@/> H  '> = * !x` %> =`h@y ,`2`@Ȑ> =@Ő  ,` 2 * #@#@ `"  "` ?"$$ > @"> c?` "c` * 4@6 $ *2$`@ `! *`!2@@ ,`&@ ,"`@"`,@ , & &@" %@&D"@ `! զ `,`8/> #> =` @` * "@ *$2 @ # ` H`` * H!x` @ h> =`! `` * ?@ `$@9> =`2`H!x`,> =`h@ؐ @> =`$!H@%5`> =@" @5`$@  ,2  > => => = `X@b!!> $@?@N"> c?"c  @@A#?$#@)`2 @ % @ %  @D&@" `+` 5  @ " $  $  @$5`?@#@H!x  > = @j`h> =!h@> =@ 5  7 `B < ' H!x` > = @P`h > =!@> =@   7> H`B :> "@Ւ> c ?"c㿐 '` @  * ,2 *`> "H!` *?Ж*  4`` 2` 4` - "``@H!x`> =`h@ > =@H!(> =`$  H!x`> =`h@ > =!5`?@#H!x`w> =`h@Ӑ > =!@!> =@ kH> c` ' `! , `$2  XH> "@)   >  6H(`B b:(c "c$ $ H!x`> = @`h,`> =!5`@2> =@  2C  2 = `?В @  *4`` 2Ƀ 4`  j  *7 j 6> H `B : H!x  > = @Y`h> =@!> =@  n 6 `B <  h@  ' @'  ( ` 3 3 < +"  ,   z  w2t  #\  F  3 *  * @^#\  1 ? * c@` #\   r耢 2#\5    c i耢 !  * @`#\   K *` '7ԀK (  G &#\w `  * @"Ԁ 4 (  % 0D  * @)Ԁ ' #\ؖ  뺚 ?ږ  ؒ$ ?  0" 6> H`B : 6> H `B  :  6> H`B : 㿐\    2H> 뀌 2    ?> 뀌 2  9> ( 5>  2` 0>  2 2`   .  *`*&  2` 2 6    `   % 6 6   @    "H  B: 7 @> "'  > > => => = `@##@`  ' @ l  "      *` "l  2 (g  bl#\*  X  2 .쀦 P?# 8  " 3  < (- ` @߬2`"` *  ' . . . *  ' .` .` .`""` "@7  (& `   4 b > =@zW"㿘 0`" H> @# H`> @#0\> `'D'Hd  '  @ 2 l> => => = ` @Ӕ#hl  " `D  ` 8*` *` D  ` 8*` * 2   "@  2 l@   l2#\D*H   2 ,`쀤` u?# ]  X  a> "H!x`> => =b@X@Ő ͐> =  @ *`  ' , , ," `" `  `  H   *`  ' , , , @`" `   `"  ' (     ($@ `   ` 4   &@  H2*D@x@ `")@` $@"@@  > > #`b" > #` > =bx@A I> =@ ?c  2@` ` @"@@ > #` > =b@  (> =@n @?c  2Ԁ`Ѐ@`̀` Ȁ` Ā`d#̀@> !" '`" 'Вb@ ??# . **"@~* ` ` @ > ` " > `"X "@ > @<X> "H!x`(> =`h@ @> ="    0` "   1 "@   2 @  3@ > =@ "Hax > =`h@ !> ="#@~[@Θ> =@ː ax > = @q`h> =#@ > =@ ax > = @a`h@> = #0 @ > =@ ax  > =`h@P X > =@  6`0`B >`0 2CX `2?X  2X `  XX `"0X ",X@`"(X "$X` @> "H!x` > =c`@  > =@Z  6 0`B < 0g X )% `  `@2`2> c @    > =c@ڐ å > =@& : `7> ` ! 2> @ ` <"` ` 2"` "  `<"`` "``  `  "``   2`> " > =@w#X> "' 2 * ?쀤`2l#\` 秚 9`0% 2!Ɛ   Ƒ.2 @ (s `4 "@  7@o @i $@`"  `Ԥ  " ̀ " > >@w/  㿘`   @ ?Ж*@ *` 6  2`0 6  @ @  ` . # 6 @  . *` 2`6 ? @@ *6 ,  4 2 6  ` ** "`" ` ` ?  ` @@ ?`" 2 2<" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @  &` &`&` &@`6$ $$@  㿘  @l &  㿘 @Z   "  20   " " "     2 0   " "  ``"2 2<""<  2"`"`  "`2  ""`"  """  2"""> " 2 ""3 2"`"`  "`2  ""`"  """  2""" "`"" ݘ  2l`2 "``"` ` `@2""" "`` n"k 2`2"    "2"""" `` "`2 `"` ` `@2"""m  "``"` ` `@2""" "``"   A"2`2"    "2"""" `` "`2 `"` ` `@2""" "` "2`2"㿘`2`@` = "  2" "&  2# # " `"`"`"`"``"&`2"`"``" ` 2"     2 ```" "& 2# # ` 㿘@   @   &`&`&` &``6$ $ $@  㿘  @    㿘 @    "     2 0   " "  "     2 0   " "  `㿘 @  H&& &  & & & $㿘$ @4, $@[ h> "@5 0 㿘NN /" N 1> !ې  $h㿘N  1> !N /" ސ "$ @3  @$@4 /  ,Ð  8@$L`h> "H5> >r7> >2-L _@vO ?Y$@vHh#R$ @3 L ($ $@ߔ @  hh$@ؐ> >`@$$@/> C ax ) @, > > ( (@x h@vp"$$  ax   @ > > x (@_ h@]p@50 @5-  !$h$$  ,@ / 2-L  @5 $h㿘 :> !#> 5 81$ - ) @ % D ! ` $` 4  nb 8` " 8ܐ $ 8@4ے  $h̀㿘&#p.$L.$MN $  @2 2N  / @%$V.$L`8`" ,J`h `h,@$N .28LN .24LN /20L> "H%> >L ax   @f > >@ > >@ p@4 Q @  / ",.@$L .$LN`.2 LN .2LN /L > >`@$@$@ /  > >@`  .$M.@@4S `> `8`2&#p> #`> > @` > >@h > >@e p d  "d㿘. cp " dL $ > >`$@cp`h@a$ddM @2Q 2 8l ``h,@@y$dL 6cp1> >@ / "*! @>$dL  &cp@t h@z "cp> #`> > @` cp> >!h@> >@ p@3ڒ - @t h@t cpL@ hi@t @$@3 dM  N  > > > >!0@$ 㿘#p`d ?> #`> > @n` > >@!8> >@ p &#p "d#p|$h&#p㿘 h@`h   ?㿐!> !> > >#\"ah$  @{ > > >#\!Lax   @q > > >#\#a   @g > > >#\!a ؔ  @] > > >#\ ؚa H  @S > > >#\ |a   @I > > >#\"aȒ   @? > > >#\ #aؔ  @5 @A/> @.?@)> aXaX  @I > a0> ":@ 4> a"$ 4> "#> "b> !> "x""x"`> `"""> > "!H">  t" t"` x %ᨒb%D ?T""*""#|  <ငp#  - Z %% %4%L%@%%%$%<*$8"$%%%% %,%0%8%(%H*"*",* $/* T!> !@sW"H"H  $!@ӥ$!x$!|>#@' 㿘>W> > d @'r > >@5!?  0  ?  0  㿘 $cЀ 2bӐѐ`0ϐbp͐bːbct "b@%b`b"b& b?b"@&b&b&dcЀ Qc܀ Mb I@d@dcc@@@ @>c@ `0@@1z@1xbp@1ub@1rb@1o 2clct "cl@%3cl@- ch@- b@- b`@- c0@- y> "@㿘   @A  "7 L  , H,``* `H2 @"@,02`#P@ P @0%   @R @ L4 H`` $ L`$$ `" $` H  $ L$ $  "@&  H㿘`.`2 `H2@`@* @0`2`H㿘.`6``!?H@L? "L`"`& "@"" @1 0`2H㿘> t!* 2 㿘. > !2`> `* `H0 `@``H2@``L"`L㿘. > !2`㿘 $ 2  @5* 2 & ? 㿘 $ @6O 㿘 $  @6  > >b@ 0@ 㿘> !* 2 㿘. > !2`R㿘. > !^2`㿘> !@ $ ? `" "` "`  "$ $ L $ @^ > @_# 2   > c>  "c$ " 㿘> !` > # > + a $ ? `" "` "`  "$ $ L $ @^@ > @# 2 %!㿘> !` > c w H /`  > H 00h* ! > a> > @ !H" Ѐ #!HJ"a'> L $ 2 @] 耢  @I   2L $3`" "` "` ? "$ $ L $ > "耢`@X@]p  "@]Đ  ">  > @# 2 H 0%!㿐@  ( !  @[u! ! `` ''H /f * ' !@\QH 0㿐@ 2 " !@ !@[ 'H /f * '  @\'H 0㿘 2`$ `" `0 `$`,`$?&`,@``0  &`0&&`4 㿘 `4 `0`$`" &`4`$`,`$?&`,@`&`4 㿘`$@ `$ "  %`( `(@ `%@ @ @ `@~ @y `(@u `*@q `,@m `-@i 㿐`0`@o@Y`@o@R`@o@Ka@o@Dd7@> cx'@7 d'@1 d'@+ d '@% d$@! d('@ d,'@ d0@ d4'@  d8@ d9@ d@@ d<@ d=@ d>@ d?@ dA@ dB@ dC@ dD@ߔ dE@۔ dG@ה dH@Ӕ dJ@ϔ 㿘 "I `4 "E `0A > !@@< 7H /` * ! `$` &``,&`$``&``(&`,`0&`&`(N&`ې``( "@.e &`(&`,P&`4H 0 (> "'@e ( " ,@.H  ,  & (*  @,u  & (   $  '> $ (* "@" @$ " " " " > >@i"㿘@+ 2 A     㿘N " &@@)5 &@ @)b   㿘@-X:@> ",> b '~ 0" P@"z90`T@"t0 @"n ``&@f`U"@@"b``'0 `W@"Y `@"T0  2 ``Y@ G`Z@F0 @C ̰ 1`>@`<@20B @"50;`0@,`/#@0j @"( #1`;@`:@`I@ `G@`E@0`J@ 3$`@ `@ 0D   q1`;@5`:@h0  W@"e0`'@"_`@Y`@`T@S0 20;`0@ `/@I0 @E0" P0B @>0j @; S 1`E@ `A@%`<@ +`>@0)`I@"&`G@03$ @ " `J@" D - @"  ( D    !> @/!!> @/~!H /` * ! 04 @ "> 10 (@ "N`U@ " (> 8! `&@>  `@ `@(>  հ `+@3> `*@>  ʰ `N@ n İ @ " 0 V@ " Q8 \ @>   @ k>   @ "8 ' @"  @"  0 @ "N"0R@ "  T@pQ@"  0 2@> S@"C | @"N v 0 @"LY@ W@  0 eZ@  0 `0" O@   P0 [@>  S @ 0 N@@ ",@0B%@ "<0;/@ " >   )@-@ 0 41@" 1  @ * @ ",1 :@ "C.  ;0j @H>   @"c.  >@,$(H@ "5,D@ ", B@,$(F@ , ,3$ @ "O.  J@ ",  M@+ 0 @ ". 8  @". հ @"а > "Hh`> Ȱ # ` hd  t##  8`x > >b(@e > >0"0"Hh`> #"h"tx > >b(@S > >"H   2  (`0@ !> "@ @Ɣ A"  `$d 8 d@` $d ``"`$ `"$d $d `$ "  `T 2 d@  d@( 2  d@!`0 2  d@bp 2  d@b 2  d@ b؀ 2  D 2  dH  d9 "  ߒ$b`$b`$b`$`"`$"``, &`, "  `"& & & " `@2 ` $@  " $ 2" 8$ 2 ҐА@ΐ̐ʐ `p?  @ 2$"@ "@ ` Ð  <#X$#<#@<#P<#H<#`?   " 2` $`&`@2  2  (U!> "@Ò +@Ր  &dd@ 8 &d "@Ұ /0dH "d@d9 " d@C 2 d@<`0 2 d@5bp 2 d@.b 2 d@'b؀ 2 _ 2   0J `% ` `@   2 ` l !  `d `)? &b`b`&b``"`"` 2 b&b&b""`&bb"b`b"`"&b` $`` "```$`0ݐ!D?x %> YNx "   @֐ 2  `4 ¶ H&a|@C0@  > #&  &> !Dk? "&  ` ``    `" & 2O`" '@2G $@2BD &( 9 &tHX "2E @LB "(u pBr "N " Nx`dJ` `@U 2Nx `@Kx 2a`4&Ȁ  / @2 *@i ~t *`* * @ Q' " @1,0   > c.`* &! @' >  t $ ŀ " !.`@1 } ! a`  .` ŀ `* @*`@ (.`* &Ґ"H~!!@(M0ˀ !> > #@i3 0Ð"@ "  $  @(6 0!> "H@i x> "@i > #@i > #"H$!t 'K`?@ " J ` " `2      ` " `` ``2K 2K 2 K 2K "f K  2 @D "\ B "X @`<K/7/  /$BJ/ ,4@D,4@_ `4 `/ @ &  @6F &0@"6H  `8  `2 2 &> "*#" > b(* c@&> "(*# &ߓ*> @ !X*`  &`ԑ*` > * aX "  L ڐ" *` * &" `" " !@`ʔ  :c@:cP:cH:c`:cXb`2:c@0!H@%> 뀤  L $ 2 u " H>  "bH!x`> >b(@T > >"X!H@%> 뀤  L $ 2  " H> ""H!x`> >b(@6 > >"h@> >@"@0|> #@ w > #@   m | L`$ $``$ $`ܐ㬒@ 0Z> !@ @  2 L $ 2  $`@T @0@> !`$`$`"!"`.!H&@` >  &``2>  #&>  @ 2 > !H@`  ```*``  |W 0 @  > !H @ '   *  @T  .& ؐ "۰ & 8  $> "#?   &ѐ 2 0?  `:& 20  . 8  $> "? "#N   (@ٔ @NV?     (@Ŕ @N zx  u D@ @$<mk D@ (8@K0b$(_ D@ (<@ 0V$(S D $(@s$0J$G D $(@$0>< D@ (8@(03$(0 D@(<#\0@4@t8#   D@ @L$< , D $($8@|$0  , D $($<@R$0 D@@#\#`#d$($4$0$8@ 5$< , D $(@ $0 xݰ D $(@ 4$0԰ ,Ѱ D $($8@ $0ǰ, ,ð D $($8@ >$0, ,D@#\$($8$0$4@$H@@$2   @#$  @#$(> > b($zt"> "@e  @F  y$ @  "!$L  88$ @%E d@eҒ$( $@$ @7  @%3 Ro  @yg$ `@@% ;$2:   @#H$$( @#C  @= y<$   "!$L  $ @$  @ey$( $@N$ @  @$ڒ 5  Ԑ`@ɶ@$˒ $2   @"$$( @"  @C>  x$ @  0L` > !`> #d@  0` `D `<d 0` `4 `0d@`@à$> !X  L ``  @:>  x$ j@  " dd @$N m@dے$(`$@d  @  @$; Z` H`@̠$> !X   @ @P : `$ ` > "(> b(# %>W.` $ :`@Vvd`` @%,@=@#   > #? /   /  &  @" > #? ?> #`9 yF `0 "`p$&`0`p`t$@&`p"@&`t&`t`l$`d@  &`h{B`h@f `h"@&`hw ͐e` ̐/ &!D?< > ?#   A"`t  u 0#~? - 0 `xٖ` 4` `xDі` `X  > !DP?w 2 $`t  20 "o&d> k&d2 > @(> "` b" b` Z"`@AX T @# O@$ K@$% F" `" ?" ;@# &@# @# /@#  @# @#  @" @" @"  @" @"  @"  @" @"  @"ߒ H 0@%b@%b > >@^"x㿘> " `> #̒@%   >  "#  >  "#  >  "#ȁ㿘x h&`X㿘@&@`&```&`` `&` ` @&``&``&``&`` &` `$&`$`(&`(`,&`,`0&`0`4&`4`8&`8`<&`<`@&`@`D&`D`H&`H`L&`L`P&`P`T&`T`X&`X`\@&`\`` @ΐ`В`Д @ɐ``@Ŕ @a a @ @a`a`@ @aa@ @aa @bbbpbpbbؐBch 2԰ <cl 2ΰ Na  @ݔ &ctd  "d b)bȀ 2 bP#b` 2 c c0 2 cx&cxc| &c|@ " cc  @ "@ `c&cc&cc&cc&cc&cc&ccN``&cÐ`  &cNa " &ca &cz c&cd&dd6dd6ddNa``6dAa`* `6dNa " d7a* `6dd6dd&dd &d d$&d$d(&d(d,&d,d0&d0d4&d4 d8.d8 d9.d9 d:.d: d; .d;.d;d; = d<.d< d=.d= d>.d> d?.d? d@.d@ dA.dA dB.dB dC.dC dD.dD dE.dE dF.dF dG.dG dH.dH dI.dI dJ.dJ dK.dK dL.dL dM.dM dN.dNdT&dTdX&dXd\&d\d`&d`dd6dddh&dhdl&dldp&dpdt&dtdx6dx x(Xd"2 䨀2<䬀"䴀"<  2"d"d  "d䨀2  ""d"  ""䬀" 䰀 2"""> 䬀" 䴀2 ""3 2"d"d  "d䨀2  ""d"  ""䨀" 䰀 2""" "d"" ݘ  2ld䴀2 "dd䨀"d d d@2""" "dd䨀䴀 䬀n"k 䴀2d2" 䬀  䰀 "2"""" dd "d䬀2 d䨀"d d d@2"""m 䨀 "dd䬀"d d d@2""" "dd䨀䴀䬀"  䴔 A"䴀2d䬀2"   䰀 "䨀2"""" dd "d䨀2 d䬀"d d d@2""" "d "2d2"㿘d2d@d =䨀 "䬖$ 2䰀" "&$ 2#$#$䰀" d"d"d"d"d`"&d2"d"dd"$d 2"$  $ 2$`dd" "&$2#$#$` 㿘@   @V $$&d&d&d &d`6$$$$$@  㿘  @4 $$ 㿘 @  $$$" $$$$2$0 䨀 $"$䬀"$$" $$$$2$0 䬀 $"$䨀"$ `㿐> > >#\ ̚b$ؔ  @v > > >#<b#\ \  @vߘ > > > b#\ `  @v՘ > > >! @ b  @v#\>  ( *(>  + (> (! @ 㿐}  @ 0 @ "+ $  % ! @7 2 @ܒ$ " > #` > > @Ob> >$@"> >@"&$ X> "> ''P''L y  ! @ ð @; "     7 > "  @ L ' `c <$@#@Z r] ,  0 s , r @  k  @) @$   /〦 2 Z  /   //〦   @{ 2> @  @ΐ/& L'  r , ' Ls: ,LL`,,`,@ ,@- @P@P 2"@Q  @@| L@E@A > " > >@Y]#X> "' y۠  @ ƒ 2۰ @^ "ְ   а ΰ  >   @_ @K: 67 ' # <&#@Z q ,  0 r , @ @O    Z *Z`,Ѡ , o'- # <&#@Y qE ,  0 rw , W @n  P @   2 Z /     /〢 Z    *Z"L'  q , 2  r3 ,  `, ,,`, `@`2'@    @M> " > >@Xh#H> > 'c'T\'X`''H''L'P 'y  #d@ Ɣ   @\ " $     4> "  @ ϔ  @KL '''v H # <$#@Y  pz , 0q ,@  /@L   Z 2  . Z  %& L' / @5   /@ 2 @2 @/& L' /`L p4 , ~ Lq` ,L `,,, ,@ 8P`4L@P"@\ (L* * " H* @-@  /o , 2A   Lq" , L7  , `,@@@@ T@mT2"X X"@2" P LP@"@   @@KH@L@  > " > >@W,# `> " ' _E @  2u @ / "p  j d + # <$#@W oc , B0p ,@   ဢ``7 @* @˒ " / Z   /〦  Z " o0 ,    p\ ,    ,`,,`,2& b > >@V#0㿈 @  C @  "> $ 2$8 @&1 @[@  ''$3>''$b<@ b<$@ " > #` > > @{cb> >@{#@> >@{" $ &㿀> # @  O @ W "J $ 2$D @ >&@Z  ''$3>''$b<@ b<$@    @ @”  > #` > > @{b> >@{W#h> >@{T" $ &X> "'L' y   @ ` { @  "v d Lp 'Z /`c <$@#@V n' ,  0 oY , A @P  : @     //』 n , 2#  o1 , & L'L`,`, ,@,  @' 2& L@E> " > >@U`#  ?0/ ! *? !%` `0J 8? `88 "J(J " ? # ?㿈&@@Y   '$ '>b<@ > #` > > @zb> >@z_#> >@z\"$ >b<@y > #` > > @yb> >@zG#> >@zD"&㿈 @Y>$ 'b<@V > #` > > @yԒb> ?@z$ > >@z!"$b<@A > #` > > @yb> ?@z 0> >@z "P> "'@Yl `  @ //'$2`!@ `/`/` ''''$`!`    ``0&`$ @H /* ! @ .H 0 #  @ j  2   X  Y`0`  > ?@T> X㿘 $> *` *  * < @q 2 $5 . [` > ?@  & \@  @xԐ h `` . 0. 1& 42  . 0. 1& 8 & < & @ & D . X !. Y "  Z . Z㿘  `c <$@#2 L@T L@ `㿘 P`> @ry! [> *` *  * < @rn㿘@`* > "H'> >)> ?+> >@ "&`Tx @x  @y @yb$``c <$@#2`L@T`L`$&$㿘   R   @ &`T$  $$㿘@` @  # <$#2`L@T_`L`$"@k&$㿘@`@`L`㿘 $#> H /`* !  Z . Z P`@qאa& PH 0& T L `> " '9b) # <$#@T kr , /l ,/『 kh , b l , , ,,Т`,b > ?@Rߐ 㿘@W `` ..  "@?* $& "& "@?* &  ..    ?   *``"`  *`*`  & p> "'@Wb 0`X  $"$H /` * ! `Y`X `   4 В `0@ X H 0` ? > ?@R` Ёp> `X b'$"$H /` * ! `Y`X `   4 В X`0@ r H 0` > #` > > @w"b> ?@wr > >@wo"? > ?@R !㿘@Vʒ ,`&`X. `Y. !`Z  . "  `4 &2 `[`8&`<& `@& `D& `[ `\` @| > @ ` b'> * € Z . Z Z 2 `& L`"``&``?`&``j" , "`  ,&``?`&`HH /`* ! P   xk3  P k. 0 x@VG @VD  /kH 0 T@ '`i x ` ``k  x` xU&` Z 2R `??L&`&`J  X # ` X `>" X Y> !l  4> `a" 8"  <" @"a`" " "  $"$2# ` \ `" \ Y> !I  8> `a"( <", @"0 D"4a`"8 "< "@ "D  > ?@Q!(㿐= @ 4 @͒ > - "'-? '> ?@Д @B8  $ ` $$$$'`̐ `@`2&@ 㺰> "> ''L}  '' 6 3 <$#@Q i $(   j:$(  C@ 8 > `'8"P 2Gd  @ 96  @w "P$ $d'O D@U $*b̒ "9$dȀ   @X "0$d$    '8@ݔ  6 "d'$dȀ 2 " d @7 "$ d 8 ? $d$d'(k$(@ @,L@ܒ L 2" @Ӓ > " > ?@O!@㺰> " '}b 'U ' # <$#, @P, * * h?$( * * il$(4  @7 > "̢  d   ?@ "$ d ?$d$d'  @2& b > ?@O!P㿘?2O @& H @N A 4<&> "? "`'@M   d(gɔ$( 2! 0d(h$(E `> #` > > @tFb> ?!`@t> >@t" & 㿐> #?2s @ѐ l @ e 4`&> "'T?<@ 3 0H /`4* !  dgj$  0dh$0 H 0, H 0$$'Ӑ Ő@5􀤠> #` > > @s͒b> ?!@t> >@t" & 㺰> "> ' mH '9 ' # <$#@O g$(   h2$("  @ > N"̒ "d'  (Ͱ$(@А2&  > ?@N`!㺰> " \' } 2x 2u "'p @a ) # <$#, @O0, * * f$( * * gƔ$(C  @  > "̢ & d `"@* $d  @  "$ $d'd  2`  @ 2'`2'@  > ?@MӐ!Ё㿐} ; . > 4 "'? $ @  $ ?$$$$' 2$ @` `< $`<&@ $`Dܸ2& 㺀> " \' m"ް  @ C ԰ Đ "ϰ `D "˰ `<@"$ Ű )>  &$ '"1 20d 4    @  $d'N ! @R $ؒ$@ߔ "̒ " $dȐ@Ӕ  "d'$dȀ 4    @”  @ { H') # <&#@N er ,  0 f ,O  "H @  2  2; ?  $ L'` ,`,dĀ "d @ d `@$d ?'d'd $dc@ @ 2& 2'  @ @u  > ?@L!㿐} 9  "4  D "0  <@2, > "'? d @b  d ?&d&d'`e 2d @ۄ$ D2& 㿘> # } F ڠ "A `D "= `<@> 7 "? ` d @  &dd   2d @`2d8$`D2&2& H> "$'d? $ 2b$ @n \$ H  ϐ'''' # Lْ . "$ T Z Z ` @"L' Z *Z$ L'$ L'2 L  @h $ $d&$$d$d&$$d$d&$$d@ $ d `< C  @s  ?@&$" > ?@K!㿘N$ '> ?a8@ߐ " ?N$ 2?$@Pl` J ``$J @ 2 ?$ ? ?㿘N /2N#N   / `J@ /  $"d$"@y N# ?@P2d:  N `d*N  㿘`@> #8N  > p ? @!㿘@@r@  㿘 @$ 㿘> 蘿"> c8$Ȑ  "c8  "$$ @` 㿘 $@$Ԁ 㿐`"`"`<`> "$Ȁ` d? "d$$  ߐ@ > c8?"c8`$    2`2 &$ $Ā "&$ @} &$&$ 㿘  @$ 㿐  d 7 H /` * ! $(@O9 0$X@O6 0  >$>$H 0&$㿘>   >  ̒ @g   c$( $ر &$`@ "`@$@ $@ @ 2&$@  㿘 $@ 2$㿐`   ’'$ "$@F $ "$@@ $Ā "$$̀`"> `@?"`@!$>  @h㿘$d@ @N㿘> "́㿘$  $Ȁ 2$ 4   `@> #("  $> bcj $> "@  ` 2  ` `Z `?"$$`B >$`B >$ 㿘$ \  $Ȁ 2$ q   @> #("  $> bc& > $"@  2  "  Z ` `@`> #` > > @ndb> ?@n"> >@n" /`*,`@ $( `B ;$X @B #:` $ @ P 2 P> !@f $ P P /`@  `B : P  @B;h> "' 8@Mڒ$(@ ``h@$! 2($> #  `% @M$  2&$Ȑ   Œ  &$$  &$$ ` > ?@HҐ"0㿘$ ?> #`> >b@mɐ $> ?@n"H> >@n"0 &$$ ے p> _?" ' > #,2$ > "$ 2$ $Ȁ 2$ `?2@ 6    @ >  @  $ `B >$> `Y! `8`4&> !> !'  b `X| `X  `Y``m&@$`B >$ `[D #`\/> ->  $($@12 YK&@$`B >$ [" \'@ 2  ؔ> ᰘPz  ɀ  o > " > ?@G"p 㿈@L  '耦'"$ $>b<@R㿈@L  ''H /`* ! ``&`X &`\ 2``>$b<@/````>$b<@$H 0H>  l"'2'  m 2#  2 *  2``   l2#\*   @ b > ?@Gg"㾸>  " `'`2 ? @2    ?h?P?X ?`  7b  /jf 7f p'L@YL@Ӕ  `2` `* f@ ``(7b7fp/j@W`@  2 (쀠x7` t?#Dh ` /hX 2*@ Y*$ 4 ƀ`"``   `&  X/d/eX2*@ * 2`X/iX2*@ * &`X2*@ * `D @* @'D. . . D Xf 7fX2*@ * `?X   h> #`F> ?b@k > ?f"b2` X h@`#\j;`#h> ?"> ?"#lf$2 > ?("> ?> ?""##pdf` #ta"> ?> ?""> ?##xi#|@k> ?@k#> "ВP@ (  b > ?@FC#㿘` \ 6`> #` > ? @k7b> ?#(@k> ?@k#8G`?6` # cc /> > ?!> ? 2  #2 c #@2` 2  2H!x`ǒ@k   , L#H@kR > ?@kO#  2 H!x` > ? @jb> ?#h@k>> ?@k;# 㿐!> !> > ?"Ԛc#\ l  @b > > ?##\c   @b > ""Ё㿘'> Ѐ )>  $"#> $b@dR 2@dK#Ѐ Ё@ p  ? x? z? |7 ~7 7 7 ///?> #`q> ?b@j > ?  , L`#`2> ?` > ?`> ? "> ?"##> ?#2 #\ #` "> ?> ?""> ?##d#h#l#p #t> ?"> ?"#x$2 > ?("> ?> ?""##|` #a"> ?> ?""> ?## ##@jt> ?@jq#'> @آ -%> @ !>   @2  @ 2 , ,@ 2  L L@  ">  2 > "@bh  )1 @b` >  p<` x"4` z 4` |4` ~4` ,` ,` $@@bI,` А@ci @] l, +, K, k@$$@ 㿘 "  `@2  ` @2  `@2  ` " @4   ` @ 2  (  ` @`" @K`*  2 (!$ ` @`"s @K`*  2m !   ` @`"a @K` 2[  \ ( ` "R `@Kt*   `@Jϐ*  2  F@Kc%*  2: %@J*  2  21 03 ``)`(`@KL  `@J  !@K>%ܑ*  2 ܒ%  `" @K1`*  2 0 `@  2P   "" `  2  ` 2  `2  `2   `  2   2""` "`"㿘  @ > bЀ`% @"` `4 |` 4 x` l4 ~` 4 z `, `$ \, 0 ``2@ p> "Ѐ Y> "H%> ?)> @'> ?? ? ? ? 7   _+7_$`(7耊 * 7bВ & ax &@hX  `,` `L#\L @h,@h0  @hE> @L  (@h,@h0  2 `"2 2<""<  2"`"`  "`2  ""`"  """  2"""> " 2 ""3 2"`"`  "`2  ""`"  """  2""" "`"" ݘ  2l`2 "``"` ` `@2""" "`` n"k 2`2"    "2"""" `` "`2 `"` ` `@2"""m  "``"` ` `@2""" "``"   A"2`2"    "2"""" `` "`2 `"` ` `@2""" "` "2`2"㿘`2`@` = "  2" "&  2# # " `"`"`"`"``"&`2"`"``" ` 2"     2 ```" "& 2# # ` 㿘@   @   &`&`&` &``6$ $ $@  㿘  @    㿘 @    "     2 0   " "  "     2 0   " "  `㿐!> ! > a#\> > @`H h   d@\ >  @"a4  @+> "`d> @@  X $!> @@eO `㿀> "'@EK  @ %> P8  В @  @  > c& & Đ & Ȑ8 > @@@` 㿘`"  ` > @0` > @0   &   &   & @d 㿘 X`" 6``> @0.  ?> #`F> @`@e/ > @  & $ > ?&  ?> #`/> @`@e > @ @eg> @@ed 0#& @d!  > !     > <!8@   2   " ``"  @" ``2@ 㿘H /` * ! > a 0 "a' 2$ > @@dl!0 $>Ҕ|& P @# $ > @!H@d^@H 0㿘 P !H /` * ! >  $`"@# @^$ & P; H 0㿘H /` * ! > `" 2" > @@d!0& H 0㿘 H /` * ! >  `""&  H 0㿘H o *@ a > `" > @@cҐ!0@H 0㿘" \$  X  2 H        2  H  8 (    p> " $ ' >   h@\L " H /` * ! > @a@ 2> @ X&$`L`L "k`HS @) ` $`T` А $`TВ@:  %`> @a@  % > @a@  % > @a@  % > @a@ `T "> @@Co@Cl "@> @`T@d> @А! ""`HF  $`Hd  "d  %`L,`a,``$@$`"@`L" & @/`LH 0 `H  u "`L``L " h  h@\ؒH 0 b > @@>&!ȁ㿘 Ā "  @  ` `  `  2㿘  > @ L H #> > @@b!$a@  T@  aa$$А㿀`> '`"!0 @4#> ``#> ``  `@&@`2` #d#\#``d!0 \ > #`> @ @b`!0> @!$@c > @@c 㿘 o  `k@`"d` `  2^` "X` \ P \ "K`   `?? ">`  `26`   20`   "    `  ` @  4 2`"@`@ `@``2@㿘> '> 4a0 < *!@ > #`> @`@b) !0> @"8** "*  @~  4> #`h> @`@b !0> @"h@b`> @@b] 0[!> * *" d*V5 d@) $ d$4`!0 4 !0> * @*`"@d*` %!0@A ,,` `,`! $` ?$ ?$` $` $`  @  ? @? ?@4` `! 2  @ :@* ,@ `! :` ,@  (,@㿘 $ B `>`L :`H 6H /` * !  `"  "` L"  ?`@" "` " `L4  " L `H > "`H @[  h& H 0 $ ` `L`\`X" 㿘H o *@ a > `"H 0㿘@ h> b'H /`4N* !N  `> !8Q? !>  @@ϒ @ `@@̒ @#&   @> !8ǒ 2  H 0m  U `В @@ 'ؐ''''Ȁ``@@ `a@@@ Ȁ`G` ?`  P @@ @ `@@ @> #3&  ` ` a@*` * *` `*`* * **@  B8@@ B  ;$*`ב*`@`2`H 0 > @@;z"㿘 H /` > - H 0A * ! > !8? ,N@0 2 @ > #$  `АS Ѐ ː.  H 0& 㿘  N @z  @@  @ ?А @ "  ?А   㿘H /` * ! > !8&? ’  $ Ԑ H 0 㿘H /` * ! > !8? 8  $  H 0 㿘H /` * ! > !8Ւ? "2H 0    `` *`"`` *`   *@ W<W<VW<VYZZ$[|[ '"/@0@ " 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# 3`# "@` " 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# # 3`"@`` @" 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# # 3`"```@" 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# # 3`"`@ @` " 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# 3`# "` P\> b' @>6 lb #\#` @ؚ 2ʰ  m  :2 l V  2 < #6  lȮ , m  h/7/|s|o m V`7耢``2  T/  /``4 T7  2Xbm T 642`   7 2Hbm6(/`/`2 / 4 ?@H$@* 2`@7 u   ,  m@; 2   *`2  *` 47 Z  ?,  m@:2  ?*`2  bm `1>Ԑ *` € lb #\#` @- 2  l ``2g m @2b m@2] m@2X m@2S m > " > @@8"> `\-b@''X`R'\ e N Lp /آ`{/>  bH`> 햂B:`Ȓ#v0''@`3  `  -` -`$  -`( -`, -@{t` bH!x`?> @b@]C  ה> @@]", $ 1 (   " + e  X` e      \` e     ( 8'\ 'X  e  " e 'X'\ e `>Ԑ $*` €\{  e\X3  e L    D8 A  =  9 5 ! #\X \@X$D`?\@X$@`?\@X$<@?"\@$8\X8zǒm e8 \X  (*\XΐU e $   8#\\\XX  #\`H8\\XX  8\X  2R z}            z^ e -@ "@|0'@@#\ { 2 > #` e  > @c@\   > @@\]# > " > @@6#0p> "",' %7"h"j#\kހ > #`'> @ @[c@"j> @"h@\0#H> @@\-#F?`l`y6`T" ;"p`l #\#` `- "",?  `,`l""Ҁ """В" `V` X@>h""?c 8" 7ހ`27`lyހ 26`V  > @@6#x㿘> "!|!> > !< <"? 6"!Ѐ 2>  @ $!> @T!㿘`N " @ɔ > @E &"x @\А 0> c !>>>ؒb  d& l&!&!&!. h&!. j@Q&@Q D u@IĖ dH /f * ' > ||`&"|"|"b"|&"> !<.`" H 0  㿘H /f * ' "x> !<*`" "|`""""b"?"|"$"|$"H 0 @RM@!  㿘H /f * ' ! &!!` ` &!&!"`!?&!H 0 `@ 0ځ㿘@  @2   \"@2 \2 \ (\> ` d ' `` 2d;j?> !<*` `"c `D ^@:M d  dd8// / /''''d?''d' '8``(@ d:   $   ''#?''d /d' l'xv  lxr , V T77`B<```: @C`D@G<` b > @@5(#㾰> "''4'0  > @@YӐ#     N@ !> > @@Y#!АN!!?# @x8402" """'> @ 2 @Y  N@` "  `` 8 "`  x@`'`<.#l#p#\#`#d#h\,?7hwXw 2Ā 2`<`@```P`b#\w .`=4 0" 8 @ww6`b6``b > @@4#㿘> @R"㿐`j >  "b  @א$ #p "#p"#t` > A`#\"| (  @P &##&#&##&#&#&$$&$ ( &#.#X  5@ <&#P 6#L> A @Z 0> c>>ڔ">ᴘ  %܆(&!&!>&!. h&!. j& l&!8cT$@/&>`#@/>a@/#@O@N> A`@Y D @G > "" 㿘@0#@0$> "`> A @ƒ?@PW@AH /` * ! #  "|#@6 # 2#H 0@Q#P@  5@ > "" ᠀    " ᨄ ᨁ㿘H /f  * ' `@&! 2!H 0㿘   @  > #@Q &@   㿘@8Q!`  &  !> &  &  & $` & ( & , & 0 & 4` *`2`2`. 8. 9`"*`2`2`. :. ;`$*`2`2`. <. =`& @ & D & H & L` & P & T & X & \` *`2`2`. `. a`"*`2`2`. b. c`$*`2`2`. e. d`ț222. . . . `̓3 3 . . 3 . . ` `'. ` `&. @}``l Lǔ `#" 222. . . {. Ǜ2 2  `2  (+` * @  . . . . #@. . .  . #"@2 2 2 . . . . ` . `. `. `. `| ! .!L `2`2`2`. . . . `42 2 2 . q. r. s. p`82`2`2`. t. v. w. u`<222. y. x. z. {`@* 2 2 . }. |`B*`2`2`. ~. `D. `E. `0    . i. h`0 . j`0 2`2`2`. l. m. n. o. k`L2 2 2 . . . . `P2`2`2`. . . . `T222. . . . `X* 2 2 . . `Z*`2`2`. . `\. `]. `H    . . `H . `H 2`2`2`. . . . . `d 2 $    . . .  . 2 2 2 . . . . `h 2 $    . . .  . 2 2 2 . . . .     . . . . `2`2`2`. . . . `222. . . . `2`2`2`. . . . `222. . . . `2`2`2`. . . . `222. . . . `2`2`2`. . . . `222. . . . `ґ* 2 2 . . `.!`.!㿘   * *`@ *     > #`> A`0@V͐  > A * * *` @  @W @> A@W pu  " 2 > #` > A @V`0> A x@V> A@V p`] [  * *`@ *   >   *  **` @  ?> ` > !H$ :> $|*@> "(#؀``#Ѐ `  > !@N w    @@V $ L@O  H@J  D@E  @@@ ( P@92 8 4 \@2 0 X@- , T@( ( P@# 8 `* 9* a@  @ : b* ;* c@  @  < d* =* e@  @w`  h0 hS`0  M`H  $ $ $ $$  ($ ,$ 0$ 4$ 8 9* @4  : ;* @4" < =* @4$ ,' %,& @$ D$ H$ L$  P$ T$ X$ \$ ` a* @4  b c* @4" d e* @4$ ,' ,&   *` *  * @ $` `l * +   *  $`J1  >  ő*  Ɠ*`@c* ǔ  c"$`$`  ɕ* ʓ*`@ *  ː # * "@ # $` Ȑ ɓ*` ʕ*  ˗*c @ @ $` ,`   ,` ,` 4`  * 4`!,`!I,`  *` *  *  @$` p q*  r* s*`@  $`4 t u* v* w *`@  $`8 x y* z* { *`@  $`< | }*` 4`@ ~ *` 4`B ,`D ,`E k`2 `0`"  i 2``0 j*` l m* n*`@  o* `0 "  *  * *`@  $`L  * *  *`@  $`P  * *  *`@  $`T  *` 4`X  *` 4`Z ,`\ ,`] `> `H` 2``H *`  * *   *`@`H "> # $`,`$`d$`h$`#Ѐ #Ԓ` $#$#` 4`v  #А?7$#Ѐ `?# @`4`@  > *Ho  "`> *@p``?# @4`&   >  @M>  @M``H`"`0> @M#`0`> @M#> !@M㿈> !> bB ! `:!`\ @bx> "Hh` "``B <B;` ` ; B;` "`B {< ,  @Ζ쀢 2  `B n<   (`B b<(  * @ @ 8`B T<8a8`B P:8@x  "  C?# @ 񀢠*` > !ԕ* @ ` 0`B = 0Jg@r쀢 Ò +`   JPŒ@ߐ㿘 @UJA* * ` `*` `*  *N  ` @ > !Dq? 7`qF 2 `w4   '@ɐ  `>  n? n 8  `2` 2`w  2 `@ 㿘 7> > "Ha%> A 8x 8x 8 x 8 x  x   @S0> A@Sc > A@S` p`P`B <`P#  Ѱ 㿈 ! G  *` *  * @ uo' "  `€  @    㿘 D  8Z    /`.`(` 4& /`G /`.`(`' 4  .`. (' 8.`. (' <(7 @(7 B/ D/ E2 \ 0" \0 0(. (( 0@&  \   ..`/` L@& $.G..`/`@' L  .`. (' P.`. (' T(7 X(7 Z/ \/ ] H0 H(. (( H@& 㿈  > > *!` h +> '> #>  F  *` * * @ ts' 4`€ @  ` '`> #` > A @QӒ`0> A@R# > A@R  pP`B H M`H *` * *  @$`L * *  *  @$`P * *  *  @$`T * @4`X * @4`Z ,`\ ,`] 2 `H`" 2``H *` * *  *`@`H " > ɓ*` ʑ*  ˕*#@ @ $` ,`> #$`H`B *@`@v 㿈 q (> > *!`  P  > > @ > #` > A @PX`0> A@P!> A@P p`P`B D=`P D H I*` J* K* @ r' 2`@+ @Ւ ` '`2 `DQ @ K   *` * *  @$`4  * *  *  @$`8  * *  *  @$`<  * @4`@  * @4`B ,`D !,`E 2 `\`0`" `\ 2``0 *` * *  *`@`0 " `\ @@( 0J 1*` 2* 3*  @$`L 4 5* 6* 7 *  @$`P 8 9* :* ; *  @$`T < =* @4`X > ?* @4`Z @,`\ A,`] + `H` ) 2``H **` , -* .*  /*`@`H "_> ֒`H 0 1*` 2* 3*  @$`L 4 5* 6* 7 *  @$`P 8 9* :* ; *  @$`T < =* @4`X > ?* @4`Z @,`\ A,`] + 2 L`H`" L ) 2``H **` , -* .*  /*`@`H " L> M*` N*  O*#@ @ $` P,`> #$``H`B =`H@Ho  &`> *@` 㿈 2> !C   * *`@  *  '쀒@@ P qi 2``X`B <`X 2 @{  Ր 㿈 @%> ! C`  *` *  * @ q=' 2X`B  ! C6  *` *  * @ q' 2X`B  "`"b    " Z > #`!> l,`!X?@/!@/ @@%> #`D> A`0@NP > A*!8>  *  **  #@ " !$@&$!> "  > AX@? $"> c > A`0@N' > A!p@Nv > A@Ns p0> #` > A @N`0> A@Ng!> A@Nd p 㿘 @  㿐 *  **` @  >    > H /`4'* !'  +  *  .*`@  /*  @ ,@n   !* (+ ) * *+   $+` %@  "( &* + ',  #*@    02 2 02  02`2`2` `  `. $-`, . #. (. ). *. +. %. &. '+. . !. "ad     -* ` *  .*  *`@ `` 2 `(  H 0 )>  !*  "* #*`@  ad ( )*` ** $  %+` &+  +* '@  *   @8`H 0 0#` > A @M.`0> A@M~!> A@M{ p> X`B :X`> ! 0@: 0 > ! 0@: 0?㿘@S h> ">' 0  !@ 8cD8!!@ , @i0!@N $H /f4 \* ' \   @6 \@ 0 ?6 \@$d@@$c$c$cH 0 H /f4* ' (  ((& l@:@,& lH 0ٰ В @,Vbx``0@r( cT' cX 'c?'° @!2 ?  H /f4* '  8 $cT䀢  H 0 ,cX$cOЀ $bx  ?*  2`4@( $H 0| @H 2  lH 0o `l@ bx g l@ g8$bx@$bx  ?*  2`4@( $bx`-8cT )c\R`\ @2 '$bxH 0< 1bx@'  "@$bxH 0, 7  4bx,$,c\@+ c\<* @ *@@ $c\   4 , , , $ cT@$ H 0  > A@&!㿘"㿘000000.`.`.`.`.`.@.`.` 666.` .`.` .` 㿘@+U T222222.`.`.`.@.`.`.`.` 42 2 2 .`.`.`.` 82`2`2`.`.`.`.` <222.`.`.`.` @* 2 2 .`.` B*`2`2`.`.` D.`  E.`! 0    .` .` 0 .`  0 2`2`2`.` .` .`.`.`  L2 2 2 .`1.`2.`3.`0 P2`2`2`.`4.`6.`7.`5 T222.`9.`8.`:.`; X* 2 2 .`=.`< Z*`2`2`.`>.`? \.`@ ].`A H    .`).`( H .`* H 2`2`2`.`,.`-.`..`/.`+ 2`2`2`.`H.`I.`Jn.`K2 2  `2  (+` * @  > .`L.`M.`N.`O@.`L.`M.`N .`O"@2 2 2 .`L.`M.`N.`O .`P㿘000000.`.`.`.`.`.@.`.` 666.` .`.` .`  „6 㿘 *`#p  ` *   2* ƒp "#t"#p `*`#"$?`"`&#"@"""|@D2 #2$`&#?#$`$ "`$b`2`$&$&$ (&#㿘> "< (8\ @4D  x , @ƒ   > '> `B <p`B :p#  @ ``#@L> B<! p`B ; p|0# `\ %`%` >%`` (@64 4 ` `@) ,`> *`2`2`, , `#> `- `  ( ,|?` "`$ "$ $` @> @C @) -2   2 ,,,, " `>@$#?`c   `@@ $ 0 $ $" $$@)~ -2   2 ,,,, -#p3> `bL-*`    `€@,   #p "#t"#p@)M > *`L@ -,> P 22 2,,,Ǒ-D ` %` %` %`@6D`?%`%` %`x 2 ($@0"`B <` 8B <   D@N > ``B :`x`B :x ($㿘> "> !̀`> Ab@O  d$4`2  '`   6  \ @ €  # ($@  @j . ǁ㿘> "> !̀`> Ab @ c "B ` # 2= c b|c@8 b|@Ad  / `: .`: >6 # # c  $c#c`# c"@$c@ j > *Ho  "`> *`@û 0 㿐> "> !̀`> Ab0@ΐ @  ` "`$# ?"&& #?$# ?# @`2@ "|  `&   "|0     @MN  "|  #\   @M "|@B㿘H o *@ a  H 0㿘> "> !̀`> Ab@@o #` > A`"  @`2`> A@G"P㿘> "> !̀` > Ab@P  b \ @^ € ˒  € " # ƀ P@0L (2 Ɛ$@  ƀ  6  > A > A  '`` ǐ . #X :   `@~@I . @G"` > *> # "@ `> *Ho  "`> *@`㿘"x 6 \ @2> !> "#&#> AȐ@z $"> #`( > > A @G`0> A@G"> A@G p>  l#> c`#ĢaX, !@)!?ؒ@)`@Y  @ 㿘> " @@b| , $ $ $ c " c`l ($ $c$ c"@$cc$c> *Ho  "`> *@X`㿘> "`2 > A@G"  ƀ ,@֐0(   > A  ƀ  > A@ǐ@ > *Ho  "`> *@!`0 @FՐ#(㿘> "> !̀`> Ac`@2  : \ @6 €   € "# ƀ (0 (2 Ɛ$@x  ƀ   4> A > A0   > A  @p0 @m@8 0 @F#xx> > "'> !̀` > Ac@  b \ @ؐ@&z   /ْ 7/@lJ'@ b > A@!#㿘> .`"L@ *`>  "` > A> A> B#ؒc@F6'.`#p`"c`l (c c $c& #t & #t"$#t. Ɓ㿘 >  "> A> A> B#ؒc(@F '> + L@ *` c" #c `+  "`+   "#t  ? "& &  . ƒ cp c?#c㿘> " E 0 $#2!$ " 4# l (# 4# $#&"$"&" $"$$ $& $.! .! #X > *Ho  "`> *@`` $  $*@& $> "`$"bb  "b ?b""b"b `$*"`$"㿘 0@% !2`2`2`.@.`.``.`:\  $@!d222.`".`#.` .`! 2`2`2`2 2 2 .`+.`(.`).`*.`$.`%.`&.`'!.`,!* 2 2 .`/.`.㿘> "> c  > A @E`0> B@Eڐ H> A@Eא p> t > @V 0##$#t$## @J$##@0 㿘 H /` ##@" 0/* !  #$  l#" !(&# ƀ 2  ŀ 8   #܀@8 `  2#>  t#䀤`&#&#@  H 0㿈> "@$ߒ > #Ē   //> 7'cc/" '@A 㿘H /` * ! # `  &##@z   f 0!> "&# &#> Bh@ʫ? $"> c  > A @Dߒ`0> B@E/ > A@E, pH 0㿘> "# l (#K#$#$#E$#>  \@  > " ƀ2  " 䀢  㿘H /`* ! H 0㿘 㿘`    *   > ! @  㿘> > "b@="㿘"В @” @ @E$"4" 5 @Ḑ < 4"$"$"4"@9$"4"> B @E 0> c>>"Вb>   $!$!, h$!, j4 \%$!@($>b @"@:@9 D @2 > " ""$"́㿘H /f * ' @;@;b> b" "b̀2̔?""$""@% 5@" H 0 㿘H /f * ' ! &!!` ` &!&!"`!?&!H 0 `@ 0ځ㿘@  㿈> 0  a@. a@" \a a@" \  !@" \a@P  0!@6 0 b  bĀ w`@{  G(w (&H /f * '  l :@@aH 0W  @#b'b 'b67 F D@!2 2?6 28H /f * ' @dH 0 $b 4b $b \ b  bĀ `@6 \>   `B :㿘`.6 66`* +/`) ) ) ) 000(`(`(@(` ./ (00) #) "/ (00(` (`!6 6 6 /`.. ) )) ) 000(`(`(`(`5> (00) !) ;> (00(`"(`#) *) +(`((`)) () )(`*(`+) ) (` (` ) ) (`(`) -(`,) ,(`-`000(`(`(`(``000) ) ) ) `000(`(`(`(``6 ) 6 6 ) ) ) c` &.  ((000/ ..) ) ) ) 6 6 6 (`(`(`(``d `ń(c&> (&/  ((7 7 7 `...` ) ) ) ) 000(`(`(`(`) %(`% ') &(`&`dJ) '(`'㿘 &` > " @"̀  㾨> "`\' @2 [ 2  ?  8 I ?E 6O ?? ? ??@ 0@!1 B?   ? ??@p @! B?  ??@Y > B@` 㿘 H /f4bȐ* 'bȀ  `  &bȑH 0/ 7b|* @*`bȒ` 0@T > b@ b@2b`B :bb|`bB  >b &b|@NH 08Ȣ@ В 0@ ̒ 0    E    =   @  㿘H o*@ g@  H 0㿘"@" ";  \ @4&"> > `B :"~> * 22**#> *`" *  * 2 2 2 ****222** * * b2`2`2`** * *@ @ 㿘` @W  2 `>  7`B i: , b<$ b4 b* $ * b@@4 4 @-$  @4 , , 4 4 `$, 6`$ 3 *` 2`  2* 22  + 2`3 ?# 8#4 `D   `@u*`4 `D@-y ``B <``` 8B <`   b@D  > " B: ``C <`㿘> > "b @H&@* 2`@, 2 @   *`2  ,`* 2`  , 2 @  ?*`2  "㿘`    -   > " @h   㿀> "0''@=0b$@ b#@40"@ :"%0 "&@'0" @!0"(0""@0"!@  " 2 @O &  @] @g " > B@g 㿘  @ǔ  2"   " > `""`" " 㿘> "? "$ "@"" @i  2㿘> " "  @d` 2 2  > "  2  㿘  > > > > " "`x#> b ''ؒ'ܐ@d @$b > B@ Ёx#> b ''ؒ'ܐ@dt @ b > B@ΐ 㿘>  `@ > "쀢`> B@@!/ > `> +   b* "@  "   ?"   "  "  "   @ #`>  ?  "  @3> @S1  > 0 H(> `> *` (`?" "" " ""``#` `H  ? 0   `  > 쀠    x> "' "> "b> B@.!( x> "`'   @   #> > B"8!@ { " > B@!@ ~@}@  㿘`A  >  `> @Rp`R` > > "`8H$4("` H H(>  ` 2``?"`"H >  "  㿘> ""0> @6Ð#!> > """܁㿘$ @ > Bp X @> 0"?>>>> !〘"Ha%Ԇ   !& l6 \. h. j&"&"&!&!&$ &$$&!&! &!> `  ` >.$@ ax.$A .$B .$D.$C.$E@ $d@3А@3 @K> D 3@+ɖ H /f * ' !> @}H"0` d` d0`2d`&$`"0"0`&$0$0"d4$"0&$4H 0 㿘H /f * ' $0`"$4$4"d4$4?$0"$$0$$4@֐$dH 0@K1@4H$L "$H@ $H "$P@ $P "$X@  $X "@ @  >  0 " $<2 $0$F2$0$8 $0 2$< 㿐!> "0 1`/ 0 "0 $`  $0 $` 2$0 2$<> B@=ِ!`  > B 0@=А!  $8> B 0@=ǐ!ذ 㿘> !̀`> Bb@ #> %> H /f * ' "Ѐ` "` $b""`?"H 0 `"!> @ 0ݑH /f * ' "耢` "` $""`?"H 0 `@ 0݁㿈 > B`  !P @*   ` "@    '> B@=S"0 @і 2 > B@=G"8  @@> B"`@=< 0 ` *   *`  @ /> B"@=("0#@ @ `   @ c` @  @ *  *`   @ X  "3 `Y0TJ> B20LDE0GF@e 2 > B# 9  ې 21`00.@M 2 > B#8! @ @: 2 > B#P ' @#h> B#> B# /> Bc@;Y `$'> B,2 @  * ?2 c  ?!> B@@;#*`2 ` @;0ґ,2 @ ` P ǔe `0_r`0`2 d<> "0`> B@ B#@ C @< `0d> `*``1w @dd0^`\dd@4dF`\ > C @@;`0 $d<@ldd@0IH@}dd`\ > C `@;ޒ`0$d<>  ,d@ ,dA ,dB ,dC ,dD dP ,dE@ٴ $dPdX "d@٭ $dXd$dT$d\4dF$d@$d0`0> C> B"@; > B" @;0> B!P> C @;@㿘> "0`   > C> C> C `Ж@9" 0@㿘> "0`S    > C> C> C `Ж@9֔#@ `> C@;k!0=  @+  2 > C@;^!@02  `> C@;V!p0(  %  *  5   * `D@ @'; @   & `B<`@Dɒ0@5x> $8 b'2\@(@  A A"$<@ 8 2  ??耢/" d" c$@2 $B2$D2 \ 2@B$@`$F> C$<!#\@: 0`? @6`$8!@&`( `$8C > ! b > C@!㿘> 0!an @   a@a@0 !p@{1!o@Y@!2 N "$L@5; " $$8 h  "l$$8 l l?@8$ l$$8$L  @|  $$L@=!  @֤  @^Ӑ$$L$H " @b  $$H@#!, @֊  f @^$$H$8``0@^ $L.$L` @^"$H. $H` @^"F . C $< &$F&$|&$&$& $5&$ -$< ( '@$d$$<$$|$$>  ,$@ ,$A ,$B ,$C ,$D ,$E$8   l?@ e @H㿘 @  `   @( `2 @   $  $ $ $ 㿘$< ` > C@8H!$H  @~ $L @v`@Ő` 2 g 7 ,  , , , ` `:*@*$@*@  , ,$H`  : ** $ * $H,, , $L  ,  ,  : ** $ * $L,d ,  , ,  ,$` ,$a, $b, $c2, 㿘 \ > C"@9O 0$< L  "$|00!> `*`#`. H /f* ' $|  &$| \@ `@H 00}*`" * <  $d$| \?`&$|> C" @9  0$d@H 00aH /f * ' $  0&$>  .$@ .$A .$B .$C .$D &$<.$E&$ " $| \ > C"H@8Ԓ 0$|> `*``.A @J$dH 00#@ " $$ \?`&$> C @8 0$> `*``.! @*$dH 00@5㿘$< * H /f * '  &$<&$  >  \ > C"H 0@8}> #`*$d@ @ H 0㿘H /f4$<* '$<    \ > C"p@8V 0$8$@@$F&$<>  .$@ .$A .$B .$C .$D $P .$E@' &$P$X &$T@  &$X$&$\@6$FH 0㿘> C 0@8#" $&$<€>  .$@ .$A .$B .$C .$D &$<.$E㿘$<   $H  @ $T "$\`@$\ `@` 2k 7 ,  , , , 4`, ,  , ,$H`  4, , $H*, , $T  ,  ,$T 2 ,$W , $P*$T$T $\  ,  ,$\ 2 ,$_ , $X*$\$\  ,  , ,  ,$` ,$a, $b, $c[, 㿀> "'{  2`0 7 *  * 6`* * * *  ??"/ c2 /*****`? @3`!  " > C@"㿘$< 㿘$<  > c` $d 2@&$<@ 㿘@D 2$< )@DP0* @  2  `B >  * *$F 2`*$G * 4`* * D @" ʐ@Dn 2 㿘@1x   `a"a " " " " (" ," 0\" 4`" 8    "  "  " " " " (" ," 0" 4" 8 㿘   = 2; H /f       * '   2 0`" ` && "` ?& `" @  4`& & H 0 㿘  5H /f       * '   2 0`" ` && "` ?& `" @H  ?& H 0 㿘> C"@6,> C@4"㿘``< ( "?`  4;`  8+ @     d 4 2   (  @T   B<    4  2 <   @(<  < <   4 `,   8`0& `,€`@ `  $@$`& `?$`  `2 $ (   @ c < $ (㿘!> #< 2 @@:#< 2@> C@5#T     < 2& <K 1 @Ѽ 0@2 #<     @ <`   <  ?  ? @v< ?<   @n< < $ ( < & <@Y  1> # 2 > #  `>ax@ ٔ @ ے &# 㿘 H /f4> * '>   !܀ "  ! `! " @*ː  2!ܑH 0`> #  `>ax@  @  0> "#㿘 < > &`&@#< 2`* @ *`@\&@ &` 㿘 ` ``  `  0 @0@Đ0@ !㿘@/t  (   "$ !  H /f4!* '!  \!!H 0㿘N $ !> @D0"#< 2  @/#< 2 > C@3#(   0  0 @z0@0@ 㿘N $ " @20   0  0 @w0@0@ 㿘 `` `   @w@@ 㿘 `` `   @@@ 㿘     @@@ `! `29 `    * : "`  `02   ` @ `*  `(( `0 0 ``` Y `    * :  @"`" `@08 ` 0?` 8 (  ::8 2` *`` *  (( 2  *(000****㿈> #8` > > #`> А@"<> b"c@#<`X-> @d @[` > > C@! @!@d@N " : 4`, @,`b2*@ *@ b 2`* @ *`B2*@*<  ;@ @ dd+ 3`@+` b 2**@ b * 2`*` B 2* *@t%< @O`$#@㿐@p: 0(@(b2*@ *@ b 2`* @ *`B*2*;@ C0((㿘 x @  $ 0 $ ("$ $ `2$ > #L$ 2$ > #D$ 2$ > #H$ `$ # $$ 2 @L"@ 1!+ @4  $    <>    * $ > C#P@2$     *  * *`" $ '$ *  @?$ $$ 8@c+㿘@p 8@f   (:"@ H:` P:` X:` `:`  h"`( l"`, p"`0㿐 0 # (@c& 0 <"@<* "@ *`"  @*  " * @ ?`$ `@Q 8'< `  * <  ,"  & ( )& ,` $&& 4 & 4   $  & 4& , $@U: `  @Z "   p& , & p & 4````@6 ``@`"`&"``&@ &```2 h l & l & h X`B > X ` ; @ B > `& ,@? H`B > H P @ ; B > P 㿘'<&@ $ @p@  , "P  * : D 00;9 `5? ` (` (  ::8 2 *!  *  (( 2`2  @ @2`2`2`**** 㿘@`  ` "&@"`` ?&`" 2 "00   "0@a< 㿘> #P  2  *$ 2   @S cP $ $$ ?$cP@* $    ?&: &  2`,$ `` 㿘 ? & > cP2 "cP@ 2@"@@  㿘`@ `1`  @,`&X: .@``, 㿘@$  @""@`$̀@"&$$Ȁ@"&$ȁ `  `(   (  ( 㿘    @ " @  $@$̀"&$$Ȁ"&$Ȥ`  㿘` @ 㿘`&`> `> `> `> `& (`& ,`& 0`& 4` & `& 8`(& <`,& @`0& D@`& H`& L`& P@`& T`$& X@ & \@ ``\Ғ `㿐@*Ր "&     H /f * '  >>>Ș#`#\#`K H p@㿘@* 2a    @-%%@ & a$$$  㿘  2&  R$Ȁ`"$$̀`@Ӓ  㿀 "  ܀ 7 ,`    a``,``2`a"{     `   @@@> C# `> C#@/[  < @"4`" L @"G 2E ̀ <?  <  2  >#h #\ #`#d  @ >  L#\ #p #` #d #h #l@Ւ2  ,` ""$  <  "$Ȱ 㿘  "#   "  @ $ @ * @ 2"@ $̀"$$$Ȁ"$$Ȱ 㾐6   U ܒ  !!5! !& 㿘`   $> C`0@.#@) 7`4. 2 `$Ȁ 2& `@ 7`@ 2   `$  $ `C <`B> >  7㿘 $@  ` $ @& 㿘   `  $! @ @$6㿘  , @  @ , $  2& 㿘 p    @ʠ آ`@    @ʘ \$@$`L 沒$`P$`$`"$`@@$`<@$`$` $`8$`"@d"` @"#$`d & :  $`,$`,`#ǒ2  $`($`(`(h$`$#2  $`0$`0 '$`T    2l#@v#而 @ @ @`*"  d@ *  = @$`\"` H /f * ' . ` @ $`H H H H 2 H& H"@$`H`P `@'`<$`D'`@@`  ``` "`@ @S"H 0㿘  H /f * ' 沒@ "& & 8& "`#62  & ,& ,#.2  & ( & ( (& $##2  & 0 & 0     *  "@ @ # H 0 㿘   ,  `  %@" @ %@     $ @  $  H 2 ړ, `*`    P"       @2 "  4D2 `"  P 2 @㿘`4 @`H /f * ' @T`P @ `D  "@`P "`<2  @ `D`P"`@"D&`D `D`@`* `" `H@ `H`H`H2`H"`H`*  @2 `H# #   `*` ` "@ # `*@ 9#@ `PH 0`\ @ `9 @@ʠ @ʝ 㿀h@ '! $4  l4  `&` &`&`&`&`&` &`"@ ے#* " &`&%b  & : &` &``ؠ`܆`Ԅ`````@`   "" " " "  &`&`  " " "  \> #``d#d#h(#\#l#p Κ &`> D@,S 0" 㿐`   @\`? 쀣 + l  p   4  L 4$  L  "  쀣6l& $ p 6L 4L$ @ `, @@  "@   @  @/?㿘  ,`"@ 2 H  , & 㿘 "- @l &( `p@6    2@4   8     ے "  D  㿘 ``ԑ* "@ PK 4  l@ &D ` p@ $= @0 & l7& 4. @!  `쀢@ "# |$,@" # |` #  T€  l  & L` p@ $ L ``* "@ 㿐@\       l  "c&   ԑ* &  "@ @   6  `8  `4 @$  `"$  l m  ` 8`6  * %2$  L 2$  HՀ`2Ϣ Ǧ`"     쀢 6  &  `& 쀥`R   *  L% L & 쀦B@ 2> D@)J ( `2 , @@ ?"@  `$ `"@$  @2    H* " * "@  ؑ* "  `*`"  * " "   @ ! & `&@͐& 㿐@[:    K&   ԑ* &  "@ @     `" H l 2 -`2 H L 2 H2ߨ?`"     쀢 6  &  `& 쀥`>   *  L&@ L & 쀦.@P 2> D@( @` , @@?"@ H "@  ؑ* "  *`"  * " "   @  & `&@?& 㿘 @&   g㿘  ؑ* @`  `` <B`C <`<` ,  ,   K< <  <     = 4;    "@2 А"@@А"@@ @ 6И"?@ . ?/!  @ @$& И"?@ &   ?/!  `& & Ж"?@& @   ?/!  @ @& & `sд"@? `x `t " 2  $``($`$`ѐ<< `$@<@ ; $$ $`$`,6+ $`$+ # : @@ $`l?/!?@@ $`l`$`p $``( @4`4$`$ $`l@`$`4`@" `̐ $` $`t `P$`x  $`h`` <B`C <`<``P`2  *   쀢  @ `l  p  6 & 쀢 4&   * ' *`%   @ Y & &㿘 @ΐ ` @ * "㿘   `@@Ő `2`  "$"`  ?$ "` *`@ ?$@ 㿘 И &  p  l |@ " ``2 А"@@А"@@ 4 7 " 0 0 h> "  pВ@ "?@  @ ?/! l @ @& l& p d  ԑ* `@& 4& @ l   > a@А@Ғ㿘 H /f4 4* ' 4  & l& 4@Ѐ`@H 0㿘> D@& X㿘` 2 d ` \  `8 `"`&`"` & &  㿘`2`  "&"`  ?& "`@~ 㿘` 2@} \2  ""@"` ?"`" 㿐@"W "&     H /f * '  >>> t xc0#\#`͒ H p@㿘@"+ 2a     @ï!$@& a$! $   㿘  "  & @~ @ @! @_ ` `">   ` 2   @  ".  ܀`( @  2#  ܐ $#\#` ' ' ' ' ' ' ' ' '@o؀   㿘  "  @  ܀  @4   @  ܒ  !`@ I3! !& 㿘 @ "  ` @    ` 㿘` @ 㿘  "   `@@ 2    2& 㿘\ ?[`  @ݐ!  @ؐ @& `&! 2  "   "`  " k& ` ` 88 8   4" $l 4`, ,`@b2`* *`b2*@*@C3`+ @+`b2*@ *@ b 2`* @ *`B2* @ 3*  @Q    @ `*"  d@*  b &   "` `!@  `  @Q 0 @u&      @      @     @0 0 @T&  !(   @̚ "   " @ 0 @:&  !h   @ &&  $& & H /f * '  $? $*@  "   2 $?* 2" @2 H 0 !2$ 2  $`2`' ` 2`"`H 0 0- " @ "    `2   " @h  " @b  " @\   "@V @S  㿘 "z   t H /f * '   `" @ " @2`  " "` 2`  `  # ?* @ "@  !"!H 0@e! "    `2   `""` ` ""`  " @  " @  " @ے  @ؒ @Ւ   2    " 㿘`   $> D`0@$ΐ p0`4@ "`   " `` 2$ $@{Ɛ$ 7`@  !!`C <`B D@"  "`?$`К` C :`B<<А@Ж"0@B<0`  @   `@0@0@㿘  2  $   & @z?  $  `"`&`"` & &  㿘 ` 2@o 2  ""@"` ?"`"  㿘  `4 `B >!`! ; @ B >!@z  ?" `?" `2`  """` ?""`2!ؐ  @+ @㿘 @ @n! &!㿘 @㿘[   @ 0 >   >  > >!  >!  >! >! >! @8 4 $ 8 4  >!>! 4 @ 0 0>`@ C > @  @ > 8@㿘 4 @ 0 0>`@ C > @  @ > 8@֐㿘 0@ >`C  @ > 8㿘      ` !```?&!`"{ X ! `"   p t@ H p@B* 2` 2 !!@2 > H H8 > H!( L@ > H!(  !(@B:2 > H:` : p  H > B   (@j!(2 !!,2 !!( @ b >!(> !    &!> xa&!a &!@> P !h   (@: (@T ,> X> ` X h@8  X2 h \ l@( h X P2  T"  @> P   b`㿘    `?  ( >` B > (!   ?`?&! " ,  H 8  H  L  H:@@j b !(@ (  x@ b @ B  > Hp H@8  t L@   Hp x@ b B> xp> H@ !!h ,@ ( `> B#@> X Xf8  X2 X \(  X X f `@ B B > `> X X h@8  X2 h \ l@( h X P2  T"  @ > P   2t (!  : h??PT  8P2Ḁ (PḀ2P: h㿘  @ "" 㿘@ a  ""@ @ 2" DD8a "a "a  a  a   @  2! DD( !!""! "!Ā 2 @a`a a aĆ?a""a"aĔ`]@`@ @UD`DP  @ 8 a2 DD8a # Đ? "" "   ) `&  ?`@ 2a`DD(a "  ""a""a "aĀ`2`@    @ ` D `"`8 88 2!`< <(!! 㿘  @ؐ "" 㿘@   "H H 2 LL8"!"!     H  2! LL( !!""! "! 2 Ha"`a a" a?a""a"a`]H`HX 2`LLP! H 8a2 LL8a?"a ""!"! + `(  ?`H 2a`LL(a"!   ""a""a "a`2`H!   P 8 !  T ! 2 P 㿘> #< 2`* @ *`@** 2`  㿘. 6` .`@b2`* @ *`B2*> c< * @  㿘  (0 (2`*  > < 2  @ >@2<?? 3`+ @+` 2*@ * @ >` <  @ڐ  @# , 4`@@4   >`@ʖ ? c @ @ * 2` @ 2 E>`   + 3` +`* 2` <2    @ >`   <?? 3`+ @+` 2*@ * @ >`(:: @: `: `: `: (` : 0`(: 8㿘 2 (q(  B : 2(@ 6@(,@@ @ YB c   ?,4 ??4 @4 @@  @9 * 2`  2 @ D@0B@c@b8   ?,4 ??4 @4   @  @ * 2`  2 @ D @ B @ F 㿘 2Z  @8T    B & @@ !@c, 4`@ 4   @ז ? c @͒ @ * 2`@ 2  @ E @ &B @c@d, 4` 0@4 @ ? c @ @ * 2`@ 2 @  (E  @ B @F㿘@` @``$@p 2> @k> h> _@]` F  r  `@ G 8@2>@  @>> `> `B> (d4, @,`   @]b     B 2 ,( , @ @b D,4@4  @/ ? c @% * 2` @ 2 D> (>> > 㿘@&`& ` "& & `& ` & & & ` "& & `& ` & & & ` "& & `& $` & (& $& (`(> 0`0> 8`8> @`@> H`H> P`P> X`> `a& a& a& `> h`> p`X> x`h> `p> ``> `x_> > <> & ` & ` & a> a> a> a> a& `` & `` ` ђ `  `?(    (   ?( 㿐@ "&     H /f * '  >>>t"Ha$#\#`- H p@㿘@ 2!    @ T & !?" " "   㿘  "  & @^@Ò  㿘  "!  8  ܀*   @2  @s 2   ܐ   @q 2 㿘  "  @] ܀  @㾸峒  @J ܒ   @!  & 㿘   , @ " @  ,  㿘` @ 㿘  4  , @"   `" @   ,    2& 㿘.`` # H /f * '   `@H 0  `.`  .` @8 @  @3 & .`` "@$`" 2  "` "  "`& & ` @4$` &W&   `4"` $l 4`, ,`@b2`* *`b2*@*@C3`+ @+`b2*@ *@ b 2`* @ *`B2* @ 3*  @    @M `*"  d@E*  Ő &   "` 㿘H /f * '   `" @   * "  @ *` * @"# ?# H 0    `  @G @D  㿘`  ` `$> D`0@M @rT& 7`4@ 2 `  2& @rF 7`@U 2 0`   $` 8`C < B> 8> 0 7㿘` ` 7 @|3 / * "&  ` `@L `?$` ` 2   $  `B <   ( @ ; B < (ד* 㿘  2    t & @qڐ?    `"`&`"` & &  㿘 ` 2@J 2  ""@"` ?"`"  㿘  `$ `B > 0` 8 @ ; B > 8@q  `2`  """` ?""`2 0㿘@&` & ` & `& ` > `(> `0> `8> (` & 0` ``ג 8`2  &  ( " ( 㿐` @.`? ?*@   .   ` 2 㿐`   + >@㿘> cX ">  "cXcT> #> D "cT@ܐ  > X"  X㿘@; > D@̐ 0 > > D@Ð!0c\"""" ""c\㿘> \`@2`` "\`` @2``"`> D@! 0Ð > \"  22 㿘> c`  > #\  #$t V $  r`  2 $`㿘> c`  > #\ " $c` [   2$c`㿘c    & & &%& & $t@ 0> D@<! 㿘 4 [㿘!> #\ > D> D@'!00@$!H#\ '> D%>4#> D @`@: @ap  2 㿘U㿘 0㿘㿘@  @ @ "  JK2 ` 2"  `@2@㿘  !> D@ɐ!x@    2> "'@ Ц  > #'l'p'tv/x    @ "> DX!`t#> %> D!> Dcpt  t EC!`@  f`t `Ft@ @  > D'!> cpx@L x0@ { /x@p p> > "c" > # 'p@ l@ِl t> D!@H@ i2"@ V ?'lt `t@t "& pxlt a> #d`> #> #>  "cN@ >"> #> "c" > D@ؐ!Ё㿘N>4 f`?@Ŕ㿘N>4 f`?@Mʔ㿘>4@K"㿘>4@u"b㿘N>4 f`?@ 㿘N> ) fa4a4`?   #>4@b㿘N> )`f >4>ڐ!D`?@JH㿘N> (`f >4>ڐ!@`?@<ጁ㿘N>4 f`?@M㿘N>4 f`?@M㿘N>4 f`?@~㿘N>4 f`?@Δ㿘N>4 f`?@㿘> #"$`> D> D@k!0@h!㿘@l㿘>4@㿘`> 0 >4@d㿘>4@yB"㿘>4@v">  ĝ㿘> j!㿈> c> c'> > > "c##" %#c> c )> E'> %> E#> !> @  "$\@ $\@ @ cQ!> #`> "#㿘 > E@ (@ !> #  (> "'@w > E) 0@  *@k   > E@a  `@  ` @ @  > D! @> E X@@ &` В,``` "@#\#`#d#hĀ   @  > D@! > E@[ p㿘@㿘@!㿘@!㿘@ 㿘@  㿘@ 㿘> !h' a@! 4   @ h`  @:`L "h@ h` @  @ ߐ 㿘>4@"㿘`> E > E`@:      ` "`> Et Ȁ > Eo `2 ` * @ *  `0@9@   2 `",`0 @ * @*`   @  > E @:" 2  @ > E @: 2`0  @@ `0̰ ( `> E`> E  @@`@*@@ H?&`> E!( @  > E!> E!X@ 㿘   2 *  *   0@ )> E  2  * @*` ` @9 2 0 `@ ( 㿘    @ [  *   9 "2  @ -"@ '  02  0  2  "  02   0"   * 2""㿘 r 2@&@&`&  㿘 [  1/ '> !*  ``" *`  +*` `  / *** &**@  @ *`xlx`$l(P4㿘J@ !> #@^ x" #@p> "'𴆿 bL  `Ĥ@ H  >4 @ |> E@V!> "c`1>#D*` €      > E!@= Д    @ $> E!@(|  > E!@o Д    @ > E!@Zߔ  > E!@MҔ  > E!@@Ŕ  > E!@ߒ3   ^ > E@ѐ!%> E@̐!   ^8> E> E@!@!Ȑ   0   @@ "L@L`@66b> "c> E@_!ЁpN> "`'> * 8 8?* : `G*`>   €>4@  <> E Ж   > E!@h .> E Ж   @U> E@Z! > E> E!> E!@P > E> E"@I > E  ^8> E> E@?!> E@;!> E@8"" > E@"㿘>4 @ K> E@%!@    (+  2 2 " 2+J " ?㿈@ # @ !> > E=" > Eb0@7#p > E b8@7#p > E  #p@7 b@ > E @@` > E"H@X > E"`@Q ?'@  @F쀢  > E"p@@מ0@?'@㿘!>   ?> "#w 2$#㿘@  > #p@  < > E3" >  h > # >  # > # > # $ @ ݐ@ @ > ER"@k > E"J @^ 㿘@\   2> E6"  $ 2> E'"  $ @6㿐Ӑ / 0=  > E "   > E"  @'@ '@?q'@? π ̀ @ $@㿐 % @? !> E  "  " @'? @Đ $@㿐Ґ , @?  #> E!> EĐ b  " * 2 @'? @ $㿘̐㿘> #X`@Pu0@4@X@#@#`㿘> EJ"Ѐ`"> E# А  *`: ?Ѐ4 L@: @- L 2 ` * : ? 8*`N *`:  -@- L  > E@'# a?N`_2 @-Ԑ  z$?> E@# `> N"s'2 NЀ />  /> t  `V  ???'Ġ  #> t , `2  "8 v* `t)>#'Ȓ @ ˔Ȑ' e'Ȑ @ @̀ J@ :`$J@   ?  $J 2  `e> c "cВN@-N ?`#J  L@   @ * :  "`J@ 2 @ +* Đ" 'Đ _* Ā z`'> !> %> EL@   + `  *`: ?+J 2 # $#㬐(#@P M`b > E@#@LtHLL,H㿘 N@,r  c\ "@$c\> c` c\*`: @,O.@#``"@*@ې c\ #`֒"@ #`"$#`㿘!> %> ` #\#> Ӑ"#\ cdΐ"cd$`$#\㿘`~>$!|*` €1> > #d#\@ ( @, #\?&#\1> > #\c`:ܰ @,J#\ &#\> > #\d ͪ @+ #\cd? &#\ð > > \#`  #\@+J@#\#`  &#\ > > #\d  J   o \cd@ J  0> > c\d \  > > c\` 0> #\> c`|" I y k 0u> #d1> #\` m J *#\@+*@+ #\@+J#\@+J^ > D> #@  "D#> `@ $ D>  @'> H@%> +> )> 1> `D  ? $ D$ D DJ``D* DH@`@#` @$ D$ Dcd$\v%#`#` @$ D`$ Dcd D%#`J`e `c`*@@`#c`J  S#`> >  D H@  J@ >  @> c  `D  "D# D D " DJ D DH> @> #@  $ D $ D+>  DH)> cd%> %#`J`  c`*@@`#c`J  #`$\cd#`d"@ > E#P^ 1> > #d#`@( U"@> #` \["  > >  D L+> )> 4'> cd#`@  K`"KK@@2K>  @> c#`   " `@" KK"KK@" K cd#`@ #`H`$ D+@%#`Y cd#` H #L> #>  H *@  # H$H` HH* $HH #`$ D* 0%#`> > #`X @*U % ^ > \   *\ 8 \*#``$\@*:%#`\#`"@#` \ƒ"  㿘@> > > >   "#X"c\"`"d@* @ #`*#`cd"@8$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$DLT$$$$$$$$$$$$㿘!> # x # > > "#"h > > > "#h> P >  P> h耢@?J@`"h>  P>  T㿘> `T "`T@ 㿘> > " P"`T㿘0? ?߀ ] ?Ѐ ` 0 >  p O o T  t X   x>   p> " h h"$h /  9 7 0 ?Ѐ ? ?  ?Ѐ ` @?4ޢ?h?Ѐ  ? ?  _> Ee#Xx ?  ?  _ \C > \ #pS ?2,> EG#x,> # %> E#> EB? ?  ?Ѐ  _ \ :2, \2 ,, ?2,!x, c0,H `??*`>'! €> <   .4 0 . , * ( & $ "       <   >  > E@ ֐#?㿘> > ` `X@ >  d@m@HX @@$@(l @(e `X@> X$`㿘> EJc c#>  %> EL@(P L @(= c"$`\ q `\ ?`\?$`\$`\ $`\L  L@(/ L m 㿘>  h` >  \ ??߀ ] !> @(>  X> l`" X@ `X@( > `\$ ` "`\$`X`X'$ ` @' > \>  > "\"X"`` !> #>  d`X@֐ d $`X > `X "`X@'Ґ > X㿘>  l> X"@ > E@ #㿘>  p   > E#> E# > F  > F > F > F  6" @ $㿘!> !  > F@  0> F$!@  H> F>4 !h@ "> F@ ؐ p$!`> b> ު > L! '@ :A> '> F@F̖ @   @ ̔@ @ Ā> !Ԁ > F̀> F> F @  Ȁ    z > F@  > F@ | #L` @ ǒ> a<G`b > F@6 㿘@ ː " @? " "&@8  >  `& & > &@ x   &"x$ x> `p? "`p>  |`> F@ 1 > F@ ,  x   "x   㿘>  x      x  > `t "`t x ` i  $ xs@o> x  x ?  Jp"  > > > > > p" | "x"tJ> p`? > > >  # x"`| 㤁"tJ p`?>  > > > > "`x | "l"tJc>    x> >   㤁" t㿘> #T> a> F > F @ 0`)> @> F> !Ā`!$@% @    2> F% @ ! 㿘>  t @   ``+``2`` > Ft+`` #`"`""@ !H@ Y?㿘>  t  , @ " @-t 2  > F!p@ @0 >  t,  "  "  # " 㿐@7 > ! @* *`` :*  **`'􀢠! 㿘@-= 2N    @-1`?㿘@ 'D @D  㿘N  %>  tL : , ` ,`@`"`@- 2`` :`,> F̐!L 〢 :@6 >  t,`@%>   @W `$`@  㿘@L`@gL  2L@- 2L` F> F> F!@0!@㿐N  %>  tL@ :`,@  , @`" @, 2   : ,@> F_!L@ 〢 :'', >  t$ @)> F'>+`" `@J!А@3`? 㿐> !̤ `  @; >  t    @Ð  ` `  㿐> ?>   t '"`   @@:` % `` &㿐 !> &@ @  &@&8> !> b ' 8ה-> !Ԁ@ ) @ &> F!ƀ   @   > Fƀ!`b@  > F!ƀb @   > Fƀ!b > F@W"㿘> `@L㿘> `@U㿘>     㿘>   €㿘>     㿘>    㿘>  ` `@㿘>     㿘>  㿐 ' >  '> !< :>  t`> F@" "> F> F@"0!<@"P!< 1>  &#> #X` > F>4#`" @, > #"$` "> F> F@ǐ"h> F@Đ"p> F@"!< 㿘 *> F> > " a؀  #> @*Ԑcp   *> > #La #> @*cp L&   *> F#H 㿐̐ @  㿐'D @D  㿘  &@ 㿘  @"@ 㿐d > FD#H > F=#HV N > F/#`H > F(#p͒2  @ "@ 㿘> b, ">  "b,b(> !8> F "b(@#x > ,"  ,㿘> "02 > F2  "0> F@#0 @#0"""> $"0""$㿘> "0"08  "0 2> F@#㿘!> "0 > F> F@#0@#"0  #> Fc @"   2㿘Ȑ㿐#  㿘㿘> b$  > "0`> !( %> #> ` 8  8 @ @   2 %"$>  $h> N b 'h"  l b> G  > G   C?+> *)> >4] !> G     '@-!> G     @!̐  Ք 2&> G  (&%#%c > G@ϐ @(@Hl㿐` ?`>/"*` €> [ p> U l> O d> I h> ",`>  !1> !Đ'@' 2` "] 8Y &!V > ",` > !@I1> !Ȑ'@ 2> "; (&!5 3 > "4@* > !Ȁ`> 0 > , ``, > ! -`4 ` p @^ @  -  @*@`  `*``  @*@`  @ `*`*@`  @ `*`*@`  ` @*@*``㿘㿘ܔ@ * @*`*@@ * @*@*`  `(`  @(`@ * @*`*@@ * @*@*`  `(`  @(`@ * @*`*`*@*`@ * @*@*`*`*`@ * @*`*`*`*@@ * @*@*`*`*`@ * @*`*`*`*@@ * @*@*`*`*`@ * @*`*`*@*`@ * @*@*`*`*`@ * @*@*`*`*`@ * @*@*`*`*`㿘Ĕ㿘  @* ` * `  `(`  @(`  `(`  @(`  @* ` * `  @* ` * `  `* @ * `  `* @ * `㿘LDL8,(l                 `?> > G b '@? ?> G ;> G  7> G 3> G  /> G $ 2 ( ` '> G ( 2 , d > G , > G 0 > G 8 > G @ > G D  > G H > G \ `> G@ &`4 &`8&`4&`0&`\ @A@ > G&`4@ "`h  @3@  @T> G&`4@ې!" h  ` h a %> &`&`&` &`&`&a&a&a&a &a&a &a&a&a &a$&a(.`.`@ @ @@@?&a'''&a<&aD.aH&aL&a@&a&a.a&a&a'aB'>8؀ ;ܰ' H€ 3> a@b|@h> ab@`> aĚbԔ@X> "<#\> G> G xa@a<@> "\> G> G#\ aHa@ ' H€ @ָ" > G@!P㿘`>2!.` €@0@T0 &!́ 㿘 &!@ײ!@p!@n d@l `H /l * - !Ȑ? &!> #`> G*`" `*!@   > G!h@ H 0@a @^ h> "̢ @ 6 > "l>5`܀  "l `@ 0 2` @   @   @   @  `> "'' @$ɒ  ' 4 H€ 0 İ?b > G@S!㿘\@$ @$ ~ ?  &@@ 6 ( @**@``$, @@$ 2(`@ * %`*`$ ``4*" &``  &`(`@ *@`2( =.` ; &@@ 5( @**@``$, @@$K 2(`@ * %`*`$ k``4*" &``  &`(`@ *@`2(㿘@ ,`@ @$ 2 @`@$ 2  @ ''@` 㿈  >4'''@E > G@א! 㿘` "> G  "> G > G"> G> G  !!@+!> G@! 㿘 0 4" T &@ L` @ &`   @ &` `   㿘 4 P  0` 0` @j 㿘> c  ?  2` c * @ "0 !̀ " 4*  2!%  ` `$!`  ``2  @@ʒ!Ȑ? $!@ϕ!ȁ㿘     0    0 @@ 㿘> #  ?   2`# * @ 2!(  "!#  ` `$!`  ``   !Ȑ@ !Ȑ? $!@=!ȁ㿘> #  ?   2`# * @ 2!(  "!#  ` `$!`  ``   !Ȑ@ !Ȑ? $!@!ȁ㿘>   ?  2`  * @ 2!*  "!%  ` `$!`  ``2  @X@*!Ȑ? $!@Ő!ȁ㿘> #  ?    2`# * @ "% !̀ "!  ` `$!`  ``@ !Ȑ? $!@ΐ!ȁ㿘>   ?  2`   * @ "%?!̀ "!? ` `$!` ?`` @є ?!Ȑ? $!@X!ȁ㿘 `$ @ݍ @݆  ? & & [&  . 9@& & & & (& ,& 0& 4㿘 4ڐ h  =   t x 0" Ɛ &  "  = "     0"  㿘   @?"*  :  "? &   &  x&  t"@&   `<  `4€`0 &`X&``&`d&`.`.`&a,&a4&a8 `<  .`< `<  .`<25a`4 h  `0``4  ha `0%a> &a &a&a &a&a&a &a$&a(&`&`&` &`&`&a&a&aa > G` `> G@(!-   @!a 'a'a 'a'a'a'`'`'`a't`'d`'h`'p'l//.`.`&`l&`@  2`4  `4 @`0&a8.`<.`=㿘H /l4 4* - 4 4  !8 " 0 =  0€ H 0㿘H /l * -   4&!0`4 0€ H 0㿘L݀  4 y 2B0 @$@"@ " @+ @0@@@: H /l * - $$@H 0 70 H /l40* -0! > d+> G#`b*`" * > G  $d! @ḛ`$d 0 > H 0㿘  `&! 뀢 2  d'> G%> G "! & d@:  逢`& d 뀢  ! " ꀢ   `)> G'> G " "! & `@  耢`& ` ꀢ ""  &!Д@@I  逢`"  4 ,@ 0 耢  40@ 0 㿘!@&%܁㿘>8̘ ! @ښ 㿐"!. . @  耠 @ 2``   4 !  = 0@  逢 "  4``  #\``>? 0 <     `$>? 0< @  耢 ! 4`d ! #\`d>@ 0 x t x l !`(>@ 0x |@ l!@&!Ё㿘>  # . @ 4H /l * - ` 耢 " !8  40,@". 0@ 0.  `&  逢 "`N ܀ 2 4 2  4``" 4@ 0 4 ,@ 0. `@ 02 <`  < = `. <. = 2 <`2 &!8 < = `. <. =&!8& XH 0 㿘> #  . @`hL9  aЀ 2 a8!> G aД"(@ aЀ` a8  `= ` H /l * - `a0"@ %> G?0``> G  $`` ! @ a̰`$``  3`a0"@ 怎H 0a(@>`@ a(@4@ba0@$a0`  0H 0 #H 00H 00yH 0r #H 00jH /l * -  *!> G `耢  L` @] πԔ"8``> G  $`` ! @d a̰`$``   ۰a(` "& 4 4 & $ $ $H 0a$`0a(@٢@2 `  㿘H /l4 * - 耢   `  `@@ & ` 4 0@ 0.  逢  d  d@0 & d 4 ,@ 0. H 0㿘` 4  !  h 3 /2`@:`$`@H#`  0 $ 㿘`2  ހ  >  ! > "8@ђ#Ò㿐 &////@` @ٽ&  `+>2!*` € "/ U/  2   *?    *@*  2  /   *@/     .   6 > "p'!    `  b @8 8@F&@`   b > G@"@㿘> #  . @`L9 ְ aЀ 2 `!> G aД"X@ aЀ` ` a,  $a,a8  `=` ``&`@ B >``2`a4 "`aB a@^: `@ B >`a@U`"@&`a4"$a4``2` H 0 #H 00|H 00uH /l * - $@'> Gؔ``d> G  $`d ! @Ƣ a̰`$`d  $@a`$ " 4  $ $$ `逢`$`L8  @@x H 0a@Ӑ@b 2 a`0`  > #  . @aа  `4!> G aД"h@: aЀ` !@,!@ "a !@ "[ `!@ 0L@"aH @ "a8!"!@" a8= @, @5  b}@".!$@ "%!#@ 0# !@&!@ɰ 00!@"b~@ 0 !@0&!@ 0 "$`X`X "$`X  `H /l * -  " `=H 00,`  ,` `逢   @  `=   `耢 @}H 00a(a`a``@י&H /l * - a(@׉`&```l@׃" &`$``|`ta(@ѐ"&H 00H /l * - ```"@ ` : a@[`&```@U" &`̐a@֥$`&H 00Z@֛`W&>@OI J`F@`0B8 `<&$ €`075&\@`0 < `0€ $"$a8`  @ `=`'@d  \@`0 &  @ 㿘` L @` ` d@ @&@@  X @4 㿘>  # . @ H /l * - `A!8 2  = "  !0@`0 @` `!8  =`2`2 !4 2        @  L`@  @H 0㿘> #  . @ 4\@ 0 "9?X "5? @  /?L 9 2$ 0 , 9    H /l4 * - 逢  N ܀ @4H 0 0X @㿐 4`d ! #\`d>@ 0 x t x l `(>@ 0x t@ l 2 .  㿐N ݀ 2  4  @6 4  ``  #\``>? 0 <    `$>? 0< @ 2 .  㿘 <   4 뀢  `@2ޒ`` $`` $``(L`9`$`(`` >?`$`< 0@0`"$``` @$%L`8 "`0`4$`4$`0!4@&!4 䀢 '   `` "    @ (/`"@ * & ! 2!`  `!& & !@͐`  ! 0``  ` :` `$``$@ D$` 䀢 &  @ ` #@@  @  (/``@" * & ! 2!`  i``!& & !@~`  Y! 0```  M`` 2 =`$>? 0`<@ " =Ȑ = "!8L`8 2 !8`` @4!8  !8 2 ! `  !Ѐ` `   d. 뀢  d@& d㿘 < h h 4 ꀢ d @1В    $  $  (L 9 `$ (`d O>@ `(x @ 00F L 8 ` $  4   @ @  $ 4 $&`d 0   @ @ $ 0 $  $  " $ `d  `(>@ 0x @ C !Ѐ     `. ꀢ  `@ă& `` 86 `81 `   "`2`#  "`` 2` "`` 2` "`` >2X(` "`  㿘  &`&`.` .`  4 @€ 0 2  :  &`.`  4@ 0 H> "'.`"  4' H€ 0 26 4  '' D€ 0  ." > G@X"pH> "'` 4' H€ 0 "b6 4  '' D 0€ b 4@ ' @€ 0 b@ b > G@"x> "' &     轒 &  :  @"贒 & : @2` `2'g B[ ,'`4 '`D`0€ R` H`$`4  @2  ?'ؒ ΀ 03 / `4 '`D`0€ (`  `$`4 "`? 'ؐ "` "` "@i" > G@}"㿘 &` 4 D€ 0  ` &` &&` 4D 0 ` && h> @ "''Ѐ'`z ''͖ؐؔr` /' 4 '`D 0€ b`  \'ܖ`$`4  @2` ?'ؒЀ HР A 4 '`D 0€ 5`  '܀@ ''" , `$  `4 'ؐvȀ `Ȗ  ''` , ` @ѹ'@ѵ'Ѐ  &.*`&@ѧ*. @Ѣ& @"@. > G@˸"x> "'2@I F ` 'ؐ> 'ܰ  `$`0 2`@ 4'@ 0"` '܀`' `$ @@`'" 4 2 4  @€ 0 b@Hb > G@\"x> @ b' ` 'ؒ  4' D؟€ 0 "` "  ```"@`"` ``@`" > G@"0>  4 b`@'      ' ' ' '!'!'!'! '!'!'!'!'! '!$' '!( '@? ' `@?"`' `?"' ?"`'``?"' ?"` '`` ?" 'Ĩ  ?"`'``?"'Ȩ ?"`'``?"'̨ ?`'``  2 ` 2`  ` Ӑ  ''   ` ǐ  ''Ԧ`?`2``   . = . = =` !8  `. ="t`\@ 0 2& ='''''''''''''''' =  0@ 2 ?'''' ?''''&! &!&!&!&!&! &!$&!(& & & & & &!&!&!`   l,?"$,`,?2,`&`,,?`.  ``,?`.   ` ,? 2> "8t #pl,@6  $  " ,`,? 2> "8T #P̠L`,@ ހ 2, ,?  . `,?  . `? `2``! 4 ? `2!< % `?!`2 2??"`; !< 2*`; !В`;  2 ; "` !< ; 2`! 2`?"`!Ā  4` '''/@؟€ 0 2`?" =  _ = "6``@ 0 2̰`"K`H /l * - 4 1  l" =S =   逢  N ܀     =   耢  N H 0 2`?  8 (  8 & `   ?8 + & `?2 `?" `8   Đ" 4& `8 ` "( 8. `8 2# 8 逢 2 8 = " 8H /l * - H 0 " 8+ ` "' . 8 2"  耢 2  = " H /l * - lH 0  " > G@"Ёx> " 4`@' 2  !<&@! &`@!&`! $ &`!$ &` !$  &`!$ &`!$!$}&`!L`{$$!&`$`Xq`l`;!Ā 4  '''D؟€ 0 2&`&`&``)!@͉ &` !(@ͅ $   ̐" &`0  "@$0!,&`4$4 .`8 ,8 Ԁ@ .`9 @ ,9,:.`: <2  .`> < `,> .`? ,?!@] &`(!(@Y h$(!(@U l$, @Q!  &`, @K &` @G &`&`&``, &` =&`" > G@W" 㿘2!(!  h @)&`  @%&@ `" &`@ $&` @ &`&`  㿘 \  \2  &@W 0 2㿘 \   @  2 㿘> #  . @֒ 㿘> #  . @!Ѐ   41> G !Д"@c !Ѐ` 0!@ "*`D ! !@ "}@  08@ 0!@ 00    @6  \" "$ \! `8&@`H€ 02`@ € 0  `` @ 0 > * R`   > D"`8P> 4"`8D"`   >  `'  `"? a? 9 2'ad / `? / $ "`4 H€`0 2ap  " '   > G@Ű"㿐 4. > G@b#"* "  @* !> . $!8@*` @ !8!> $"` > G@Ӑ#(!8 ""@ " #@ 0 %> '> G !8X@ ̠?`> "#T> Gc`#\< Ȕ  @ᣘ <@哒 <@孒$ > *a8" > * "" * '$ > G$p'H$@뽒   > G@념#x Ē * * @ $   r   @$@"H$  5   @}   ޶$`@і  $`h @   2 (@*  @  B @ @  O : @W@ dr`  2$@($$ Đ$  5 `  &!: @&  &`"Ā " @Ӓ @В P $%  ""đ*` * :$Ħ* @*` *$  2 % $ 3$@1$"%` % @ @ > @ @  (%  @@ܒ%   $> " > G@E#㿘 Ē  ,@  #&  Ģ  @        @ <$ $ <   "@``@  ĨE @ h$        Ē * @r $  đ*`  *  @ " @:  *ؒ : @(<<  Ȣ *`  *   @ " *` *  *  *   ,`: " ` Ȗ*`  * *$ v$@ @>E  㿘? 2  > #T2 F *" * " > a8*  @ޒ  8    ` * x `@) ` "  @6 ,` ` " t" p t$ t$ p t p $ x@\ ́㿘?2  > #T2 *+ " * " > a8*  @  " "  p  t t **@$ t **@$ p t  p @ @#$ x㿘 D? @2  `@2`*`" > * 8" * `2  < 0  <(& 4& @& 00!  `@  <& @H /d * % @H 00H /d * % @nݐH 0㿐@`D *   @`` ` B Ģ@ D *  @! `< 0`H-#\@,`0``p "`p@$ `<  0@   p`"p@<  @ <D% ժ@@ 㿈   'T  *?      > >L2`@8@ `,`* @ C @ C 4@ 2`@(`@ oe : @Ȗ? @Ā    >  >L"?4 ?2  8?     ` %@  =  B?@ܐ * @ @:  誂@ B  @ -`0* @ `<2  : @  " ? ? @Ą?,`*  "' * &< @P?\#$`0 @$0$`,@ $,E <$D$<$$T$H$$$  0@<@& \" ݔ Ȓ $ $ D$ $ $ $ $㿘> !̀`> Gc@a `0("`<`<&`@`<`@`0" @ϵ @m㿘 > !̀` > Gc@a  0(""  * @ओ*`  " `> G # 0($ 0 4`" > G$ 4#> G 4# @畒   &     "  "  #> ` <@֐a<a<@Ӓ @("> G@# $ @㿘?2  > cT2 *" > * 8" * @` >K>ג!,@ 㿘?2  > cT2 *" > * 8" * @` >K>ג!,@”  x? 2  > cT5   - "* > "8* 0b- @ '`  eϰ  e`g@`f@  m@  "@  0"@ @^   h@"g`e e@ "\` r s@+ 0@B  m@ 0 e g@  f@Q "@ 00"@ `  #@x  t`̐@  n ' `''  @*   @* خ* K$  @ " : ,    @ & ,`@  '? $  ,    @ & > "@* 8"* @@ĺ ؐ@& @# @0> - "@*` ً &``&$` @i`@} @Ր `̐@    `x*@  `p " ``t "`@ϰ  @%> -     ``@;` @װ `Ā@* ``  `.`@``@ǒ `.`  2``@ `@ `,  ?@$``@  @@ @rH/ /@j@+ ؑH 0u `̐@  n  @! @`؇!@{ @FZ `̐@  S@ߖ @7K n!F &`*`` =&`̐@m  7`$``@ 2`@2`? 2  @?`5# @ `* * >K`@Xha,` @$` "  0  ` $` ?$` 㿘?2  > #T2 6?*" * > " a8*  ` > 0  ! " ?? *` ࠀ?? @ B > 0  X ??  @'''''ܐ @U < <  @``@ , ``H@J   @``@ 0H @ &   @``@  㿘`@!`   6p&<`&( &, &0 &4&8> H`@   6> H` @  aW &&6r&X@e`? 2`  ?6   .  6* `>Ka,@W㿘> ! 2 ! ? > > H@Đ b b @4  * > ֒bl*@ 㿐> !`!> " `@O$" @_  6 @ 6  `*`> ֔ "l*  㿘> #X` > ! > * bl* `@  㿘> #X ">  p! 2  3  `*`> ֔ "l*    㿘  b@1> #X   @ߒ  2&#X #X ">  p! 2  0 `*`> ֔ "l*  @㿘> #X` > > !`! !@㿘> #X ">  p!   2 `> ֑*` l*  (@  ,  € 㿘> !` ``@㿘!> !   € !  €㿘> ! !> #\?$#\#\  € #\ $#\㿘> !      P0 w@ w   @.$$ږ g@Τ$ 2  $Ֆ X (@@H.`@`D``, @` '''V`@O 5`` `( @?& @ @ > `@j `@!V`@> !  &`>`X>` >`8>`@>`H>`P 6` @&`(@ @b  `@ @Y(@   >> b4 0` @ $h  @~  > H` 8@⮒$#S ?  '''''@v H`  @ ; 4`27 @D 0 `- D'D @~l  D    '?'''''''`  @ D&@&@ @@  ` a4 a a ` a` a` ` b ` c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c c cH i i i i i i i i㿘 Ĥ @  *@E c? ׮  ` ? 2: 2  3  *   * Ė`* > @ #?,  ׃  @ 렄? Ē `*   $  `@>  Đ `*@&㿘 Ĥ D ` c? W  ` ? 29& 2  2  .   Ė`* > @ #?,  -  @ 렄? Ē `*   $& `@> &㿘'>T!L!, $@8 8 $,` `  "? `,` ̔  6 >&%&!* Ĕ *@ * *@  *@!`@㿘 Đ *@א! Ė * a*@ ̐"* @㿘!   !`@@!  @Z ! @<㿘!`"!@!  &!% 2   Đ  ``*֔% &%@4!`@㿘H /d4* %  > H@࣐ 0  `4> H   @  `& !2  !$ * *`@" ! @H 0㿘  4!` `H /d * % `!  > H   @\ !  > H@Ɛ! !,    ``8`8 & ,@Lz0),$ ` 4`#   ?# #  #  $# # # !( $!(2$$! @! > H@ލ!@H 0㿘! 2!> H@}!h 2 > H@w!  @ "!> H@j! ,  $,, 23! `"  $` `> H   # !$,   > H@Ԑ!$,$ &!&! $ *`*  %"  $,> H   @߾! $,! 2&!> H@(" $ *`* @" @C $!(&!(@K&!㿘! ` @! "!> H@" "$> H@"8&$$ *" * !4 !,$@ " ?- ,@ a, 8`8!4  2@   !`@0&!@s! -   z> H @N"X!%` &!p&%, $"&!   &!  `&!$&%&%&%&%``0  > H"@) $, &%&! &!$&%&%&%   $! &!<&% 9b !3&%@2 ! > H"@ &! ! "  耢"  !$!@& € "   `" @   > #`S@t# @Y @N! "B!㿐! " > H@<" > # @`> Hԍ  ̀ @2Ԅ   2 > H#      *@" > H#H @ޔ 00  Đ *@#)> [  "  Ģ`> H#h@|  * *@  @ #? =  ` Ք? > H#@] U! 2  > H # * @ /> H# @F >! *, $0> H!&! &! &! !&!$@&%&%&%&% *  Ȑ $*@   `" @  0*"@ 0##@  !  Đ &!*@Ӑ   i &%&%@ ̖ *@ *  @*! ?&!㿘a  `*`*@`*H /f * ' ` *@`Ȑ *` $`ӕ `İ? @ @ Ӎ ` @ 2 `Ĥ *@ӄ ` ` "`*`*@H 0ӐT *`*@H 0` `* *`Ġ*@^ `Ġ * X` @'a?O ` `@?  `*@B ` `@2``̐ *@`Ė *`Ȱ *@`*`` @*0`Ē *a ``Ȑ $*@ 㿘!  ̦ * % @ %Ԣ:4$@! ?&!%&%Ԣ  @> ` #?   `  ?   2   2 ` "!% 2 ! Đ  ``*%! `&%&!! 2A Ā`$ % 2 ! Đ  ``*Һ%! `&%*&!> ` `%*  &%%̔ (: ``27 ``%̐ ` .`$  %̀ %͐ @$ ` Ė* > @ #? |  @ Ơ? 2 Đ *@g `` 9>R"L*` €]%  % Đ  ``*S% 5% "9!H ` `& B! % !$=%  &!  8&!$%΀   > I @_ %> I P@Y % 2 % Đ  ``*% Đ &%  `4( % ` &! Đ  ``*% &% Ė* > @ #?   @ ܠ? 2 Đ *@ݤ㿘 ̒ ! * Ħ  *%` %Ȑ%@z@$@%% &%&%%%  *  &%&%` 2&%>R"t*` € 2! > I(  :     2  .%       .% > I @۽  .% > I @۵  %K&% `@N> #z  `  ? 2> 2   28 Ģ2 %% 2 % Đ *@Z %Ȗ&% >   *@ *#K  ` ?  2 Đ *@ `4 % o` Đ *@`"㿐!  *` /   *`// ///    L @` $ ,!%`  &! Đ  ``*% &% 㿘!` @`> I<! ̐*@4 x j !  `> c`* @ > I!(@ 0[2   @> I!P!$4` ` T  В  @2  ; > I!h@֒ $! "  !&  @) `*!$   ! !  !$@ " $!$$! % ` $! Đ  ``*w%  $%㿐 ̔ !*@   > I& @ڍ! 㿘! 2!> I@!2> I@! m  @ @> I@s! % ,X` @> ` #'> I? ! C -8/ d ` ? @2   >R",  €-/+'/#> I"`@2!%`  &! Đ  ``*% &%> I"@ `&%`")    @ " ! &! @ ! `" %    Đ  ``*% &% ` > I @"%`2 % Đ  ``*Ϯ% &%`^``!> I`&!"@˒ ```!$ `> I" @ٺ &!$!$% (`4>  `c@|  `@" Ġ? > I"@ٜ  Ė * Ș *@ ̀`* *  @*  &%&%&!&!&! &!$&%&%㿘">[>[̐@  ! @ @ے !㿘# 8  >_"&##h#@$6#p 4 6#p#@  6#p#p*#h@ #`*` ; : *`@ @ #6#6#&#l&#d6# +@`  0̐ >\>^!"Da$!$!$>[#$!?`"4 \! $! "@6$!<> I@#@@R@b 㿘#` @㿘#  ""`"`#Ā€㿘H /f * ' @ @9H 0㿘#\#  #c,@ #4 @ 2#?Κ #4 @`2#?#`@㿘> I  @oc( АB< Ё㿈> " 8# 4Z#\'# 6#r6#t6#v, #^`"#P#P,#@ H, #@ ,#D, #]#H , #L, #X "#$#<,#$ # , # # 8, # ##, #T", #4#, #\# A, ,@  ,# 6##4#, #\# , #]\! #H,#L, #`"#\@#\#, \`@ {@ 4\" > I@ސ#@㿘 \ $@ @crcp@2! \$6 \ !€  !! 2!!    &!&!$ !?&! t  2 D> I@a# @ ct* @c`*` c @_@.ސ <@*ctcx* 4ct`*`cp2  4ct4ctcr`*`2  4crcv`8c  @4cpct "cr> Icp#Pcv@ cr 2cv> I@#*  c\+ c`,cv2* c c(* @, c,,c0, c\c , cv`*`cp2  4cv4cv g4Z㿀# #\# B- #4 # | #\# -  ###l" #* @# #"###" "@ ? !  * + 2 > I@8## #> I#\###d#`@*(#@*> J#@ *2@\> J  @В`H B> 06### #$#-#@2#~#\㿘# 8  # #\# ,@ #4 @ 2#4 ,@ 4 `  #4,@ #4,@#4 @ g`#r b#, @  #( @``" `B <#( @B<ࠒ `\ B ;<4\4Z#r*`2 <6#r#v 8#  @ #p#t "#r> I#p#P#v@ #r 2#v> I@##x* #\+ #`,#v2*# #(* @, #,,#0, #\# , #v`*`#p2  6#v6#v 5 Z`Bw<0"#`B <#`@0Ր0#\# ,@ " #4#L#P @ @ #T @#4 @2[#4 㿘@ H /f * '  ! "(`\! L0!5@0 !6<A@- @ 4`\ 4`\ ` )`@' 81 4@  2 `\$`\ @&4`\" 4  `@ `@  40` 4 9 4 @o"@  8 4 `\ @ " H 0㿘. 8@[2 2  `B >  D`B >  @ @ڷ 㿘 \! "6 \ `.@@6.@01`*? 6*" @c    \"6 \ `.@@ 6.@0 @B2 2 @  *@ .@  2  ߐ \ =6 \㿘8 @*y  L.2 &  &  E,2 !   @+u(`5( ,`   ??" $@ & ,`2 8& 㨀 @$*`2     @*    & đ,0@, 㿘#h#? #`+ ?`#h > J#` `@   &#` 㿘#  #`"&#@ > J @ؐ   &# 㿘#  #`@&#㿘 8#`""ȟ@"@ܒ?@,@Ő #  * *  (2*0#d@##f (0?  ?+@``(0#l"*0  *2 @#` ` `  +@  @`2` 㿘p  @ \ *@ $   $ ##  0 @##  (Ȁ@ \   *@ (, ` @ `?   " ,(` 0  @ " ``@ 0( * (㿘#  *# ` ` @"`@ " #  "  $ #  $ # ## "*@>[>[@ > # . @ @   . @8㿘 $ (D !> @tR"@tP@to"`( #$l@ܒ$ 1 ` "` $`, ? "$ $  L$l ?`$ L`> "@0`   #@t@> J! @ !> 0@t4 㿘  (l @5  b~@b}@##kf@"'ej@"!$ !#m@" #g@!#n0#o@ " 80#i@   #h`"  !> @sɐ"@sǐ@s"Ԁ` @    #g@P cf@C #k@`ce@% 0ycj@rcl@"6Lq 0#i@ "E #o!#n@4!#m@> 0_@10#h@# 0W` @> #`J> J> J a@ږ0B@? <$L@+8@3@d.@)@%@K D 2  " @o "H@oH&L& $D$L$H@B@sM㿘 (`A !> @s""@s @s?"`( @`@s5  -㿘 (!> @s "@s@s&"`@D @  `2`(?%> ` "` $`, "@" "@ʫ `(2` @z` ``H "`L@o_`L @oY@r (@p L& ( 㿐> > J"ܚa #\(  @ > > J"  a0#\  @ > > J"@sa@  㿐#d@J   L@n% P> J@ra@&``&`&`(`(&`,&` ` &`$@| 2  &`8 ` &`<` @OD&`@ @oʒ L0 2` 2 > #""`(&, ?",`0?"`0`, @`0㿘@@ 㿘@u>  "    0@ 㿘%> @r9 ``@r2@rQԒ?@@m@rH&  0@rDԖ 0Ho * "`㿘!>  @Ȭ"ܰ"@Ȩ & 㿘 `!> @Đ"ܐ"@㿘#> @qb 2 @rb0@q@r bԒ@`8@ 2 > J@Ϲ!P`" ` "``8@@q㿈> @qǐ"` '   `a @ & @qא= "  > J> J> J!`ap@v"@q@qƐ`8 "`0  !@` `<@  `@ `?2   `2` @ ` a-` @*`  @@q  @o@/a$(xU @ @qR` 2 @qmӰ @qH@qgT P 2 LT R@0Ā  ?$ L '@D   $ U @y ` a  L  @ X@$ \ L @  `@$ d L ?$ L@q, @q` @q0" L  @ X  2 L \@x L ?$ L L @ `  2 L d@ L ?$ L@`0!@"  L ``8 2 L@p0O  ?$ L  @p@pސa"` `"@O$ @@p` * @p@pŐ`   2 @@p`  @p@p U #\@Ĕ0 @p0@p0@p㿘`  @z$`0" Ho !"`㿘`  @y$`0" Ho !"`㿘> #`> J> J@!`@ϛa` 3 ` T@. @* )`6 P`*` 6 R 6 R`   L & L` "` L & L`& X` " L L @& L` & ` L @& L㿘 l`@$ 㿘ܰ  |  `  v  2 @m0 Lܢ`@ $܁㿘܀ & 7`@韐x 2`  L@kL @L` ܰ * @ *`$ܒh|$  &@"``"`@l L㿘@ "$>   >  l>  #`> J> J`!@a`#8 @f 2  7&`#`> J> J`!`@a "u ` @   "k   2 "d `@ "^  "` `! 2U ` `"&` @&` ` "`& $ ?"@$ $ $$  $"@& $   `5$ `!1$ #` > J> J`"V`a@ΏV` ` 8#  " ` @      2  V`   ` *@   L2  "  H5` 㿘> #`> J> J`"(@Nb0 ">  0 ``  `2` & D & H & L` $ @j` $ @j p>>  0c   > J> J@"@`bX@``   " ''  `` ` ?''ܒ'''''@w `"@&`㿘> 0 @qm  9 `0@"`82 # 8@b, 2* @"`$   `!@@wՒ `8 > ", 3@㿘!> @n9" "@nV"`h㿘'> @n/``2`@nJ0"dx@n%@nD 8 `  <@  @ @n20 $@ː@  㿘 J`$ "`@kL L$`$` @:  a ?86   (+h'(% 8'  ` (  L@iV$$`$%$`$` Qd 2 `$`$ d&`  @k  L$`$㿘$x@灳6`  :  6 2-6+ @,& `   @  @ ё,&ҡ-H (  ("@H (@(H"H㿘 $ " H@j L& $ H   ( H?* & H"  H ?㿘!> @m<"  `@m7@mV"8 ` 0!@2   < @2  @ ` ",`lL`l `l @Д$ $`h,`l@m.㿘%>  $@m %   @l@mԤ ( H@ ,`@u 2`    h @g l " @m @lԀ  &  ?$㿘    2 x  㿘> #` > J> J "h@bd  0Ho * "`#   L  ?& L@W ? L " ` "` $ , ? "& & ` "`$  ?"&&  ?$  `@d㿘`? &` 4?& 4``"@`@i L@``"`& $`?@"&@&`> " @ `8"""" "  "  " `0"`H "㿘`4 @> `8 > `   2 @> " @¥ > * #`> J> J"b@a.` L@g|  & @&  * `@& `4 `0`$`4&  $`0& &`$& `$"@$`$㿘6 &dx  &d|d @"@ `?$@@J 㿘\dx&dx7  "  "d @"@ `?$@" @," 㿘`dx!  .dx +` +` +` +` +` +` @+`㿘``  &dx` @&d|㿘 $l`!   T 6 T2 &$l" "? 2  L   & L&  , &  ,"$ , L & L@kt> 0!> J"@ږ  ?` "  L  㿘` &`> "@В > #` > J> J`"c@ʎ $$l`$l"` $x`?` 2 "@$  , $  ,"@& , 㿘>  @"ܠ> #`> J> J`#@fc( $$l` 4$v$  , $  ,"& , 㿀> "'''  @ƒ  !l@sz `!l@sٖ"!l@t"b`B ? @n" ޶" > J@ڐ#@㿐 1. * " * @f4 > > J@#P0"" l  %> '> J  lx@j!p?ax> "#> Jc#\   @ @ؒ @$㿘? 2  4 ` `*`4 g@ *  @+  @ 2` >  #3  w +  * > `l" * !p@jÒ  ih`!d " ` 4 ] !l Y`!P@ 0P!P d  ?d$!P @I ?  2   * ` !P2 2  ` `  0/!P !P*@$!P !P$  `+ @ `" "   $  $     $ @j!p㿘@Β!aX&(a\&,a`&0 &8@aT&4> Jc@ʔ  6> Jc@Ô aT   6p&<&X !W &&6r@?  26 @  .  @*@ @ 3  `@ `?@  @ ` *6 >kcД@;㿘?  2`6  `* 6  g *`  .  2  > c6  . * * > `l"* !p@i   `"      * *@$  * *@$  !p  @ @iz$ X D? 22`  *  F * *`@ 2  `@2`*` * > " l* >`0P ` 0 (& 4& 0H /d * % @NFH 00 ( 2   @@" < 0 (& 4& 0H /d * % @N!H 00ܨ & @ 0 (& 4& 0H /d * % @NH 00P$@p  4 J> J> J#c@!H 0f Dd 4 l " 0 (& 4& 0H /d * % @MH 00֘ +      `(@ 2 B  @ @ E P5` 0-  8@'  @-`  H >`d'`@є>`@#d  ̘@d @ ?" @K`&@ *H /d * % > #@. H 0# <# 0 8# 4# 8`4? ?`| # D# D< # H < B;  ,>n!$# ,# #  #  #  #  # # # p'#  0# 4(# 0 @%"@& @H /d * %  0@ `p "`p@Lc H 00 @;3БH /d * % @H 0@ <`EN㿘@;3 Р @X 0 0@ `p "`p@㿘 ? D F *`   2  2 * @*`> "@l*` > !̀`> Jc@@(  4 "  @ 0  $ 0 4$ 4@K$  ` <" $ @@K`@;.> #@ 0 <  @`0@" 㿘? 2`  6  * 6  *` ` +`@ 2  `> @c3`@ +` > * l" * @aP >k>ג#Ж@g 㿘? 2`  6  * 6  *` ` +`@ 2  `> @c3`@ +` > * l" * @aP >k>ג#Ж@g]  㿐 | @Ԁ ` `h@    㾘? 5 2`  *  * @ @> 5  ',2 @o  4> 㼀6 ,* > " l `h* @ e e@ "aP  r s@ > @  m@ >  e g@  f@ "@ > 0"@0"@9 > aP`Ӱ @ap ˰ ap@f3  Ķ` Z `@ > J @P > K `@ aP@> K 0> K 8> K(@7   > K @@@e  @$aX $a`$a\' ''''$aP*@ $aP @~W   aP $aP @~K f`4  ? 2 (24  @}aP@    @@erM 4 2  $aT `@@|*  @}&aPaX` @ $aT @}t$ad @0 2aP * H H& aP@    @~@e(>   @` H$al@mp@ߐaX$alaXaT >aP`0 $aP@$`L`@82 @e aP Map@eF  ׶  `*@  `  ` @dİ @$al @`Hal@b @8`@ؐ`0H/ /@dА@!xH 0 \?"&\\@ `I*` * "  l* aP`  @@{rad > `@? ZTX&`y&d&dv&`aP$p  @_! `Ŕ!@a a aP$Zp W $Q`!O aP$H `&`*`` B&aP$<0ap@d  7aP$aP`@= 2aP@2aP   ?  @*>k` @6cаaP ~@d7$aP> 2  aP" =$aP  > " > K@ `p> 0 @m$!h  @_v"!T'!X8"!d   ?''''''`@~ޔ!h!d@z۔ !d @|@a 㿘> #*` > * l" *  !P @!x* @*`"@`l*` *!P㿘> 0 !P!d ? &!P> K@r p@  !h@}? @m+!h&!T&!d&!h㿘? 2` 6  * 6  *`  .   2  6 > . `l* > "*  P 2X?? T62`  㿐 >   `> @:> ".  . :  * @ 9  %" $ &  & 44:? < ?#`: `: `:`:2``2 2 `l> @A# > > cА" :  &  0 ` > x`B P:x$$$c> "`@:<Ѐ@  #c̀2 "> p`B 6:p"> * @" "  ` `,`B ; ` !c̒`АB  ;@. !  8 @B 8B :  `   @| @Aǐc㿘@> > K,> > c(  6.@`"``*c(ff(c3dϲg.`'a. `.(/`@`(0`!ʐ 㿐> @A7#>   `"> @=>  `hB:`h'> +> ' '@Ab @A @B = c̀>   "@ <$$Ѐ2@AE(> "' `%/>  -> ` ,@O\@Oh@O&@  `䀦` @@䏒 X@䌒  > K@ 㿐!> @@ >  @@#> `B :@@ 㿘%> @@> #@+> @B :@@ڐ؁㿘   8  @ܒ @Ԓ@> "'u @>  `@9 %> +> )>   * ( @@[ؒ`` 4 # `$ #Ԓ@ @@@ؔ @@$@@@@ؔ!#`  B`B ; ; @@uؐ@ @@! > K@R 㿘>s    @ >  p@˒"X㿘>     > > " "#Ԓah@I㿘> !h  a@ p2`  q > >t`t @֐ pÐ > >s `@Δ   H> ` b  ' K @\^ ( @ @@@h&@| @ ` &' 8!`@3@}? ``  @ `` ߒ`@N!@K@] " > K@ ȁ㿘` =  @\ ) ,  2,  :`ސ   `  @{ `  8#@| ـ` Ē @@]  ~@}@  㿘   `  "@ "   x@@VB<   p@`"@ `@  ":@? "@ " h   @' ' '̐?'* '% '" `@v   P $`"? ԰ Ԑ@Kl !`' 'N@ =`?'܀ ز`'Ѐ `0`4  `p@  2 `0`t( `0  <`8  '<`8`<   @ > 08`B :8 '`p  @  "`8@@`8   @w r H   8`8  @ @ 8 C|<`8     !y7!` "@  ܓ2` ``?@[؀ N@ ."!l򀢠7 M! @M! `A`8@! `  @5 -` @`<*'<'`8 @#-` @  $`@@Z `@@K@A j@\H  `8  B<`8`88Z`8``<8T`8`2`8:  $`@`<P `8@a:<  @  @@ @  H @+<`8䀢`   `0<`8 '䀢 "@?@@K{Ѐ`` ?@[ @$`@䀢  > 00`B :0 Ѐ `8<`0"6`@@?̒ @v@%`@@P@ @ F  ̐@y`` L*@H%`7 4̐@yO  "@Z07*@'%`  @@?@Z4"P@ @ @?} `  ̒ @v`@%"@@J 㿐  `@A   `?@=" @?F '` H @ & '㿘> ct>  9@{ > "c 㿘> 0 '> %> 6` 㐐 *  "  @2 2   @YV 6` 0 2  㿘 >  2 > 㔐 * " 2  @2 22"&& " D @S<    2   " "㿘 >  cȀ    < > K @\c $ @u `@[0 㿘 > cȀ    < > K @\HȐ@Jϐ " @Y$  @Z :&  㿐  '  6`6``@     `. :   􀦠< H 26  @`!6` @2 ` @6`  2 ` 6`  2 ` 6`  2 ` 6`  @2 ` 6`  * @&`  * @&` `&`!m6`&` @>$㿐'􀦠 `  `  *@ :   􀦠'`H ` 2! ``=@ ` @@` ```&`&``@` ```&`&`` `@ ``&`&`&`&` @=㿘 'l '    &`&@H 8X. * "* "`  @_* @, : & @U d@Q? * @,`,`* :`& *  @B"?. * *"@ *`@*" 0*  ``d ,:`*`" *  * "&@&`   * ( ?А㿐 ?/  /  /  / ޒ / ڒ  //}   (  *  * `( p l  | | | | ( | | | | | | | 4 | | | | | | | | | | | | | | | X d l t   (@2   *  ( @* ` *  ` `(@*   *@ 2`"`㿘> K@א!@2 㿘  `(@`$F`0`2 `,@6  /,` > K!0 ` ! >y!*` €  $ `$  `@P> > "( b@  > K@!8`, `,@@   `(&`$2&`0   0`( &`0&` `$" &`$2`  ?&`㿘N > K!0`  >y",*` €  > > "( b@   ?> K@K!X`, `(@2*``,2`@  ` `(&``$""@&`$2`$`$&`$ `  ?&`㿐`(> Ka0`,`$@n" N !   !`al  #\ `( `@`$0`( `( 2@   (  *` *`  ( "`"`JC   `( x0"`㿘  (  2 "@@`  @I   @` @  " "   -@ْ`.` 2  "@@3`  @#   @'` @  " "   @``@  " " ` ?&` 㿘@N     `( (   `*  *` `( ( ? 02 ?@ ?  0?@ * @(@@ `  `㿘 `? @`@&`!X㿘``/  .`.> >` ` / ``..> >`  .  (.&`$㿘  2-    2% ` 2  > Kax @Ք 2   2` > Ka@Ȕ  > Ka@  `" =&`㿐 `!`' `!al@`2`  *` * + `  X "h`!d   ` )&` `  "`L@L@2 L`L @2 €` # ` (`@`: `` >` 9``: `  0` + .``8 B<  2` ``@   ` ?@8  H`` @ @:*  2  €   2 ` '> ''ܔLX6  !l x`!7'' '''ܐ !@J> !T` Ĵ ?'Đ(`$  7> '6'''Ĕ' ` "#> K&aha@     1&aha@۸  2?"'> 'ܐ$"? 㿘.     ?.> "d"  ?* € . 㿐Leؒ ;) ;Y  А R, * @ ?Ѐ .`@*`@ ;$    ? +"@ )"@  ! . ; 0`;   ??? 㿐`\    =. `.X  ;` .F6 ` P `   ` `  `> 0 > b> @Rc  > K> a!> @R"4 > K@!07> K> K"b@Q| /"4'|@  | "@P||@T 0> )4"| "4@  |#a4 |"@|a4"`@ 0|@Pװ @  ֔ t  `$`@| @  b @X]o @&(&&$&&,@J d4 "|@S[ > `h@SQ @` `@r `!@mݖ @SV0: @oA`$@@2  @0  @Ss  `| Y| Z`@@$ a| Y| a@@$ at t@j 00@SP㿀|  ' $ ''    @V @U > "4  `@q`  @YK  @n֔ r耢   ?@m< gl 0p ' 'c' ?@m 2'(: '  A:  (?@5 > K Hb( @ٙ  2  "` 4 :0 - ''&l 'X> Kb0@r  " > Kb8@j  " > Kb@@b  "   2  @7c'c  @7Y' ? * b> ?   9@Qx!p@ђ!p$` P ` `+  P* `@ @ *@ $`a4 "  +  *   *` $aX ` `+  * `@ @ *@ $a\$al`$`@  $`?$`0`%0@7 '"'   $ ' ' $' ($`$`$` l )  aX` *  : `?@4 R H $adl l ?&l`0 "`0@6'l  $@` $a` $a`a` #`!a4. "  *  *` * $aX ` * `@ `* @*@ $al$a\`0 &`0`"|@6| &"   `@6`"@6`@p:耢   ?@k@mi `@Rr 9'"㿘@7($`D   ,: ($`<<`$`08 @h $`@@@9 `> K`Hb( @B  X T c$ޑ, K? * b B> (@͔  8@ɔ  2 " 2 "  6&p(0<    B  6& .6&0  B  6&. !W @ &&6&&6r@6 `0 $`0@5 㿘6` @Q b  |`"@o   @kH?@P @QΒ 9`$*@$`$$b㿘"!4~!` `?@M -㿘"  &`&`   ;  0>`>`0@ >`>` >`( ` Z!` Z!taD  t&`t  㿐 `` & ` &@P} & F㿘 @ 㿈"? &. > h @N,  &" :@O > KH D @I "`$$C$  @Pu ""2J'6@ @P2 F> K#"X@`!  @P& F> K"@50?,  ;    ?@2  @P@5> K"@0 H @ @@P " @4 > K "@@  F$  @O$ 6@ 'n쀢 " @4k "@4}< @ > #`2`  `+"4>}"*` €> # "`0> ""`0@NA >  h$ " "`0@O@P$'p@&QtXh: @  l `8 "`8 &  2@ "`|"`㿘"@T`  `0`4&&    |   8 d p | | H*  2+ 2' ,2# 42 2  2 4$"  4 >(      㿘 4  o  @S `   `$ `$ ` /$ T`$ `$ `$ `$ ,`$ 0`$ 4`$ 8`$ <`$ @`$ L`p< `p`t.  4 2*   @M͐$      $?'''''''''''@]耢 А$ < @Ou  $ D$ H` $ (`p< P 4$ x  ' ,  6 @3[ 0' %`@= `  ` " 8 p@b    `;  ;  쀢 ( `B `E >@<  @MP!  . D@ :`. a"   >  `@Dp  ?t ?#`#\#d@0Қa@N  ?@0:`@'8 {`H@n`@  p@  t@`0 "`0@2   2b   E  㿘``*@ `  ? 6`#0@* &#@#D`#H 4"@&#@?#H`?&#D&#H @m#0 2>#8 㿘"" N" =`?  " !! 2!@V ""!  # ! 2%.!   # ". "   ?  6"#(!># "  #(>#" 㿀#P`   @LX' '쀢 ,a,`,b,a,`$c0 $cD  2 '* @LC $cD$cH $c@  Kc@! b`2 bL! 2 b#,b  L! 2` ,b`!`  l #\`? `Q,b``2c(c(b c(8ic( c,@8cc(  `  ,b̐ & ` @M=  cH""@"@ "c8@11c8?  c@@M'#㿐   `!` " h ?`?0(    @. 5 ` H   ( @0 H   > (`#> (@#@8    > ( c> (#@I@0װ 0!@0  #  @l> (#@20  " $  "" "㿘  @ga @K 㿘  @gW @K 㿘  ` @D D㿘  `  D@D`㿘` 4? > K@#  @21   @2,      @gp "  0$ 4($ 0H /d * % @4,H 00)?2  H@ <$ @ ?2 H /d * % @4 H 0  | $ D0@ 㿘> K@;#  㿘 `@Dt D`>0(`!``     %` $` "`     ??1 J@` +???"&" @?(82`?" 2?2 ??"" @?` @((882`?" ?: P> "'@18(  $($`D<`$`<$`08  @ $`@@@39 `H@  `H  ?Ēc ? @ (**`+` @  3   20 3` ?@֒(#   <`$`<$`08 @z $`@@@2 K `H@   >А  @ K @ѷ  2 " 2 "  p(0<    B  6& .0  B  6&. !W  @&&66r&&@6 `0 $`0@/ > K@ܐ#@㿐`&@`@ l  #? @'? < =*` >+` 8@ 9( : ?(+  ;*`@ @  4`,  +?   ,+`- 5`1?   # ,` .6 . 6`-` @ )?6 ?6 5  5     ܔB*2@ ' < @Hؐ D'`4 D@ `@I'@㿘 2 4 @   &@@ <@ @ 㿈@  4*'  @!찒  !@.kt   @.aL?@# ?*  *@2 @ 2@ @@.O&@ 㿐!> !> > K `c#\!  @H > > K#c#\ D  @> > > K#\!(c 0  @4   㿈`$ 2`$ $`$`$@d -N  ]` @X &(&&$&&,@@7 N4 "|@I2E > `h& @I(;  @ `@g !@cc @d˔  @B ` Y Z`@@U$ a Y a@@J$ 0@H ? (* 0*`2`    @   `  h'L'@L'̺    '@K > "4@ w `@g*`  @N͚  @dX a ?@b– Z  @G h&b`| !` &``$  &`$&``|!$` '$` $`  (?@+԰ 2`HԒ H 2 `HԒH'? @-)1??# @*`+`  @ +  *22`  3`  3  (?@d'Ԭ@'Ш( 2   (?@*Қ԰ ̒  H@ 2B Փ*` ֕* ב*  @ @**` @ 2  @2` $` $`?$`  * *  * !  !* +  * @2  @ 3 (2@  '@h O Ԓ  H 7   *  •* Ó*`@  **  @ 2  @ 2 @$`$$`( +  * *`@ *   * +`*`  2  2 3  $`$` @,sԀ'Ԁ А @ a'Ѐ" @ `,`?`@ +@ '`@*&Ԁ > K@]#Ȱ `HԒ!  H 2 ? ѓ*` ҕ* *  Ӑ @ @ ? @ *`* 2 2` ' p!  > K *Д @.#Ұ  ? *` * *   @ @ ? @ *`* 2 2`  ?**`@ *  # ? ** 2` 2 $`,** *  @ @ @ *`+  3` 2`Ԑ  $`0@+А 'Ԁ> LO 0`P@)^   d @g`L@`$`HL 2`H@ "`,'В`В+     `?@)x԰ > L@ Xr`HԒ! H !`8 @  '`<4`@`, $`<@+Ȁ'> L x@ Q`H`<?#`8 @? @ *+`@ 2*  (@ 3`@ 3  0'РȐ`В* `:    `, ?@)%԰ > L@\ `HԒ!  H  ! > L@K `H@+2 `|'*" > K@>#`H `@G" ` @G `$*@&`$&bԀ "@+`@dÐ ?@`|@a 㿘b6`  @G 9`@d   ?@LM ?@`Z@aӒ !`|@F"``" d 4@FԒ  d " H@FΒ  H "@FȒ @FŒ `$*@$`$$b 㿘"?`8 `# `*` `* * ` @ @ ? @ *`+ 2  2` @! @ `8 "`8 -"   "`  "` $ :`0:`:`:` :`( 㿈> 0 &' @   >  @# 'А * :    ?@(/ > L@f c@ @*I!  H  ? Օ* З* і ֙+ ( ҄ *  א *` x! > L@; 5c ? * *  + (  *   *` @c ? +  *+`(@ 20@ 3 2@  @`ؐ @D)  $@c@_  @)3! `HR@0``HM@@)'@f찒  @@E̒ c@:0h$8$ $  $$4" @Dj > L  @= @@ ` ") "  ' > L > L > L4@           "`44@C\  > L@!> `h$ " "`0@D@E'%  &㿐 `` 2& &  2@8 "`    㿐`,?`-* `.*`@*`/   '?*  *2`  2  @CW #? $ d `,`-*``.* `/* @ @**` @ 2 @ 2`@ `(`)*  * 2 @$ \`0`1*`2*  *`@`,`-*`3* `.  +`@ `/**  @ 2 @  2+`+   @  2   3 *@   :`*  ?@& " `, " d@( d@D 0Y`-*`.*`@ `/*   *`*  2   H2 d @( d ' " d d@D 5 01* @ *`2 @& $ ` 8 9*` :* *  ; @ @*` @* 2 @ 2` ? 0`1* @ *`2 @@ ޘ   # `( `)* `** `+ ( # ,x> "a' ; [ ```@2L ,`/` > La @"  > L a8@  > L aP@   , %`@a ?a *a*`@ * a  ? ** 2` 2 * @   > L@!h 㿘> 0 & P@%| L H@* `@%     82@%  @B     & 2 8@%  㿘> 0  ` @a] P@%D 8 L H @*  2 > L@#! & " " & @%t 㿘  P@%) 8 L H * @`2> L!@ `"  "` ?"&& @%S 㿐> $ @@7 > L &@@t! @? ,c -*  .(( /@ @ ? " @ #*`*0 (2`  0 2 *0  a  (( @* 㿘   ``4      @ $ %( (( )*  *+` &@* + '*  `4 @G㿘 `?@ d   @!`?㿘&` ? * c *2 g4 &@&@  *"@ *` &@ *"@ *`@ *` &@ *` *" *"@ *` &@ g*@ >  *`@ * * "@*`" @* &@  g@"@&@g@#@&@g@"@&@'Ѐ6!m* @*`" * @"*@  &@? * c 2`*  <@ *: x*`" @* "@&@x '' ' '`@  4"8$'$? 0 1* @ *`2 @$ $? %*` &* *  ' @ @ *` @* 2 2` ?  " ( )*  ***` +@  * *@ 2@ 2 @  "`"`L4  "` :U: < =*  >* 8+  9 :* ?*`@ ;* @  ??  c0( +`,` +?1?  (   # 5`- .6 . 6`@  -`)? ?6 5 6 5     < '! # P, \44  L M*  N* H*` I@ O( J ** # K H,' T4`4 a D E*  F* @*` A@ G( B **  C @@ I  ?  0(? #?  4`,  *,5?   ( @ / 7`,`.6@ @ 1?7  ?@6  6@5 @@ 8`@x@ :  4"D8"<"@"H #? '?"( < =*  >* 8 9+  : ?**` ;@ * @    4`,  +?   ,+`- 5`1?   # ,`.6 . 6`@ )? ?6 6 5 -`5     : P `4 :X"    㿈     `' '?`@? < =*` >* 8+` 9@ :+  ?* ;*` @    0(  ,* +?1?  (   # 5`- .6@ . 6`@ @ -`)?6 ?@ 5 @6 5 @  @ @  4  0 @,  "(  B4 $@ 2'@$@ ''@Ϛ캒 @_Y `@$'`" 㿘> > L@!-  @H `?  > L@!``@_ ``?# ?@ " `.@ .@ ```@H.@㿘>  @ ` ?@Ų``@+㿘      & "& *& @^& ?㿘> !(@ "" " " 㿘     & ( 2 , ; & $ $ @, "  , `& (@#u &  "    " & ,@?g    & $@  `$? `%* c *2  `   & Z  #@   > L@\"(E @=w  &    @#8&  $ $ & $ ; &  @ٚ  % `& (@#" & 4 `$  & @" `$? `%* c 2  `* &` > L@"H x& ( $ n@ & , &  , &   ?@$  ?& 㿘  " ,@"&  ,  >   "> @>Ԓ > !(@A`> "'D  ''̒` ' `'` '`4  @<, 'Ĕ'''ܐ"x@’D'` " `@, "``0"`$`@+? < =*` 8* 9 >+  :* ?+`@ ;*` @  ?  1?*   # -` .6   . 6`)?@ 5 ̆  ?  5`@Ɛ?#y/> L `u  =`: `8 '// . //7'А   i   ? * *  *  @ @* @ *` 3`2`   /'//7'А// 1  $ %*` Ȑ &/  `? `+  `* ` *`@  * *@ 02@@ '   * ?  /7'В 1 7> LR D+! ` *`@  D `#    :: (`@ D` "```("`$D ` @=  > "@D"@>  > L@yn" -㿐   @`  @" `: @{   @Ș "2  H@~  <??)<    @Xt "  0$ 4($ 0H /d * % @%0H 00)?2  H@} <$ @ ?2`|H /d * % @%H 0   $ D 0` 㿘  ` @5 㿘  `  @5`㿘 `@5k 㿘 > L`" 8@! @6֐ > L@"㿈  `  "@  "  `: @{[  @2쀢 "   @z <  2& h' '''`;?' )?' @ <+? =*` >* 8 9( : ?(* ;*`@   1?#' ' ' '?  '̓/`   .6-`   " . 6` 5   5 @  @ @Vܰ  @*찒  `   `J`. @;"؀   `<> (   ? *` * *   @ @ ? @ *`* 2@ (8 `B :8   , "`0"`$?3# `/  `$  ? *` * *   @ @ @ *`* 3  2` $ %*`  &А'  d  =! > L@"  "(   @ e` "`^2P A  ؀   "`<  > ((0`B :0 Ԑ  @  ܐ "@V "@Ԑ  n  ؀    @+@ ` "``("`$㿘   @Vb 㿘  ِ " @@:&  @ "> @;Y > #@ƒ$  㿈 '@?W  @! " @? Кc ѕ* ғ*`@ ӑ*   ? ** 2` 2  ؐ'@ ՗* ֕*! ? c * *`@ *   ? ** 2` 2  '@ * *  *  @ @ @*`+` 02` &@3 1@ 쀢 @&@@@8&@`?`*@  :`*   `?@ > L`: @y H '@ "@Ԓ㿘'D @!  'P'T`   `? `ї* `ԅ( `Փ*` `ҙ+  `ք  **  `Ӕ ` `? `* `( `*` `+  `  **  ` `  @c @ ? @ * *`+`( 20 22`  ? * @ *`2 @` @> L> L@s# #8   *` 2   H   > L# > L#2@8d`d.D`@! @ ؐ @ ? ( (@ +`   * *@ 2@ 2 @   ж5`2@80`d.lD`@K! @ ؐ @ ? ( (@ +`   * *@ 2@ 2 @   ж`@wĒ .` * *.  (  - @ ?  @ ? @ *(+` 0, 033`T @ B 7"T?"D``8 P ^:> L# @ 0W> L#X> L#@N  =* >*`@ ?*    ** 3 2   P 4:`P@:`d, `` '?`\#  #?'? 8 9*` :* *  ; @ @*` @* 2 @ 2` @`6 <  㿘'@ `  @|Ȓ d  @|’!`? "mn`@퀌`  @| d  @|!`?   8      > L#Т,* @* "@*` * &. @h> L 0#`!T@z!@|w!@|s .`'  @|j d  @|d!`? "    @|V d  @|P!`? mlۀ `6@  @|A d  @|;!`?  '̢@    @  @ $  .`.`@z9..`@|.@z2 <.`@| <.`> l> " ?> a8"a?  v wP wP wP x0 wL㿘@% 2!@ $!< @SF2  @2  2   " ,    㿘'T?\ > &!(  *   " $" 9> &   @&> a(  +@ #@#@@2   '@`'@  `'@!( `8  @ F"@  @ @* @Ґ >* "@  & *`( " $ $ `$ @6v$ @$ $ @"A @* @ >* "@  & *` " $$ $ `$ @6T$ @$ $  @* @ >* "@  & *`( " $ $ `$ @65$ @$ $ !(   8  T @* @c >* "  & *"@ @ &"`"`"` "`@"`"`T"x  #\#``#d#h#l @S 2`  > 'T" D ''L'P''t'p''@-Zp'\'X R  4 B `L@P! 8\ P $`2 `!@P 2"  4 2  Ȁ "  ,  @5'\Ԑ\ 2䀦 > \!(t@  `8 `` "  `` @ @ @'T,@L T"!D"@  p> ,!( t 8 @ @  $` 'l  " @ @ @ 'l$ 2$  "3>  $   b0@f   @9 2   $ $@#dl#`#\l@ט 2$$l#`#d#\l@ʘ  $` l @9`i` 2@9`l@ @> ( *"@T@T,@ "L"aD>  C\'d 8'` 40 XXT 'X'h   "@'h#\Lhdњ`  d@ h   @ L"@P"$# hd 'h  @R>  @OQ\ h@5ג hT@4">  > M@q x`  ` 3   '7/m 23 ?* 2  8, a`@ " ,`8 # > M@-  ,  @3ԐaE `?&a&a , @ '#> ( `` # @ʐca %  倥` ,`2,",ޠ  2 > `Ѐπ`@> !t&a4 . 4`?'> M8 @    > !p`@ ``2`2,. 4, e ?'耢`Y'> ܓ*` € 2   ' "@'?'a`#\՚䀤`'䀊  a?&a(&aa  " &a &a" &a",a ?&a&a a  " &a &a" &a  , a ?&a a?2 &a@a> a ,@ @*@&a&a&a@`&a$  @2ߐ " *" ," @"" &a8&aD @4@Pa@`"> (#@@4 @` Pa@aD`'E a8<  @4o > (#@ܒ@`01@ & '  '' > !( ''   ''''   ''''a<''' @@4< > (#@   㿘,,   @2\a͖ 9 ,* - 2&  d! @   @2> a   `@2 ` @` `0 * `@3 @3  > "'>\' @3  `' @  > M  @??????    '  4 /77''/777///''''777 @Q 4  * 4B D @1’ >t?'@ m ""` "" #`# "# @Qz* R* `4 B > M@" H@ݘ@ :@D > M@ p@Ș& )> M "  @ " @  @Q3  @D  @3  > M@nؐ ȁ  x  #` "  #d#h#p#t#l#x #xx#xx#x> ( #|p B; `"@d"`h"`l"` p"`t"`x"`|"`` ##x> "  |'`R'8@sE h (  h?,'0 ' '!'!'' 8' `8' 4 ' 4 ` "' 8' ! '  '' ' '@'̒  h '@'D'H> M8@@ 2!`` 8*  D'8 $=p   x'P?X'p'`'d't'T'h'l@?P 2f 2!`  '@  * 'D'H @@PI 2Q@> M8 @P>  2F*` D@P2 2:8 @`'8   ?@'H@4א'<> M8@@< 2"8@ @&8 " 8 @ @8 2 8@  &  > M@m ؁> " 8'> M> M8 @@@r      @Ĕ$@``\H@4" 21 P '''@0 2# &  ?`!@@4  2! '''@ @& b > M@mM 㿘 @O  @O  @Ox 㿐`? 4`a'a( ) ` %> Ma@ڔ  2C `  8  @ L  2` , @ J@ 2`*@@ *L %    9> (J@ "` "` L %  J@    2`J@ "a*@`J@ "` "`J@ " a `J@ *@a` `'` `@N`!@Jk @KӔ  ",`a( "> M@^!@Ga0 a(  &a(2` > !""`(2 , ?",`0?"`0`, "`@c `0` "` ?"a(  &a(@.ܐ  ? @.֐@%   ? @.ɐ% @ $ ?@. $a( > M`0@   $@ @$W    > M@!Ha0 p @$$&` @^ 2$`a(   &a(``@L #@a(&a,a &a( "a" a" . " 4a(   &a( ?&a(a0@  ```@L `#4@ `  @0 ?  @0 ?@/㿘  > M@! , > M> M> M!a@q `, " &  ?@.&* , " ^*  @ @/ ?& 㿘  :    " @/   `  & @/Œ ? && 㿘` @ "  +> M` ` 2 @6a  $ € ```"``㿈`> , !,`@ 2' ` 2#  "`  @T  2` A#@` $ #`` #\#d@` @㿀`2> !(` * &`#\ ``  $@ * #`#d ?@? 2(  #`#\ @`#d`  ` #h`@K#l 2` 2` `  @  8  $ @ @ 㿈`> a(`A`#*&```  $ * #``#\#d ?@H?  㿘<>&a&a >  0a,4 * &a ``@*```>* "` &`*"@ a@ a a" " "`a"`"`"` "`"```*``` * "` &`*"@ a @ "`a a" "`"`"`"` "` `>!>  0 " $`@f.@m@̄> M> Mb@"/@k@w@@ @ @@3b@!+@ B@F@<>  t" t "`$```$``""` $<$`$8>  ̀` $` ̐`"` % $` > a$4> Ě  $`<`<"`@"$`@ > ,@ #a@" ,"# >  "b$$> "8""8"`# `0Ho  "`> aД  ,`5$a> M,a a " >a`d@e> `@e``> !@:_"`` 3> "@`5>  /> @;> @C2 > "h$`(@E"@  >  $`b+> (1> -> и#?$0 :`:@`> #|  @@< @4$!> !(   :+    P < @  $>   `@Öc> #\c $`$$`  $a$@3; @>$@]>@= 0@hbQ@@@@@ @l@:@@$    $ @  2 @F@S6H /f* '@ʭ @@rH 0k > "  @ "@ @i?#d>`#\#`   @ > M@ܐ"@"o`d > %> M  d@]  d` >  @M > M @lԐ"> M @lА"@>> !耢 "> M > M@#> )!4$ "$> )4  €c "`> M@# c"`@+`c@G `"` c" @+`>  "` > b%!"&! `#  ` " "`@e $`$```2` @i>> M!h8 @! ">> M@[#H> M#8X @! ">> M@O#`> M#p @! ">> M@C#x> M#㈒ @!u ">> M@7#> M#㠒 @!i > M@+#@]̓ @ @ѐ@> "b4>  @Lْ > "p@^p> Mฒ @\Ė > MP> N  @ '''''@"  `> N> N@ 0@ 80@+X> `p'̀ -> %> ش7>   #> N  p`X@\  p` ̐(> $"@ '#`#\#dԖ ?@? " $> N@Ő h "` Q> N -/(  `  s/ِڦ  * "$@'АZ'@lܐ $@'В O?''АВH ̠?A ?< Ȕ'''@ > N @ 2 -> N@ > N@j 㿘>`0@5+`㿘>`0@`㿘@P@7 L@  '''''ܐ@G? =@F 4    `@H - > "`1> " "@> @^"b "" ` @G&"$b@ @$b 2    $b@@Gؒ 8> b> " ' 2  0 `$@;"`00#?: ʔ @9ϖ @7@ 7`ؐ@v' ذ" '" 'Вb@ ?@f 7ДĒb?' '?/a ?> #`> #d@l" 7``` @l 7`0 `,@; 7 ' ',  ?4 ` "? p'  3 #\#`/#d#h#l  ( @GR @:`0" 0b > N@f ȁ㿘@ma . c   6  `  # (.` 6 `.` @.`6 㿘> b  b>> N @_  㽨> ">'`0`7> #> !> 5> N3> 1> N/> -> )> O+> N   :@h @j d(  24`, (0`" $b$"@<(``";%"`4 9 `P  `ܒ :@h @jȖ d(   b, 8` $"$b@ `" (@Zt`"`"b`4 2`P  @F?$"%"@  @F?$b㿘>#> b 0 `!> "  `"" @Fm?$"$b㿘` > N!P@@  .`@> N*` @ & & @  & > N@y!p> @  > b !>  %> N`b @ZV b`` &$ @ ` 㿘 @ o @ @ `? .`= > N@ *`  .` 0 @ U  ,*  @ € @*  @€ * & & & @ v, * `@ €㿘@w !>   @#>  @ & > b ` %> N" @Y "``耢 $`2?"&@ ;㿘@    "&`p!> N   !@Y  ` &`p   &  @  㿘 @ Ґ  @ @ 㿘 @ Ő € @ 㿘 @  @ @ 㿘00"4("0H /* d % @ϐ H 0  㿘@    ?`&  @[O @ Ð &`p㿘!> @ x >  "b@  >  耤   @ k   $ %> N  @Y8  `@   㿘> @ O >  耤`%> `@ G`@[$`@ @`2`@[ $@ }㿘  @&Ȕ 㿘@( 㿘@k+ X" XX" X X X" \ X"`X" X`X`X" \ X@ 㿘  @& ""  㿘@(X "`X `X " X"" "`X`X" "@ 㿘> cD @ > "b> N@!> >  "b$@l"" > "`> > #` ""@i> h> "b"h㿘@AÒ 㿘@A 㿘> 0`-0"@)>  @  >   > #d@^ې 2  @_y  >   > #d@^ʐ >  @_h > "`2`L@c`L? $`L@c@!`l> #>  cd> (> b "(" "(> \`> #X"@ "\ > h > h!> #> "1> h> #` B :#`#``B<8``#``< `2`` ``B#8`Дb?" ?/!"`#"@ "?/!@""`$"$c"&#@`! > @&b؁㿐@ " А"@? &- (c (c& > , "@*`" * * > d?@i  #`%@hҒ4 ~> d?@ip   #㿘  &- (c`(c& > . "@*`" * * > d?@iL  #`%@h4 ~r> d@i9   #㿘 0 4 0Ho  "`> b  !"b> "`H /m * . > "> b> > " @}"b$H 0㿘 0 2 0Ho  ?"`> b? "b> b  H /m * .  > > "b @F"$H 0㿘> 0>    b `D  `$`D$`@> @,b> @'b @  0 "`@ @[`@? X$`@ L! `B < ``B 8<```B 3<`" `@ 0 !(@<`@? 9$`@ > "@ "`( В`B < `(`B <`("`0`H" `0 Ȓ`B < ` B<` `B <`0 $`@ X> b  $ X>`0`  "`@d#㿀> cd> > #`> h> '"''''@Lc H > "" H 㿐@v*`" *  * & &㿐ݐ*`" *  * & &㿐@*`" *  * & &㿐@$*`" *  * & &㿐@>> aa" &`" `& А"@@& &H > "" H    ( X 8 4 0㿐!> !> > N#Ԛa#\ `  @}M > > N#\# aؒ!,  @}C > " :  * *"*   6 *  ? * "? @*`2,  㿐@ 2`0'  $`0(@' @Y `0`,?`$`0@WH`0 @ސ@'ސ@@'㿐`@     0` A ` => #| @6 2`0&1  $`0(@'L@  `0`,?`$`0@V`0 @@'TŐ"> N@"@@'Cx@ @  a 2`0  $`0`` >!*` €   0`` } ` (z`0> #| s(@&@ܰ   @C`0`,?`$`0@V`0@&Đ 2 `0ܐ@\ `,?`$`0@V`0@&0M @ A&`  @ 9*@ @ ?5*@`* :` ?* :  ` *&`!  34`` ̒@`4` `'ؐ"~؟ 2`0` `@'`"}ذ  "~` ?4`'` ؟`0T` 2``( <& `wذ &T` 2```("<  `"@  @"D   &`@)X 2 4˰  &``  `v` PT`  ``(w”  2`0W W䀒@耢 6 薠 ` ?` @ b ` @ B ?W "9   `0 `0` H@Ho  "`` 5@Ho  "` @>d  @>] @V@P  ??7 @>K @ C7T` = `(`wF  26`0W W䀒@耢 6 薠 ` ?` @ b ` @ B ?W      @> @ 2 `0`w  `0`,?`$`0@U;`0㿘` #@  `0`,?`&`0@U*`0F . `"" `0 $`0"    ?*` `&` `0`,?`&`0@U`0`> +   +@@"   2   3 * +@@"  4$ ` ' 0@ ~@ 㿘.`"  @ >`&  *@ ?2   2*`   * *#  `  * *"  @> N@ِ!& 㿘 .` `2`09  $`0"  *@ @>`$  *@ ?2   2*`  * *#  `  * *"  @> N@!2 0$  0@@ @㿘 @   (@$@$0 (`@ 2 0!  $ 0 ` 0 ,?`$ 0@TB 0  @- 2'`v  p㿘@ 2`0-  $`0T` "`(  -`  "& `@?[`@<@< `0 -`0`,?`$`0@S`0㿘 />   0|`@8@ @&: <`   <`  "@,  ?2 ?2,  `2``  ?, ?2,   , ?xd8??O `-    : "@,  ?2 ?2,   , ?x?8?-  .`@@6$<`+  ` +@@"  2 3 * +@@" @4$ @$$ &   㿘  1 2* -` ' @#* v[-` "@@asvQ@ak%@ `@ Ӓ '` :`: ` :`: @7 ,` '@,` ' @ >  > . v&@a@$ >  ?. v@a3$@ :  :  $ $@  '@  '$$$$$㿐   2u> > c|0  @;`&  *@?2   2*`  * *#   ` * *" @> N@ސ!> N & > N@͐"< ">  @y#Ԙ # , @`" > @ #@" "@ # `` #`" "`#   `* "@#   @#  "&@& 0 # 0 㿘> # @yT     @$` $` @> Nb @# `(> !ƒ `D` ``?4`&4`$$@$`$`$`$`$`0$` $` &0& 㿘 >  @y!# uE D  " @x " @r  `6 & D &&   `c*`@,`4`@: `c,` * @4`,` '@ؔ ,` & &`:  :   '  &  &  @đ, & ,  '@ & & ,`tt < < , t , t  0?  @ "  R 2  `@ ?& 0& 4& <& 8  @#`"  `  Ӓ "`  `@ 㿘 &?* `F4&``" `0 "`0$ @9 &   @ ' :  :  $ @ '@  ' " @= "4@74 "<@ < "> @ > # @ya㿀 2 ,t   ? & ` > N@b"( 0` & ,!> N  0"@@O   0` ``` ` @ `V ` (   7?? 7 @9ߘ @`"   0 ,?`& 0@Q 0-  € `"  "` ?"&& @*  `> N 0 "> > N 0@"H`> "`@x#԰㿀`@e  2V` B ? -`0 &`0`(  ?7 ? 7`?А*@6`    7 27 ` 6`      0@9d`0`,?`&`0@P`0? 0 "H 㿘> 0 0a   7`" H@    7 2S  " y #@2r .`"@ >` +`* ` #    +  "  @ ?2   3`* `+@"  @4O& N . .`" >` (*`"@   * +@   "  @ ?2   0* +@@"  @4&  >&  *@ ?2   2*`  +@*"   +@ * "  > N@~!2 R&  㿘  `` `+` $`㿘 @`(@ `@@ ,  ``@ @ ! 㿐!> !> > N b`    @uO#\> > N#\!lbp @  @uE 㿘`4 €`4R` (> "`8 "`" 4(  ` 2``?"`" 4 `("   㿘@"   0@>-  0    "  ` a"  @) "   & 4 6 ?Ȓ*  0 & & 6   (&  " ( (4(  (` 2``?"`"㿀< ,@@    &   4   (  @ & (6 (2  "(2? "& # 2  ,   ? .@  $ '77'''@.   &  @ 㿐 `&  (  & (@   0@]#' 0@_ߒ#* "@*`@*`'5@S <㿐> > TaX4%  0"T@]ߒ#' 0@_#* "@*`@*`' ` 6   @S >@S`@S& < 㿘 <@T@  > aT?"aT @ "  R` > Nx"`8 㿐 _ + 2` 2 > `">  @u# """ (& 0 && 0", ?",`0?"`0`,  @N*`0 㿈`@ r T` "`00l $`0`  oޔ  2Z`0&`` D`( ' ' * `oɕ* D $   o4 @B ` 14 $ ` o `  ``?&` &` *` `* " @ &` &`   &``` @&`0`,?`$`0@M`0㿘V`    `  ` 8 > !\*` 2  "1`8@ 20  $0 `$ @`0:*`4@ "7` 2V`T @"-` "*` 2V`T @2`"`@2  `<* @ "` 2 2V`T @2`   X 23`> !l@t  2$  $ 4 $ 80,?`$0@M*0`$ ,` $ 0@&`&` $ ` $ `$ ` $ `@$ $@  .$ ,` $ 0`$ $Ho o 8   €   (  $ (@H 0` " ` 8@@̒7 "` ( 2`Ho o (  $ (H 0`  ( Ho o (  ?$ (@ؐH 0L@ ('X U A#@['` ' ?h` @Pߐ ; T!@ > #`*@ *`" *" * ? ' '?` ?/a  '8''' 3`   -r@@"" ''Вb@ ??T!@ > #`*@ *`" *" * H/` /``!`6`  #> N $`!@IؖH 0 ? # " '`'`"@$`` @ ` "` $` ? "$  $ H 0@0 (` $ (`?n$`  2  8` € 2   ( ?$ (`[$`& & & &  $&   ( ?$ (`$`H 0 8@ @Ho o " $  ($ ?$ ($ `?$`` $ `"@$`H 0,, m= Ho o  `2q@`"` $`?"''H 0` ,m*X%"@   㿘 ( H/` /`A   @   $ H 0㿘 (@Y3 p   :&`>`8&`H 㿘`  0' ( 4*@ @->  @ 4`0 "`0 8@ 4@rl$`2  0& 4 8 #?!  <*@ @3>  @  8@@rĐal$`2  8 * <>  @r& ( 㿘   ?& @J   ?& @ 0 @ 㿘  8` € "   (  & (@  2 8㿘 @@ @^@ 2 8㿘 .`4@㿘 ( 㿘 8@ `8 2   @  @7Ŗ`8$`< `82  %`<`0  ! (!  @, `0`4m5*`0$* @@XL*``4 "$`0@ $`0$`4 `4* @@&&@& (㿘 8` 482  <* @@"@5> 5> 2?"& ( " 8@> 8` l 4`0 "`0 4l@q㿘 H/` / (` > N> N> N"b@wҔ$&  & "" ( & (`"H 0  㿘 H/` / (` > N> N> N"b@w$ ` "` " ? "& &  ( ?& ("H 0     (  " (2   2 (x`(D% (% $@ ,  &a4    `@0|a 2 4P $  "a` 3"`` @@0U 2 4a `I2 ` @0# 2w 4 @1#\#`` ` #d`#h#l@3 2T>  ` l"   '&` > ! @€ a4 <`"  2a( a(  =al ` 2@ >a$@8 a @@  0a   $   w` @@2 > ( 4@p#0 4> (@p#@Fx!0 @0'L@  Ho  "`0@> ( @oe#@$i찒 0 'l'''h@''h''l''@'!> ! ?@- !h'''''' '''Ȕ> !В' '' ì0> a@+ 2> N@v]#  #5> (  J@,`J@   @,@ ?  @ ?ؐ ?'``j  2` i谒  ?` ?%@'i˔  P䀢 2`` ?ii谒  ?"? 0=``?%@'i  /䀢 #> ax  ? (Fax* " h ` *   " А ? '  'А@7>> $($ * 2@ $$ * 2@ $$ * 2@ $$$Ȁ 2> N@u# \ &''>`$"  =ciC  _~@,' @8  'jc?,2c 42@ @$Ho  "` 0` 0Ho  ?"`@G'` @`2` ` 2`Ho  "`Ho * "`,@! Ho  "`܀  ؀ $@  @ `"( $  @"$>  @"> ! ;' @'`  ܀ E܀> N@t#8@@؀ 3 @-؀  `@ "`@ 2`2 "`"(, ?",`0?"`0`, "`@Fq`0``$Ho  >"`` " `"0@ '> ݑH /i * * @L$$$$  *@" "  @ "`"`H 0> a@@n& @0`(" , € 2 (L@@ 0(@-C @ ?`" `L䀢@؟€ؐ `,7 ,7 D€  @`$ @ ^Ho * "`0@ !@`؀  ?'`@m耢 "@* @/ @m> a@M@ ?Ho * "`O> (#@mv0J@3 @=`@m[耢 "@ @mR @/:> a@@Ԓ ? @ Ho * "`@m- 㿈`` ''f  2U !4,  * * @  @'&@'fؔ  -f쀢 6  @ ?' 'f  ? &`f   f^쀢  ?  'f   㿀`8'> `4`@ ,"  @[@&`@%> $(` 0c`@ * '#`#\#d @| "`4`@@ 0)g6`  * $@Ԕ@   @&! @`@(  *  $a`@ #`! #\#d@T 2`@ @ 㿘@*`@  㿐>  `2@ ` 'f0  @+  @  㿘 8 'H6`> N#X`@rb  0Ho  "`  ` 0 "` $`  ? "& & ` `@D!0 0.@0 (0Ho  "`H  @ 20@@+N > Nx 2@AŖ 7>  />  9> O;> H-> N7>  />  9> D;> `50Ho "` 20 @+  2@CÐ` "  0 2@A `` 2 0 Ho  ?"`@C` 0  ꑐ @jxd&!4?&!& @IԐ @Iѐ  @Iΐ  0@20 @`4  @2"`4  "$  `2 `|  @*J @   " $ @+   "$ @,$ $ `4@ w ܀ & ؐ@   0@ P . 5 <`" @ @"`@ @? <"@& @& < ` "`   "& & Ѐ & " %&  0@+`$ #"@C ` @ 0("0Ho  7"` @*T  " 0@2 6!0  He!4!4`@  !4@`H 0@& \ 0@ "` 0@  "`@i $ @Bΐ@&9! L`a(@a(`@"> N@pؐc㿘#> @a|>  & < ! <"`@"& @@ a|@B㿘'> @Ԑ|> ! 2 <%> Na| @@ a a <`" @ @"`@ @? <"$ <$ @@|@~ 0@ h, 5 , "   `   ,@)  @Bi`0@!0㿐@ 2`  4 &@`?"   $  8 0 2@" ` 8  4 @ 2`  , "y L 5 0(2L 5 , 2oL 5   8&``  !0'c 2u` ` !4c H 2k@jf )` 0 %`( 0``Ho  "` 8&``  !0*  'c>9 "# 0 0Ho  "` 8&`` ?#'c  2n 2` 2 & > N! @?y "U  㿘`D "# T@ `0Ho  7"``@&`D`,`@(Ҕ @A0 T $`T@ 8 & T6a0 a4@m H@* !> @2  ,"   ?""" `$"`$ "`$`$" "㿘 > !4@iE"d 耢 " 0@Β * 0#2 @I ` "`  ? "& &  02  `"  "`   "@$ $  ? @) " <@  <? $ <   > N> N> N#cЖ@o "[@P 0 @@ > @h!> "h@h> #@h> a?"a㿘 0(@(+ @֐㿈 䀊  $>Đ#``#\#d  @ 㿈#`#\#d    @ 㿈@` `@ "  $  `@   `@2@` 2@2@#`#\#d   @b 㿘> "h@gk $`$  $ &   &  "$ ` $ ` "`&``$ $ `$ $ `$ "` &`$`$$ $ $ $ < (@N  `0ch 0>  @g;!$ `c_ `@ " 0 "`4`  "& `,  ,Ho  "`& x\  '>  `@U ["@2R "> L  > #x`   2>  > > ",@Da > O@n 0 #$ጒ @  0:` p  #>  t a?@ ##> ݐa > (!> #\"|#`#d@O#h> `$ x a@ǘ   > ?@ጰ $ጒ @f# , 5$ ,!$ 0 0Ho  "` $ $   $  " "`  < 0 "<  0 D@M   b (>a d@D>  `@D 0 " 0? 0! Ho  "`' 0 Ho  "` $ @  ې $ $ $ 'Ho  "`@Ho  "` @"  T$  ܀ $ @ [ T$ T@"l!@"[$ (! H€6 `$!$> ښ #\#\@Ӓ > b<@D > bT@D $> b<b< "b<   @(" > < "   @" < "   @ "> <  "    @" 0(   *@ t  0@7> '8'> #> %> 9> 34 "8@Oc '@@8 48$ 8``̀ $ `̐ "` $`$  8Ȑ  ĕ* @ $ <@  <"`@ 8 Ē @ *`"  8 * $ @ 0(` 8 $ D   @    $  "  "@ 8 "  8"` H /m * .   ؐ  4!2, 5@$ @ǐH 0@  *` >   ( 8  > a( `" "d "d 2"` 0  #> O  `@;  0`2 쀢  ` 0(@%/ `` ` 8`"А"@@`"@`"  㿘@ 2 @. 2 >  Ѐ`" `8" ` 4 "` 2` `2`8 㿀#d> 'T'X#\ #` "Ж l 0Ho ""`!  @mxT& 㿘  > 0 `8> O @ma >`0` . 㿘> "\` 0 @ (  2"> O@kv P""> a`""`㿘> >   "b\ aa@ $a$ @ @ Β a a㿘 ܀ ` @ l ܀ & @ 㿘 (@KD @m6 `8a &  ` h> "'` ! <`"  ` 8 ,@ @& ؒҔ  @ 6 $ $   *& `2'! <`" 'ȳ,^ @J'Ȓ'@0@ X  *@& " > O@F pX#>  b@'& ؒ  ''Ȓ7''@ *@& b > O@E h#>  b@'& ؒ c@Jې'Ȓ'@ *@& b > O@EӐ h#>  b@'& ؒ A@J'Ȓ'@Đ *@& b > O@E h> "'`P  & > a(  8 Ȓ  @ `'@'`''Ȑ@ '"@&`&' > 0 `"@F 8 @4]Д א`@   *@&  > O@ER #>  b@'& ؒ .`>`'8'<'@'DH^t 8 ''Ȓ@9 *@& b > O@E& `#>  b@'& ؒ  ''Ȓ''@ *@& b > O@E P` ؤ ` @  *& ب  % @ @'''''ܐ!@$ 2  @$ 4` ` @%c *@& } >  ̀`h `܀2`@ &`$ ` ``2`R 2` M  )@  "E   ?` @{@ `"  @=``@  瀥!`@e   @W ` `@``@`"   ` @$ *@& ذ㿘@ ) 2`ؒ`ؐ@&`@ 2``   &`?* &`&`ؐ ` @` R! 㿘 ` " `$˜  `$ @@` "`h ܀ 2@D   (Ȑ  '?''''''̀` '`$`( ''''`@T `@!̔  > O@  `@h̔>  ̀  ܀2 & ؐ%   2 @ ` 2 2  2 2 `؀&`0   㿘@HH  p?& && & &    2 㿘> 0  @  p > O@h 8@` > O@h ! > O > O!H@h * & & @ > O@g!xO > O"> O " % @  3  `&    @7z &    & 0  &  @> O > O@g!  ? & & * && 0 @ à > O@g!  & 0  @    3  `&    @7* &   &   `&    @7 &  *@& z &&  "m > O@gD!  > O "@g8 ?&  `* &?& 0   > O ?& 0@g "@  F@80B > O@g"h@5   1  -@   &   @6 @    耤   &&  & 0@fؒ` @@      *@&@8㿘   > O @hA"0@ > O > O @h6"> O @h2#0@h/#  > O @h(#  B C C C( C@> !> > $"!> 4 4 > !"!㿘?2   0$# > a  ! #> O`!!`&!!c8@6 2 ! `!  $!㿘  @ H>  b4?& D & `& `$ ` @``$`  & $4 & & "@" `&& `""`㿘`"  "`> ""8 ?"&& @ > ""< 2> 4p> b!> "4  '`   $@ &( `"4Т  YF & "4/  ,@ 2  $@2  & > O@A#@㿘> a - > "<` `D?"<`,]`"<""<0" "<> a4@< "<" 0"<"$a" $a> a @- "<" $a㿘?2   > a   !> "<  !  !P"<!! @7Q&! 㿐> ",`'0# @e  0# @] c @1>  #@> #@ J'c@X D'0# @"0# @ 7'10 #@#@2- > ""<`$ #@  "`<1> $ &!" @ <0 c""@ & `"<"4!"< @ <"`8"`0 & <0 #@"`8"`4"`0& >  "a1> !? 8   > "<`` " (`ؐ X@ '<``    &!< "!? 8   > "<`8`4" (`0 XV@ '<`8`4   &!<8 "8> "< g!   2 7> > "< @  "@ @Dy <s <  "(   ' &!<<b<0<84@  <, \N <> O"D<@eԐP<` "`F&!81> >&"<`(   6  > o"a "<0"1> (&"<`(   !'"<> $&,` &,@& &(@E "< &`, &`,`&`,Wh '㿘@!㿘@t8 㿘> "4 "  , ,`@ 2  "  2 , 㿘 ,`: B`@ "` 9 a8> "0 >ϒ`     `a8  2`a9.` .` > "0, `X `X  $` ` > .`@"0*`@`Xu 㿘 ,` 4`2   @ X @ ~ 㿘 ,` `z "`   "8`  ` `> "h  > #t>ϒ`Ԁ  #t `@  2`bh@ .`h 9> "h@ 6b .`$> Ր#t, `X `5 `> "̚  > "l>ϒ`Ԁ  "l `@ 0 2`b̀@ .`5 > "̀@ .`- > ֐"l, `Wߔ 0` 0W$` ` ` .` .`"> Ց* ct `WƔ 0 > ֑* bl `W 0㿘 ,`D N`L "` E `> !l  > ! `   `@ ` @ 2`!l@ .`' > !l@ .` > !, `W{ `Ww Ʌ$` ` > .`@!*`@`Wi w㿘,` >̐"<*` €  ߒ    x> ".`@`> P@bK# > Q> Q> Q `8@b0 @r> !(*"@ @ > > !,@8Ȓ` > Q X@c > Q@b#    *@8@ %@ :``* *@8`-`"@> *`!8@H /f4'* ''``@?> #a.` 8`  4`  @1 ``@ ` *@  $`  2|> a(* @a(`@, > (> ݐᜲ  .@ > a6᜘ >@  #\.@ #`#d#h @ > > Q@a H 0  > & ;  + @ B <3@ > a( * @  '0`'$`&0  B > !(X~<"'7o$@  b" *"2 ""`" $'' $ *`2` > !:` > Q> Q"> Q#`#d!Ha:a8@bϘk> > Q    C'?> !`  `` "!>  &`` "0@0Ӗ `  @ 2`` &`@) `  @` > Q> Q> Q#` aa8#\ @b$?" 6 7o""*">   7o" 2#\ *> > !(&`&: > * R@@> Q@`Ɛ!> Q@`!H 0 + 0 `*B? <$`@``B ``<$@@ $`$`H 0 耢  @ 㿘> ".`> "耦 @> !( > > !.` > Q!@`ua(`& > b: * R+ > " * 8  *@ H /fa(* 'a(  > P#   ( 8 " :``(  * 8*T@> P#*`  a(> !.` > Q!@`/* )a(`> @+ `( "$4`4@  6 @1 ?B$< H 00r7o"@ `> Q'> Q 2`"@a@_(`    7o""@`@ *"@6 `  4` * @ "3   $  3 2   $( > Q@_Đ"@ (@8  02    ,@(  0`B < 0 "B<  $ 6@1?`$$ " & $ H 0> ᰀ> ""> a> > 08"a> &a88*"ᰁ㿈%> $> !(!> `0!Vb'> b@#\  @~z> "a> ""!> $"(*` @, > '> a8!($`(  *@  @@\:  aV%"* @*`@@ " $? 6$`` ``` `"3 ``  -0]`"L  ->  )> "`" @>  '> Q  @$,@@`@?  @`"`* "`   * 8 " :``*  * 8*"@ > *`!8@S 8''  8 b > *   @$V> ` J >  @%  I> ! . @  @>    0 > Q> b$`  %> Q. n`$ @`/` @> @``@*?  >  _J@ "*@ @` `@$> (((`*   * 8@"@8*  ( 8`( 㿈> Q> Q> Q> Q> Q> Q> Q> Q> Qb#\#`#d"ؖ"b> > !b  ,``> Q#(   : # `; c#\ ;`  #`#d`ߠ 㿘`@;` @n 㿘> 0  @+ @^ 㿘@ڐ @ @㿘@ @  @ 2 " 㿘 `  > R0 > 0   > Q @]# 2>> Q @]# 0   > Q @]}#@]{ " "㿈`* >`0#> Q, cX` Th ?-@@ `@6  @-`"@.(a`?@- ` @.V `  #@2@  ` 2 @/  㿘 @0@*` ? ?g  @.㿘 2>> R @] 8 0  @ > R @\ P㿘?> R > R @\ x㿘 > R @\ݐ 㿐> 0 @  H /d * %  0 % #> R 0@$ 0 `@,j  0` 0 $ 0H 0$ D$ 4$ ,$   - `" )@ '$ 0 *2 @ : < `($ <$ < <`@> R@\ > R@\|   @@y|  0$ 4($ 009 "@$ H$ H@H /d * %  0"  %> R@+  0b  0 $ 0H 0 2@@@@y̔ 0(" < 4 "  < @@@> R@\$ $`> R@\! @"  $`$@ ;`  B# ?  ' @ ` q &dH /d * %  0?c $ 0@H 0㿘> ( @T!@!Pc!" 㿘> !̀`> Ra0@@  @ 0 @"> (> R@[Ȑ!@!@@U <@4" <㿐> " > "`!> #x %>  >  ): @  #x$Ā`#> `:`>  )`@ #x`$c,`:`>  ) @> `""dc, !> > R@[!h!> > R#\#a!8  @R > > R#\"ha @  @R > > R#\"da H  @R > > R!a#\ P  @Rޘ > > R Ԛa#\   @RԘ > > R#0a 0   @R#\> > R#\!aȒ   @R 㿘> #> "d @ *`   2  ) є     2   )0 "` "@" $"` 㿘͐ @ " > R@Z!Ё "  88  2 > Ȓ>  @ć( "   8  < 2 8 > Ȓ>  @ć( 8 2<0  28 > `>  @,( "     2  㿘 " 4> R@Z! 4`  > R@Z"K  8@> R@Z"@& &&&&  4  Oe  ,Ho  ?"`>&  0 ` " &> R@Za"h$  "&&> `> #,@* `&" `#,@* @"@&& > #0@T'>  @T#00> #0@T>  @T@c  4@_  `"  "` ? "& &  4` 2& 4@& & 4  &   "` $ &  㿘 `"  "` ? "& &  4` 2& 4@ & 4㿘  `"`|""`|`"  "` ?"@&&  @? "@>  @S#0>  @S㿘  4`  2 $` &`? &`@& $   4"  2  `5?   "? "@   2 4㿘  J 5`2    @  @   20 2㿈 5  *`> R:@["   8*`:`> R"  8> R 0> R! cƀ"!> R! #ƀN! > S  ƀ  > S!$ 0ƀ $ \@;  d \@; d T> S X ƀX > S А #\   ƀ ā㿐N   n.> SJ `  N@" LL 2Lm> > S@Z > S@Z} > S@Zz!> S@Zw!@0n wa0/"0,> S> S> S> S> S!ha@Z_! > S> S> S> S> S> S> S#\!a"@ZMb> S> S> S> S> S"a8@@Z@"Pd'> S+> SN5 P > 0 > Sb`   *@Z+8L n"> S w a"$;"+`7bh$ @Z0`"@ 8? 4 ? `  N5| "#\#\#\ #` @Y0  | > S"@Y`2 >  Ш 2` 8"``8">  8@"  [  @8" 4 "㿘@`  8@ " 4W 2    4 4 `   4 `&㿘@`  8@ " 49 "   4 4 `    4 `  `8& ` "``"  @" 0 "" `  "``"  @"㿘 @`  R` &R @:`   Kh.  2& 㿘 )>   8'> @Pc#0 @P_Ԣ 4 @ܐ  @Qx#0@Qu  & 㿘`@` O >  @P7  !@ 8  ": k 2 43 `4`  2-  0@ " 4%  4 `` 8 8@  " ` `4    @Q㿘  @ `  `` JԔ ` J̔ ` JŔ  "㿘@` `  @ @  "z  u @ @   @ @~ 2a @ @   @ @h 2K     @S 4 @  <  <$  `@@] $"  0 2$  0Ho !"` 㿘  @ `  `` J ` J ` J  "㿘@` `  @ @  "d  _ @ @   @ @ǒ 2K @ @   @ @ 25     @ 2$ @$" 2$  0Ho !"` 㿈 ` @'쀦' @2'   2 '? ?'?'e㿈 ` @'쀦'@2'   2 '? ?'?'㿘  @`  @ "@  @" @ @  @ "- @ @  @" $  <N  J<$ $ @$ 0" Ho !"` 㿘  @`"$  @  @ @Β @$ 0" Ho !"` 㿘  @`  @ "4  @" @ @  @ "! @ @ $ $ @$ 0" Ho !"` 㿘  @`"$  @  @ @] @$ 0" Ho !"` 㿘 `@= 2$@  @[@$@``H7,  2@ 02 Ho !"` R` `(@ :    *    ` 222 @ 㿘>  @M! "㿘@? "@> @N!㿘  H P &㿘ؠH P &㿘  4` `  &```G@㿘 `4    @ GW ?"  02  &  㿘@ % )  "`c "=`_    O ) K )J &2J A )`   4 5 )  1 )   J @& 2J 2  ) >   @&`>  ̀ )` @2J &2 )?&  㿘@    "`[ "0`W    H`@KB `   4 7`  3``@4  `(` >   @&`>  ̀ ' 02  ``2  ` @`  2 0`` 㿘  @ ` ``1 4 &?@Ja 6 @  @*! H /m4`* .`` @0\``H 0 㿈`Fu  @@㿘`(  .` 0 `  2` @  2  ` @(  > " v 0 ` `@ "`0 ?$  `0`> ` `` >     (> #|> #x :`? 8 >2  (>@8  ` @`>`2)@@` " @82 ` (`>" "  >" "  > !,8     $@ @v  <@<`㿘@ * `0 `Eɐ  㿘H o4+@n   H 0 @D@B 2 > %%&&&&"4`> #`, @,`b2*@ *@ b 2`* @ *`B2*@ 8*@1 Д @1@&Д @@16`.  .`@c3`+ +` b 2**@C3`+ +`&  @1 Д @1@%А @1@)%5`- @-`b2*@ *@ b 2`* @ *`B2*@ *@1c Д @1]@&А @1`@&P@    ?"3 7 "$ 3  `E  E˔ H   "   5? (  @  `% E H` H`Dܔ H@Д""?`"?/""`" ` " ?/"" `&"  `@"` 㿐!> "Т 1> > !#\> S#0bؒ   @H[  $"А#0@I E  & 㿘`? "`> @J#0㿘  d " T" X` >"$ H)$!X@ >  @/㿘1> >> S"Ԑ"XԔ`X ""> S@P" &"ԁ㿘> 0  H /m * . > #@ - 5 0% Ho  "`@,> #@H 0>0 '> > S> S> S#c0@PC  `H@  > S> S> S#c@@P6 +> d 1a̤0H /m * .  @,- 5H 0aX?<`"@@"`@@<"@"@"<C aX2<d à > Sc`@u @D1aT 6`` ,` (@H /m * . aT@? Ho  $`H 0@!CaT C@k0㿐> @ɸ"@' "@ 'Вb@ ??   & & ?/a  & & !X & <!X <"`@$!X!X& @H /m4 H* . H * 5Cc > S@O#p㿘!2 > à > Sc@  L "L&,  X& X"@"X T*@"T > @ >  @#㿘!2 > à > Sc@ʻ  ` L?# L`,  "`,   " X  ?"&&   T`!T *@* #!T!T >  @ː 㿘> @> à > Sc@ʆ ` (aT "`H *` T  `@q&  `*``H 3 > S> S> S#c@N! aT  >aTEs?*` T0@ 0 `H 2 H o@F2 H /mސ* .0. 5㿐#> > @Ӓ`@  ?> `@@Q `   \&@ @r 㿐 0   0R>  > `C : > @` @> >  > 0  \` >   `B -: @; > `@1@j@@$  > 8`B :8> 0`B :0㿐#> `@ "@Ґ !TD?*  T # 02 @* 6 2 0@ ݒ "   > `& B :2   2  㿘> `#@   > a 84D"> `8 >  @ >  8D L> `0D P`2 @`  `$`4> D<&㿘> 0 H /m * . !  ,!, 5$  0Ho  "` `@ @*"`@H 0㿘> "@> `#`*  ""@` `0*  *@H "@` `0*` @(H/@("@ @` `0( * @㿘> @b؁@"㿘 >   #> cC, ?,  @ Ȑ,`:  ,   > @  " aȄ+ 8  > @  " aȄ+ 8  > @  (" aȄ+ 8 㿘H/` /> `@   & > `@&"`@> S>  @> S" $ `& &"`@ #`@H 0   H ` d  \ 6 "`@"@  d `88 2 82 `8@@ $ `82"`@@"`@"@"`8(@ `@2 ` @  `" `H㿘H/` /> `@?"`@> `@"`@> S> S2?"&H 0 #  H `" ` d @" d    2?""@`8(`@@""H > @" "@  $ 2 㿐 0  d` `82@`@"&@`2`8 㿘 ( o   > && & bl@"@,0 㿘@#Ԑ  $ "   > S0& $0 & $ $` !> S #@L  $`   0 $@K#㿘>  @&  @#d! & $㿘 $   0& $@  $ 2  & $@K0& $@#/  p p p p p p p p p p p p Ƥ Ƭ Ƭ Ƭ Ƥ Ƭ Ƥ Ƥ Ƭ Ƭ Ƭ Ƭ Ƭ Ƭ Ƭ Ƭ Ƭ Ƭ Ƭ Ƭ Ƭ Ƭ @: 72  0  44 ` /  0(>* `  @  0 `   @    㿐> >! c8@! > a> > T#\ D`!D  @BW 㿘>  @C D (?J!D $!@ ("`( (@ @㿘 (!@`@& (㿘 (a@? "a@> & (@D D㿈@`?`   (`  Y G, @ `'@ ?&`&` a*@ 2&`a 2a` &`a "a` &`a  ` @&`2` 0 " 0` &` 0@"`` &`` 2`` &``* &`> 2` = "@    ((H(`"  ("?`M"  0H" 0H" 0 8 H "H@("@8  "8 "@  "   "   " > D(` 2! H "`"!! #!!  ! #!!  #!H> D  *``*!"!`` *`㿘! + (>  D !?ِ * , &!*`! &!Ho * $`*$@!`2!  0$a($a$$a $aHo * "``P "$`P  "`H@```? ?    "  ( "  " H    "㿘 (?! `$!$!@ 3> T& !(`@  㿈 (`! @!( $!(``! '!$'!(   ̀N"8 $02 ` @281 "  4 2 *  ""8 $02  `  5? @ؒ2   㿘 K*ߐ  D  @"   "  "   2 @   䀦0  "   "  "   @ 㿘   @ 㿘   " , " @g   􀦠 0  (* G!"D$a8 2@$a8  @` t.`x@z't@  < "<!'t` @ `@  & a@`!* &!>  D`"$@!&! $@$a8$a0$a4$a,@  㿘@ 㿘` > T@FŐ  0 i * '> .`    0   0@2  "   D  (@ D 0h5   & PHo "` @f  !%  !   N!  .!    4`    Ho * "` 쐌  Ho * "` 0 Ho * "`Ho "` $    E    N 5 H /m4N 5* .N 5 >   " 00> 0 h `Ho *"`0o`f2e!`hHo *"`6!0@/ 0U 0hR` I * 0 Ho  "` Ho *"`"&! ` & &. 5`Ho *"`0 ` `@ߐ0   "a! 2 2.!@"H 0 @=`㿘 0 2     0*@ +  ;ː ? * H * %!  0("  0 ((2; ( 4!0H /m * . @ "  0H 0 0(" !0 " ?  *@ 2 Ho * "` (. >  `D @ <0F 8`> T 8@Ff + 0(2   4`2{  4!0H /m * . @, "g H 0_ 2]  2X  0(2T > T@F+ XO Ho  "`㿘  0. 5Ho * "` 0Ho  &`> !  ``@q > @b؀`@ 㿘>  ̀ &#8 0 0Ho  "`  @`0 2   l  @`  2 0> 0  (> T@D$ h? * Ho *"`. a,@@  a0a4a8 @`  x't@fta a  @O0K> T> T@Cܐ pH/` /a  ?a$a`@ $a@ * $>  D`"$@$$@H 0  < "<a,@2't$a8$a,$a0$a4't ` t㿘 0Ho  "`!2>  6!2D.`` (@ "a, "`  㾠> "$> T' 0@  > 0! >  ܀`"  ܀` > T > `0  0 @*   @  o D j> T "@D !^  `  % # !% ''''@' ֐C@ +`4 '  # 6  $ @ @$  ?8@ 2?`42''' 0€ @E @ " > T@ @> "`! `@' $ @h' (> ',('0'' *' *' +@@ +@ @'쀢 2@ 2  #`#l#\#d#h @p " > T@ 㿀   #`#d#l#\#h  @V `! > T!> T! #\#`#d 8> T @C @B >  㿘 }  N>  `  [@?b   쀊@2 쀤 "`8 ? * H`*@ $& (5  y> #` :`: @ > d *"@ *`@ @#*`@ : D 4`6$Pc$PHo "`> T!( @`"  > T> T> T!a(H@A&3Ho "`  <"?  #P 2 &> T> T> T!a(X@A&<` p  @! P`'p5M 㿘@! &&  & ` >#*` €& & > 0 2 " 4`(" ` ( 4(  (` 2``?"`"@*@   "  @ 㿘  > T@A@!p  `> 0  `> T@A3!V R> 0` `?&?&8  "'@ "@p  2@@44 "@0# 2@@60 @&@`@"$`$@@"B &>` 2㿐` 2`> T@@Ӑ!``4@> T@@̐!  2` &`&@  "  /4n   0*  `?$ $```B >`&`㿘 > T@@!Ƞ , *, <,     @?*``@ &&㿘  &  2&  `&  && " $  &" $ & $㿘 2 @``"`& `?@"&@&`߾ 㿘`  % @  2 0 ?` "`&  "$ $ @ `ߖ  2 Ϝ ϸ  4 X t Ґ p , ` x  4 H D Ӵ \ p  Մ ՠ ռ D ` t ֈ ֜ ְ , T  4 d X p | ؘ  , d ـ Ԕ Ҭ Ҹ H ٜ $ x H ڀ ڤ Դ ۘ Ѭ Ѥ Ѭ Ѥ Ѥ Ѥ Ѥ Ѥ Ѥ Ѥ Ѥ Ѥ Ѥ Ѥ Ѥ Ѥ Ѥ Ѥ Ѥ Ѥ Ѥ Ѥ Ѥ Ѥ Ѥ Ѭ Ѥ Ѥ Ѥ Ѥ Ѭ Ѥ Ѥ Ѥ Ѥ Ѭ Ѥ Ѭ Ѥ Ѥ Ѥ Ѭ Ѥ Ѥ Ѥ Ѥ Ѥ Ѭ Ѭ Ѭ Ѭ Ѭ Ѭ Ѥ Ѭ Ѥ Ѥ Ѭ Ѥ Ѭ x ܐ ܨ  0 D ݄ T   < X ܼ   l t  @X`   'Đ `  @*2Ȱ xȒ?` #> <*` €>` !X > (>l >!> "> #> !>/"Q -` 2Δ  H` "%`#> a្  => a(` ``H3 " (`Ea-  @[  ":a0"`#\``ğ``` "> @[ٔ> "!  ` `2 x> \" '`?`;>!*` € ?`K> d*` €> > Đv> > h@^l> )$"> #x> #|> L > %I"> )F"D> $>"!> ",'@D첒   ", 쀢6 $",@6$",`8 * $", '> "@@Ú! `> ""(> !(@! ز`ְ> "#H!> #L'@$#L> ܘ @@)ݰ @ 6հ @mͰ@ǰ> %8"a     > Y!> R!> K!> w"!!&V~1S sK > ) ܐ` [ V Q > !h a@L  B> !h a@" < )  #\D-> "@V >bĘ 0 $   ?@"    $> > !Ȳbİ  @W&? b > (( `> <  @z> #> !`> ! @;Aܰ!> !x'@ژ䲒 䀢``ɰ  Ű #@4$!x @ > o > h > a > Z!̐ @d @g @  @ey @ ۚp> @p# 5@c @*hY> #T @ I>  @H?!> !@>! !2 U +$!> "3L @m d@ > !> ("b> ! "? ' @< > '#@0 - > T@e"㿐 \`?ְ ?`>"*` €> > > !Ȓc> !̒^Y> > "a0P* > (> " " F* > !(A @  > !o> Tl @  >  > *` + # @+ u>   @ h> #P`c -@ ^@V3> b4 Q -1>  @h 2G d d&  && b4@ 7 > #T0 -> "0> #D> "8> #@!@%> > a0" ( > (>  " (  @ -㿐'@6 @   ' 㿘  @     `&@.  . 㿘'P` @     `&@P. 㿘 @ *  \ -㿘  @     `&@.l  .] 㿐''` @     `&@.H 㿐@#\㿐 #\@㿘\@ `  @@  `,  `% ` "&@@   ?*?@.@@*&@-  -/㿘@q   @     &@-ؒ㿘  @ ` `&@- -㿘` @   ` &@-8  @ @>   ` *` *  @&@`!> :&@ -~   2&&@.  '   `_. `U    @ ??????? -S ` ע ߰ `&&@ 0\ @_!`?&!| >V`& `, & V` & ` & `& `  > ` & (`& ,`  > 0` > 8`(  > @`0&  " `8  `@@2 `8> H`@> P`H> X`P> ``P > h  & &  &  ?`>"ؓ*` €`2`( | > p 4& x & | 8&   >  P  >  P` `@^ ` `@! p` :> > *  & > & ]& `(R&!R&! >! R&!  `&!$`H " `D ,`0A `0= >!(`>&!0`8&!4`<&!D`(1&!H`D >!(`>&!0`,&!4`0&!8`4&!<`8&!@`<&!D`,&!H` &!L`$&!P`(&!T`  >!X`( <  >!` @ &!h`( &!l &!p`( 4&!t`a `8&!x`!@ &!``@^s&!J&!㿐'P `  `(  ! ` P@   !  4 t > o 2m >  `i`  `#\    + 2@%@`2` ID>  ̀ B 0"@2 M 5  $  82    `#\  ?~+ 2%  `#\  ?e+ 2 %  `#\  ?L+ 2 ܤ% ܀  `#\  ?3+t 2% 6) ,@`"`, 2 `#\  +N 2%&  2] 0 ̀  0"@2 M 5  $    @2z    `#\  ?Ϛ+ 2 %  `#\  ?* 2 ܤ% ܀  `#\  ?*ޔ 2% 6) ,@`"`, 2 `#\ w* 2%&  2s 0 b   `P, * P"㿐   @  ` `2ð    2    " h   `2  &  `"X(   "X  N >  s' "p``4 j :>"- €`84% 4 ` "X` 8, "Q`4 ` "K` p2G` `2?`  @28` `0"22`E #@J*!8 6!8)" 0#<c @ɒX"X) %?@``2N`5  >  А '$@'@ #@'@Շ Ղ 㿘&@ ``4 P &` &` &`  &` &` &` *pN 5  5 8  $&a&a&a&aa0@!&b@a0!4&a &a &a &a*Q  &b@   "&bD 8&bD  4`&bH  4`6bL  ,`?` `?`p&bP`| " #&bT`&bX&bP`  @ &bp 4 ` 2 | &bp |`b\> T" @[ `.bc`6bh&bd6bl6bjbt@[ .b! @[b.b   0   P>b  0&bp ' 4 'ؐ''В @Z"XД Ԗ8` `  8`   @ 8`(`0  8`0 $ 8`8 (  8`@4`   8`H!4 8`X , `d 0 ,@ ` `h 8 `l 4` `x `  ` ` ` `  ` ` ` ` b0 ` b4 `'')`Д  `` b80`4`0` T ` ` ` X ` \ ` 8` 8a 8a ܚ  8a a a  a$! a(! a, 5(a0 ! (a3!00a4!20a6!'@Z'Д Ԓ! @Za8Ԕ ؐa`@Z  Ԁ```  ``` 2I 5``  ``I 5 4 5 0 $ "!$ a $` a $` a $` a!$  8` 5(a0 ` a ` !(a1 ! (a2 |`aP''@Zm  ` 8aX0 " 5 P8b@ 5? k? f  8a  a a 88a : 8a   :`8a   :`8a   :`8a  $ :`8a  ( :`8a  , :`8a  0 :`8a  4 :`8a  8 :`8b  < :`8b  @ :`8b  D :`8b HP?@'TL @ '?/!@ '' b b$??8bH   8 `p`  8 `t,  `?`p ``| ?  `|` 8`P? `| ` 5 ` $`4 a'Ȗ  a a a aX`'T `(     - 2 5   &ް ? ٰ 0b@а @Ͱ $  >  % (9 'T=   ?'ܺ ?''''@Q   s  j ,``*` '`y&@:w  /> &  w ?T''''''''ؐ@Q c "V( '  ?T'('ܠ" '''''ؐ@Q F L  @`@@L 2`@ +& ,@@&'',&  ` &'`@   '& @hB X> ">   '?А!I  > а`  >   `+>  /> ` "@@@` a    ">   >   * * "  * %4%a% /   *`[%aج 3> T`@~   @@W۔   C @ A B#\ D #` Eb#d F#h G@4#la%`> T" > T@4Pa`@@` @X&@Y`,& `0X> `8> `@> (`H> 0`P> 8`X& @`\& D``& H`d& L`h& P`l@& T@`2`a*?3& 0>  `,'>   `@W`@!`,& `0X> `8> `@> (`H> 0`P> 8`X& @`\& D``& H`d& L`h& P`l@J& T@`. " > T@ &"X㿘`"     >  @S > # $ D#  <(& @@ &   T    '@> cc &@ &`  &` &` &`  &` &` &`&`> ##`&@`&``&`` &`&`  @= 6  > %- > %!<,  , @*``$@ , *  $@@d ",   , "@*`` &9  , "*  @M $@@: "&$Ъ  "㿘 @  㿐```\ `% T  μ `` $`@V  H`% `$ \ `m 05    /  Η @`$`$ ` $ `$ ` @$ `$ `$ ` $ `$$ `($ $`0< (`8$ 0`<$ 4`@$ 8`D$ <8 㿐 `< > !l4`> / !l 4+ '> *a * `@`"      0W`< `'d `&`< 㿘` >??  0 ??2   g (> X  ?㿈> #X`> #"$`Ho o> !H 0 H 0  @V@֐@ @@ِ@1 2 2㿈@8@@``H /m4&`* .&`@P @X@@`@&`H 0  2㿘> 0` > T@/ΐ"hL 5 " > T@/ǐ" @ @`@    & & & H /m4&* .&$ |,!$ `$ $>`> #X $ ""㿘> 0   `  , 5@`"@> !̀`> Tb@ @ L 52L 5@L 5 > T@/x" ! *`HH 0  0Ho  ?"`  @ @`@ y 㿘`>`0`@X d㿘> 0 0d"x0Ho  ;"` #  @Pd 㿘> 0 a`3&  0Ho  "` 쀢`  0( @ 鰐  &  `  @i , 5&  ` & & 㿘> 0 `$    쀢`  0( @ 逐  &    (? *@  ? 㿘H /m4 `* . `  N 5 @  0@ 0Ho $"`H 0``@8` > X` `?@""@"`"``㿘H /m * . > >  c#X@ @@`= +> T 5 *`b@.U:` `2(`$ ` $` $ ?"$$ L 5 2 ( @ F , 5$ ߛ$ ޯ> > ""0"a `2 5H 0㿘?㿘@ R 㿈>   @`` u [` \!  2l`@ 2e耢@ @" @ 耤 > !!  LJ #" '"@ '沒b ?> #` :`: @ > d *"@ *`@ @*`@ : D 4# `# c"  & L> !!Z  2 > T LؖL!2?" 㿘> `  `@ [     L2   L   & L  2 L   㿈# @'` '> T"@.\ > ",`> ""`` > 0 " > # @> T#@.ђ" 0@H /i * * ""@" '`"@ 'Вb@ ?@#"`"> aa? #a  ?/a  #a > > "#X"c\H 0@^X 㿐``` 0: 074 Ȑ0 >`@@" '`" 'Вb@ ?  b?  ''?/a  ?* "@*`@*`&& 㿐@ ` g 㿐P ` S  2 @ 2 +  㿐@  2 > #`'@ "'`` 5 p`@ &  W#@ 'а'@  J Hǐ  > > T"ܔH! ?"  #" .."@'ܐ" '沒b ?"@'"'沒b ?耢 ''ה  2㿐`@`  @^FŔ    > #l 㿀`@ע 2-`  $   `*`" * *'l'䀢   > cl"cl" 㿐` @> #`>  :`@ #h?r  2+`'Y 2#]  H /i * * > #` :`@ > :hH 0 㿐`@`H /i * * > #\H 0 `` m  fc*" * "@*`@ *` @` #`> @!3 > !@4> @> #h*@ *`#h@@ @ U"0`& H /i * * > #\> "#\"cXH 0 `!В"@@ 3'"@@'   㿀@ S H o *@ j 0   ' ' ''쀢,䀢 " ''" '"@ 'Вb@ ' ' * ''''H 0`` x@ &```K  2v` ? `j`f@Ð 2a @  Z . @耢 쀢 "Ґ@tؔ?ܐ '耣 '?/a  ?& & & +& @H /i * *  , "䀤 """ @T  @N H 0 㿈K    ?/& =& ?/b@!b?     & @&  @& &  @ @    "" '耢`'@??J?$  0@ @ }x8   沄  }x@8  Є?`  2  " > d&"    > d&"  6  "@ @" "    "  "  " " "  `" Є@@" "  㿈r "@' "'Вb@ ?@@`       && 㿈1"@' "'Вb@ ?耦2   耢   &&  &@ @  @ @4&@ > p p  > p  " " " 㿘  > T@(#X`!> > T#x@(@! > " @  ?&  & "@" ? " "@&& & > cp`&& `""`@! 㿘> #`@ :`: @  > d@ `@ : D 4`c 㿘> #`@ :`: @q > d *"@ *`@ `@ *`@ : D 4`c 㿘> #`@ :`: @I `   (0 (@c3`+ +` b *2*@C3`+  > #d @ m @ : D 4`cE 㿘> #` :` @ >`  `c- 㿘>`0( (@b2`*  *`@> #dC3`+ ;@+`  㿘> #d@ 㿘> #d*"@ *`@ *`@ 㿘!> @!    ? " "@&&   ?&  ! @ & 㿘!> @֐! > `# `> #p*` @@ > p" "  "@ " # 耊 2Fp:  ' @@  p" "  "@ " # :` .p:` ' @@  p" "  "@ " # :` p2`*  @@  p" "  "@ " # pp @ @! 㿘> @h! > pp@ > #p+> )@'@p ?" "@##  b"@ a !:` `  !42`:` "#* b `" # :  !42: "#* # b"@ !:` `  !42`:` "#*  " b"@ !:` `  !42`:` "#* "   ` # @* @ pp@p@ 㿐$> #p&%>     6 `2'> T#' > T<`"   @(:2 㿘> " > T@( #> T@( #> ̐#p> #pȐ #`㿘> , > "0> > ",#x |b> >   T > "c㿘> !,> a0!> €!4> `\!42 @> #xb:`㿘!> !, > o#x> a0!,€ > >  "a8$!,"4㿐> !,`Z -   0R5> 4' I 7> /!> Bx> a0a,€&&4!> !8 5!8 5>   !8> >  T 僖 & 7>   7> 5> `> 啐 &!8 !> !4`> a,0> `!42 @x:`0x㿐!> > Tc#\   #@Q #@D > !L@ْ > !X"!X"`> #:㿘 $ d   & & &@&  > & #& "0 㿘 @   > U  &@0 & @%    #> Uj  ` n  `@Ԑ 㿘`  > @/#   @ @  㿘&@&`&` &` > !< @i&` `"& @Ӓ 㿘 @Y  > U@į 02 & @%1   +>'> U)> U& @ 0 Ya$@4 "  @& 8   & `   0  ߔ@`㿘@ #> U     & &  2    ``ژ  ? &  m @; 㿘 %>  ``€` @͐ 2@0 㿘l @@@㿘> U h@$ A A A B A A A A㿘!> ">b> c`@ɒ > "``@6"> ` "`< "#`L` H"`LH"`L > > ""0㿘> > !b*> " > > U> U> U `@$H  ̀ X 5 ?` $   $ > !`F \ 2 `@$ \H /m * . d \  X X* *  @* @$ \ T$ X#@($ T@ !`1L 5  ! 2`2@" ,!Դ ! ԉ,!0,!H 0  2 5@\r> ݐ \’ 㿘> ! T> !̀`,> U`@Q , @& T &  & hՐ@ "& T ? & & T@L㿘> 0 H /m * . !  ,!/, 5 `@ @4"`@H 0㿘> 0  > U@# ȑH /m * . !  ,!, 5$  `D @ "`DH 0㿐> @ 0@4( L`5  > > U> U> U `@#W!hà  > Ua@ɐ R@@"" '"@ 'Вb@ ?`? $``@ $`?/a $`$`` 0`: @ (2   8#    H D  @8    @`B <Ho  ?"`@  > ( "ǐ>  ,`5> "b0̀ > Ua@I `> 0@ > U> U> U ` @"”!`Đ 㿘> !̀`> Ua8@. N 5`*`>! €> U@"!8 0(!0  ?* Ho  "`  . 5&   & !  H> 0 H@ > > "a"0㿘> !̀`> UaH@ސ N!  *  T @ 8    .!   H> 0 H  > > "a"0㿘H /m * .  T $ @8& T! 1! .!H 0> x x > p p >  h> d"`" h  㿘   @> ap  `> U@#!XV` `> U> U@#!pV`@#!x2  @ 2 `> U@!! p > U`!@#s   " &   "& P & &  H 㿀''''耦` `  ` @ >  h' ,'"$  * 2  (*`: * @*``  2  V  2V   2> !p`耢`> U   > U@# !@# !㿘` `  ` @ >  h4*`$ %` * 2  ( `*`: * @*``  2  @ T ` 2T` 2㿀> Ra'' ''''a> #V* @*`@ ?* 2    @F 2V * 㿘: @'"  !> !tƀ * @" 㿘  > U@"r"0  @ 㿘    ` ` @p `* @"@V   V `  6 6 > `p&```&``""`@`> U"P@"4 > > U"`@"- >  h"&  "  2 $V `@2 $V "6 V 2 $  6  $  뀢2@Ɛ@> #X``ᬒ㿘@ /`> U@ U"p  2`> U@ L" V` && ('& V`  V`> U@ $& `  @ @*`    @ & ` @ *`@ 2  V` & > U `b @!Ԓ  (& $> U@ "` #  , @$*`*`$`   "> U> U## > U@"@ڕ, @c $@ @* ` > U#(@ & ,㿀> "' @E   ?* 2   > U@Ȑ#H  @`  € -` `> U|#p @ ` `> U`$2`@`2`$> # `"!  2 $T  T  @"4 T 2  $ T  @ 4  $  怢 `"  "`> " t ? "& & @v `* "@> U#@  @j 6@ 2    *`" >  $$4 > #X`  b > Up# 㿘`  ``(  -   $`(€ 2$`(㿘`  ``(  -  ?$`(€  2$`(㿘 $ 2> > U@# x > V2@`(2    2"> V@ِ H" " x " "@(" 㿘>  x  x?  $@` $`$ "$ $ @  (@ `2 > d d㿘> `d `d> V@ x`d?"`d`d`v 㿘>  p``"  `$2 `  "  @ 2`$ 㿘 @  €㿘` M  $2F ``` 0 $ ג4 *> V  @Ȕ``> V@ ؀`!  @ 3> V $2   @a   @  2 $0  2 $㿘`  `@ @.`@ 2 (  " @ ," ,㿘 ,? & ,`  X"`XU" X`@@-X"K"`XX@ @ X @ >2X `48X2X `81XXX2X+"`XX2X$"`XX" "`X X@ @  2X `4X2X `8XXX2XX"`X"X (   @*`2  ("# ( p < @B 2 8?3 p# < 8 1 "3   0 0    @B 2 3  p <@ B  3 # 3 # 3 L# P p < @ B  3 N# T @# # 3 r H'D !W'H??耢@ D D  D  8  D`(  D    D?# ?* *2 @ @'Е2 @ !W ?D` @ @*`* @ 2 2` `  * 2` D*  @@ @`@ @+` D?(#D'`,D'`0D'4?D'8@D' <D'H*D'`X*D'и @  @ + '@@''̺ @ ' @Ė  '؟-` @ @ /`' +  **@ /`+` */`@ .ܖس.`@@Գ6(`6е.5 5`. / 7`̄52`@1 Ȅ Ġ5`7`6 56` @65` 7`6` D,6 ,2 @ &66&(&,@6`&0&4&8&<&H&Xt\?   ;?c @?*` @* 2 @ 2` #  D?`p#`r  @ `*2*`2  @5`p5`r??   @*` @* 2 @ 2` #  D? cD @  ( -``?`  @  , +,-   @ 44`2  `4(0+`2`5`5 @ &`6`6`&`&`!?`   * * + +` @ 0 0 @22 @ D##r 2  @*` @* 2 @ 2` %   @ `* 2*`2 @ 33   * 2` 3D D7`7` dHH p< @ DB   Ք!H`r )H` ` 3`r 3`p  C  >?,  -` H5`5` ` H5`p%`<5`%`5`%`5`L%`P*3   @B @   2쀢@ HH 3 N# T3 Hz H3`8`N '? `T `8  @ ?B 'H'P??'D'T' '  '  `(     ''2`((`(  `(4  @B@D;``(4   @wD *` 0 <DH@@D P̐?"DH @`D Ha *  _Pb?# ?? *  *@ 2 @ 2 @"   "'  " ??* ? @ * *`? @ ?3`?  @* ?(3  2` 2  FB?P`?`0 2`,  '`0`, 2`8  ?'`,`8 `0&`,'`8` 9?.` !@ #`p+`(*  1 -?`< 0  @ 0 B)?2 8 1  @ @+` (0 @ 3`  @  B8z @ trH C    ;P 5P2   - ) )P  #P    ?@* (`?@ ?2`@  2   ` '  +' P`&`-` # ?* * 2` 2 ?F 5`%` + +` 03   %@5`   `I.``P 0P `+7`)PD`H @  " `  ` ` * :  >*`2`n!P``  B 7a'a7a'a /a P  7`L'`P`p `< @ B @   2   7`N'`TT`3 `(4 B @@ؖD:`(4   @D # 0*` # <DH@ @D  DDH 4㿐`8 " `( !2 @  A! !W@2} ` 2y , Er 6? `* @ ,.* @     B @ B 2V  2S      @B @ B 8D 2 ( =   + +  3  `@?@=є  26`#> Xϒ `   @@=  26`6` Ĕ! > "  㿘 D  <*  a@ c: `8`O: KI  @  `(@C@ 4  B   @ 8,`2  ,`2  @ 4  B @ @b <?$% @( % < `(   @ 4  @ΐB   @ D`8 @В% @ 0 (% 0% 4?㿐 D? @2  `@ `4` a> V@a>3#>4" 0,  :`> V!0> V!8> V!Ā V!@Ā`   ? F> V!HĀ V !X Ā`@ , <`(@9  @ `8B F   @ > V#\Ā!h`8 @& `,  @ߔ `,   @ > V!Ā>  > >  " 㿘> V ’a @G  ( $ ( 㿘`( !`! є &`> V@!`X&@> &`"@"> >  " "?&`$ &` @ ? *   `*` @*@ &`$`$>  | >  € 㽐> `> " '0   $2 b (  @ d (`$ (b > V!؁㿘>  €? * `"  "`> "  ?"&& > >  ?" "> V@!㿘 @ ,  & , `@㿈@  ,??& ,> V @"n `"@' d"'Вb@ ?? h l & h & l?/a  & h& l`& `& d >` H 0@ CB> H> 0 P 8@ CB> P> 8 @`B > @@  U@ 㿘  㿘 㽐> !> b  ' @ d @.    @ B > V@"0 ">}  " > 2 >    " > V@v"P>`ğb > V!"㿘@%  > V@\"> `p > V5> V3> V  @N  2 b@G   2> V@@"㿘`G E&@  *`: >  p 6?#   @; 2L 2@  ْ ` *  *` @*@ & 2  @;q 2 L ?  2> "> a ?''h ? >  b  "b b !> V@א"Ȁ "> V> V @А"`2> V> V"@Ȓ`a> V@Ő"> V@"Ho o 3p p@9 3j H 0> Vp @:c +> V@     @:@F ?L *2  ,$l ll > V -> 怢 f3> /?> V@t#> V`#> V#(> V#0@d @bbHo o 3  @903  H 0p@:b#  @  (?&'hl? 2`   n * * 'h h > V@ h?'hhl@> Vl> "aha%? " f&a 'h-> 3> >X!@ `?> "a> > "b"S)> > !쀤?%a@ ?*   *` @ @+  *> @ "!'h'hh> > "a*"a2 @ > !p? @2  ` `4 @> V`a8 @@_ ol > V#@@         @  > V@c`  > V>X!> y'!i"`> !> '! `@t#h_> &a)#> V`a@j#> a ?a-> > !? 2` 22    2`  2 "a ?2 ?@a%a?2 @q a? 2`   > V#2@-a?"> V2 @] ? 2`   > V#2@a> V@"> " > VŐ#ȁ㿀> "' @9U  ?*"&O   @?А (*@`J@ 2 @> Ւ#$ @ "?  @8 ,`  `?" > V#Ё> Մ$"   2`@@2  㿐@#? 2` 2  ?#  , *  @D  > V@Ő02> 0 @ٔ?  > W@>e`e @<?  > W0@> 0  @Ŕ?@R`" 㿈> "'@7 / 2e?@  c@ 2Y?N  .2U? c  ?@   А `  .2:   *`@ +>      @@7  2  2 "?  > V#0 ?> W p, > W`@$;`  > W x㿘H " >  `` 2@`V > !  : : : " :#!" " " >  "   `"`` > `?`""`"`㿘 "]   `" U  R ?> !     `"``3 -6`$ -0. Ho oH 0  , ה   2  㿘> b > " "b > W> W2 @` &  "`"& 㿐#> b !> > W`#\    @   @   $b㿘> #  #>4@<b  㿘@ \> W> W @c`؀ !> W> W ؐ @> W!@T  + > W> W!(@K`؀  `> W > W!P@?` @@& ( 0& $&   ` "@ " ' "`& `   Œ 2& - & && & &  &  & `a  & @L 2 "` 2 n "`   "@ " &  "`3㿘 2 > W> W!x@ޒa " ?`"`"@""@U  `"  "` ? "& &   - 㿘     @ <"' '   ' "  & ='   . `2@&  @ "" & `""`?"""@ @0 ' '  '" &' 㿘 @> W> W!x@Ma @!> W> W!!@Ж > W!@?!!> W> W!!@˜> W"@1! 2 > W> W" @)a@ !> W @(> W !@"`> W!"@> W"@!@\ 2  > W> W"@a[   P  L> W @ >   &  !ߞ " <%@@ @2$@ ٲ`@`"  "` ?"## @U  :  @#@ @H #    㿘\ `> W> W!x@bd 2 > W> W#@b@ !> W @ !> W> W " @#(> W"#X@ > W#@{"&@ !> W> W"!@> W!@j"`> W> W#@cb@!> W> W"#@> W#@S"@  &@> W> W"@Ւb ?           !> W> W"#@> X 0@*"  ``*  `  " `P?`I 42`"? @ $ @  @@    @  8` ?[ Z u" r`:`  ` "@  C `?`? 53`" @ $ @  @@      ? # ," )`  `    &  !> W) "0&@@  #d "㿘 @> W> X!x@W`P @  @@@ !> X> W P!@Ҙ> X `@@ P: @!> X> W P!@> W"@0 P 2  @w 2 p N @ >  F@2 @ 2 `"  "` ?"## @ A 2!@ @ 5@ @ /@ @ `$  $ #  $" #$     @   @!> X> W P"@[> X @ ʒ P# `#  @K  " ?& ߝ 㿘  /` 2 !> W`&`"   & ` ! "N 2!  쀎` `"  "` ?"&&   `  > @@  & 㿘 `-> ` `  &` &@ " &  &`>  @F  &` &@ " &  &`     -& 0 @-㿘>4@b́㿘 2> W> X!x@ 3`> X > X   @`   !> X !@  2 㿘`/`a>  "h        @ a&&   J `  @   > > "ad"\> h@a``(`` "`"`&`"``` ` "`"`> `   ` > >  ` l 㿘> !h H/` /  @#%> '> X lH 0D #`$l! C "  H 002 @『H 0> al ?"al,  `$  @&`$ ``     " 8㿘 H/` /`A> !h`` > @! apH 0 R > h> > !t"8" t  t` 2``?"`"H  <`` " ``@ 㿘> !``> @ ǐ!p!> !l !l :!l > ݶah!l ?$!l }@"0 ~@w@> 0@@= v@( 08H> h   H`6$"> h @"> l ll l> al"` "`  "`> |" `"2 2<""<  2"`"`  "`2  ""`"  """  2"""> " 2 ""3 2"`"`  "`2  ""`"  """  2""" "`"" ݘ  2l`2 "``"` ` `@2""" "`` n"k 2`2"    "2"""" `` "`2 `"` ` `@2"""m  "``"` ` `@2""" "``"   A"2`2"    "2"""" `` "`2 `"` ` `@2""" "` "2`2"㿘`2`@` = "  2" "&  2# # " `"`"`"`"``"&`2"`"``" ` 2"     2 ```" "& 2# # ` 㿘@ " `$ $ `,  ?   ,  `   2 $ &`&`&` &``6# # #@   "" `$ $ `,    ?  ,     2 $  " `$ $ `,    ?  ,     2 $  "     2 0   " "  "     2 0   " "  `㿘` 2 H 2 H> X@! @@:> X@!&  H @" & H@`"``"``?@"&@&` l" t" `$ &@" & &`@R l"2 <> !!@r < `& <@& 㿐\ 2B > !(@ 9!( @*@@ @א#( |@44 *@ > *`!x*@ > *`#x@  (N `$ >2>2 aL>1>2#`$$ > !  2 > !($     $ ?$ " ` ( @@  @ (& > X!@& & & > ሐ ?`& 8& d& P& <& 0& 4& l& h& $& (& X& H& L& & & & & "ሀ`& T> X@"& & &   & : @ > !(@ "& l & &  & t@G&@B& , $$@頒  & @> X> X> X!(a88@!qƒ@鐐$& x?& p & |& & & & & & @& > !! $`> > X 0bX#\  % @ >  (& & > !`!&  "` ""& 㿘@& p㿘 L`" > X@{"`  `  "  > X> X> X!(a8@Y! "  > X> X> X!(a8@N!`"  "`> "! ? "& & 㿘 l" @> !!@`㿘` > X> X> X!(a8@$!Ȁ`@@C@.@ 2 $ `" > X@"  @(@ @g  $@,   $ 㿐'`L`P@> X`d@#2` ` ";`h` 2`݀` -> X`c0@+ (` 2G `H" `d> X@`#8> X@А#h@z {   @|`2`h`  $`a$`h`d ֚ `L@` `$``"`L@@`L 2`H> X`d@# 2 `d> X#@ > X@#h7"@"  > X`d# $@x ` "`$  ? "@& & `H`L?`$`H$`L 2 ` 2?> Y@[ 0$`` "` "$$ ` $`" $``$    ` $ `@"> Y`d@9 P`"  "` ?"$$ ` $`" $``$ @`H`0@@d㿘  €@&@ @e  & h`2 p> Y@ x > !̀` > Y@_` L 2  l d> Y@z > Y@ " X  @ !@ ''t t  `$( `,> X> X> X!(a8X@   > X> X> X!(a8x@ 7> Y d@ b&@ &``"``" "&` "  H L  & H& L&  h! >& h `  & u0B `2% @  8  &   0`""`?"""  " " &  "@א0?@`""`?"""  " " &  "& 㿐@` @@@D@ @*  4 `& & 4` @ܔ ݔ  ` @ސ 4 8@ `& 8@p 㿘 ( ,  & " &  &&& &$ X & &, l"2 | tV |  x  & @ & |& |`$@&( @ H ??& H7"?> X> X> Y@ "&`(8@Ô#q `&` "& &@ $??@ "&  <   & <& 㿐   &  H 0@ @V W  ` @X  "  " 㿘` & 0 @@R @@N @& 4& 4@ H 0@@̐㿘`  @@6g @@2 @& 8& 8 L@  " P" " " " 㿘 `@ > X@@ > X> X> Y!(a8@/#& & " " " 㿐'@I %> X'> X)> Yb  < 4@ " H(8!p@ $ @ 0" @k`  ?%> !` "` "$ $@ $ l"2ݐ 2 㿘@#㿘 '> Y $ሟ@   7"#> Ya@  2 2 $㿘@ :  p" `@*  ` d> Y $! ( ,ƀ l X> Yƀ! 0> Y 4" 8ƀ < @> Y H"8 Lƀ P > Y "pƀ  > Y " ƀ (  > Yƀ"А   > Yƀ"   > Yƀ#  2 $> Yƀ#0> Yƀ#0`> "N' a* > Y@Ӑ#@b*  $> Y> Y> Y!> Y#> Y%> Y'> YȞР#آc> Y> Y> Y> Y> Y> Y#\#`#d;h;p#`c㘘#@c > > Y> Y> Z> Z#c@> !b=  a2 > Zd (X@ " 8 > Z> Z@@ɒ H@Ò > Zd P@y ?, > Z`X , $@m ?@, > Z @ ` @`?@,  , @U?@, @, @K?@,  , @@?@,  @, @5?@, > Z@ h <@)?@, @, @?@, @, 4@?@, > Z@ p @ ?@, > Z`x , @ d@a \= b > Zݹ 㿐 X $ @" l"`> Z @> Z`d $0 3 7"'> Z)> Z`"#\@Ւ#\ d$#`@ː  X $ @ `@#\$> Z`d!H@ 0  դ 㿘`    ` " ` `   㿘 "   ( $2  (  2  $`2(㿐   '  `_ `[ 2Y 2V  `2Q "N  2J 2G  H /f * ' > ! T  ' H 0          0 0@ d   & d㿘`" X@ X @Z㿘 X`€㿘 `` @ @#ޚ 㿘@$V㿈` H /f * '  >  X  #h#\#`#d`@  H p@㿘H /f * '  X> a@!H 0㿈 >  X>  Ę` #\$#h#`#d`@  㿘>  X`$@!h㿐 /> -> Z+> !)> ݦ , ,@  @xbT #\ 2 !\  ȁ㿘  `*`` `? *` *  > !bT*  O 㿘  `*@`` `? *` *  > !bT*  W X l t ؘ ؐ ؠ ( ( ( ( ( ( ( ( ( ٠ t l L و ٤ \ ٤ d x x p ـ㿘> Z!@ 㿘> Zaؔ@O 㿘#> #b$H'H 'L'P'T'X ! !!> #X"@Ô#X$b$> Z@v!@> Z@p!> aĀ @Mx@|㿘> Z"@^> à    > Z " > Z" ][@,㿘'L'P'T'XH/` /@   @LH 0> !``L  @| x> "'  <@J > Z @@=O؀`  >L @;  L   > @2 b > Zګ"H㿘'H'L'P'T'XH/ /   @;HH 0> !``H  @+ X 㿘> #"$`> "#X`  `> #X ````@;ʒ  ` `> cX""cX`    > !d` . :  `> #X` ` `> !П@`㿘>'H'L'P'T'X 0 ``,  `4  `   @H `,  `4  " "`4 㿘  @? "@> #0㿘'L'P'T'X"       @7K    @L㿘'L'P'T'X  @sL㿘> "4'H`'L'P'T'X    @`H㿘!> 'H'L'P'T'X@!   @OH> #"$`v@!㿘!> @l!  @9 > #"$``@!㿐?'P'T'X`'' (@P`*㿐?`'' (@ `*@> " '''`'' `: `   2.` K>  . M`%`2* 2 ''? M`Z.>2"*` €   ? 2  "2   @  ? ?  ?L@  > ZP > ZX g O2> Z` [O `L `   2.` >  L.GL 2L QL@   $? @Œ   :  < ,`   2.` > !L@.L@: `   2.` ` L@.`L@`  @`*  L@  "`L@ ` 7 >`  + 2).` l> * ؔ% `"1 0M-  ? (' '$ " +M`*  ?&?MЀ   , * ?РMЀ &?  , * ?РMЀ ' @M l2  " ?/     ? 2  "   @?* : ?:  ` -  ?> :  @ ?"" ?2    ? 2  "2   @  ? ? d  ?> Zbh '  Y x ?`> Z"  @! "''@܋'    ? 2  "2   @  ? ? & > Z"> Z"h ' ?  2  "2   @  ? ?   2  `' ?ǀ`"R逢 ".  5,A> Z 4, 40 - 806 03- @֖ `0- @Ė  8' 8'0-,4   4 - "'@ '$ '` /' @ & +` ` 2`  '# ? `  2.` ֐ . ? ?< `   +` .3*/ + 0`   2.` >   . ` 2.`  `.`2!# ? 0`  2.` t . 0ݔ ?"@ ? 0`  2.` U . 0 ?'M `  2.` 6 ?.??' "@ ? `   2.`  . ~ ? `2&> " > Z"㿘` @@`% 2 sq  H /m * . `"` " @"`s "H 0 㿘   @ %&@   @K * 2`     0   $ $ Ho  "`> ސ "a㿐 0 +) ` @ #&@   @ * 2`@   ` ݔ   7ڔ  r P d t P t  , < L \ l | < < < < < < < T < < < < < < < < < < < < < < < < < < < <   ` \ < < < < < < < < < < 㿘> ̲ + > > .((S7> !P4P&.`(@2> "a ؅.`( !ܰ $> !܄!!܁㿘!> !  > !耢 2 !> Z#z> Z#$!!,`:` `q$!䀢`Q > > > @"> #x`( "㿘#> #> Z (bP@ibP1> !> a !> #"x@]bPbP@WbP!@&!> > 􀢀 > #x ( > "!"㿘` > !Ԁ " > Z4 > [  > [> Z#0> Z}#0z 㿘. > . @> *`#̰@ > [j V `*`>9 0 €> ZV ]#0 > [Y 0> [U 0> [Q 㿘> . aر>   !> !܀*> [ 0=0*!ܱ:  )> b 4$!ؐ& ?> b$* `* @> a @ > [ P!ܒ& *`@ > [> [ `> [ p0]!ر: $. > [ 0T@> *`#̤@> [ > [ V? > [ V?"T #> [`Vo | V?T   4> [> [Ր `> [А > a* R  > !|  '> [VЕ*  *V? > [ ؁㿘N -    N 02% N x  X2   `     ɠ    *:   2Ѐ  ? &@ 㿘     `O* Є 8O /`8 (. (> а`` ?O O "  "  " O?#66 㿘N?   +> J@    `,`a:  4- *> : a|,`: @׭2 `@ "`* a:`@ - : ? &@?㿐%> $x )> ['> [ڐ G@֐ (@LxJ@ "` "` "`J@   > [ &@    ג㿘> !؀ 4> . Y< %> [#> [4a , :``y`Y`n`N, :  y Y cĐ. > c̑*  `   %>   "`$`" `$@ *R@? @ `R@?, v  > [Q!(0 몒R@? > !| T* \ y@T?`> [!8Ro  , @  %  > [  >> [!@ː0T!܀ > [!P0K> "  4D> [. < %> [#> [a , :``y`Y`n`N, :  y Y' c#!> & " *`> [@!pܠ & *` > &?a* @> [ʐ!x{>%Đ 㿘> !؀ - . > * c̒ R` "   "  > [4 > [ 2` 2` > [!> [ . ":  0> [!3> [!> !܀ > > [!0-"  4'> [& > !*` > [x!!> & "$*`  4 > [j! > ["  d> [^!0[ 㿘> !؀ * . > * c̒ R` "   "  > [ " > [2` 2` 6!> [2 . :  (> [0+!> !܀ > > [""0-"  4'> [& > !*` > [!!> & "$*`  $ > [! > [" . e;Z> [!0 㿘> ["(#> aJ@ j a,@@@Տ)> [`  %> [ِX`` a, @ ?* : `2?*`>9 D €> [Ð"`08> ["04> ["00> ["0,> [#0(> [#00$> [#X0 > [#0> [#0> [#0> [#0> \ 0 > \ `0> \ 0> \ ! a,J@a㿘>  "!%> #> , : % b  ?v ?$㿘>  "! #> !|,   > \V a?\ > ?$㿘> !>    Q"a> > !c* V @ > . !:` ,T/ `2@1!@@$ ). :``e `s`d > \  > \  F < :   T?ˢ` !ئ$?'a㿐L@?  -> L@    2`L@,L@` "`` "`` "`:  4-`*> : a|,: @l2 @t "* :`@ -`: ?2L@> \ 0    > [M s0 㿘/ ?  c > "!> #̔#̀`Y%> .:   @*`2L $ @1 2D $.:    T `` 25 $T 21 $T  2+ $a *?  d e c > \  f> \  $ $x  $,`:  $/?  $ `  @6A? .> !> : a!ܑ,`@ؐ -`+ ?  d"! e c !> \ f"> \T ! 8  * :  !? ` @ˑ,`?  c> ?"a㿐NN    2 NN "  "  " N > \!00   > [.`.: :l0 㿐.`?'> $> >`#Фx' )> \!P@w (LxL "  "  " L :ے 2"L> !􀢀 > [ -`* * @@3  `a> \m!X` ' ? q  ј f ` Q> [V ` `h@Œ $> !> aب   > \>!p0;.:  > > \5!02# `  @`2 $@ " $ 2 > \> \!0! aà?$* *̒`> \` "' '`'` '`'`'`'`''77ڒ i=̀? a.: ,: 6!؀ !̑+` * > c̘ $  ?ܚ?## ?䀠 ?# ?# # ??# ?# ?# # ?> "ܓ(Ԓ@И̓*`# ؔ@ "܀"" """"" > " R   2 > !`> ̖!  R  @  2 !ؔ %!؀` ? @`2$@ 2 $V  2$V4$ 2@   ? @`2$@ 2 $V  2$V4$ 2 !@`2$@ה 2$V  2$V 66 $ 2R`㿐N  /> N "  " N - N    2  J@ ? @ч2  @ "  J`NN "  "  "  M@ T > \"8O *` ?* : `2A*`>9! €N > \"X7  > [> -"!N > \"p%  > [W-W N ’ > [ ` `> \> "!> \_" N i   > [Wm c@& 0N % X dӰ  lʰ Ö > [WG dN > \"  0 e Z   > [W eN > \" < W } d> [W fJWu  0qN U> [P 0j q&?0eN ^ 0^Ԑ[ N  9> [N#> -%> \$cl  *`:   2 NN "  " N   cl"  tclĠcl clcl} y  > !p `?"!p> \#> \#> \h" > \c#  㿘!#> \> \Z#8> #b(VcP@- ( O > \I#X    N - 2  *  > Յ(#t2  * > օ("l> ̇2`6?> Ȁ6?> ܄؇*? @ `2 ?@ (@* ?> h2` > !? @ `2 ?@  (@* @Ȕ 6?> ܘؖ*"? *?㿘> !̀`> \ch@j > 0!t`> \<#x㿈@ i "   `` ?0`"0#\ #`@#  㿐@ i "   0 "0`#\`#`@  8/ `   $    l  ⓔ `  ''''''` '` `G `  @`2   e㟒\   ?  # & P8 >B`C >8`>P     `" 0,?`&0Y0㿈@ hے "   `` ?0`"0#\ #`@#  㿐@ h "   0 "0`#\`#`@  8/ `   $  Ԕ  t  ̔ h   ''''''` '` `N `  @`2   ג \  ?  #    & X@ >B`C >@`>X   P , `"% 0,?`&00 @h     2`0b b> ` @ ?* ` @  * !(,2` ð  0 $ 0    x ` 2 0 @_   `$@ b|"5@"{"WT i b}b~2b @ 't    ?4    b~Ut@ 't  @  ?4    b}Ct'tT   ( "<  `"@  @4"D   't) 2 4(  't   `vt 2  ( `<$@ `w@  $@  2  0`~ 0 ,?`$ 0 0`0 H @ 4 ,`,`,  O ,`,   ''''''@̗ ''?'ȴ'` / 0` & 0`  0` "  0›  fd? '  '?/a  '''' /> $0⤓Ho  @"`А@ i e` ,f)@@V"" ''Вb@ ??T!@ > #`*@ *`" *" * d^H/` /0`@⤀ H 0Ho  ?"`> $> \"!}H 0 Ho  ?"`?"  #" ``" `Z 2``Q 2` `H 2Ѐ 㿘'D  'T  <T> \# -4* %@,eݒ 2 02  $ 0 ` D  4`*  `-  & 0 ,?`$ 05 0א " ?@&Ց- Α4T@'@  `E 㿘@ 8 "&@@ " &@ `> $"@2&@` 6`㿘 "rg  D  > $b  "b> $6 " 3&H /m * . `> $"@2 0J5   0W 0 @0Ho  ?"`H 0㿘  @* @` 6`e. 2 0 6` $ 0 ` V`6` 0 ,?`$ 0 0V` "` ڲ`&㿘 @ ` L  ``   `>  0`|` `  ,   @ ހ@ 0`2`@  ?,#@~* "**% *"@ *`@ *`?Ѐ  dQȔ?̐ 'Ѐ  '?/a  ''''Ԧ 5> $Ho  @"`M d?,dЀ@Ԁ@VȐ"" ''Вb@ ??T!@ > #`*@ *`" *" * bRH/` /0`@ H 0Ho  ?"`> $> \"!qH 0 Ho  ?"` #"@@?  @0@ "  @@@ 㿈 #> $( ?b@{ Z b7 @s OhY I 2 > 2` " ("`&hF 202 2` " ("`&$ <$`<, ?",`0?"`0`,  `0, ?",`0?"`0`, `0o f+i @ @^(㿘> `$@ m " @x> aX& && & & "aX 㿘 & @ & @& <& D 2b 0 0 4c& 8& (& ,& & $ 㿘 @!1> \"$ @!# " @ !" @ !$ @㿘 @ ~b& @ |& @㿘 @ @ ?& @  @ " @p  @   8#V 㿘(  {`D 4$`D`  $`$`@" $@$`$`% ;  ?$`@c3  #`@> \ $`@Ȑ! 2)`D 2#`D@"`@` `" 8 8 `  "` 2`Db` `D?  $`D`@  ?$`@` @!T@8 ` `@  ?$`@ ` @" !d㿘 ( <   @ " D  $ D@ #> $b        @ b $b( " D? $ D @  ?$ @Ɛ0 " @ $ `R 2r D "@@(c @@ "@ @4  p @    " > \穐#В$^    $ $@"$ > ]畐   $> ]猐  2) D $ @d   # @> ] $ @0!# 2 D @ 2   " D @   D?  $ D @  ?$ @9   @  ?$ @,    " 2a ( u }@  ( ~@ @ 0@ @ 0@ @    88 "㿘 (`A <   2  @   @ 2 `" `@ `   ` @" !8 `A  @ @$ @```@ @$`@㿘`(@̒ p&`  &`H   @  C B?@8>`8>`@ &`  $&`$ (&`( ,&`, 0&`0 4&`4` &`` &`㿘 (& @& ( 㿘 ` > $b?"b> aX> " "aX$ @ & 㿘 + @ D `& @!> ]U @` & @  8  D` <   @`>$ @$ <> $";`4(R` < > "`8"` " >  "`8 "`"  4(R <"  " ` 2`?  ` 2``?"`" 4(<" @2  `" `@  2     4(<`" `@" @  2 "    ` "   㿐> a> $> ]#\"`@ H  G  : :0 : : :D 8| 9 9 @0 8 8 @0 ;@ < < ;| 9 =x =H = @0 @0 @0 @0 @0 @0 @0 @0 @0 @0 @0 @0 @0 @0 @0 @0 @0 >` = ?| > @ 8P 8 8 8 8 8 8 8 8 7D 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8P@  ` 2`0Q `0 I #@`$6>M"<*` €`88@,b9 h6 ` `!@ #`8 > ",4 "&0` "& h2`     L`5 @2&0&@`$ >M!*` €`0Ho ("`` @`8`$`D  * $``@ Ұ `  '`Є@    ''??''''؀   @ޒ &` s  Ą̐ Ȗ '''?'''쀠'>M!( €  '=ؐ ' 8ؐ ' 3'a ` * : @ '䀢  m  :  @  b 4耣@  '''Ԕ@ O@s̰" `' 0@` = ``"/`@g 4(`` . ` @`D8@ `0f > "`t``0$`DHo * "``@) L`5 2` `4a0H /m * . CH 0 ` /  &` `0Ho ("```8$`D "`t[ `耢    * $` &` `  @ג ``'`  `s   $``  ` `0" > ]> ]> ] H`Xx㘔!@   L P`L P @ 0x0" > ]> ]> ] H`Xxt!@m h  ( P@X `) P 0U0" > ]> ]> ] H`XxQ!@J E  !`! @s 010" > ]> ]> ] H`Xx-!@& !  !@ `! 0@a'` > ] 㿘`  ``0!@ `8 2`0> ", `0@ # 㿘  Ӓ `0@ `$`` `&``?@>@`=   c'?'''''''`$@$ /`) * @ B>  2  =#@@ B 4    =# =#" & 㿐#\ (   @Gj 㿘 (   @E 㿘c  (L "7cG2K  "~ ""}2?  ##28  ! >3 G    " Ԕ` = Ԕ 3 3 3 3  l # <` `# @` @$# D <  "  2  " i r   @@    `    @$ 㿘 ( H /` * ! `A L ` h @:   2  T 2 2  8 ` `  "@  " 4    2  `" 2 8 ``  H 2   @  `p   4 `h  Ԑ 4 ԑH 0㿘 (@ p0&`  a$ h a$&`  2 ` &` &` &` `    㿘 (  @C@$ (㿘2` ` `@@@ 0 `` @њ  ``@@Ȑ   㿐> %H H (( > "`"`"` #\"`"`> $> ]#`   ؠ > $#x"#x"`> %> %> $ > %"ct"`# h"d㿘`>&@>&`#\@ct8  @@ې 2`h  7&`h p`h_ l`h 2e`h`l`"`p`p"`p> $"#|`p?`l"&`l&`p`d`h &`d` &`h> ]`h u @ݐL _ 2;`h ` 24`h`,@> %  > %(  PĀ@8'Ā > &`&` ` a > &`&`H&`,.! 2 `h@ ` `h? &`h`d `h 㿘 `  @@`b@X  f&!  a " `0`b> % > %> %``L  @ a ـ` `&㿘  `@ `> ]2 @@ t  ,p> % H k HĔ d h ,  $"@ @ $ h> % h )` (,#> %`H`h @> % "`d d> ] $ dؐ! 24 h d 2/ Y , $" *` `h @6` @( 2` Y #@ 2 h@L d  ?$ d d " h Y h? $ h d  hE 㿐 @`` `@@' N J! " h0F: Z)> ] $ h`( d`$ d! C 2) h d 2$ Y@ @v 2 h@@ d  ?$ dU> %`d @r"`d& h? $ h d  h 㿘  } |@C (> > %> $P> $#xt```? *@& & & & #t t6 & ,& H& x&& & t& l& p > %` l # "`~  > $x"`2ld  > $ x"2ld 㿘> $#x  d " l ?$ dА l 2 d㿘 h $ t> ]ސ #> %? `"`& x "@"" @7  t2 ~< ``?$``㿘!> $#| `d > %`h "`hؖ#  t ` @`6 4 㿘@7* > $#x> %`h?"`h`>  $ ( " $" (#8" 8" 0"`  x` "` x " x >  $ ( # $# (c8# @# 4  # x? "" "㿘 2> ]O!   @  4 00`$`` @4   @5(( 쀢8$ ` $`&` `      @ 㿘 @(> ]!  8ѳ  "&  ` Ѧ 2  @ 㿘 E `B > % H *` *  &6   , {o  * @*``}.  Ҝ > $#x  `ғ ` l ``W}  [ [ [ [ [ [ [ [ [ \ \ ]P ] ] ^( ^x ^ _0 _ j\ k< k k lT l l l lН㿐!> !> %> ]#\!@a@ D   > %> ]#\aH t   d !> #  { * #> %"a<* { > %> %"`p"l㿘> > ܨ c ( /t"ܐ?"%"ܐ!> %"ܐ t  #> %  t`l    2  & 6 `l&$`l㿘@  > % l   2&@ 2 S  "i   2&@b S   @K 1>  2@`R2<` 222R 2F  *`:   3 > %`l "`l> % > % 2?"#`tְ "ܐ?&"܀@ *  "  "@  *`:   * `3  32"  㿘> % l J '> T   @(  *`" S  *`: @ 4 *  "  ?"  *`: `@ݘ *` 2l$l@$@> % tD ܐ?$ 2T 㿈`?`  >U"8*` €`   >&`>&#\t#\#`@@P ? c@ \ &`> c6) > %!<,   >`  @2  >U"\. €  > `$"ؒ  `" $ {m#"> %ڐ!@<"@ @ D > $ $   a > $ ,$ t! ؐ Dΰh! ̀&ʰ  6ư . * @`'@S! &  6 . * @`'@>! &  6 . * '@*!   ` ` @.` @   󀥠0w! u&s  6o . * @` b'@ `&^  6Z > c @ .Q "  * 2:ޔ B  * xߔ    > # @  )`@"` @  @  ` 2@  @  ?c<  "zn 㿘   @` @` > # $ > "ؒ"@ > %  ӕ!@,@*` xx $` 3> c . -> % > %!<@ `! `㤐W l ` e &``T<`z > %!@ԆK<㤠 ؔ "X > # > %!<`" 㤔   , @`2 㤀2$`2 `> %$@` $``, $``?p$` $` >  * 2 > % !<, 4`$`,4` $`$" > bب "b<?c *  &   ` `y > %!@$X ?@` @'L '> cc> %!<- 'W@ @   `2 L "@  ` ' ,`  w* Ȩ',``*͢ 2 9> % 7  @ @ߑ*` * U` `` # * `2  2 `2    2   2 `@2   Ϛ`F @:``* @*` @  " 2 `(2 #U` 2  4  4!<> ]P!$; !<'@ W@?c "U`y Y 2 ?4 ?4  k `I Z> +`"= V` 8 @7 0Ā ?+` * !> ]`"V`  @  ":!X @4`* @*` @  " 2 &  ` > @ *@ *  8$ `> #$$> %a< L" xs 㿘> % l l I+> % 2 BT  6)>  @63%> %,`  <(V `V > ]Ӑ!x` &`> ]̐! + @ *  @@ 2 @ *` 2 <(@T `@԰ `t$ҕ"ܐ?%"܁㿐` ` 4 `6 ?`>U"*` €3> c'j c@?#@ *` v$ #> %ca<\*  v* !> %c pP*a<wْ  pw֒ $a<$ p&cp > # '1 d @`H?#@Z $ W > # ' K  G/ C$ > # ' 7 @3?#@- $ * > # '  @`4$   >  #> #> #> #Ē - sL r r rt rt y z@ z {t {>  6?> %("2 (?? > @ > %*``:` "`   㿘#> a( 8`  @à, > %"с`> %> %4 ""@?"#"㿘`?#@ > #@ 6( '> %,` >  !,  @@G* ?&` (> #*`$ 0  4 ( "  > %"" "@ 㿘 $ `! @`?" `  ?"@@2 "  $  㿀  $ `@!> #  *  t͐   $@ `?$ @  $" K@ 2`j @!! _ @` ?     ?2 J > !(  ` .  ``!(  @?@2/ '@ '8@@, #`#\#d $@ @t > $@ $  8(`$ 4($,&@@㿘`>&@>&`#\@ctX  @ʐ P 8N >[ . €!! 2A@ < : 8 21 < 2*> & &   a > & 4&  2 & V ("` & ?#@> %> %"b * " 㿘> %b. @Ғ "``"` @(`  && ? #*`@'  㿘>  #``  㐀+> % b >  !( %> %  , 4  (@ %b$  #> %Πb > % Κb?bϸ  #b4 " %bf$> %"    @ > % <+> %7> b` `@ ,``2` @ b> ]գ!  ` #"  > %b*  <+> %7> ?#"  <+> %7> b,`"@ @ $ < ,`$$  ?b?$ $ $   * 3 4 $ ` @ $  *`@  8 $ $$ 8$ 44 ($ $ 0$ ,'@㿘`@ a$@ v@ `"  1 #㿘 `2@'&` ,   rِ&` @ `> %?"c? * @"@( 2(@ 㿘  @  ?r`@  tl & 㿐> a#\> %> ] aؘ "#>  @f c   r*  > %"b* r > %"b> !(c> %> %> %$c"b ""㿐` `4 `6 ?`>[!*` €!> #  > a(`##`* : 4# x > # 'p l @h`f $ c > #`'[ W`@SN?#@M *` r !> %`"M*"s֒ $"  r* !> %`"=*"sƒ $"&`> # '#  @` $ > # '    6$   -      0㿘H /e * & `t &`p &`t`@ &`x`t =&`tH 0 㿘> cX""cX@ r  & |  ` 6 @? "@>  ͜#0& t&  㿘`p *`|@`(" `H /e4* &@ @ rH 0a > %#`DB:#` &`D> %"`$B:"`&`$> %#?`B :#7` @ . 22V @   `|` @2)`t" `!@%y ! "!@%q!  ( 퀌@`@"`t@ )`t  2?h2`*&`t!d=` 2  `` @ ^ @`t@ `t &`t ` ! @`*@&`@ @``( "`@ `&``5 2  ` 2 `@x @    2 `|  `@a @ ̒`| j `t( 2 " `t2 `r> ֑*bl * `&`t@ € 0|"f`tx  2i`  2X`t2  `2`@2 `(2` @@'*?`t( ( 7&`t ) ! '" `  ^" ~  | { } \2?(&`t? ( 2  " ` "`t@%`@ Y`t2/  +`V``@` `"`t@%|`@ A` `t@ *` @ %``"6`@#`6``t>*@&`t 2B  >d< b`@ @%Q  ?"`t@ @%E?  > ]!  @@ @%3?   ` @@#`t 2  d" @ `t 2` d` `|] @2w`t@ 6s`t``(`h  V``H 6d`t @w_`t@/ [`t`@# S  @ А@ K`t   2`‌d  6`@$`(@  `t``*`:  6``6``t@*@&`t /@5V`@ [ 2`t `"`tV`" 8  $ `t @?  `t! 2`   ` `t* &`&`t@r㿘` 2 > %" `d``B ;" &`d`H@#/ ۰? <  9 `5 `   "$ H /e * & > ]`H@#"> %b&`d > B;b&`dH 0`6`?  2?  ` > %" `d``B ;"  &`d @"Ӓ`H " 6` 6` ` 2 ` ?  4? 1@`@.@?`>_ <*` €  ' ! ^ ( ) \? @> %b \`dB:b &`d@"`H =`@ > %V` "2?> %" `d``B ;" &`d@"r`H  > ]!  `?`V`>_ *` €4 6`` " 6`  6`?0 ` @#`}@? ] r@<'> ``^@F#> ^`{@[`z+@@+'> ``@%`e@ `u@'>  ` @ D` @`@>h  g@ '>  5 `@1`@ /'> #> ː   \!c@   4  , h|@  0  ! 2h "h@ "!?`n@ `@c `@G` @`^@`a@ސ| @ " l8  w`o@"@uk@ " 4 s@Ma[@[ b@"# "}@ <8   @ ] r@^C@ "t"~@C9@3 `Z@ e@ؐv@$`g@Ӑ  `@`@ 0H /e4* &  t t ?$tH 0 H /e * & @.&H 0 H /e * & t$$tH 0װ ` ` @ϰ 5> #X  " > ] t ( (> ] > ]" @ '''''@d\ @ْ` `!@@  @mL $#X> cX""cX @ " 0s , &666{6H /e * & &&H 0e   , 2 |y V | " ʐ#H /e * &  $H 07 H /e * & t ;$tH 0! HH /e4* &#@  @f   H 00 @2@  J $ ( 6 ԑH 0 € " tH 00t2   2 $ ߐ"$t@ $$$$($(`       @ )  @"<  ! @4`$@-@!5( '''' ''('$,$(0$ 4$$8$,@$<$ $$0$4$8$<$@* $$($ ( 7&  @  $G H 0T >  pL  lH H /e * & l> #@*`  .   l*` H 00,lH 0 H /e * & ta   * ~$$t@YH 0   ` ` >  4 ܰ  , > l#@*`  €ΰ H /e4t* &t r> ֑*bl * `$t@€ H 0  4 @  `" 4@  `"  4@? "@> w#0 4 ,`  " 4` $ 4$| 4 "` H  "r q 4 i  , e2 a  ^ [$|@X @  Q 4 44|4E H /e * & x@** *@ *$x @@@$x x $x @x $x x $xH 0  @٘  㿘2  *> ֖ bl*`@ € H /e * & `A@ 4   @` t ``T  H $  ` ` H 0㿘6  `*`> ֔ "l * @V`? ?2  > # `&`8> #0`&`8&`> ֑* bl* `@€ <H /e4* &   "2? "& H 0 㿘 `>> ֑* bl* `@€`<H /e * & @u$` H 0  2 `  t 2` `  4`   㿘 >> ֑* bl* `@€ <H /e4* &   "2? "& H 0 㿘 >> ֑* bl* `@€ <H /e * & HL" & HR耢@  H 0  㿘> !̀`> ]c@F*  @" @ !  (    " 㿘 H /e * & ## @ H 2 t t + t`2  # Ѐ `& t>  H!@U  H  t` `2   Ѐ`H 0㿘 @ 㿘H /e`* &`  (`" @3 ( `" t@-  t>*@& t6 @6 @`>  r t* ~ l& t*  H` H@  H 0㿘> "  㿘  ( h    t ?& t h2  : &  ( t @2 ( !"  ( % $"  "  @ H 2  t`@@3& t @@ ؀ €   t @& t㿘 > ]ɻ#H /e * &  t @ & tH 0㿘 Ѐ`@ 㿘`A 03 㿘 t ` @` & tސ4 21  r> ֑*bl * `& t@€ "  t ` & t  @2  "       `@& t 㿘`" t t & t ` & t  @2  "    b ؒ   x> !̀`> ]c@D    t*@  &  & t   ' ' '''''& & & Q@  t *@& t㿘Ր 㿐> 0 'L  '਑H /e4* &@ H 0`4 ,`, (|$ $   0 `  ` g > > `\!@z  `਑H /e * & a<> #` @  &2t0{  *t`   f >j`s  q ]` `W'` "t0Q( N(t  @  L  `H 0 ` H 0 #> #> #!@ H 0`" ` 2 #   # t  #q`# H 0%> 5> E 2  d$2 |  `:\!@ 2 2 ' !       d  @֐ 6 H /e * & h@Ȓ @@H 0`g 㿘> !̀` > ]c@B  t @% $" "  @ H 2  t & t @@ ؀ €  t ?& t㿘V H /e`* &` > 0 `  HȀ@$@"> 0'> ]`  쀢@"  tH 0 > c` & t  HՔ( H@H 0 㽐> "`'V     H /e4 t* & t*   @%  H 0ì  > H 0 # !@ H 0򀥠H 0> 0 4  21`, "-` |( @"%`0 2!` 2` 2`   x  ` > > `\!@s i `a  @2e&` Hj``b8"8 瀤@4`B) '> %/> ] @욖 ?@6 X 6A H = H9`0  H@6 $ @  d< C 6 @<& d $@  H`4 ``2 `4 `&`@/F H?H /e4 H* & H  H 00 " tH 0`&`@`  #>  & t H!@Ř H 02`0b > ]#8㿐` h  *@`z&`V`• &`> > ]!  `?e>_ * €@| v`` @"r`@s m`*`:  @{0eH /e * & `t` @ V```&`&`t6`@ђ @@ ` `t* *&`&`tH 0V``$  6` ?,%` R? `> ]#@` ` `t 2 &`t \;@b``@]`?6`㿘`' $ ! `㿐 @? H /e * &  (@Z   @'@' @J @@  t*@& tH 0 6 6 㿘`t@2`` *@&`` (  ( @      ^   ^  @ ?㿘V  H   t  ?& t Hٍ 㿘و  t   |}Z ~ @2``@2@?㿘 @ 2`@: !4! & 6 6  (  h* h 4(  4@; 3* @*`@*`6 p > ! d* ,  , $4 @w d@Y> ]chŶ 2 |> ] cx`2`> ]c  > ]cŢr6 @o 2  2\* @*`"@*`@*`dL54  5  $`4 q cД b?  '?/!`''  '?/!`''L5  " > ^|`2 > ^  > ^ (! @##\#`@##d d@#h#l> ]8c16  "c  5 2 `5  `5(  "H 4 `TT+8 1`8  ?@ ") $ `"`8` 0`0 2`8 `88  㿘H /e4`t* &`t    ` @ H 0?2 )&H 0 㿘 Ԗ "V , : @ ?> %  > % 㿘!  >` p"$$ h h @  h (@  h H@ޔ $> %# $ "@" > %>i "a 㿘> %b? "b> ^ِ 0`"  "`> %"# ?"&& @͐ @ː (@ɐ Hb8 >㿘> %" *`  `b* &> %c p""("H" 222t""| ""  " l*$(㿐`H ?`<>_ ԓ*` €> %cc Ҕ5> %bbɔ,> %bb#> %cc> %"* X+ aÒ 0@y 㿘   x x @ @ x x @Z!?㿀> ^ P!>  P / / / / / / / / / /"/'@ђ >@k >`.`-$.`"> ^> ^ ``x @  p ///.`7 t6`"6`$6`&6`(6`*.`-.`..`/.`0.`1.`2.`3.`4.`5.`6.`,/" > ^ 㿘.  _t 㿘!> c >    > `2  ,$, 4 ސ!>  #* a $ $%> . @   _@ 8 $m"c͐  cɐ > ^z Ȱ 㿘 $ > "`> " @T 㿘? 2  @ [>  ,   2P $ t  $l  0C"$ t> # a %$ $ $ $ $ $  Ѐ " t t $ t t`2 lb`$ t#>  !c  t `"$ t l> c@* @@ 㿘?2  > `. > c@ l`* @'@ 㿘?2  > `>.  0  `  "h 4  @ 7, "4 ( |"0 ('-> +> ac `_ [`0 W  yr \!c K4    , " ( |2a ( 2 (6 #>  (!h " 0* $ (` "  (@ (  (  2 (@ ( ( 0  > lc@* `@@[ 㿘?2  > `.  Ѐ   l> c@* ` @  㿘 p? 2`>  *  ta `  * "@$ 㿘 p? > 2`  * `   ?" .`* ` ``@ 㿘 p? 2` >  * `ߐ ܐ P`ؐ Ր 㿘?2  # "> $ .  @ ͐ $@ Ѐ   l>r> #c@$ В`*@    w$ ,`!$`,` 㿘?2  > `. > c@ l`* @  € t$ В $ t(?> 2  > `'.    ,m> `P!9 ^`t    `~ M @" , ``,8 ,`~  ?, ; `" `H ! " `H~ 0, ! €`  ~q}`  `d8 d @`H@4 `y@1 > ^f  #(> b? 2  > `'.      `t   "E``( `"4`(`h6/`(  d8 d "@84} }``t b @`(`  `h`(@ ֒ `(@ _` [ 2 d8 d4}d J``t "E ` > #T``(`h@ ?@ `!2 `lt``t `l* ?   ` Œ``t   `&` #> `! "_`t`&``@e > ^ ؁㿘?2  > `. t  j  ]``A)H /e4H* &H  t!"  `` 2  ` ! 2 H 0 `  "( `(h@ ?@`!`` `` 2  ` !    `Ҭ `ҧ  * R`   > "`8 > "`8"` * @㿘?2  > @*`   `@$` "`  " ` `@,  `((" `   `@, ڒ ` 7$` 6  * > ֒bl*@ >s 䀢2 `l i@"N @"V`H "@p w@"$`|o `l _@J f@"+f `l ` @ ` @8 p@"Y `l `@S`@*Q `l*`H   &       ?     ?$    ?$ #  `H@c`H# `l?  `  `| u  `@ `H & `l> c@* `@@   6`  !@  `O, !! X  `("/`  "+` ` @ ` @:  `@`}@`u@" `@" ` `@ `@* ` `@,  `"  2  "  `@    $ , Ԓ 0  `@ ߐ $ , ɒ 㿘`"3   & -0, !> >  ! ]ڐ 3> ``  `4&`>  &` "] 0 >  > *   " Ѐ 㿘!> ] ] 㿘!> ]  1> !>  @א "`]!\1? # @*  ` . 0 ,@P 0 `4 ) g @t @Wn5 '''@tMf `@  $`@@Y㿘> "̖  > > "l>qb܀  "l  0 2̀2 \> ^   㾐   @''(]9ٔ ],09Д 7;g0c? 2`  >  ,   `"' ''''j  9 0 2`> 2 !"` "(@u `-h''l''h@PE' x P`$   >  @V`!' 'f@'x@sf@ "x@Xxu @tܔx`<  `8( @s x@Y  ''h''l' Y 2`2 " x "(@tx&&`"6`$6 `&6 `(6`*6`,.`-.`..`/.`0.`1.`2.`3.`4.`5. `6.!`7.", ?",`0?"`0`, `0, ?",`0?"`0`, !`00 7:6:\: H ` h ` h㿘`l a ev [  Wv"(> %c> ^ "c }a> %  ax  "%``X%`m%`   %`> ^ a %`=`@߇``m > ^ a(%a %a$%a,=a@z``l> ^ a8%ah%al=a`%at@na4la0&`> #@%b X  &`l>}b@|a㿘 . l!m!xXߒ > %c& ܐ? "c> %"#> #D㿐  $  23&&>`5-: 4,-@ c,@3`+ b2`* +``*`0(b2*(@C*@3`+ B2`* +`@ d*`4`, `0(,`@ b(@b2*2`* *@*`@C0( + =3`( D+` @ > B &讥 e􀥀&@>  <> &>& x "2> !@   @   " $& !& !*`" *  * &&  2> . @  & 2 > `P4> `. &> #T€"x @ "  $ N `* `, * : . C, # `,. @"  "N x> ^@ aH , % LЖ  `2*` *А *ɑ: @ L  @@㿈 Т @ $@耢 覂 B"4 !2 "8! !>"< 0( (@b2`* @ *`b2*@ *@B2`* @ *`b2*@ *@ b 2`*  *`@C!+ 3` +` :  @ `  >"> & |@#耦 & > ^"aP0N"$J & * : `."$>y Г*` €> ^ aX> ^ ah> ^ax> ^a> ^a \@ݕ > ^a \@ݎ J A V   !, ?!t   > &!l& &!,&!t& &  &!$   > & &!l&!$!J`S  @$`?  &!$!`J`W @`?  &!l` &  2" !4"X"  & 㿘N@ 0   `N@ 0"`N@@   . `J@   .`J@ ?  (N@4`, @,`B(*82И*`8N@@ C` ` 4`N@4`@ , ,@,B(*82И`*8@ N@C@`@ 4`N@  @ @4,@,B(*82И`*8@ N@C@`@ 4% 4, ,@B2`* @ *`   ,`b2*@ *@ b 2`* @ *`B2*@* @2 <@ D>`> 㿐N  `J@  / 9$2U?J@ "N O?/N?N * ?В@  +  +`  Г*`** gЗ:* /7///: 2`* @ *` b2**@ c3`+ +` B2**@ c3`+ +` b 2**@ C3`+  +` >@ 㿘N#    2 1/.2-`*: &?В "@@@C>y!, €N 1 3 9 5 9 ` N  /$ّ*`2e?N .&  N"?/94N- ,* *`?Г:`*   N   / 9- N :?=`3`+  +`@ b 2`* *` b 2**@ B 2`* *` b 2**@ b 2`* *` B 2* @沣* @Ȑ" ; @~= @ D>@ 㿘    > Ѐ & ܐ &!l& &!$!T"X &  &!l&!$㿘`l I a C  S!`> %c$> ^ "c$ > %   "   $X $\h$da⠐  <$> ^ a$@%lhh&`> #@$P T  &`hY>bĔ3(㿘 . lH!(hɐ T > %c & ܐ? "c > %"#$> #D㿐 ܀ P .&P&T >`5-: 4,-@ c,@3`+ b2`* +``*`0(b2*(@C*@3`+ B2`* +`@ d*`4`, `0(,`@ b(@b2*2`* *@*`@C0( $+ =3`( D+` @ > B & @e􀥀&$>> D:> &>@&x "0> @   @   " $& &X*`" *  * &&X 2> T. @  &P2 > T`4> `. &T> #T€㿈!T @ "  N  ;  !T .  * . !T `"N @㿈 @ @耢  J  B  S3ؐ< D S2!H'9s D!H4 !2 !L8! !>!H< 0( (@b2`* @ *`b2*@ *@B2`* @ *`b2*@ *@ b 2`*  *`@C!+ 3` +` :  @ `  #>!@> P@& D \` & H d  ?> ^& \& daА $@ْ  N   N   & & \&  & \ \ 2!X!(d"X!X  & \㿐N D2?N  :2?N  .2?N  .2|?  * :  .  ..  .  . . . /9    `J@  / 9$  2U?J@ "N O?/N?N * ?В@  +  +`  Г*`** gЗ:* /7///j: 2`* @ *` b2**@ c3`+ +` B2**@ c3`+ +` b 2**@ C3`+  +` >@ 㿘N# `U   2N  :2?N  .2|?N  .2x?  *:  . . .   .  . . 1. /.2-NԐ?В "@@@>}", €, :  1 3 9 5 9  N  /ڒ24?N 0?=`+ 3` +`@ b 2`* *` b 2**@ B 2`* *` b 2**@ b * 2`*` B 2*  * >@ ?㿘 \   & \!(9"X0& \㿘`l I ^ C  P!`> %c,> ^ "c,ؒ  > %(  "(  $X $\e$da⠐  <$> ^ a$@leh&`> #@$P Q  &`eG>`!(㿘 . l6!(e Q > %c(& ܐ? "c(> %"#,> #D㿐P + &T&P. >`5-: 4,-@ c,@3`+ b2`* +``*`0(b2*(@C*@3`+ B2`* +`@ d*`4`, `0(,`@ b(@b2*2`* *@*`@C0( $+ =3`( D+` @ > B & @e􀥀&$>> D:> &>@&x "0> @   @   " $& &X*`" *  * &&X 2 TT 2 .@ &P`4> `. &T> #T€㿀!T @ "  N    !T .  * . !T `"N @㿀  @>?@?  ?JL@?~ং@ B !HD 4 !2 !L8! !>!H< 0( (@b2`* @ *`b2*@ *@B2`* @ *`b2*@ *@ b 2`*  *`@C!+ 3` +` :  @ `  #>!@> P@& D \` & H d  ?> ^& \& da $@ւ J 6 8 9  &  & & \  &  & \ \ 2!X!(O"X!X  & \ J   J/9$ 2?J?J  (*`8(J АX   '''''''''''''’ ? !m 7@< d  @6! !n ' ? D?   +`` +`@& 4////:/: 2`* @ *` b2**@ c3`+ +` B2**@ c3`+ +` b 2**@ C3`+  +` > 㿐N  :2`?N  :2\?. . L 4Q?/ B ;4G?/ 8 <;? ("** "@ * *` 8+ 3` +`@ b 2`* *` b 2**@ B 2`* *` b 2**@ b * 2`*` B 2*  * >@/ 㿘N + -2A?  *`8?" *  * : 3`+  +`@ b 2`* *` b 2**@ B 2`* *` b 2**@ b 2`* *` B * 2@* >@N + ` >@㿘 \   & \!("X0& \㿘 >L  & ,`:   >L & &  & & && & 㿘  " @  Nj >  " &  ,:`@` N\ >& & ?H4(*( 8 82!   8 (** """"" H  㿘H /e. * &'   "  " 4 q @    @" & " @@ &@&  &  4 & & H 0$@㿘 H4(3 2     `* ' !  @ >@8 `0   `HH(@"&"`  #  4   ""@ ""`4"" H 㿘H /e * & @`@ `H 0<?2` ` 2 &`> ^:!$ `&`&` ` *`` `"@! :` `  * @+ ` * *+ @`  ``@ &@&` `&` H 0  :` @ `**6+@` `8@ + "@ 8  ""  ( @ ( (+@   @ (   +@ +@  &+@ (  @ (+@ 㿘`R H /e * & @;`2` 2,&> ^"$ "& " " 4  "  @@ &&@& & `@& H 0  >  ``` `  `@"  @" "   "@88" > `  "@" "88"@?H4@(@!` `2`"` @` "@` ` 8 82@"`"` H  xH /e4* &  H 00?@ . `)&`' & '`'&  ` '&  `'&  `'&  `'& &`&@&`&`&` &`&`H 00H 00K7?㿘`,  `4 ` `@i.?@d֐@f` 0 㿘```,  `4 ` `@i?@e @fA 0 㿘```,  `4 ` `@h?@d@f" 0 㿘``, `4 ` `%  a@ q @ ``4 ` `,Ho  ?"` @dҘ?㿘`, " `4 ` "@dӒ05㿘!> %#0> !x> a" > "`"@3$#0#0> !H> a"  "`$#0`%> ''> )> ` "```:` "`` 4* ``2` > % $> %#4 d " > &"b> &" >c'!|>"cTd$ !|! > %0"  22 㿘 2    :  V`@ 4*V 㿘   2     : V @V2  4V 2  4`2 4 " 4 *V 㿘`(G   A  " @Ԛ6  k , & !` `0  8     @   R` 2`4`0`4@ *R` *㿘> %#0```:`    ` 4* ``2`㿘> %#0```:` ( "`` 4* (``2`!㿘> %#0```:` $ "`` 4* $``2` ȁ㿐!> &> ^bp#\  !!T > ݴ !Ta > # t!T>  3> 1> ^/> &->   ,a2  "x$#\  f  R Ȁ@ > '>#a@ؔ @ 㿘)> > &"$ '> c <O`` > &#G!T㿘H /f4> %* '> %#0` ``:` , "`` 4* ,``2`> %#8 `" H 0㿘H /f * '   > &1!T > %#8 .` `2 H 0  6 & && 6 㿘H /f * '   > &!T > %#8 .` `2 H 0   < & 6 6 &&  @0 (㿘 < & 6 &&  @$ (㿘   @΋ 0 >  * @  * ?     "2  "2  ( 2  㿘ِ*` * 2 2 㿘> "> '> '"c#ܒ 㿘> ;> 'c&+5> '> 3> '  1> 'c&&c&! '(`    (00 *6     @> '(`> ᔄ&4#㤄@(㤲 \@"8 " 6!  *` ( 2      < `((0"`2㿘9? > ^";H /f* ' `  H 0Q ,  ƒ   H 0@ , > &*  b$*  ` ,   & <`@H 0  H 0 @*  < $& 6 * `$@& T& H& P& @& D& \& X㿘T > %c8*`@ ?2@  " @   "@> &!T㿘H o*@ gؠ H p@㿘 X@"  \"`\ \ X "`X -  T> &*` *  * $ <j   @> ^ < H D t" ?# @6 & H㿘 H o *@ g  H 0㿘 "^   2V > ^D" 2 P?   `2 B?  @\  $ $   &H /f * ' yH 0    < < $& \& X  < 6 & &    ?& & ,&  c 4 @ 㿘`> ^"@%& V   "@& =& Y 2 j; ('  ` 3   @3  #  ?#  #  #  $# $ (# ( ,# , 0# 0 4# 4 8# 8  6  ` <# #   " ?@& &    & 㿘@  㿘@ 㿐'H` `> ^#xH  2 H@ݔH > ^h#8"' $@"  @Ғ 2&`  H"@8&`   S 6(H  &` <&`< @&`@ D&`D H&`H L&`L P&`P T&`T X&`X \&`\H /f * '  ` @6` X&`\&`X$ X`X" \H 0 #`  ː&` @h&` &`  H"@ 8 &`  H`z `  H`s ` 2& H 'H > ^#'H 2zT > ^א#Xh 㿘`'H> ^ɐ#> ^#’@/H > ^#!> ^ 2 #H"   'H&㿘  m ` 7 @Z@ &@T`  @ <  ` @$ $@@` @4@9 ` " &@Ð@8`  $` ` "` @@@  T`ɐ    `$ $@@4@  " && 㿘 2`!   "& X2&@r` ( &  ``  @ V& 2  P `&$ 8" "@ " " `4 4"  0"    "    "  , 2""" *" 2" 㿘  ` ! `` ` `  5&@V   {$`   ('` ` 4`  @4` $` ?$` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4 8$`8  6 ```<$```  ?$@H /f * ' )> %)`#4* 8 `` $ ( ` &@@$`  " &  & a`ڀ ` H 0$@ OH 0 㿘`_v  h ( h` h d`  8&@[V n  U  (``2$` 20J  "'c ` 4` $` ?$` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4 8$`8  6  ` 8``   ` &@@$`  " &  & `〦 `$@, `&  (""@`2 "` 㿘@ `= "@ "]  @8 "V   "@ @"  " $ `""`8    2 " `* ΐ&   "  $  `" &   @@ 2@"@ @ @@ 2@"@& 㿘$@   @8 ~ `+"T  @k " j "& $  % `& ͔ V&&$  Ā2T JK ܐ  " ?@&   "4  <& < @& @ D& D H& H L& L P& P T& T X& X \& \H /f * '    @6  X& \& X$ X X" \H 0  &  t& $ &$㿐'􀦠 &  2$ P  0K$ `G      @a   ( `2(  > '#@ @ $@  $  $@$  8 $  $ $&@`㿘 '!> _   ` X` `` < @Lj H < @ǁ   @{  2 㿘`> _  > _> _ 0(&@ ` 2  H@ :$ #> _ 2 ֐`h" @ ߴ&  `  `X "`0`<` `" "   X "0  <H " "㿘` 2  > _> _> _ `m%W' ` 6 ` @6 `& `& `& ` & `$& $`(& (`,& ,`0& 0`4& 4`8& @& 8 "  2  <&  㿘> _@ V > _ > _@ > _ @! > _ @!> _ !@ < `%> _  !П@ ( > _ @" &> _ $@"@ :> _> _@"x ,> _ 0@" 4> _ 8@#> _ ;@#H  > _ < H@#h L> _ T@# P> _@# @> _ D@#> ` \ @ X㿘 'H> ` 0SH     "  XH H    "@ "@  @  p@ H@@ 2@& "@&` ` @`@ UHH     & [H "!T2T`  `""`` "`  HS "& 5T     (``` `2&` ! H `/   "& `` l ` &` 5&@&'HH&㿘4`T   Ȑ (   b   쀦   ( ` M  '&  㿘` `= o " 2 2   "@"  `2 㿘  @ & 2?"&@ o?9 `"6 `@`6 㿘 &  ?% o 2 6   2   2  㿘      t 0 㿘ΐ``   Ð 2 "@& "@$    6 @` "  @㿐> '> `#Ě`X#\   Ҙ 㿘> 0 _A "_ +  2VY +T )H /` * ! > '# $  $ $  $ $4J 2` 4 ` `$ `   $ ` $ `$ `8$ $   2  H 0&@  `@m4 H 0㿘H o *@ a   `  H p@㿘 L @ - P <H /` * !  >`0  `   "  H 00 `  4 > a܀@> a> !@&4 4H 0 㿘> !̀`> ```@ې   I  E  @ B < P"# L Ԑ >6  ~2 P" L PL 2 Lh@  R2 8 " L@ A P L`"  `Ԑ >2`  L ~6 " P & L@ & P@h> '#㿘H /` * !     @  @Z  2 @  @P   7  " 2 @ې 2   "   !!" %> `!>    #`V  6!mh "   > `0  `   `"  " > ` p6 FH 0㿘> !̀`> ``@  >`0  `   㿘H /`4 * !   > ` ?(6   ` 2  5 >`0  `  H 0㿘  / -H /`4 * !      `2 8@: "  8 >`0 `   H 0㿘H /` * !  >`0  `  H p@㿘H /`4 * !    9 "   %>`0  `   H 0㿐`   'H`'P   P`:   U@ ``` '` `  `'􀦠    `4 "`42 `Ԁ +`, #@ ڐ`( H 0x`5`8H 0n`H 0f`H 0^` 5`԰ eP` 5`H /` * ! ` Ƙ`8 ˀ 2``  `$2`2 92` 9H 0)`H  '`` "@``" 4  ``$     @  (   (H 0`@ <D=  ,@ * !`!! #`Ԑ ? 5`Ԑ ?5`m`@ %``?# @5`H 0 PD`ԑH 0P% P p sqP     $$\  쀤 4'(a%'"  (`(P > &" $ @4  $h4( %4 %P 2 6  " ?@$ZK$ %P `  W"` `` `P` 2``` 5`H /` * !   2``8` `?c 5`` `   > 0 PHH 0` ` ?5` 'P  P E`?Ȓ* 5``Ԑ ? 5`Ԑ ?5`m `P   㿈 ''H'X''` &@ 2'X   ? !2``. y >`0  ``   @  Y/` 2g2& $"   > 0  `    `  #@ ڐ h 6  2ŰH /`4 * !  `2p h@ :k @ `@"e p8a 2]` 2X2  8 h " 8> `w  2I`zx6 8  2=p "7  "1 2V  2   `"X 9  RP #`N ? 6 ?6 l @ Q hH 0 "w G "  `8 "`8  > `> `> ` `Ȗ" `` V > ` !'H   m H"@w h " & hV  " x l " & l x?& x HH"@& xH "& &U *P&    : '@ h " & hV  " x l " & l x?& x  H"@& x` " ' `2'\€'& & `   `€& '쀦 V  !`2V& " & > `> `> ` `Ȗ\"V '`!2a"2b    > `> `> ` `Ȗ@#& & &   * 2  ( > `A!( ?6  H "8 "8`2!`2H 0WؔH /``* !` $"& "@G` 2``U  h" & hV  " x l " & l x?& x `H"@& x%@& %@-&   > `> `> ` `Ȗ#I!&& & & & @` $ %@ "@&&  h l""@& h& l H 2 "  & H  @Q6 O`K`@# 0  ,@ h "  ? 6 ?6 je H 0 2     `" 8  V `    `  ```2'@  h`2" & & &  "& ` "   > 0  `  쀢@````  ` ? 6 ?6 i H 0J `2X X"@ ? 6 ?6 iҐ H 0㿘` `` 2 @`>  >`0`     ` h 4  @ 4 4@0 4 4H /f * ' @ 4 ? 4 4 ?4 4i 4 ' ' ' ' ' ' ' ' $' (' ,' 0' 4''@w 8  4 4$ ,H 0   `@@E㿐  `@2 ɰ + " İ -  ` 95H /` * !  L``Ԑ >2`  L ~6 " P h& L @   V 2  8 @+H 0 >  0 @Ӕ 2| (    ! #@- h6 _`Ԁ  @!`6`Ԁ 2J H /`4 L* ! L  `P "` &  `"` + "` -  2& L 9&`P  > X> `@1   !6 `Ԓa6`ԑH 0`Ԑ ? 6`Ԑ ?6`h` ? 6 ?6 h  0" 0`, h|`0㿐 L '> !̀` > `a8@  8 2L B8  BA h>  d ` ! X4 X> ` \ > `> `> ` `Ȗ@M$b X@B 4 2 \ 8 \ ""@" 4  H  *    4  '3 `"`  ""  h l"@"& h & l$@ h "@ & h@R`  " x`  l" & l x?& x@` "@`H"& x@& @  $@` (    S $@$$@ & &  ` &  `       H ?@6 $@& H& H`X@  @6 :Q P 4 % ?`"   `    '1X X$@'B > X  ! $ `    +  ` 28 X`B `> X" @m 􀢠  @2 `  !` # h " ?Ȑ*@4 `    '    X@B > X "?Ȑ*@`46 8  " h "  2 Ԁ2Ԁ`" Ԑ >4 ~6 $P h& L @   V 2  8 " @ 㿘 !c 0 @: h ܀  㿘 Ԁ! PO @& 㿘?#@'P  "$ * `  @P *7 >`0`@a  `"V`$"Q`@"L`G` *C` *"?` :`٤ *#4`Ӥ *  <`"(`#`¤ *` *o# *`"Ť ` 2 ``#@4 6 `" ` ( `` 6 *6 " ` ( ` $ " t4  0} %0w @͐ 2 7 @ 2| 7i& @ 2u 7 h@ "^& tm 7  8 U&  p 8 N& `"] ` 8'> `d@u% > c`&@@u I !  d@u,  2 ``0 6 6 `2` ?     `  ` ]`  ` ` @P `㿘?#  " * `@   W&` 4$ "SV "NV "IV 0E"DV 0"AV @;0 06"5V 0```9`"2 p ` "`"* 0o%`"# 0h"V`"I`#/0\&`  ` "@V `X" V ` S"@` 8"@N6 8 `J"2  > #` &` `@tA$@v#> d`5$ H /`4 * ! &`  X`:H 0 & R `2 -    p & &` ` Ӕ  & 92 *& 㿘 <  @K8 D `4R`(2(  > > "`8 h> "`8 H&4,(,"` ,404H 4(H4(  "` 2``?"`"2H `4( h"`   "  8` 2` 8 "`"`,  " `0  4(H4̄(̀  "̒` 2``?"`"̀Ԅ2ԅH 4(`` ``"4" `   2`8"`82,`   , 0  `&  4(R`2" R`2@  2 㿘   ;  6 @  @ ې 6c] 0c 6Ӑ㿘  6 `8c6 ِĐ㿘  6 h0c6 ̐㿘@ > !̀`> `a@  !> &"$ P d* * @si"  L@U T`4T`2*T`0 @ @L!> '#M :@6` 6 `6 `6 ` & `66 6`<& <`& `& `& `& `& `@& @`D& D`& `t@#& t >`0  `    @28#  ` Nc+`6 6 㿘` > `:!&` 0  6 0 2  6 2&``&`(`(&`,"`"``  2!  0 2 0 " 2 2 2(", ,, ,?(""(","" 㿘 ` 6 㿘 ` 6 㿘 4!  @6 4 > ` 6`㿘 4  4#> `  @4 4! a`{ " 4    4  4 4㿘`(`4 ? 6`4 ?6`4b "  D <I  @㿘 @# 2 7@ h  2  &  2 (&   8&  @_ 7`> 䀢@0  (*`"   " "  㿘 @ 7 " 㿘!> &"$ P d*" @r *  L@ !> &!T P d*" @r*  L@1> > "!Рb$ P d* @r*  L@ !> &!T P d* @q*  L@(!А &!!Ё㿘@& & 㿘` $"& $ "@!0 @z㿘  $@"  > `> `> `!Ȓaؖ"(@g & $㿘`1  &R  "    &  !&  " $H@&  $ "& " & $ "`?# @2`2@0 㿘`D   @ R  2 @ 2R@ &R  "    &  !&  "H@& "`"& $# "`?# @2`2@ 㿘 @ > `i"       ` # 4 4W @  Ȓ  2@L $` `) "$$@  &T   "    &  !&   " H@&  2  &T   "    &  !&   " $ H@&  $ "& " & $&  㿘> `"(     ` `# # 4 $#?   &R  "    &  !&  "H@&    &R  "    &  !&  " $H@&  $ "& " & $&  㿘 `r `` ` " $@ 2R R V`@  $1@.& $/ +(쿐` "VV`@ `@ `   & ` @&V`   `  & 摐"& && `  &V`  "  `  &  !& ` `H@& ?# @6& > `6"8㿘 4 "  > `> `> `!ȒaؖP#0@?  2 "  > `> `> `!Ȓaؖp#5 "  > `> `> `!ȒaؖՔ#6 "  > `> `> `!Ȓaؖʔ#7 "  $> `> `> `!Ȓaؖ#8  > `> `> `!Ȓaؖ#9㿘 = ;2  > `"1@("@"" "@&R ? > ":& " &R  &@ "   " &  ?&  H"@& Ԑ `ƀ0" &R  "   " &  ?&  H"@& 巐  `""& & " 2& $& "& $㿘 "" &  " &R  "   " &  ?&  H"@& } 2  & $& 㿘` ? (> `"%  㒒      Ö( `2 Q   ` ? & `$ $$ 㿈`/ ( Ӕ - 2` 2 > ""``@`  Ր Y0"`(, ?",`0?"`0`, "^`0&. (㿐 @n@ ``@7  2 `(3 0" 0`, ^v`0㿐 @J@ `(`0?"`0`, ^]`0㿈`  `   @&@ H /` * !  ( `2   2! `2% 8  # 5` 8   6![ T 2   8    > ` 54 8 8 l4 8   2> `#    `.6 ( 찒  ɔ  6] L & "M  2` 2> ""` "(n L `` 8'  `     W0, ?",`0?"`0`, ]`0Q - (H 00,?`$0]0㿐 @@a' q`(  !!2``0?"`0`, c %]s`0_ %`@  2B  2<   !! 0" 0`, ]U`0 $0>H /` * ! #> `    8   6!c([ "   84 8H 0  ?4 `0?"`0`, ]`0 ??" x @`` @`` | (-< ఒ j '2  2` > """( ఒ 2M2 2` " "`('谒 5` 2 ` 찒 +` ~  $, ?",`0?"`0`, \`0, ?",`0?"`0`, \`0,  >' 7'耢 ,쀢 {p`` ``'` @'''''И''@6؁8` ~.  (䀢$% ( *  ( 䀢*~  `@'@ ')˒ h'@ ԰     '  '? '''' `  ' `@  | "&'  @"m @  f @2̒  ' ?  "`"@"`  @`2ܒ ,  'ؔ~ӒԚ`( ̰ 耢 ?  #    C  `Ԙ$ '`@`B ;`@`X @ ; B ;`X`   D )   0" 0`, [`0Ѐ .p` }@  "`0'`` `'` '`@''''Ԙ'@B؁8` }  4䀢$1 ( *  ' ` *@ '*} @'@  `'| ( ` ''@԰     ? ?''''   ` '԰ `@     @`2ܒ ,  &ؔ}耢  Ѐ #\#\`( Ԓ̰  耢 ?  #   $  h (D  $'`".̀2' '' @" `2@`|b jȀ&|W   @[԰  F Ѐ @?#@2G& " A&?" ` "`Ѐ 2!  :  & |`` ?$ @` 2 &@& `8`B ;`8`P @ ; B ;`P 0" 0`, Z`0̀ "Ѐ 㿐 @@ `:(`0?"`0`, Y`0㿐 @@Ƞ >`(* `  { ``   ߯( ` 7 2`  7 {`  `$ `( `` k 0" 0`, Y`0㿈 @@'찒 B` " '`{h  '`(`` 2` `쀢 " 8' {O `{H  0" 0`, Yi`0쀢 㿈谒 ''@{$   ) ( ) (㿐@@ :`{  %  (0  `   ` 8'``z `z  0" 0`, `Y`0`߰㿐@@Т H`(  $ 2``0?"`0`, : 9X`06 9z  $ ې  `   ` 8'``z `z  0" 0`, X`0^㿐@@ J `(ۺ  @ 0" 0`, : -X`06 - ݎ  2 ! 7`   ` 2 - ` `zA ` z:  0" 0`, X[`0 㿘 0 #   ( `2 ާ 7 $ z ޛ0$@ * 㿘 2R`    &&`0  "`0㿘 @ 8   1ɒ ``&  @"8 2   " 8 8 "Pl|(@Pĝ㿘 `  S -`     = - ``27 `1.`> t € , 8@7(@c% @    @@_ @}     2  > & z a @ V  2> `> `#0 瀧  x 0`"@  &` x$ 0 , h`" @ &` h$ ,Ҁ t#8 @' Ȁ V 0 _> ` [ 8@ U  %  @ > !`h֖ " 7H  : @ 6   " /  * 9 `h4 2  `h 0`x "@ " &  `x"0 ,`h "@ " &  `h", #@ _`^ @ߐZ @ 5U  &HV  ? "?`h@&H?& `2 4> (`$  "` 4 &0 8& &$&4&(&, :&  "+&  &  `y$  "&   "&  &   y     &  y  & > `#H 83㿘 "V p  V "> ">  > `> !> "ܐ {#X   <"  " 7& "@8`4 㿘  " " |@# &  "  @( @b 6  2 "  > ( ` # @# > " ' ` @ Z `@>,  'x'T'P't'|@ǐP 2I` d@>Atd@"0@"@"6 0@ 4 '$8 a'd`@<t `" $ |&  V& `  &  `& $@  8& @>>& (  > `_#hP` D`  a '''''K?  (0]* @[ X 4 R &` @< H | "D =U@T@? )`  `7  ߒ 2 / =` `沔  &``&`  @&`$@`8 &`&`(   $ $$$( $$(@@!Ӑ㿘V@V@  )`" V  > `"["  V" T 7#x㿘 '& R`` 2  $   2 > `#2$ & ` ?2`SP$ 㿘R`    㿘4 8   t$ ۀ "^ 㿐> 0  `4 6`8,  y  ` `@6R`   '`( 4` `2` @@ 2` $ː ( S'$@Ѡ 2H, wz .` t   .`<.`  ( $ (`@*`" > ('  " "vՔ%& $ (!Ò 㿐 ` ``?#@2 @   ?@t 4 ,`? ?$`   a  ז( `W 7 v@ `@$@ ` & ?@-1> (v i?"' #@ "   vӔ ``  "` @  "`&   `!> (`v ` `?"`  ?"$ 㿘> (`  >  > (  %  "`?#  4  2 > !x` 4?#%> (#  4  $ `2 @" T `4  (" `2 ` >a @Y  2  `> `  &* `  ` @2   2  $@` 0 $ 0 `$  2 @R` 2 ?`( "?s?` @ ?`  &%㿘 >al@ 㿘 1 *?#R 2! (` 2` 2@?2  `$@  2R   ` R`  > (  2`2`㿘 > ( 0 & 0 & ?"H 㿘> !̀` > `c@  > ( 8 > > (   > (         2  > `# 0  (;@  : ( b ; (;@  : b;  ` $"`$$  $? "& & $B?:㿘> !̀`> `c@Ȑ  t   8  > `> `> `#Ȓcؖ?  0 " > aH !P#!@" > a> 0 !P#!@" > a3 P " > a, x`"  "` ? "& & > (> (!8B? :>  8!0:@ " `#!8#!8@  > (!@y㿐%> > (!> > ݒ #> ('> ( ""$!$4v$b@a d$!$b@a $4@a  !> ( d$! d$! 2> &f!% > !(avא @vђ%  ? @!> (% > a`#\!@   wC !@x6 > (   ""   *"@~ a   :`*` 3  > (:"`> (" @`’ a> ($" @`$> (> ("""b 㿘H /d * % > ݤ"! )> ( :`6 *` : > ("b% @` > ($"a@` $> (> ("b"" #> (1> (  d@@%t`   : @       :  > ( $> (   (: @  > ( , > (Q "> ( 1> (#> a `NҖ :   "  "H 0㿘> > (!a4 ?1> (!" "  !> (" j$!8! $!8㿘   @ `0" `0 > (&`0  8 HB`B ; H; 8@9>`0` , "," 4@@ 4 2 P |   2  x`B > x`B > 㿘   @'@㿘\ d   @$  @  2 `.`@   `@ @㿘 L` " 8@Ӓ& <` % ` 0("`0"`0@  ϒ  0 @ː0 0 *@& 0P/㿈O '> !, * ƚ`E    @8쀢  '? @@_C4*  ”  ,1@ 2 u @ < E `C   @,  $@  6, $%`0"`0@f? ^ 0s?Հ @, $@> 0'> ( พ  8  H`B B9 89 H`0#`08 B; " 8" <;"`H`t#`t`x@ B ; xڄ``E > ``  > `> `> a#Ȓcؖ}"%` > `> `> a#Ȓcؖ}"&`0 D>8`b `0 `L ` 8 HB`B ; H; 8@8D>`0` , ",@}㿘 ` `4 2`P`|  0  `$ @@SO  `"p`B :`B :p> (  0 @B`B ; @; 0 0? 0a `$ 0H /d`* %` @#  > 0 ` 0 "0 `p "`pH 0 0@ $ 0@7ڐ` @@㿘 0  >  0 & 0H /d * % @#uH 0> 0 ` 0 "0> "h F *> Ւ"@ #t*`  @0  0 & 0 0b& 0@C㿘 0`& 0@7㿘> !̀`> a`@   0 > a|  0  0`& 0@#)㿘> !̀`> aa@  0 > a|!( 0  0 & 0@#㿘H /d4 H* % H    8  > `> `> `#Ȓcؖ|_" 0"@ 0 & 0 0@i > (!(`@ 0 "  0 ?& 0  d@@"e H &  t >  0 @"  0*@& 0N  d@ɐH 00> 0> ( 8:  :(> (b B8((;   > (,> ( ,#b> (  `&  "`$ # "O& $ 0  > 0> ( 8:  :(> (b B8((;   > (,> ( ,#b> ( 0> ( 8:  :` > ( B;`   0 "&  &  "`$ # #& $> c    & $ "# > c!,& (`B : 0>ߐ# & 0@Q> (b b?"bM|  0 @ 0*@& 0MrH 0H o *@ e  d?@MH  0@2 H 0HH /d * % ?Ȑ`d@) 3 0  0  & 0> aP JH p@ ٰ 0( 0@> (P`B :P 0 & 0l@H 00H 0@ 㿘   @ " 㿐  ' '> (a8 > !> (b#> b 2 ?!> (!Ub ! $b H /d * %  > (> (  `` : > (`$@> (> (" ` (:`   > ( , > (L"> (!` (:`   7> %%>  , "(7> !> (%> > (   d@@ ," ` (: @ ( , > (( > (  ,@ 4@ ี<`?)> (       d@Ē@  ??"ᔖ: `@ B 4"ᔀ@ "> a %"" I H 0| ᔖ: `<`@ B 4> (2> (@ > (> (a8 2> (#> ( ra@  > H 0W #!Pc!,?& (& D& & & <@&`"  a@sH 08 > @> `d@ > > a!Xy 0 & & 0& >  &  "`"& > (`B  :> !, @~*@ @H 0㿀> 0 > ("a ( 1> ('> (-> ( : ` > ( `$> (> a"x IH ਀  > (>  a(:   $ Đ@qH 0 0@H /dn * %g  0 2 > ay[! < 0@7> (!0    * 0 $ 0H /d * %  8  ;  ; B< $  $ $""`B <@А$V&"@'"'Вb@ ?H /d4* %耢 V ਀ pQ 㿘 0  > `> `> a#Ȓcؖxڔ$H /d * %  0"  1> a!H  0b H 0 0$ 0  ;$ 00  0(  4 " 㿘> !̀`> aa@  0"> ax! 0 p"& 0` * > (!$`@ 0! > ( 0@*  & 0@E> (    0@ 0@ 0280B?:0B?:8 0 @  0  & 0€4 0 ֐0 0 *@& 0J:㿐> a!> (ภ> a "  $> a#\ "     > a 0"P 4 8 <㿈> ("D""D"`!> (> `$>  0 ($"L#\#`#d"L ?@ښ? "L> ax"x> (@> (","4> ("P @> 㿘 0  > a> a> a"bw NH /d * %  0`& 0@"H 0H( 0" 0H 㿘> !̀`> ab@0  H 2X P> (> (Lb, @@"L)> /> (> ("D)> /> (!> (#> (%> a"0"0b(`$"0$b( GR D "0@!( 8 : :6& H -> '> a)> a+> a x, @ B  t @ 2⠒"cwk  ,`8@P  8: *& H`" T T"`T> (""H T? P/> ("& P& TX`B :X 0*& 0㿘 0 2  H> a> a> a"bw5  0@ > a> a> a"b0w& H /d4 H* % H  > (XB?:X& P> (bD` P& T`""`> (b0 b0?"b0 H  0/c & 0H 0㿘H /d * %  H & H 0 > (XB?:X 8@f t  @:  H 06  0 & H P`> ( T"`T> ( TD"   T? P"& P& T 0> ( ?& 0 0 & 0DD & PD P"`T P"`"DD& TH 0 㿘 8@  H@"@& 8㿘 0 "  H> a> a> a"bvw  > a> a> a"bhvm H /d * %  P`" T T"`T> (""H T? P"& P& T H 8& H@ސ 0@> (!@p>H 0㿘> !( @ * @ "  t> a> a> a"bv,! "  H> a> a> a"bv!!  > a> a> a"bv!H /d * % > ( D:   > a  > a> a> a"bu!a(` 6@  -> (IP`(G& 8a( ,@ DP @  )> (> a#u @ؐ a(  ,@ D P @ > b ("0Ho  ?"`a(  6@ `B ` D  :@a(P& 8& t> xH 0㿘 H   t> a> a> a"bu!6 > a> a> b"b(u!7H /d * %  x  > x& t  +%> ( ,@ @ E  @w 2 `0> a> a> a"buY!A   > a> a> b"b8uN!B@"`0> (B?`:D (  8: : іΐ(H 0㿘N 8N`8  9" @`9`"2 2<""<  2"`"`  "`2  ""`"  """  2"""> " 2 ""3 2"`"`  "`2  ""`"  """  2""" "`"" ݘ  2l`2 "``"` ` `@2""" "`` n"k 2`2"    "2"""" `` "`2 `"` ` `@2"""m  "``"` ` `@2""" "``"   A"2`2"    "2"""" `` "`2 `"` ` `@2""" "` "2`2"㿘`2`@` = "  2" "&  2# # " `"`"`"`"``"&`2"`"``" ` 2"     2 ```" "& 2# # ` 㿘@      &`&`&` &``6$ $ $@  㿘      㿘 ޒ    "     2 0   " "  "     2 0   " "  `㿘 0  `"  "`> ("# ?"&& > (?" `"  "` > ("# ? "& & > ( ?"  (  ֐  (` "  0 . 4L@*> ( (&> (4 2"> (N 8`4 ``N : .2  `> (N 9 .> ( ` $"`$" $? "& & $> ("Xl9 @`8> b> 0'  &@> "`*@&  > (((?`B :(*&*:f/А 2 > (( ?`B : @(> ( 0`2* 4 ( @> ((`B : `? "`   "@$ $ > (c` $ `""` (`B :`L> ((`B :@@; @$ @,5@& @ +   &  @. "@-fb*@& @j       @,@&  `L)  > (@> ((`B :(`B :@     +?@.  %b*@&> ((`B :(`? "` "@$ $> ($ "@"&@ ?b > bL P㿘> "`"C&@ 9> ((  " , L@"8 2()(? K 2> bq  ` ?"@(> bq @`B :@J8& 9&@ "e&&@  (H`B :H&@?㿘> "` > (> ㈤ ct > (# > (# > b$#> (pڐ #> (bXi `$ 0`L$ 4$ ( L 9$ ,, 8*e:  @ b bXj0I`.> ($$ "@" $@/> (`4 , L 8`4$ ``L : .2 $ ` L 9 .t$ ` $ $`"@&`> (> ($ c` $ `""`> (   "  t@> (# 㿐> (#"#"`> (#"#"`> > (> b#\"X` X  gژ 㿘  !> (   # $# & L $#& L㿘> (#`!> (`( " @ P@k c 2`(#``( " ` P`W # 2`(㿈    >`>`>`&` ` `"P``B 2P 2P <;  `;  B 2P "`P@@Q8` ? Q' <: `` %@@MD,`@2* <``B 2$ < 2! <@ؐ` *`` @*n ` $ * + <#\#```@e  <  ( +Q>` <D: @Md@"  @)   ? ? &`  >`>`,>`  &` D>` >`>`S>` ;`@ `#\@#`D>`&` 9>` >`㿘 P 8\ `> b o,D  @``2````N0+*  `0 } 0; 0  `0 ` D jȐ D %㿘``  +$,   `  & @&  .` <?`D `@&  .`" `& 㿘> 0 ` > bn   4 2 8 | " 8   @ 4 2 8@  8(0! > b"& 8 >B 0(!(& 8 |@  " 8|`  4 4@2  " @w  8(2 | 8 >& 8@u  "    `"  :@  2" 㿘 㿘  $> (h,#     P > < 8    `@" "  2  㿐> a#\> (> b#$  a(e @ }> > #4c8"#4 "c8  @?`$((㿐> a> )> b#\ la0 @  ef 㿘 `` > cT* 4  > #T $  > )`" lf " 4㿘 4 > )" lg㿘>W` 0 \`l``"@f @ B&_ `` @2`?? DE?4P 28K  2    7`A     @ ` 2< 2 M< $ $ `$ 4 $ $ $$ (`@4> 0 `8$ 8?$ 8    0@@,@x0 㿐V  $   (_  @q  #"#>  @    @2``a ``cX`|@ > #P @   @ @2`?*  @2 &  6 @ 6 & & , ( ,& 0 ("@$ (cX<   ,` 0"`0"( 0? ,"& ,& 0& @) 2'  @6  `*`>Ő  €`" "& V   R` @3  2 V R 2ېw  @  @ " `B  & :@ʒ@ ^ V   R 2$@ !`$?,`"0"`00"`(0,"@"0" ", (,"0 ("& ( $2,`  " ` '&  "@x  & "   B?:@'g`" "&  `B :@ 㿐  2'0H: ;@?`>>Ő ȓ*` € "@F02     @ @> ""  "@.   B?: ' `B  : @D  㿘@!   6`6` >@ 2   ?2    @ b `B >` 8&`6` 㿐'  V   `  @ 2T 㿘'` ` `@> "  `@6  ? ? 4 @2 $        2     4   8  & '    @     z 4  ?  4 2c  ] 4 @@  ? @ 4 2E   ? 4   @ 422  @  ? &  4> b @ @ 4   8 2> b?> b  > bj!8 4 㿘 `@2   ` @2 ``B > 2&` `@2 4 `@2  4` B?> !&`  : :  :  :  :  (: ( 0: 0 8: 8`B: " ," $ $" (`B> &` & 㿘 $?,`0"`0& (0,"@"0","  ;  $2,p,$ ``$0` `"> b``2$> bjE!P?"`> bj?!h $> bj9!`> (#b $` $`]Ɩ$`]  "  > (`c#$`ؐ  @`2``] ` 0@ "``@"$ `@ *`L /"?` ""$, $  $ > (#$ `J`/2 @ `> (c# > (`c#0@  )> (N  #b ``$'`   ?'''''''@#Œа   V%> (#cR`2  # ?( `^x`cr#$`*@@$`J`/@) @ P `$`@.$ @`@ @@d`cJ# $` 2  @#  `$  >%> (`c3@@$㿐$` $ ``  `"` `@$` b*$``$@&Q`J /2#$`J /"`""@$$`4 ` J 2` 2$U $`  $`$`J  /2`"`$`A ?$" $J`/2`J /"" "$$` $`*@$` J 2`` `*@$``  $`  * $`` 2``J` .2 `J@ .2`` *@$``@"%$ ' @@`@%Ĕ > (# 28$$@` "$`!"P$$`*@$`@!  "!` ?> bhn!` ` P $` $@|  `*@$``""@$`"@$$`J`2 `  $`@Œ 24 @"  @ΐ 2f`@А$4 `| 4  @  @@"$$` \$``? ` @2 @$`@`@? `2`P $`2 `"  P`$"`  `@ @$2`@x`   @"+    `  @@" @`@[$@#$㿘@*   "&`@$ĔJ@ 2> bg!@"> bg!@ - "@@ ?> bg{!QO  P $`J@I @E  4 @"> bg`"? &  P $`! " P $`" @ @h 2@  @!     @@! @ؐ@&@`" 2 2<" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @  &` &`&` &@`6$ $$@  㿘  @t &  㿘 @b   "  20   " " "     2 0   " "  `` 4?2  ` ( ?`4  2  `  㿐> #t> *`> )"#\> )> b!Db(   \ > )!<"!<"`> )" "" "`> )4"4@ " 㿘  > bb0 `" `" @  `  㿘5  @ 㿘> #8``@ 2` `&  " ̒ $ $ @ $ $$ $ `> `$` $*  $ $` @?  /, ! YW &  > )44@" ` 2 @` 2@ @ 2` 㿐 >  > h  aԐ * & `& `4aa?# @ `> ) 4* @4 ''aԐ `'4a & ???: P" " `": " D" H" @" <" 8" 4" 0" ," L" (" " " " " 㿘> )""> (> ฐ 0:`   2@> )> )">  2`@:` @ " ؑH /d * %  > )" `" > )!<`!<؀ "H 0> )!D\0 $ d$ $  $ `b$ @ 2 T 2 bcG"8&W  "  T> b"@@f> bcB"P` X"`X$ X? T"$ T$ X D ?$ DH 0 4 @4 > b"h@A> bc"xH /d4 p* % p  > bc "H 0$ 8$ |$ 4$ $ 0@ & $ <$  P`\"`` ``?\""\"`` "P`"\`\ ``"`"`㿘@  㿘@ 㿐?> &@h   &@$ 4@  '@&&@ 㿘>4 0` [ @ @>` ?> )* b$ @    |` @ 4 4@2 <  @; 耦      4 "   ($|@"`"` ` "@"`"`@Bg  $@8$8 8h@& 8 @@ 0& 0& P$4㿘 8!`"Z & 8> b 1 Q  D <`3  "1 ) "!@ T`" X X"`X> )"" X? T"& T& X D ?& DH 0  <` & <@ " <? & < "@ 㿘 <`2 4> ba֐" 2`> baА"& <㿘H /d4 <* % <  > ba" D "  H> b#@Ԓ> ba#( `& D> )!<> )"  4 2& T & T T"`X T""& X T& X"@"H 0 㿘> 0  > ba#H < 2 ?> b#X@> bat#p & < @֒ 0 @ > b#@> bab#@ <` D 㿘> 0  > baK# < 2 ?> b#@d> ba@#؀ & <&  @ " > b#@T> ca0  @Z > c@H  @] <`2   D 2 M D!H<2HT"XX X> ) X?T "X"T> )<T"X H"H㿘 H`2 D> c` 8  & H` <  T`" X X"`X> )"!@ X? T"@& X& T> )b ` T& X`""`㿘 `` `P `\@ 㿘> 0 @"2 `  8 2* "  < @ "#  4 2  < @ "` 4?  @ > "h& 0    &`㿈>Ґa'''쀠 `  㿘 <  & < 8!"!> c`Y P& 8 @@Ѧ` ? @"  ` ?@+@x @@~  > c`. h <?  & < H > c`! Tɐ> ! & 0 " 8e @ 8& ~b& 8 |& 81㿘 <  @  㿘> 0 @㿘 8! "> c& 8 / 0  P   4? 8Z < | U@  "  |`2| "`2 8> c_  8(4  |@ |  @ 4 4@2` `|  @ 4 4@2`" > c_ 2 88 7 8 8 7& 8 | & | < `>& 4 D :H /d4 H* % H  > c_h > )" @"  T` X"`X" X? T"& T& X  & T  T"`X T"`"  & XH 0 ;` ?> )$(   | @4@2 " 㿐@ ?* c`@ * @ؔ @ `@`㿘 8(2 |" <  8@ ` |` `4 4@2  <  2| P> "' "`4> c! `b`4> #Г*` `<> c`@`H`V!(`8`/> caP@w @`8 > caX@o @`8 > ca`@g @`8!> cap@_ @`8"> cax@W @`D > ca@O @`D > ca@G @`D > ca@? @`8(> ca@7 @O > c!`` > c> c_!"_!@" > c9!㿐`<!> #8`d `  ` ` `[ ` 2` `T @\#\`,J  "`   -0?4 -0<> #4#-5> 1 #8`,  `' `2` `    $R $ $$$ $ u 0 > (# ` -㿐 > )" ` *` *  * L&@$&@F > )@!4!4@ ; `  .@` ''+> c`P > #`_Ia`\Qi  Qc N0'@G4@ʐ$&@  | .  8* %|  4 42 | | `  4 42`"  㿘\`  $"} $`0`4Qϔ P $`4 $ "o$ $`l d h`f d @ 1 `XP\ U `\@$d_,`d" \`Pђ B d@$ g, #6 *`  > %#0 `"@ 2`` "``$€@ 2  7 @ @"  $`0`4Qb P $`4 R 1㿘 `   D 1㿘 %>֢ #<   3 & 㿘@" $ <& $! F " $!& $ 㿘 $! `* @` `€  2  $"2㿘`   @ `I/ -   ! @! 2 @` @  @2 !2 2   @2 !2  2 @  㿘 '> )4  > 0)> c   2`@#  ]" 42  > c]"(> c]"X֬ 㿘^H o@> c]"h> #b$ >   @Z @   > c> c]x"0]u"㿘> 0  >   @?  ' @c />   3   0  "  0 "% H /d * % 㫐H 0  > c]1"     > c"]#R``㿘`  2 -> ",` >  X#̰㿐  -\#\ِ 㿘> !̀` > cb@  p   p D`& D`* " p㿘> !̀`> cb@֩   p??& p> c[4" D`  & D- p㿘`IH /d * % > c  l`.H 0@  H /d4p* %p  l > cZ"H 0@0H 0H /d * % `h     `&   l  0   `&  7%> c  &*0 0  &0 *M "hH 00*֐⃐0 `0 &0р h  l > cZo#H 0 㿘H /d4 l* % l & > c 0   0 ZL ّ>H 0 `t0ɐ0Ҡ`` > cH 00 8Ė  l` H 0> c#H70H 0㿘> !̀`> cc`@n ` > cY#h&` 4? ? | &`D&`D h &` h`"` h& h&`㿘> !̀`> cc@F  2 > cYՐ#!P#!@  ` "` ? "& & D`"& l 2& "Dt`"xx"`xx?t""t"x&  㿘> !̀` > cc@    0"@`p`L&`p `"  "` ? "@& !P#!& 㿘> !̀` > cc@ߐ  !P#!@  ` "` ? "& &  0 2 D D`4 h l 21@ $ D t`" x x"`x x? t"$ t!$ x  l 4   >  \>  \2`@ :` | `> `\@:V >  \@@ & @ "`$@& 㿘  > cZ#> #8 #8 @~      >  4@4"4& " (`" @ 㿘> #8#8  @~  2 2     $@8     4 2 > "#4  4  㿀 > d ,@ 4> c 0# D#`#\#d#h#l ƀ  L> d  #\ #` 8#d < @ (ƀ H> d !0  ƀ `@㿐 `>  *` > d" 4` > #*` > d" |> d !#\  4ƀ P> d " < @ Hƀ p`&> dƀ"X h > d#> dƀbh  > dƀ"p l  #> dƀbh  㿈 > d $> d  ""ƀ > d   #( ƀ+> c P> d L#`;` H#\ 4 8 @ƀ D l> d h##\ X \ `ƀ d > d # ƀ  p> e t  ƀ  > e x ( |ƀ > e  !ƀ P> eƀ x  !)> e'> e%> e@ " \ \  @:V  `ƀ \ƀ \ ƀaЀ`$> eƀ   %> e3> e1> e \ @:1  ``ƀ \ ƀ \ 2 \ƀaЁ㿘`  `@}” `0``& `d & dl Z& l`0&@> @P> PH> HX> XhL~& ha Lz Zat!DLv l㿘#> !> )`X  " " > `"$`X> X@> h> )  @H4D(Dt"xx xx?t""t"xD"D> *`"tt x "xH 㿘> 0 > )/> "b+> 9> 7> )> 5> 3> ecH /d * % h!* X  %h%h I ϔ  :H 0   @qH /d4* %  l >  4 > e  P`"> e> e Xc`> eVӐ >  \W 2H 0@Ҁ  ` ?% `c\ (a&g 0㿘H /m4> )* .> )"  `>  \@3ѐ H 0> `\> 2  ` :   >  d`# `" d 㿐> l – 0$  "`@> >  a "`4">  X > ܓ3 2   : :`#a  ">  X2 :`#a"  $ 㿘  P>  \Đ Ȓ  `$ ?`$`$ @    `$ @$`$ː 㿘 < 2P  @ 0%" H /d * % t`"xx"`xx?t""t"xD ?"DH 0  m"@ 㿘> eWz! p> !>  ``'  R` ZI1 IВ D ''''o' <@4`8 2`P3/  $`y  @  L \F /`$  K@ $ @z$ $ `@ <  @$  /  "`P `$  `  5 `4 ͐ɰ @  H > #8@z 2 2`| -    א"  >$ $   $* @ $ $@{1 $   @$ " $ $ `@$ $ $> c ^  $ $@` `@ 2 $> #$  $@@"&$`|f $@ $ $ $@*@ $ $$ $ $     U "$ $ sCt 25  $> )a4$$ a4  #!4"!4" @3 @ $`&L   0 ` B 6"`|  > e/ǐ!㿐 < < | '>  %> ( > eTo!(`"` 2  $  2 2 `|$ 2``2`i$P@ D'''''ݐ .  P@` @  ̒ "`$0`$@ 8    `@㿘 $ ?& $Ɛ  " $ &  $ 2  ` @ " @     @> ) $ `Jp*> )!4@ "` 4@"4"@?&&  ` ]"`|  "  > eS!@J  㿘> )!4 @("  "`$` 2` ?$`$ @@! `` @ "``$ @$`$`4@ܐ P@ @'''''     P `` `@`㿐   ?F ` ``F   `h h!!FP@ @'''''Ґ  P  0`   $>*@$ 0`㿐@ @ 0`( P 2 `0?"`0`, # $ܐ`0  0 `0?"`0`,  $Ȑ`0  > $*@$ 0`㿘``@4!> )!4!4@3 ?#R  `$` 0 ` " $S $ @$@R aC4Ԑ` (&&50& 㿐@@ _ I (`0?"`0`, "$U`0`@ 4` ` @@ ]א ! |`  ` €    @ ` $`P@ D '''''@2 `Ұ &`P  2@ D'''''@  "  %$  $ 㿘矐   4   `` @@  [0@ F Ȣ` (,н(  @``$ @*@ ?'X'0$`H 'T'4$'\ 00  ;0@    ?`H(  ?,)(&?"b a(@ $`H, 2`,> 2 ,!", 0("`(  ?7 ?x 77   0 @ ܐ, @ x 5(`@, 2., `2`P  $` `4  @  w,  ?@ ]   @ (9,ѽ0 @ (&,, ?",,`0?"`0,`, #`0^((> "' *@ D'''''欐 А@1  P ' ' P$g `D  > e,"!X> "' @'Ds ``  @`b (Ű ߪLϤH 'L@D`  L쐐 2  FD` ذ 2'DD`4 ` -  !@  LdD`4  {  @ } uL@ 0D pLdP죐  ?pD@  `LD@ > XL`D`@ "`@L `2`L 2 L> !"`L`0D)"(  ?7΀` ? 77̀`  0D@  DL @ ۖ D$'D`@ WL 2D @ H&L, ?",L`0?"`0L`, !`0R L  H LЎD w? > e+8!h> "' )@C  ! 2  F\` ذ `\@ RA\ `Cw p > e*!xh> "'S 2/@CV  2'놐 2   F` ̟؀ 2  P  0    $>*@$ 0`C5! > e*! S` `N @ 'l 'H'p'L'tH AX " 끐`< $`8 ` o ' '     2 '' ' \Xl@@ Ul\ѐ  Ȑ@  'H'l'p'L't䶐H 2(X \@ 0lX@ Xt X 0"  '$`8 / @'\X@lP@ @''''' - 4   ` ''''ܐm'  @@d , ] 0@^԰V> ( Ga#@$A 24`  'H'l'p'L't5H 'X \@lX@+ X X$ 㤠ꠐ $X8 '\l@]HJP@  '''''  8 @wĀ0캐 @ÚĔ@(  @ Ȝ@ 2T W 2T (`4  M ``?  `   @  <  @ B@ "/@ D   6!< % `h@ Ӕ 2<   (  @  B @+Ĕ 8<   @8< 0>H `B #̀`? @@  3@"?0'''`@C``'l@'H'p'L'tdH <X`@`P`$ 0 ??L 2> #̀`? @@  3@"?0纐'''`@(``@@Q K (`@`P`$ 1 ?? 2> #̀`? @@[  3@"?0q'''`@V@ `0?"`0`,  `0ؐP`  Đ '''>”  ?耢??'?2@?'@ @'`'8'\'<'d࣐8 (H`@`P`$  + *" " * *   * *''''`@K`  m '''>k  J耢??'?2@?'@|@  8| (`@̔`P  $  + *" " * *   * *''''`@@ |`0?"`0|`, S`0@ @'p'H'l'L't H )X`@`4`2 ` @J @ s`? @Y貐(`@ @ 3 ``  (`@L`4` @͐ B? @*@p  0" 0`, `0㿐@@  , (`@@w  `P "  $@@Z@; `0?"`0`, `0@!  '''''b 2v4  ,` '''h''lOh  @͒L!> (JNx |4  4 ` `  4  " "?`| "@ӐĔ|@1x@ ې "֐@p!> (C7# C.# @ `'l'p'H'L'tܐH *X \@Wl\Ӑ0ΐ J` '$`8 ! @'\X@l XP@  '''''ޤ %`4   " `8    Ĕ@@ Ā爐0QOhI  @̰ C` 2` 2  (`4`(  ''?''''`@֐̒ ??   @̰:` @ &'@ 0" 0`, i`0㿐@`` ` <+ 㿈@`` ` '<  $ "`2$@ @'p'H'l'L'tH %  X@P   @ܒ  `< `8(@ Ր㿘Ž  R   ( 4` 0 "0& 㿀@ u "$   2S   (`4 2` ``''? 0 # 0#\ #` X 㿈@ I "  2R  (`4 20  "0```#\?#`X 㿀@ " "#   2S   (`4 2` `? 0 # 0`?#\ #` Y] 㿈@  "  2R  (`4 20  "0```#\?#`Y6 㿐 0'` "@€0@㿈 0'''`@"@€0@㿀 0''''`("@€0@㿀 0''''`D"@€0@㿀 0''''`H"@€0@㿀 0''''`$"@€0@㿀 0''''`"@€0@㿀 0''''`0"@€0@㿀 0''''`"@€0@㿀 0''''`X"@€0@㿀 0''''`"@€0@x 0''''''`8"@€0@؁㿈 0'''`P"@€0@㿈 0''`"@€0@㿈 0''`t"@€0@㿀 0''''`,"@€0@㿈 0'''`l"@€0@㿈 0'''`<"@€0@x 0''''''`p"@€0@؁㿀 0''''`x"@€0@㿈 0'''`|"@€0@㿀 0'''''`"@€0@x 0''''''`\"@€0@؁㿈 0'''``"@€0@㿈 0''`"@€0@㿈 0''`4"@€0@㿈 0''`h"@€0@㿈 0'''`"@€0@㿈 0'''`"@€0@x 0?''''`"@؁㿐 0'`T"@€0@㿈 0'''`L"@€0@㿀 0'''''`"@€0@㿈 0''`d"@€0@㿐 ' 0`"@€0@㿐 ' 0` "@€0@$0<HT`lLL0`,` @d$b ;  $`(i$`$ L$`(ڔ ` 2`'h' '```$ {#``$``@u `= `h$`m }$`$a  D$`(\ b`4  Y -bU >d` ! I`d4 B @D =  6d4 ଐ  ? "H 8$ ;&8$`  &Ɣ`В ` @ &@ʐ㿘 P $`" 8 4` > 4*` €   8 " @    8" 8㿘` @?$ @`@Nⓐp`d hl`@8'\ '''?'쀦 '' ''1$  "  I 㿘(`@@ > 4 *  @$@ @ C >@% 㿘 ( `4   2   2  2  `P  $ ` `@ǐ@>Ҕ @$B>@ 㿘 (@0 @ "K&@&` 4?`> X*` €  ( 0&  *2 @ 2 >`@&`&` &`&`&`>`8&` &`$&`(&`,&`0&`4&`H&`L&`P0`( 4?` > t*` €"@` *`$ " %&!@     @T`B  a@ 4`  "&&㿘 (;㿘@"`@#> e! 8! "  @  & 8 am  @2 8㿀   (   ??77 I  V q㿘 ( 㿐#\  "@ܚ `?'D  `h "  D"&@ ("'L'H'P> e@! 'T'\'`'X'dH ҐD"d&@@D \""  ЮجD    ?''''''''`  'D1    ! #$ ` ( "  &@ @ "6&   D "  ॐD "i㿘> 0 Т  ?.W%)&@@ L='ߐ 2&@ 2 &@L 2&@;&@ &?b%㿐\ @``'D'' `> (#ŐDD`ǔ D'DDi' /e*c 1D_'D4 `  ``q Q!@D`8 D!@F `P'DD > ߂D  D`8 뀢@D`? D D > eA;!> eA3!Ѐ' /*?'D' D& "DߔD ߎ㿈`4  " "  ޭ #\,4  ';  B   $@&4@\  㿘@  " > e@ؐ!`8   㿘@p  > e@ɐ" 㿘@f  "  `08 㿘  " @Q  `0("`0H /d * %  H 0 Z 㿘   @) 2 0 @㿘@  "        㿘> eA"  㿘> e@`"0㿘 8! !> e "& 8 "H  8!"㿐`| 8`   $|   ߬ $| $   $  " $ ߐ z$|$ ""` 2`      $    2  $` ` "`  $ ``"   2 I  2 `  2  $` ` = "` 2` 8> e!X { ` 2``     > e!` a `֐ 2` ``` 㿐   |   @> e?"h  2 ) " `!4`      #\c ` ` #` >4`  |` " 㿘  `|` > e?V"x "  !4        S `k `  >4 8  "~@"#      | '\  "  "  `| ' \  8     A`|` ?2`  |@' \   |@2    |`'  \@㿘   A 㿘  `|  /     ? $    "   ? $    2   $`| "㿘 `|   tr  $`|㿘> e@"@ > e @"㿘 |> e "@ " "  "    "     -㿘> e>X"Ȕ|R  2 > H" 8h> X" 8 <`," "`,`42`4 <  "` 2``?"`"2 <h"    2    ?(2 `  <̀  "` 2``?"`"̀Ԅ2ԁ<`` ``"4" ` 2  ?(2`  <<<׌<<<<dt匝㿐`|P``  `$  4`>!t*` €> "̀  ` ?1> ` ,> b,   > ֓, "l@*` $ q , > M? ?  `< ߐ Z@ U > ֑, bl*  $@  (8 $8 (` @?```s0.> "h * > ",`` ?`  > Փ, #t"@*`   ߔ , "> Ւct* @`` h   > e= " 2 > 0  "> e<" 24Ű  > e Z|> bl* * `@  ` 0 6| (` ' `> "h >> Ց*ct" * ` @`3  `h@  +  ? *@ `  ? *`2 @Ƒ* ` 2 ܀ `"3'ܑ:` :` U R* 2` @ ܚ`: >  @?  & 8 |@B܀@@D ??#\#`#d ?|: @"@8 H쀦 "0<9# 㿘    㿈   > e<## 2 `4> 0  "`4> e<#  > e v`|> bl* * ` @  `'0 2 6`| > (h = > Ց*ct" * ` @`3  `h@  +=   ? *@ `  ? *`2 @ߑ* ` 2 = `"= 2=  =쀢 ? <* 2` @ `:  @W  %@ 8  ?Ԛ`@%8 `H.@ g쀦 "0;f#0ݐ 㿘  | 4 ` ` > e*> ֐ bl* `*> Ր" ct* ` @    @ ;?#@㿘 `4 2 `| > ֑* bl* `@    E㿘 >  |bl `(*`  *  ``,   € 㿘 4 IH /d4l* %l  > e 0   0 :P3H 00۠` > e hu l` H 0> e#x0H 0 㿘    F> (! `"> ՟@> Փ, #t"@ *` € 㿘  | 4? o> eے 4     4`  48 ` 4 "`4 `> ֑*`  l* (`@6Mi  ` 8!1 `* l@*` 7 8!2  `    +  8!`  `: 4 8!4 > Փ* t"@*` :-#  㿘  8 "  |`   & 㿘`  8  | `6` |` ` `!``g 0 㿘  8 "  |`    㿘 ? |  > e 2 #;i `>(`  ` "`  `    㿐  |    #\  㿘> e9#㿐  | 2`  `* ``? <` | `: 2`+@ * `@2 |H ? `#* @ ` * ֲ :  |> bl+  * @`| ` 2 | 8 @ "8    "" |"  8$ d $ 8<`` @ ` * **@ 㿘 >  |bl `* * @     |?   @ 2 | `@ 2` `+ * *  㿘> #l> )*`" * "$ @K%> )"$ @s4` <@ѐ@m <* .@ʐ@f * > )2#0Ta@> ), ,'",  !n!m:"`> e#> e# @  *@" `@:* !'4(8D* @4(> )#06(&% * ,  , @Ӓb.(6@㿘 6` &k& g2`**`" " `* * .`@ * @ d@^> )8@@'> )=)> ?" 2` 28   ! "!n!m  `> e#> e#6  ?> f 9  ? : ?*@  ?, @*`" *" * b $4#l4*"@ *`@  &@ d* "*"@ *`@*`@*`&  > f> f8 `> f8  (   > f> f88  ` `+``   " "*@ .*@ ``  > f> f88  ` `+``  *@㿐  ` *? 6*.`  .2 2.@а@ .  . .`@ .@  `   " ."       .`"2  < *`#"@ &  ?> f 8 .@ `2 @ .@   $ &   ?? "? ."?   > f 8 .@  `2 @  .@   $ * 2@ _.@@ ` .@7 5  @  0?,@   @ ?@ "&  " @ "  ~  .@    @? "."(("@   ( ** *  * 2 ? (@((` ? @((` ? @((`   @*((  @* @ 2?[? ?+` (@"@ `P@@ ` K> f8  * @   7` 3 > f8   @   #`  > f8     ?@   `  ?<璂 @a ?a @ ((` *`` 2??P`@?((@  +` `/"<+? `4< `  +` `/$0 ` '*`8+? < `  +` `/" +? `  *`+??<   ( @0`㿘`? " .`` ?` "`."` ` @Ȓ 㿘> ct> )2   ;: @ > )"c< 㿘> 0 @6@)> )'> )#@< * @ "  @2 $2 @2 0   , #@ > )> )$ c@0<(   2$ $2  2 0"   2 @ 2" """@   2   " "㿈> 0 `xc 2``"`@`  &@> < O  & =Ҭ > f8   ̶ <"` $ $ $ $ 8`$ $ $@$ ` "$ 4X "`0` $ ` $ 0`x#@&`@@## 8 "8, h`xc 2$ t`@$ t`D+`$ x !4 r4 j, i4 l4 nX4 p@ 찒 t \)  d )  c, h , i  * @4 j  * @4 l  * @4 n  * @4 p  * @4 r  * @$ t  *`  * * $ x 4`x    *` * $ t h  " 4 t?c @D  > f`X*  $ x#@5Œ0 "`4 U &㿈  P`$2   $  &  r p  h . h 4 `   n     l j i  ?&    ? h`&  0  @ )耢 2y \(є  d`(̔   h * *  i*`  k* j2 *` m* l2 *` o* n2 *` q* p2 *` s* r2 *` w* t2 *` h  {*` h  x2  *` h耊   y*` h耊   x*` 4x#耢@  u* 4x#耢@  t`*r 0㿈` 8`4` `h'  x#@> f`$` 4#`  ` @֔ `x@` d X@ 2@  @@ "  d0w`t?''$`t d@  X@M2@  \@7? ` X?"@  H*        X `6@" *@    `^ d 0C@d``H d@"@$`x` $$``  `   􀢿 @?  X2@$`$`쀢`  x2@ ??@Ð㿘 `8   4 x#@" h5  h " x/ @ 8 d> f2# X@@2@ 2 "  T    @    x    & x $& X 㿘 h I㿘 > cȀ    < > f#Ӊ5 " & ђ =$  㿘>  c   ``< > f#i \   0 `P $`   ?ǘ  , \  암 \`㿘 l@ p) 8"@8 )*  <@@ &2&  l@q'㿀> )c `4 "c'?2`t `t 3' `h + X`x.@ ߰  ` D"2@&  ` @" .@   >2& ɰ  X`x.@ d"@ 8 ' 2&   d''@&@'> )c "c> )#H* `" :g x x2? ( @_ i쀢 ?  Țఒ b耣@  k  x#@ H  *`  * *  ' H ` * ' x/2 x 2 ' x ' x2 ?8'  ' x2@ ??!   X `"  H?*   >& $`|$`0& "$`?$`  |    "(  " " |?  :" 㿐 | )  42$ *@    ? =& |  H W* T2 * T* T* @ C  @"(   6#  8  `< 6 ' H`<%~`H @   & 8 @0t㿐 T 2* $ T  * *@# @   @" T$ T& 㿈 2 > g    > g P1  `P`'6@` ? `s谒 `0)`x#@  H  *  *` *   H ` * /2 23 3 8 & b?`x#"' R#&K耎 H  * /  < / 3`H* 7 `H*`H '* < H@  @ *   *` * +@ 3`H33 * `H * `H *  &`h'耢  㿈`@ P?  0&y@D N?  谒 #v` x?#1 a4\蒎` H   *` < o (` `H3쀠*  H@ *``8'5`0``H*`H*) < H@@  @ *   *` * +@ 3 H33@*` H@ *` H@ *` '@ 􀦠2m  $ h 㿘6` *@` P?*2`%Y `"  "    * @" ?%A 8㿘   2`* `(  "  T & T `?   2'`2'@ 㿐`   q@` : @qbm%s  P`9 @ؒ @$ 4` ,  `  * ?@, $8 ?t: P` " @ 4` @!4` ,  `  * ?@, $8 ?O(` "     X㿈'?%@ ՘耢`?  4谒 "X0{ T6`  $ T* ` * *#  x?#@")o" R@ #@,J x` `H   *` 2  <@ H2 *@  H@ /*` H  ** @  H !*  H@  @ (  *`+@ @ H+ @  * @H6` @*` H@ *` x@ 6@ ?8@ `( P@(l 耢` 㿈P  2  '?," P 2 *P _$T$G@@l 쀢 2x " ? v찒 "x08#@  H@ @  *  *` *   H ` * o 23  2PT4 $T*  * *# P(b 㿐t  4 h > g.h  > )#`"#t ?> )#D"#Dc Ę  `0G 0 2' '?$ ~&@& t 2  $t G     ?$X$T' h  ```X"@`H( ` ' `d  +`` `X . `d`X``  @ "   S ??<  ?2  H ?2 H> g,C  H@ H <$ @& 3?`'`2vt 8 > ' b'  ''?'' * '  ''''$`4" `h 2 $  @ >  > 8 "J@ .2  2 J` .2#  '̒ "`   ` " `' '`  '``2 @2 @Ȁ  @ " ."'Į d'И?`Ȕܰ ȀQ H ``2?'@``': K`@ &  ` +’#'?' @`?  @P  ? '%`(`]]%`,Ȩ  ܒ`'6  P> `' "* @'``2( @"#`0   .> %`,%`((` $ i@$?@`  %`,  * #`x @ @  * @*``@@ @" ̀ "`'# @`x#@``"`@`7` @1#; 㪒 > `t ̀ Ɛ "wİ > Ā `"@ @$`4 0 @-#2  o > `t̀ Bİ > Ā` "(u$佒 p @5 䴐@$̐İ h` W> *@Q$ ? @;`T Ȝ`?> *@+$`t ̀6#"@İ > &"}!>   @  _@$ "@ > " > g  Ё㿀`(`x `4?`d"`X 2@'  ߘ   x ?M 0`X`x*@ &`x`(`X2 谒 쀢 `(`\ `?谒 \`( `\`H @  }d y  h , , i, k, j2 ,  m, l2 ,  o, n2 ,  q, p2 ,  s, r2 ,  w, t2 ,  h` {,  h 2 x2 ,  h  y,  h  x, 4 xc  u, 4 xc  t, `, =l `,? 2&`,`(`\@"䰒 M`(&`(`X2@  谒 A?`d谒 6`(`\H &`(? ͨ 䰒 "  h t'`x#@`@"'쀢  #T㿈 4  Θ  ?`??耢 .H"%> g#> g `" 2耢`@N `@N   H *   0  㿐`h ' 1' h "m `ttf e`44@"`x> g(l!Z #@>`@R9h H` `  > g`@M " `@  `#`x*`  ` `*` * tԀ , `@'Ʈ`'   h ՘?``t`X?" `H(  ``de    2> g)!@ z 㿘` d X  `2 "@ D* ` \*  X `6"  @ ` H" +      ?'  K &  \ H  '㿘 $ 4 㿈`0(?4 &`0  *`?  `\ "*3谒 3` 2/ `\* ) `X?4   ?`Қ谒 0`\H  `"Ġ ("   㿈 4 ``  F D  S `7 5?袒 ( H H@   @L  `ː  㿈 4    22 ?Q耢 u 0#H@ @   @  "` `  ` @ * @[ ѐW  S  x  |  $@@"K   ` @  G  $@2 -  %x$@J `ɐ !ߑ   *@&x  ͔| ( Zx YԖt ` Z   @&&(&$&&, ` 4 " | > `h  "$$ !!`q 9 ࡔ d$@@2 @c  А N& && @&#&!x#@&@pp @=+`p`   &hptG Yt Z`@$  Y@K$ @'tt |  `C 㿐 | 0 Ʒ > "4  ``  ʃ   `$   ?s Ԑ'  ?ߚ   ; 0!# 0 .H$@   * 4` * *` 4` 2,`  *` 4`   *` 4`"  * @$`8  * @4`(  * @4`* $`4,`$ *2  @*2 2   *`   * * $`,  *`   * * $`0 * @$`,$`0` 2-``" 29 `8 25   * @`2. #  $`x$`$`  *`   * * $`8  *`  $`` $`2  `a@2 `0`" `8 ؐ `4$`0`,ܒ$`,`8ؒ`$`8$`<ϐ`xc  " !+  #  $* * `$`@`<@$`H & %* `4$`| `` `<*`a2`  $`H$`@$`D`0 `H@j"`8 `x*` $`t$`L$`P/  ?#  $`x$`$``x/2@`*` $`l`@H`ty``P ?> g!h%$`P`l, 2  ?$`p$``$`\$`d? *@ $`Xt O'`| : `4 2$*   ? 2` |> g Ha@I  2$`|> ga!@I  2$`|%> g!@I  2 $`|#@I  $`|0 "0'`P 4   ?@ ,  <  $`" $`$` 2 |`$ ` $`` ` $` $`h` &b&`  &` |("  |"  "[` `  ?: ` ` "? << ;&b 㿘6` F #b ` |" ڐ `  ?܎  < ;`$*@$`$$b㿐" i  `&@㿘" d &`d 0&`L  >`T@  >`T >`  >`0>`( `O Z!`K Z!taDG | ``@Im  㿘 4 ! ` <2`  l ` @  `` @ 2&`@ݜ ߐ 㿈"'''' h  > 6> g#!cLZ耦` ?` ܟ 2' o 㿐"`` 2& `&  2@  "`$"`㿘"K`  `0`4&& kl l kkl kk> " '  t`2 ( x@e $2`> g""@ G 2U`  ! /'' X't  'l 4'd'pp $  'pҔv Ȑ / `p Δ g p ̔_p ?'pT 2@> (K#T "@> (?#b > g"(㿘 > (-#   㿐 `< /`А *  $  &  r p  h . h 4 `   n     l j i  ?&  㿘 !m` h` 4! `   2@ 22   4   s 㿐` 4  $  $  r p躖 h , h 4 `   n 論    l j裖 i  ?$  $` h`  t2'$` x#@   @ x 2$`  `2   @ X ` H" +   @p  $2@ @ kB $` h !m!$` 4  $` h @$`  !2 @` $``2`  $` $` 4 ` `4$` 4 $`L$`  x <`  r p 4 `   n 觖`, l`< j i $`H`4`8$`<$`@$`,$`0$`H h 2$`D@$`H$`D 4`d$`( 4 x\* <`P4$@ 㿘` *  ?2  ?2  ?2  (?2  L?2  P?2  T?  D? ? ?"`4  2  ?2 $ $?"  , $ u t ,?2`4 4?"4 `4 @ "`4̇ "`4 ` ] ” V`4 `2  4 ,? ,`n 矖  4? 4`r`p痖 `h` ` ,`h$` ?" H`4 @ " R ,   `h  ,`h` $` H?`4 @ " H8  H@@ `h ߐ ,`h` $`D p  `   4 6 h ֐ 0    x 4 X2  8X @ ?\d "@ 8  x " *  +찒 p ?pGX``B & @k ?B2(X2$X x @Y X2`@ (``@L"  #\?#d#` dFd`@9"  d?,= d@"@8 rHރA耦 "n  `P $@   % p   ' 4 ' 4  > g0 耊 "  x =x "8 p  j @ B d " x 0`2  x`@ؤ Q  x 2  (  줐 @':` x '  B  2,`d@ ()`d:``d@ E@`XB B?@?4"@  U  耧` '耊`䀧`  ހ``X?2 ? ? 'Ԑ@``% @k`\   @ 2]`d@E @j@X @b@P4`d2 x@ 8 `d x 4>`d`d@9  '<@H"@@@`X``@1"  Ř ??:`?2`\`?2`\- `"e 0d? |`\ `d @"@  x <  B 4  ' x  @ @H6Ԁ   `d  f ` '  ``X@¬ ب  9܀@ 6 ` 耋 Ԗ?Ԙ  @ b %= x?Ř @2   Ԁ`    E㿘   `?ò   `?㿘   4 ` F  q  n㿘  - d P> >"0' '''P"` $ $2`P> gʐ"X P  #P̰ ̀ c+̀ %ԐTR>    `Ɣ ے h`"   J`.   `  @ @Ȕޒ  $ '̴   ` ` (' /]/Ȓ Ŕ `tt2  $`" "̒ 2`@2> g9"p 2̴   !h M  B` Ɛ W 怦   ۀ  ? $ > g"` \KȀ 2 > g"`F  `(' > gΐ"z` /P p\А  $,$(ٔ   `0`$0$`( `F`X 3  ꏘ  `Z V `\ @$$` ߔB`At 2``> gi"؄?`X?" `H(  ``dİ $ȕ4 `H+ + `x#@t`@" 2+ ;+ :`x#@ 4 24 2+ 5+ + + 4İȔ֗ ڐ ?$> " > g\#> " '  t 4(x@   ?Ts 2`@  X'p'p $  'pҔ̖ Ȑ / `p Δ ⽖ p ̔ⵖp ?'pT ```X " `H(  `d`V H@`d H> " @W H+ T2 + + ̑2 + + ʑ2 + + + Α2 + + ґ2 + + Б2 + `x@ t`@" 2+ ;+ :+ 0̖2 + 1+ .ʑ2 + /+ -+ 2Α2 + 3+ 8ґ2 + 9+ 6Б2 + 7`x@  T+ T+ t+ 4 t+ 5 /T$2> gM# "T /'''t 'lPc T@> (# P   "@ꯔ > (#  > g[#0㿘    ' , " B` @ B=  k  |   \Z㿘  - P `'D>  ?" '` '  `h?`4? ' @’!` `  D %` " 'г2`  N.`D"@"`2 '`t `x#@2a`@]Ȓ @  @'UȀ@ Q`7D3Dȡ4:  A' /> g-> g`xc 2'`@'  /   /@@@9!  /H@@1!  ? 7`@   2D D " &`   $`x`: ' `X@dȚ $`\`d `"@ 8 `x" Ѡ 8  ظ Ę?`Sظ  @"  H  r 2 ?'Ā` Ē㠐 `@'Ĵ?'Ĵ?}?  #`x*`   *` *  0  - +`@  *`  * * 2 ܀``@`X```H" * ̒   @z  H$ : :@ @rB  '/㿐Đ @` N/*?  ? '7`@   Ԁ2&D"? ?  &`ް Ԧ `H D \ ` D `"@""@` %`=``x d @  b DD`8   "@ "> " > gZ#P 㿘  `  <㿘  `  <ڒ`㿘 `Ɛ <㿘   ` 4 "@  2  2"`X @F"    ژ 㿘  `4? `> gʐ#`  @2$   @2 `4 ` X @ "   浘 ??<  ?2&`  ?2  H@ <$ @ ?2`  ?2` H /d * % ؐH 00 | $ D0@ 㿘 > g`#x t  $ ?  2`  "> g> g#ؖ#> g# <> g# 㿐 `  x #\   8 ``4>@( `  " ` $`    `    㿘!#8#ТcC @@ ,ӣ(' @ + 3`3  @@ @ 1 㿘` "$. `". `` ".e `".` ".\ `i`" .U  .    .   h C ny $@$ ` $   o~( `2$ . 7$ & n % @ʖ         "@$ $  !w  2"` w p$" `"`"` 㿘 8  . 8 @R   " > gr#   > h`@f 2"  2&   "@& > ) 㿘?2  @  > #а X `"X""H 㿘? 2 @H /f4 * '   @@ɐH 0 㿘?2  @s  2`  @ H /f * '  X   $ X $ 2:$ $> "6$ $4$ $ "   2:$   > h $> b? > h8扒! # ? #@tH 00W     )$     2 :  %$  $  $ $ $ H 0 V H /f  @;H 0 @1H 0 * '  $ $ @$ H 0㿘O D   H` L P T+B \& \㾈> ?b2   '@`2`= `\ 2`7 2 2 ` ,7 )`l (a@n  ("(@` /H /` * ! a H 0 > hI @ "" 4" " " 4" " " 0㿘? 2 @P `; I  C|@@j@; "v@ "5-"h+fq@- (t@%s@ "$"kbo@ bn@"@ w "p@"k "m@0"{@ "k@"*`Qs@"`H!bv@X  bh@ΐbi@"`w j@"`f@"`l q@6 f "@~x@"5 `<t@"(`@U |@"0 `=O "n@ ">  "o w@";`LA @"`0<  ~@ "( "y@ " "r@ "&8"u"p@"$ @" "}@ ""z@ 0}@"  "w@ "V"g@ "N "m  v@" @>  0"f@"*` "l@ 00"{@l 0H /f * ' ` ``@H 0&& 2ǰ > #   8$` &$`  @H /f * ' H 00 " H /f4 `8* ' `8   ` @o  ,`8H 00{` u@&t "q  n&` j@:e "b  @ 0]@Y#` i> #d@ M$`  I G$` #`` @#&` @>  Od:&&`46&4,`:616/&@ +$`@),`;'&@ #,`<!& ,`= ?$` $` $`D$`L ` $`P  @ $`T& ($`H &㿘" ( ,` 2 @@ 2S H /f* ' & ,& (H 00b5,`  ` '@$ !H /f* ' & ,& (ĐH 00  ,  㿘> )#     0@9K 2 `"`  @( 2 `",    @ !H /f4 * ' @  pH 0 㿘 0M 㿘`A?5 2  @@ - H /f4* '  : "   ?  $ > ""$'\H 0㿘?2  @~@V`?>  #&`8&`<`H /f * ' X "X&`"H 0  㿘 <? @2  `@Q@H /f4 `* ' `   # `2? "& @z H 0㿘 <? @ `2 @#@`& `: " `&    㿘   #>( 0 = $ 0   (@  @Ә`D < 2  2 0㿘#> h 2 `P h@㿘`+  ` @` !#>  0 = & 0   (@x @bh < "` 6` 2 0㿀''7' @6㿀H '''H7' @6h` Ȑ0&` `  `!`&Ԓ`777&` &` ''7'` ``  `?&`6`&` 㿀) d''7' d` @`@  5> 0 = & 0`  (@ @ 2 0㿐    @ 4   $  `2  4 8& 4& & & & & 9  @CՐ$$@""  2" :`& ! $>  b     & & & & $&  & 㿘    &     & & &   Ւ  7㿘 X? "& X  " (ƒ   "   " (  ( " ,  ,  @㿘  ڔ  2> )> h( `# "@"#""" "&""㿘> )# <#>#P-> )>  /%@̢ @ 6 "l > #P"l`@ `0@ 2` `%> )  2 l`h Ɩ  `X  2 & D㿐`-    -0%1> #И'գ 2􀢠> #Ԁ 4 > #Ԙ'Ր " 4&#  > )"  h2l2h 㿘   t 2  > )& h & l l"`p"& p㿘 l`" p p"`p p? l"& l& pݒ 㿘 > )  c  "&@ 2`"`@@  ,`    "`&@㿘 ` ,> )#`    2 2  H /f * ' H 0 (\4Pdl@ X8D|hp 4<\L " 9"@ @: `  " * ( (/  "-    " "  * ( (  * ( (   * ( (  " "@ @: `  " *  "  "  *  H@ @  %?? `># h*` €  A2  p`  J2    Z2 ` Q "  :H  @@ 2ذ  9@ @ , *  *`   @@ 2  i@ @ *`  @ 2 `  "  : z x@   2 `  "  :  `a,`@ ],`[ Y  * U * Q * M$ * I$-  () '  *# !  2   "  (  *    2  "  * $`0  ,4  $ հ  @     , 4  2 *`*'>#0(@"> k   0r"g`  0ji > WV^ @"O`"J D 0MA0 0H"=pP7 0@4= 1.+ 2  0  0$@  0  0       **` `?`" 2 2<" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @ː  &` &`&` &@`6$ $$@  㿘  @ &  㿘 @   "  20   " " "     2 0   " "  `㿐> )> h `p##\  % !> !>/ᥒ`P@!㿘>    >  "c '> />  3> h-5> %> > c  />  3> h!5> %*`?# > h "  #c h@*`   6 X @&7&  $@ ** @6* " *  `   % * Ӕ `    $& & @ Ւ`*`" ! 2!> #&!!&!0 &!`&!&!&!@x@ 㿘!䀢  0@? 0@* i@`( ``,`   ((,( , 0 X>  i+` h2 , , , 4 #$&!>. $$ $,  *@ 㿘 X> `*  H o *@ g  @ &!H 0㿘H /f4> * '>   @  H 0㿘H /f * ' !@n > %#0  ,`" @*`$@   2 ,H 0㿘@?>  ` &   "` ""  & 㿘@( h   >   h 2  2  > & ` ` & `""` & &  "$ `w㿘&  &     & $> h " "    & (> h " "    & ,> h " "㿘> !̀`> h`@C !`8 ! * ` \$ ` "! `"  "`> "  ? "& &  ` ?& `!@0  & `& > `` & `""`> *Ho  "`> *@`㿘H /f * ' >  ? `"`$` "@"" ` ?"`@ 2 H 0㿘H /f   \@x  X* '  \>3 {>3>3 # ,6 \&!&!&!  h 2 H@ H " T@y T  h @! "!E!! !@@ۧ@U@9> a@> <a@> `@ `"  "`> "  ? "& &  ` "  `"  "`> "  ? "& &   2'> > < d?@ 1 `2 X 0` 4"`4$ 4 0"@$ 4$ 0 X*  "  $  ?@ܐ $   ڐ @Ґ `2@ X* "`  X* ` G?"`  X * "  $ (   , > %#0 ! 0"  * @`" €  2 0@p  X> `* "H 0㿘@  ` "&@$`` "&`` &`_"` &` 2㿐@S  @Y   €  @M @ 㿘@7 0 @; 2`)  2 \$ - "`H /f * ' @kH 0`@`@ `@㿘$  L  А 8 ;$ 8L 4`4 > 0> L  ? > # &`@ 2 @, 2 `& L !   /А  *`: %@ʒ @,` * , ?Г:`$ L  `2&@> "  " > )㬄 㬒@"`` `?@""@"`> )#"#㿀> )c> "  '`&#     4 > #?`  @Q   @,&  "  > hz Ё㿘    ה   & >-`4,> c`@D d* 㿘  & xؒ @'@'> #   㿘@>  `"' a@2``\ "`` "`   2   `"   @+I    2``2a@ 㿘  @ΐ   >   > >  . @ >  =@>  8!@20  `", @ 2#```` @@ @   @`* `" `@W` "```2@  2!@㿘@w>   @ 2 "  @   22@ 㿘 `" H ` "D `2; "  " `\ " @* . `"&  @* 2  0"  ``   @   @`  @  2㿘 ,`@ ( `$`     $ `@` ?@ &`@"` &`@  >. p> b'H /f4> * '>   %  \ " @" \! ?`4 \7!  2 \H 0 > h 㿘> !̀`> h`@  \ ؒ @66 \  " !Z   2! " !!А!   T`" T` &!&!"`!?&!`" T\ ! " H@̐ H @4@@1㿘> !̀`> h`@  \ ؒ`@6y6 \ T " H@ H @@ ` @@ [3㿘@@ ( 㿘\  & && 㿘H /f4> * '>   T Z   Z*` 4 Z!`" @  2T ZH 0> #`㿘>  "  0@) 2   0 (> "0'@ $@ @!@;  az@>ay@ ;00 !@ $!0!x@0,@0(B b !z@Ng{ w@Ds@o$ kb@f  _ !F@`\K a@!a2@a1@a@oa@ a@ aI@{a@"c`l a@ِa@Ɛa@ a@  !@ "3!'a@B "!F0a@\&a@"Oa@"6 !Ja@">`p aH@ aG@8a5@0x a~@".`lr a@"a@a@"u aa@"Iab a@"`b\ 0 !@a0 !6@ 0!K@"aJ &&`h~ i 2b`\  H /f * ' H 0 "`\`\ 2`\H /f * ' @H 0`\?bR! a K4`\F`\ 2cb "```` 2``H /f * ' @H 0``  `\ `$``H /f * ' @H 0 `` H /f * ' ``>a `$``$a$aH 0 `` " 2H /f * ' ``a ?$``$a$aH 0 `` *` :` @R$```\ b$`p ba[`l@@j`\t baFaD @@'* @^ b @  2z`\aD  @@'"@' @o`\ k @ f @'v [2 yb  2N`\@a@}G4aE& 2cb 8^ 9,a7& Ub 8Q @~  @ Gb@c@U@2= a@@"GaH /f * ' @@ɐ@w@[```  '$``> < d? `  0` 4"`4$ 4 0"@$ 4$ 0@p$  ?@3$  2H 0a b $a@ b@ ba`\@f ba@ b0t b`X> `*    "  2  " `h    bx   bx 2 bx  ` ~ a " @T`\  p -! "$ ! "8!! " 0a"a"a "a! a a" a%  2  .a# ` 0a a "  `\aa2`\6`\  b@2b``` b`\ H /f * ' @wH 0b > hP!p> "@'! >  0    !  `  2 &@\ >  >`;` 0!   P  7  E x ` $m  2 f`  @ 2  ̀  В 0  `@ߘ C "@"&@ > hÐ!㿘!` ` &!&!"`!?&!`W ! 㿘 ,   @%7  & & & #& > c` $& $& (""` 㿘N@ " @xJ?`/$  @qJ?`94 M `  @@$͒ "D ``2@  ɔ   7    > # @$ 2 $ 2  2  s p   $ $@$$ $ "@$ $` `$` "&  㿘   @$~ 2  2 P ` "`&  ? "$ $  "2"`""`"` ?"""  `? "` $`" ( ("`(> "#?`(`$""`(" $   㿀>   b'``")   & ``2     ` `@f @ @$;   ``   > hً!㿀> "> c' @#ݒ 2 $ 2 0    "*   &  2 !     @  `0@#      > h?! 㿘> # @# 2 $   $` 㿘> # @# 2 $ 2   @`(  `$ ! `!!@`2` 㿘 ``!> 0&  #`!@ ` @T !@#   `@ `!@"  @`> "> c''>  > ha8@#  2 $     #> h a8 2  @n  //@ x#> h < "a8@Ւ 2 <x5 @Ȕ "#> h < "a8@ 2 <" > hs!@ p> "'`" @ \`2 @ 2  & @a 6 \? & @ \ > 6 \   \ !a7а" > h@!X㿘\`      -0  -0    㿘@ ` 2&`  &` `"``& &  &` `&` "@& @@O \ ` @E㿘```"`& `?`"&`&`@@V \ ` @L㿘`@E` @> h!hj`@㿘``&``@! 㿘> ) (#$ $ @$ 5> $ 첒   2 `$ 0` 2`&`xؐ@I @> ''#    2  2   `> )Ր> )$`> )#㿐> #Y?3.%> h  ```"    @'@r  @ y > h !s`0  2 `p> b'H /f * '  \ `*  ! 7 6 \a \ ! 76 \a  " ` "    2 @R  2 ` >  ؀`@ @`@Ē @  @ @鵒    \! 7a6 \H 0" > h֩!,t,,,,,,,,,,,,,,,,,,,,,,,,,,,,(㿘 a2  a1 a "  a2 -$ 8("l R\ @ @ϒ@K 㿀(@ a@ @  (@`0> ha@! `h   2 `\" \ `k ( \a@א "  \ 2  \@$z T A A`\ A Ai 2"94  `(@  8?$84 "4h " 04  @0 @a@$h "@ A4 "`> #@ :1 A/ @ `!v>7#*` €@ "  `!(`\((`;  (沔 Sږ (W7@0 *!"J7怤" A``   3  2 A  0 `@x 2`ְ ϰ A # " H7 G7      7> h"`0  /`@$ S   ?    "xޔ " `H h 2`H@x`H +   Z9  `H @C  2 2  Y   c 7`H Y @m [H /f4a* 'a   aȒa aa@&$R4  7a 2" $aa$a $a "`a $a" `H 00!@ <B @<` @ B = b``B <`H 00Q㿘P !@ &(` TS  h`А@,  h "` \`@ 2h>   ` @"`  2` `  @  >  @  !"6 `B <  `B >   B<   B> > * ` `  7ĒHo  "` ,` 2`!@" @2  H@ u H "`?# @ 6@nÒ b 2 Г,`  2`!@" @2  T АBQ;< 0I " h  ` `@wi < h  #  @wM ? @6  #  \!"x \!"x@ޔ  H /f * ' !"ݓ4`@"T4"h"1 \4 h 0 5@> 0G@H@yd@ c@ HHo  "`> *@sv`> <! Ho  "`> *@s_`> ! \ @̐0@Ho  "`> *@sD`>  # u Q  ה "4` c@> > "а"Ho  "`> *> y Ho  "`> *@s`C  94`6 @ 1  ` -*@"@( "R & && P  2@2`2`2`2`2` 2 ` 2 P0P0!  @  `P &   <0 &  2" & &  & H 0> > ( :  0 *@ `  *@`*@`> *"㿘   ."x."y."z> "> `?."{X`#"@7:`."}."|㿘"x >8ݐ>8!8  ` %. i. j&!. h& l&!8!"x  i` &" D Ζ 㿘"?`""`"@"" a 7"2 > h @  (@2 (@2      > h> hp` 2 ` @2`(@* @ 2(@*   㿘ǐ?㿘א?㿘  "    H /"  D /x ; 2  >  @n > 0 H ^.@.`.`  .` .` #.`  3 2.`  2.`  2 .`>  PK >   X.`.@ .` .` .` .`:  㿈H o *@ g     H 00c 耊 2 bH 0V  @  2  @  2      & H 08  7   H 0* 7ޔ  ڔ  & & b & b "`&bb& b`&b@F  b &bH 0 4㿈H o *@ g    " bH 00K @  2  @  2  2  H 01 ?  & H 0%  `"  "` ? "& &  7b&b@ޔ  b?&bH 0 4ttttttttt4ttLxxxxxhhttttddt$DD0||Lx0 H` Hx H!!"("("H#####0#0#0#0#0#l|llllllllllnlnxnnnnnnoopp pp$p0p<pHpTppppp㿈 \  `"  @ C n> &"`> i`   0  Ț`C B> ML> 0!@&`("` `  / O/  //`O ` ` : P 2 > i`8 ٔ 0  ȖB`B > U>  "" 0  "  > i `X  0      W@ "s"40`W"v" !`!"O""̀@"B""̔ #@ "0"4"# !@%> h"̀@"+""̀ "0  &"`!  @4  > i `   q 0 В`B c> А"@0v t@0p n@ 0j h> h"@0b 2 \> *Ho  "`> *@o;`> <!&"Ā F> h#8@l0@ 2w \> *@Ho  "`> *@o`>  ^&"" 2  > i `  M   5@"4!h> * А"݀@ > * В`B 0> @L;0sHo  "`> *@n`> <#!@Ho  "`> *@n`>  > i a    0  \ `" H /f * ' `` @&&`` $`H 0 > iaX  0` 2  ` 2" $@`$` $`H 0 㿐`(@/ !@@  `(@( 0> i!@!xH /f * ' m \`&"@@ KH 0: 22`@6 \H 0> h"@H /f * '  2G"`   `  *  ( :"" 2" K[H 0  1 "@6"  2"x >  ``* @ " "x  *` 2""x" 2) K  2" \ > ia Ԕ 0 `B > H 0 7 ` --   -- " "0"(  "  ! !""Ԡ W 2 2` J `B > H 0 /`  KW  2` \ > ia  0 `B > H 0h 725 `!  @ !`J&!"0 70/&` 2" $$ $$ !Ȑ! !!@&&`J  7! 2" &!!&! &! " \! &!" \ `B > H 0$2"!@" B> H 0 㿘#> b 2 b!> >Wa"ȿ "ɀ b> h"&" >? $b 2c >  p. h&!&"&$&$&!&"6"6"&"&"&"&"&"Ȣ ##,``ȗ` >Vaȏ@8@ @ @S@8㿘> " "" "" 2"""@ #> Ʉ"##  z# "#ǒ # "$ $ "$ $  㿘!  !!В  ""x"x"!` ` &!&!"`!?&!`I !@S@QH4"x("x  "!`?H 㿘H /f  "S K!€ F* ' "    &"&"$ "?&" 0@ ̐ 2"x" '"x    &"x&"|$ "?&" !܀ Ɛ!! 2!!    &!&!$ !?&!H 0㿘H /f  "!& €!!* ' "`"Ȁ ""x" "x` !܀ 2ߒ ! 2!!H 0 㿘H / * '  2@ 1@@ @#x @"  \r  !@m 9@e@"M`c 0:@W~@"R lY А \ @`? \@  `? @  ?Ȑ*6 \32" "  > h"ğ@ ` \" @`(6 \> h"@0"  \ ?6 \`#@(& lH 0  "`@@H 0㿀` \  `> ia 0 0Z ``> i#\` b#``#d` #h@ 0`@E 7 ?> i"X4 00:6"`"@&"" > i bҔ 0 \ 6"@"" /6"&" \@  6" > ib 0ﴐ 0  @)􀢠@ 㿀 \ ia E  Q   $ $ $ `52 *<"*c# # 3 W`3 3 ?2 #\ > i#` b#d   0t ""@ "!`&"G&!  $ " 2" &""&" &" \$ !@   "  B> 㿐 \" `   /  "@2  8  E  j, 2  @' ' ' "  2 `  2 **   2.@.``6``㲔,@ӑ2 @@``> i#\bЖ  0`"> i`@> iJ"""@"!`&!G6&"  `B  > ' " 2" &""&" &" \$ !@   "  B> 㿈`\` k> i c`0 0c  b̓*`@1 @P #\> i c(#` `0`*`2`@> i"@4 ?` ">=#̓*` €`4  (> i #PΒ`0"`b̑* @   4   ? *  `>=#*` €      @w0c(b"   @k 8 6@c > i cx ,`0| ( b `    > i #l`0`b̑*@`>=#*` € `c(b" @. 0 @% F 8c(b" @ > i cx `04 ( b   > i #(`0|` ` 2   $  b̑*@`d >=#p*` €cb([" R @ؔ  8 b̑*@`G >=#P*` €@Ĕ > i c 퍔`0   ? 00(b"@@  ,@瀤 b̑* `>=#0*` €@  4@  4 @ ,@ 8€0`   > icА I`0`>  p @b     p+  2 `" *`@ʐ `` `*`@ > i#  `0 + -, 2 `#\`> j (#` > i#dc`"   `* `2 I`* `>=#*` €@ 00 !@x00 !q b̑* `  y> j 0!`0u``4 r> jB X * * *` c  2`> i b첔`0> h"ğ@0X,c, c2 , c, > j `0+  3 O 0@0 !@& c@23`` 1> j `0Ԕ0+> j Β`0 * * *`  c 26b0> j ! `췒`0b&b  ``B >`㿘`\ b *` @ˠ`0> j a(C  b̕* @  "c0@d 0 b"@ @]  8@㿘`\ b *` @`0> j a8  b̑* ` >=#*` €@6 0@1  0@0 @) 0@$  ,@㿘`\ b *` @g`0> j aPߐ  b̖* @` >> *` €@   0c * b"@@  8@0@ 㿘`\ b *` @0`0> j ah먐  b̖* @` A>> @*` €@Ɣ   4@ 00@ 0+@  bc* "b &b  1  ,@0 c* b"@b  &b   @ 㿘 b+  c"@ $ +  , #c@ 㿘`\ H o *@ g bb `0*`@  *`@ > j a(  *`@ ?  $@  *  "  0;: @= * 4@8 % 4@4 ! 4 * `#>> h*` €b &b   0@  8@0 8@H 0㿘`\ b * @" @G`0@D> j a껐  b̑*  "@>> |. € *` * #@0  * @*`@c$ ?> `  l  "#"#"#"#"#"#"""""#"#"#㿐 \"` H /` * !  . kH 00D l &#&#&#6"&#d#&#  \&"'&"Ā > ja T 0 \"̐ @`6 \ ""> jꛐ!"!> h "&"`€" !> h> jꋐ! ""̀ !> h"@ 6 \€"ג㿘 \"` H /` * !  . k垐H 00*> h"ߒ \ @ > ja  0 "> jb  0"̀ b @" \ &"]6 \㿘# #  ?&#"> h &""㿘> h"㿘> h"{㿘 \   | > jb8 驔 0p !> j%> j ` Œ c?" @@ @P @ "   0A >  ` C0  ` ;0 4 `"- `齐"X) `0 `*@ *`2`"#@2 # ` > j驐"h `# 2 " > j鞐" `  &"> j镐" `ސ `@ `% @> j邐"-0`!3 ۔  > j> ju!؀> jb  0` 9> j" @@+ @]"P @ "3 `  "L ` `S 2~ ` ` `*  `*` * ` #  t> j"; p `> j5""# 6"8 222,`,`,`W,`  `  `  ` M> j"J `> j",`,`,`9,` `*  :&#> j#6 ` ` `* * #2 @" #@d#@a> j##2 ,`#,`0"#@2 ` ` " > jՐ#( ,` ` `@ `% @ ` a%"#Đ  &"> j赐#8-0`!3  > j訐#h-0`!3  > j虐#x&"6".0`!3  d `?㿘 \ > jc * 0B`> h"#> j` @> "@@8@jbP@ ""  " ##`2!`#&# ?&# ?&#  #  > jJ## ? &#> jB#@`&Ų@ > j5!؁㿘 \ > jc ֔ 0l`%> j` lj`"@@@P@ "L`  -O`2M`# HG` 2E&``*`* `@*`@ #@ 8@ `> j#',&#*&#> j#&`$` 2"&```,  > k Ւ"?("@(8(#&#  &#"> h> jŐ#> h"ğ@`&@`> j緐!؁㿘 \@   > ⼐ \ > ib P 0>  p , @ `"  @  , #  " "  &"@o>  p , @ `"  @  , "Ȁ >  p , @ `"  @  , >  p  #"  ,  `2  @  ,`$,"""ȟ€"Ȁ @㿘 &"@#  )> # p,@ ` 2 ` @@@,㿘 &"@$ `@㿘&"@$$`@㿀> "# ' #  &&# / , # 2 2 2 , , , #, #  ,   , # 2 , # ,  #  #,  *0 2`"#@   , *2 ,  0, b#2    ,  "+  &"."0`!3  b > kK > #p   *`  ``* 㿘"Ȁ   > h"ğ@"#"#"#́""Н㿘> h"В㿘> h"㿘> h"&㿘> h"V㿘> h"㿐 \   Y   > k`   0`6 !> j `   ?" @@ @'"P @  `  > j"X `> j" `[ `@ `$Ϣ@`> j"-` ``!3  > j!#̀ #' @  > k`8 厔 0^  [`7> k" @@ @ϐX @ 2> ` ` `*` `* @* `@ @ #̀  " #@> k寐 `#' &#"&#Ԁ > k塐 p @r> k噐 ,`,`2 ,`,` `ِ `@ `$@ ` ``#̀ ` 2 2  2 ------ > kf `> j_#h-` ``!3  > kP . ``!3   `?㿘 \ > k`Ȑ  0`#> j`  "@@ @%bP@ 2`#Ȑ ?&#`&@ > j!؁㿘 \ > k` 䵔 0@`%> j` @>`"@@ @P@ *`' 2%&```* `*`#Ȑ `*  &#@ > kؐ #̀  `> kА!#&#ؐ &#`&Ų@`> j!؁㿐@ #̐ `  ` #' ` #'@ ,㿐#&# \ ? `&#̐&#Ԓ@    > ka 0: 0  ##Ȑ `&#&# 2##̐ &## &#㿘#̀ "#@ X# &#x> "#Ș ' #̀ #'ܒܔ @|  / *ܚ *ܘ *ܑ2 **"  &"."`! " > kِ!@"#"#"#""ԝ㿘> h#8㿘> h#8p> "#  \ ' &#@ E 2#䀢 2#耢 2#쀢 2 # > kaP 0㤐  b> h#ܒ`&#&#ܐ#8b > k!x㿘> h#8Ӓ㿘> h#8<`> "\ '  є  $ > ka d0  C ` @ +> k | ?" @@ @㚐a @   `    > k㆐! `> k【! `ɐ ` `$@ ` 2ǐ > ji".   `W3  ƚ> jZ!ؐ @ > kaȐ 0| ` y ;> k" @@ T @;a @ 2[ `  `??Р{  @Д`?   Ԁ  <؀ ܀`?< 7Ѐ`8 @lР@ Y > k!- `'`  ,`,`,`,`,`,`,` ,` @ג 9 " `@lŐР@ 4> k!ߒ `( ` `$@ `  ` .@  > k!.  `W3   `@ @l> k"⪒.   `W3 w `?> " > k:" 㿘 \ > kb0 4 0$`` ! #> k   "@@ @ra@ 2`#ܐ ?&#`&@` 2 > j]!؁p> " \' > kbH  0Y`'> j` XV`"@@ T@;P@ B` ? 2=&  ??ؖ<‐7Р`q #܀` &#@k> k"`# @@ܔ   `"> k"x@@`> k"# &#`&@`> j!" > k"#"#㿘# J&#p#> #ܘ b 'Д @  / , ؒ   "  &"."`W b > kQ">  \" '``4 ` > kb 0B `@4@ ê`   0]  0z $@@ 0 0 @"#> k`b 0 0 @"#`> k`c   ,@ 2`> kX#H@ > iR"@p?` @pK@##@pE@pA@pn# @/# ` #d> h#\#h#`#Ē#l @@< > kc` Δ 0`$ > j> k#x*``@ ͓2`> j!ؑH /f * ' "0# ?b# &"# #  H 0 H 0 @ > kc 0 ` > kې#x*``@ 2`> jӐ!> kc 0y  $@@ 0 0 @C"#> k`c`c `*``@ P2`> iଐ"`"䀢  > kc 0L @9$ > l$@a > l 0` : ,2`@ @> l @@"$* $@ 72`> j}!؀ "@"ܠ@0@"#``> l#\ 0`P ,@ 2`> ka#H@> i[" i> l` 0  b@o;` @oG@$$@oA$ @o=@oj@y  !> h`> l#Ē`#\ @? # ,"܀   `> h> l#Ě`#\ @, "܀ &!> h#Ē # (@@1"`@> l``#\ 0ߦ `*``@2`> i" > l! ""܁"# 㿘#0"#@#  !> h# 8@#&" 㿘b܀ > h# 㿘 \ H o *@ g   "@ڠ 0> l"a R "? &""܀ !> h# ,@p 0"܀   #&"!> h# 8@^ H 0㿘 \ ##  &"- !!,#p`"Ȁ  0> l!X> l!h> l aH# > l> l!pR0O!H /f * ' #" ` &#H 0 0 H 0 "Ȁ @N㿘 \ > la ͔ 0#p#> h ?&#bğ€x$ " #`/."@&"" #d#> h#\#h#`#Ē#l  @㿀 \`  "> laȔ 0ޖ 0``4@    0׀ 0` ?@ `$@ 0 0 @E #> l`a`e *``@R2`> iޮ"0!a@"ؠ@0@) #``> l#\ 0b(G ,`2`@M> lޓ"X@G> iލ"a a4/$@P   $@I  /`> l` !> h#\#`##d  @#" ,"؀    /`> l`Ȕ > h#\#`##d  @g"؀ !> h#% # (@0wȐ# > lbh  0 N@`" > j> k2#x,``@2`> j+!ؑH /f * ' "0# ?`# &"#  #  H 0 0 lbx 0ݤ  N@`> k#x,``@2`> j!0> lb 0ݏ 0> l`b` 0 ݅ *``@r2`> iΐ" ""؁"#㿘#0 #@2 ## > h#&"# #0 #@> h#@##㿘b؀ > h#| 㿘 \ H o *@ g   "@ 0> l"bД1 "? &""؀ !> h# ,@O 0 "؀ > h#F H 0㿘 \ > lb  0> h#@㿘 \#  &"> h#> icx  0H /f * ' #" ` &#H 0 0 H 0 @I㿘 \ > lc Ȕ 0#X##> h ?&#bğ€p"#`."@&"/@##" # > h#\;`#h#l#p#/#t  @㿀`\  'X'T2  |'`b  `2` `  **  2  ,, T  X "@@:2` '`'` `4  @/  > i b#\ M`0`,`@;2`> iܗ"bb@ba`&a4&b` `B >`4{0'`b 2" &bb&b &b`\$`a@` `b` B>`㿘4X  & && 㿈H /f * ' U> " a> h""`"Y" \ @T``"Ȁ N`2 """ 4"D4" (""" 2"> lc  0ɐ `@4" $$`")"@%"  4""  "` $"" ""Ȁ 0"# ' $",#`!  P" 2"H 0> "          2    "   `"   22"`2"@㿘 < @ 0   @  4    㿘 @~]   `%>X l #" `p> " \   '     ` 2 `  C A' ' ' '@'`'`'` @e'܀`2'䀦'` &#$@$`$`$`  @Q  $Q   > lc@ 0Ր  > lÐ#xx> #̤"'#'ܒ 2     0  ` 2 `  % #' ' ' @'#̀ 2'#̀ #$` @  $ B > lt#p> "'@, Т@(      F ` 2 ` ? ? 2  4"       ܔ  ֔       ο ι `γ  > l#p>  " ' ` 2`"`? ? 2`@'`'` '` '`'`'`v' $E " > lŐ#x> "' H ؒ `Sz/߀  ۀ 88 ې @ /`/@ b > l#؁㿐`  ` "@",  @A 8@  R "@ L  v֐$8$$0 #@ $@ $@ `͔$8 +0-"v "@##@ "@4 `4 `  >`0` 2`` @Ҕ!`̤" x_  x[  㿐`̍  ""   "@"  8@  0"@ ~   vg$8`g$8 0m"v[ "@##`T" x [  0#@ #@x K * 24@` "`w ` "w @ $@R 04`,@   v@F` "$`w֒ $`  ,@   u@/` "$`w $`w  㿘 &"@>  p , @ `"  @  , >  p  # ,  `"  @  ,`(㿘 ` (>> *` €1> l'#1> m$ 1> m! 1> m 1> m 01> m @1> m P1> m `1> m p1> m  1> m  1> > m" ٠ " 㿘. 06 `# b#4`"1> m `   ` 1> m( & 1> m# 1> m  А` 1> m1>  1> m 1>  1> m    1> > m"0Z "0㿘 ?`>> Г*` €1> m 1> m 1> m!1> m!1> m!(1> m !01> m !@1> > m"@ / "@㿘 "1> m  1> m 1> 1> m1>  !P !` !p> m"P  "P㿘  1> m1> 1> m !x !`> m"`  "` %>>* > m!> m!> m!> m!> m!> m!> m !> m !> m!> m!> m! >>* > m"> m "> m "> m"(> m"8> m!㿘. 06 `!"1> h `#  !*1>  b# * 1> "1> h#01> h #1> i  > m"p2؄ "p㿘> m"@[ .`  !> m"HR *`  㿘?.`#`@#> m!> m ^ 9bP `4"X*  @㿐 6 6 !> #\> m6 ` `"? "㿘 \  "k 0> mbpֺ "Ȁ    k . kH /` * ! /H 0㿘!>  @ Ͼ 㿘"x s > m3  `0 ?>^>]a 0ఘ  $`l4`\$a$a,`h,`j$@,`ia $a>^`x` $a!> *$ x x 0`D ܖ  㿘> * x " ͢uv  㿘` > m" D  \  ò &`41 @" .s4ϰ ̰ 3ʰ A `B < `  ; @ !B < !܀ "K!>^ x@2E .͔  2 7`"H /f4!* '!   !Ȓ! !!@&&`.+  7! 2" $!!$! $! "!! $!!@H 00n ">  ! > m 0 > m  0> <!    > y  "-N /H /f * '  @`-"H 02 7&` 2" "" " > ** Ho  "`> *@Pf` B< `  ; B< H 0 㿘> * H /f  !d "!€ * ' !܀ !! 2!!` ` &!&!$`!?&!H 0`p`@/В  "` ! > m"> m"> <! >  @4``  > y  >-E0JH /f * '  @ `-0"H 00/$` 2" "" " * Ho  $`> *@O` `B > `  @ ; B > H 00_` "`\ 2@  1@ @"  \ @" A2 \>^""  /  /" l "  " " " "" " 㿘  qД  2"`> m""` "`"@ "`"& 㿘 `` ``㿘@ 2 & > m8 Ն#``@ 2&  Ė @~ 2& > m#8㿘 2 `/-0!50 !6""` a `@^ ` @2&2&N &&@ F&C& 6> ` `&`&`&`&`€  ` $.  q4   *$@*`$. 2 r &` 㿘 8 @  > m<  2 cP  ޗ2㿘 ?2 @2 $ & "@"" r 逦>   @2` @  㿘> *" |> ̅#㿘#a p 2 H > m $"xԺ 0?>d>a`"!(  2 $ l4 \, h$!$!$!$"$! $!ɲat  H /f * ' > * |ယ |$"$# |H 0 㿘" ( H /f* '   "  ? "$ $ H 0 1r  㿘" 2" ).  $"  *7(" ""x < 2 ""x> m# \  4 \"H < $"<`$"@>$"㿘>`0`} \`l > *V  | Q!`H" 2H  "G 7&`&"`Ē :> xH /e * & `t$ &`tH 0В H /e4`L* &`L"Q &"`` @ #&"Ȑ#x" 0&"&"ȑH 0 2" 㿘 ܀`'. lH /e * & K$b& *vbb$b $b$b $b H"ېbȐ"bđH 0X@ ?x "㿈> m`0B#*I`а /`B <`@m`(!@@" b`(@m 0> m!@#*b`2`t*- 2 2 `\` @2`\*! A@ ` * 4H /e4b* &b$ b H@ Kax@ @ " '`" 'Вb@ ? bb`@Z$bH /f4a* 'a aȐa aa@&&`)Ȑ  7a 2" $aa$a $a a $a H 0``B <`H /e4* &!xJ@b`H $b@  H 0 X> " ܬ ' H   П@ H 4ꀤ L H" "QH /f4|* '|     $|$% ℐ?$℀ "`B <  ᠟€  ἀ 2᠀    $$% ᨐ?$ᨑH 0 !t` HȬ  t@  %\@  ̐@~   @*%t   / Q  xJ H G ఐ B<">  @@6@ @ @```@@ $@# "ఖ < B<ఀ@ "`  @ ` ݐ "U "#0`B <(f 2  "C " #o"; ࠖB<`B B<< > n8 (㿘b &  $b  '(b`  `H`<b@$b$ $ $ $ (i $b 㿀> %#> `ܒ`B  ;#' 6?2 "`t 2  ` @2 " &$" ` \B '< 2!$"" > " @6$"" @"  $"$"" > $"   ܀ """ 2"" 2Ұ "" 2̰ "$"  ?$"""" `!t` A " @ @*  p 2 \ O*@ \#@ "@~͖"̲ 0@ p2 `'" p@~"̲ $  \4 \6 !@& (at ' (-   *Ð H /f * ' at  H 0)  B!x< HH /f * ' > <!`` @``&`  ȖB`C < 'e< ` "Ș0& ` 2" "`"` "`> *Ho  "`> *@I`H 0"""@`*@$"$"" $" `B < "`< $"$"$" > nʐ 0㿘H /f * '  a2@ a1@a @a@"9 0!{@2  `2- / \ )6 \ `"# /  /@N 0`&`$ `$ `$ b$ b$ b$ b$ b$ b$ $b$ (b$ ,H 0,,,,,,,,,,h㿘> *" > dž (㿘# k 2 J > n@ $"ϼ 0> c?>h>h>o |̘!%ܚ  $ l4 \, h, j$!$!$!$"$!$"$"$! $!ĭ#  H /f * ' > *`$##"c$#"H 0  㿘" % H /f * ' #`"##"c#?#"$#$#H 0 4m  㿘> *  ""# 2"` " 2# %& $$"4"# $"@s$"" k  $#L@{@# $#($#0" "? 6"> #$#$#4$"$#8㿘> !̀`> n`H@H ȩ \&" ?6 \&"""" &"&"""?&"""% """ &"&"""А?&"Ѐ""% "Ȁ"" &"&"""?&"耢" "% " %&""2" %&"@#@&#( �lc &#@&#<#H "#Ll[ &#H&#D#L lS &#Lp> " Q'@$ S@ "b8  Z N@"@3?@ "4b V@,? J@{? `G@ `F@R@RY@?  M@`K0 L@&?b&b&&x'  @H /`4b* !b @ @@H /f4b* 'b<?c $bH 0~ w y> $@(p4bo l&w icL e H /` * ! cL@z H 0N w’ I 8D$bw A 8   5р  >  `  2|  = H /`4c(* !c(  c$@$c$€  $c(b@@> n X[`0 7H /f4b* 'b* $bH 0H /`4c0* !c0  c, @$c,€  $c0b@@> n p `0 7H /f4b* 'b* $bH 0 b@@|> nА Ғ`0   ! 0 L@c &w c @ H /` * !  *`" @b@H 0b H /` * ! > cc4"&c8" &H 0G "*    h j{ 2J   jp &    G@cDc<H /f * ' ""H 0 jM    > n 㿘H /f * '  2@ 1@1@") @"!n @" \h 0!z@ "P!{@"[ @V  @S ?Q6 \  `  `I$ l"F / B@ /@ 8#&#&`# &`#&` #&`#&`#L - &`#L` &`#L`&` #L`&`$#L`&`(#L`&`,#L` &`0#L`$&`4@U 8#( "#0#$`€#0 #,`4€,H 0㿘b "  2\ @>   2@f%`(@@" ``(@f0> n@ ˡ`?Ȗ*@6`> n`  c ` !6` , !ˀ0ΰ /ɰ 23 "  2` 7< * * ** ``2b> nԐ!(@`> n!PY0@א 2!c` *@c@  ז 2cH cH ˖ "`> #$c4`*c - H /`* ! c`"&`Z$c`@ ab @& &` `""0 7&` 2" "" "$ aȐa aa@&&`!  7a 2" $aa$a $a "ba $a "bH 0`c`B $c<`@చ`C = B< !̀`> na`@D " m"   *`@ `! # "[ ZP $ @ # ! " @ `!"0 7 2" &"" "% !  !Ȑ! !!@&# !f   7! 2" &!!&! &! `"! &!`" #`B > &#  !E$ 2 &#㿘H /f * ' "*@&"> *Ho  "`> *@C`H 0㿐"    $"$"& "?$"耦  !܀ !! 2!!    $!$!& !?$! 2 # !€   $#  ` `, @! `  -01 !",0#L( `  0  ` 02 @vD  p " ,` / -,@,`,`,`@Ք 0 !3  "0"#( +"@' '   " #$ l  `#(@`"  m  ` g " 2" 2" 0 !" "   & & "  2 ` @,`,`   & & 㿘> !̀`> nap@C H /`4> ** !> * S #"2G"! " "?"H /f * ' "$"H 0 "@&"H /f * ' "` ` $"$""`"?$"H 0 `" #@7" # 2"H 0㿐` 8`@`` ` `` ƞ ` `( @  @"@> n!x Ȟ0 @?`>e *` €" H /f * ' "?c &"H 0 0" ` @ ` 2(#0#(~@#$ @  " rH /f * ' " &"H 0 0[Y@ @#, #\`$ "" KH /f * ' "@ 0*@&"H 0 02"`/2#0#()@&#$@ 0 @#,(@ H /f * ' "* &"H 0 㿘#( "#0#$@&#(#0 #, @�㿘H /f* ' ` 6`&`" 2" &""&" &"> *Ho  "`> *@A_`H 0㿀#" &#@ ' ` 0  > n!dž@` ` `,` `  @?А*6`H /f * ' "(&"H 0 D#0B8"  <#, `, 2"T Ų` ` `,:@@> n!Ȓ 09H /f * ' " (&" @&"H 0 " "@ #,`0€  2"J " `  h-#L  @t H /f * ' " 7&"H 0 -/" O#L K` #\` @t쨒   "@@;> n!  4$ $    (#` :`0` ?`$ `$ `$ ` $ `$$ $`($ (`,$ ,`0$ 0`4$ 4`8$ 8` 6`  !,@,`,`,`` !  $ ` `"@ &` #E&`` 8$  `˒  ` @ *$ $"! " #L ̐` #\` p@t{쀢 6  !"@@> n"D 00,`8&``  X     ה9&` &`&`!@ &`(` *#@  "#H  "`> #`*#  !*  \ # "`0t`` ?&`&`&` > *Ho  "`> *@?`> <!"Ȩ H /f * '   @&&`  $ H 0 "@@> n"@ŷ 0 Ȓ`B >  $0   2" $ $  $ H 0   `C <B> > "@0  # `B &# > > "h ' * | >   @ 2  @*   @ *  ** ޔ "> n >*> n*F"Xb > n"`㿘"@㿘%> * EHo @*$@` @ @@@ @s @<@82 8  +  㿘>ob @>S > * "`> nP"p㿘> 0  n `H /e4`l* &`l  `܀ " H 0B `8 2 "H 05 `">s@>sb"x#P 6#@&#x?>r>s>pt$!&#P&#\&"&"&"&"&#p@s&#t \ @6 \`Đ :`> x&` H 0 㿘H /e * &   ܀  . l& "@ }H 0 㿘H /e4#t* &#t  E&#t#x "">&#x"$Ő"x" ;&"H 0㿘 ܀  z H /e ;"H 0k H 0c* &#     @  > H 0D # !, " l " "ȑH 0+ " t\ ("Ȁ` ` $"$"$`"А?$"БH 0 `  "x>  t ܀"'2  l  @2 l` [ "Y U l` @`K (H"`.@    `$ $ Z $@$ `#  ( )`@ 8  | $ ` ֢/` ܐ`"ܖ ` #` ܰ" > n"㿘 ܖ "p? P@\  `U@.`X@V  W@ "  T@J  O@Cm IF$#P#PC& m =:$#p#p7& l 1H /e * & #P- #X#\*  $#\$#X$#TH 00#P 0 T   R@@> X*  @2 (2 `* 2 㿈> "b 'H!ct  " H  ?c ~`&cH?# 6c  `TcP 2 *`  .cP    2 *`  +@"  Hc$@&c%@+`&H /e * & H }ؒ ; Ґ +H 0c  &c``? "~% m ccP8 ; *  .   }//ՐH 0ހH 0ր/c8 ;  ; *  .  },@` ,@,@` ~,@`H /e* & H jH    ?0 * H 0 $c &c " %f "&ctc *6c% &ctH /e * & @8  b$bx b$&bH 0b > n&"㿘H /e * & "  ()H 0㿘 Ѐ` ܟ@!  H c` t    @ " 㿘"H o *@ f " {&"̒ H 0㿘H /e * & "#x`  .(    H$@"<`  2     2&H 0㿘`܀`0b@,> %@c`B :  $cb@@> n~"`"( `2` "``t > `r*bl * `&`t@€ 0  `t`А >`&`t@0H /e * &  bb@ $b> > * bX@  * bb $bH 0b@@ ~2bcc 4c@?b0   3<c @/ H /e * & b 0@ $b@@> nc"7`0`c `B $c <`0*@$bH 00z 4)c| u@> n"ؔ`0H /e * & `c bB` $b<`$c H 00P` ?  "` cxc|@ 2@$c|c|! " c|cx$cx"b bH /e * & b* $bH 00@  cp*@H /e * & b @2 *@ } @$bH 00$b H 0c @ cx 2cxycx 2 cxb@@> n"&` cx`  `<``<&`$c|`<c4c $cb`@@> n# *$c *c`$c4c`  &` c 2c  @b@y> n#0`0Fsbc 2c "cc*c c|`$c4c  " c  2b@@U> ncJ#P*`0Lbb*2 `  4cb@@?> n#hc|ڐ 4$` @ 2@@ 2 @b@@(> n#`0#b$c|` &` `< ``<&`$c` >  &` cX*@c`*2 $c* 2@ )4c@%H /e * & `c `bB  <`$c $bH 0b@@ 㿘`##*@ &## `  > n 0##@#&#> "h '"> n造  >/hi> 2bx @ + @  +  +   * >+ +a" > n#ۜۜۜۜ۬ۼ 0 ! " ," 0" * " (" $" " 4㿘  , )#  $ (  22 " " & & $  #   & , $`*@_  ( 8& (Ȑ  㿘 @&@ <&` H&` D&`  8&` 4&` &`  $* &`2``@4`&`㿘6 & 0㿘`$J  2F   2B  6  2=  `!>v!x*` €#  #)  "] " Ϥ ,  *@ P Y֔  `*  Yʔ  & L[  & L&& . & . 㿘 L "[~ [{ 㿘 㿘 㿘`@ 29 ` 25 `6` 20  ` 2+ "! L "  !  L*2@  *#@2`T2`V. \&  &  . U 㿐#\#` 㿐\ #\#`㿈`'H`, ` '` ` 'T' H"T4'T  H`"$` `T@   '(``@  $`   @,` , , ,` 2 , ` , `` 5` & '}'쀦 {'@? `* @,P@  * @`@  `  :$ , P@ @ @ N`, `耤 !'7 ,   `$ $` } $@ T"@ $`   (`H ڹ/ `@ * ?@ '-` .` X@*`@ `T22#2`T25 %`%`& 4@2 ,耤 `!'7 ,   `$ $` + $@ T" $`   Y(` ڹ/ 耦`$@%`$`  %` `%`$Ԑ .!& *耤  !'7 ,   `$ $`  $@ T"@ $`   (` ڹ/  )耤 %' * 2 ,   `$ $`  $@ T"@ $`   (`` ``$@$$`  * ?@ `@ `  -` ``@  `<%`@T`%`<H@ H"`4`8` %`8 %`4`H `D `%`H%`D㿘`   +     4   `& 46 `  ?V`S`  Xc   *@*P  * @       :" * P @:   #` @ *?*`. *  T@"2 T03 #  L& + ,  2  @2 , @`2` 5  $@ & & $ 4  8* <  @`& 4& 8& < & @   . x  'L&`"'  '  '` ?`"f ` `$@ *     > n #J 4 ͒  'A =   ('` '@̐`!'@ c'`,@- - ? '򀢠`' ?* @''􀢀 2@ *@'a'@`0@`2`  k G> n B# ''@ @@!@Q -> o ? > o H9ϰ @ 'ܢ'L,`   @@'* > o  p @< % "   c $ $" 2(А W' `,` V*``P *`,`*܀ !- "HC,` ,@* P/ @-    :" * P@* X *` `T23 #2`T3 2"L$ *@(2  "', @`2 `  % " $  @ $$H$ " H > o | H `@@$HD <$@L$D$<"㿘ؐ U 㿘WE 㿐`2:   24   20    2+   ' 2` ! d UX  >{>{!4aX& 8& <#\&  ?   @ &  H@ 0W  㿘@i V 㿘$# @  2 ` 2 ` ` 2 2`   2 ` "&  & &  @)& 㿘 @"&㿘 c -    &@ư4    ,&@$ `    (` `6   $ ` $   -@ -`-`-`@`: -@ `-``$`($`$А"@$`($`$  @  $@$`  "$`   5`` 2`(" `($` $`" `( #  $  _ $ ' $   ( *$`$$`( А"@$`($`$@  > o`0 > o D  "``(   `($$ 6@ 2`P @ " @`P`T`$`P$`T@ "`X&&@`X`\@ $`X$`\`H`L@ $`L$`H㿘 H&@ L#&` P&` T&`  X&` \&`&`*&`2`@1 &`㿘`25   2/   2+   ` 2&   " 2``  d S  >{>{!4aX& 8& <& $ @  &  H@5 0U  㿘@ U 㿘$% @  2 ` 2 ` ` 2 2`   2 ` \  & & & &  @& 㿘 @&㿐&` ` `" ` ``$@ * ``*    " > o V  &  o    (%` %@ u `6`` %` $ `-- - & & @`    & $& (`  :   2 (`"  (`& ` & ` @`@  ( && (   -  $ ( & $& ($    $ <   ( & $& (@~    > o 0 !(> o ؐ  ߐ "  ( $$  H L P T@ & T& H& L& P&   㿘` # * <:8 &` ?& & ?& &  & ` & ` @$ "@  > o 0 !X> o  0`2` X \ H L@ & L& X& \& H5l667T778H88<0=>0@ABFFG\GTUVW8X,XY[[[ĝ㿐#\   @ 㿘  &  ?   2m? 4h?`` $ a?' (   W? ,@,@ & ?$,$L$$(  $$$H$D@O$$P  ( $0   (┟$$8  D ( $<,@ $   (0  $8  > < 2 > #@/& ?␑*`  $ $ $ ,\$|$ @$㿘 "(?  "$? " ? $  ?. ,& & &  $   $ $    * q $ $ @@K  2` ( " (" 㿘  `8  `` ߔ & ` $`   @"& & `" $``$` 㿘 ` 2@? 2 `` > #?$`` 8>   *& ( |*`?:  *` * @ `@ $ q&   "  ` "   |2   q`& `2u  `" `> #?i$`` ` l ```2 |"&  | @Β @ 2L ` "H `.`- "(`` @ ;0@ 0 @֖ `  D <*  2? D <@O*`C` ` |&  `2   2  & ?c  ) ?& `?㿘   2 0.?`" 8 $ $* ( 8`" < $ $* ( <`"  D $* ( `" $* ( $ (&  㿘`` 2` "$` `2@ @@@& @@`@$`$@㿘 $ D*` <*  & 42? D <@Ó*`>  |c8*` `& x@  & @ `& @ & X& t& @& d& T& l& `㿘`$`d~`0`t`p!"@ `0`d`p`a`8`, 1 ^  Y T  N  &~ 6'@ /'@ ('@ !'@ '@ '@  '@ "ɴ'@!  ` `h@ ( ?2㿘 $ 4 l d"@ @ ??9?2 $4?~  / 0 h d" T# D" <+`@& h& d& T@ "2@2@ 8+`@@ "2@2@2 #  0 d l@ ܒ@  l@`& l 0 d @ & @ ` P L*  & @ l! `2 4㿘 & p `  d 0 ` @ P L*   <& @ ,* @  8+ 2  @ <*` f2 " X d $"@>@8 X ڒ& X X l 8& X XF d h@̒"  X l x" (& l %& X d 0`& d@  @ P L*   <& @ ,*  @  8*`2  @ <* f2  X? & X d  X d& X@ 0& d @ & @ ` P L*  & @ 0  d@  l d & l& d`" l T  0   d" @  d & T `"&  l!_ l!`"  T T  0   d" @ d& T  `?㿘آ `( X d 0 ` @ P L*   <& @ ,* @  8+ 2  @ <*` f2  X  h& p& \`+& X x@:( p d $"@>@8! p  & X X l 8& X X`8 p  `2  p d h" ( p& X p(V ` X Q d l \`" @ l? p " & l& p d @& d 0 @@  P `*  L  <  ,& @*  @  8*`2  @ <* f2@  p? & p d  & X& dJ& ` T  0   d" @  d=& T )` ` ) 0 d  @ " d T  0   d" @Ɩ  d& T d l & d& l 2  l9  d  l & `& d& l l!( l!`"%   `   0 d  @O & ` T  0   d" @ d& T  `?x> o!> > "   ؞   +  # a(+@ ?` > o!* > #   >  * $@ +   㨡**@ ?  *"; > o!> # *>  + "?,@  ` ?㨡(!*@?  $`2? 62> "  ,   2 7耤 !> " ,  3  7ꀤ!!> " ,  3! 7怤!> > " ,  3! 7> "@=!> #0  4`@V 4@  `㿘> #2`Fbbbb b& > o> o> o& Ԗ" )*t&+&+&+&+$&+(&+06&&@!0t060 H060" 2"" " 㿘.T7H.46.P*` /  ) (`@/`@*  / / / T@.@@  ..  .'@ ..T 㿈`+4@ '`  +R ' 2@ L +T'*` * @2  `<;",@, @* @ `@$22 4!,`   5 $* @@@Q @ & G@ @& <쀥C- ?,``,``",` `?2 *   2  2 " ",@  * @ `" ?@ $@@&6`? 2`ߑ,`xؚ    * 2 ` ` ` *` *6 @2 6 㿘 LH"= & ?@& P+T " 2  & * # +@`@`H +T '+4`P b b  *  & % % , 4 + ?&   "@ &  急 H&2`@ :`` `4 H L P*+X &&+X ,`+X?&* $ +`?&* $  ,   4  @` -+`,`2  2`&+Xe  Ϡ `L +X& *% 5㿘?  `   .<c:0jt "-.@7@ .@7@j 6j 4jj6j6j `       ͞㿘 ?      c* @R 1 +`b tbv "@.6 (&6 .@ "&>6@(6&  `v@,v+`b #@t.6 ( &0.@ #&>& 6@(&6궺b #@$.6 ( &0.@ #&>&6@(&6b .@6 .`6` ( &0. '@( 4J꺺b #@$.6 ( &0.@ #&>&6@(&6b  .@6 .`6` ( &0. '@H(Lb #@$.6 ( &0.@ #&>&6@(&6b  .@6 .`6` ( &0. '@&>@& 6(&6      @    * 㿘+; + 7)+(> o"  *v $  * `"?  *` @$ 㿘  ~+  6  `+  3  *   & 2`*  " ;6 & &  ~* @6 &  *  6  `*   3 *@   & 2 *  " ;6 & &  +  6 &   +  6  `+  3  *   & 2`*  " ;6 & &  * @6 &  1)""> o" *v`  * @+ @6   * ` & 2* `$ & ; 6`* @*@  6&㿘  .  6  `. 3  *   & 2`*  " ;6 & &  .  6 &"` * @ &@Ζ 㿘" "   *  ` & 2*  `?& & 6 & @b   ?& 㿘   +@  6  `  *   & 2`*  " ;@6 & &   * @6 &> "d⸢ #d +@  6  `  *   & 2`* #?;@ 6 & & d * @6 &!" ` @& "" " [ "  +@ 6  `  *   & 2`*  " ;@6 & & "  *@6 &bd #d +@  6  `  *   & 2`* #?;@ 6 & & d * @6 & ` @& " &㿘!" `?  `&@Xz+w+"" `  2`2 (     &@{&  `0p 4  +@  6  `  *   & 2`*  " ;@6 & &  * @6 &> > b0@Ȑb 8b  +@  6  `  *   & 2`*  " ;@6 & &  * @6 &++ ` @)b b   &  @ b  & "6 㿘" "*`2 "` *@ & . @  -2@ " >  & a @ *  2 `> > `>`# !# @*)` # >`#! @* @ 2  | '"2# d> o Ta" *)  @@L`?`" "2@ 64  bb  `?㿘☺@ > > o@ ረ@@+ @ ) / @@ #@$@@@.7@ ``(@ `'`0.@@ #'@@@('@7@> ⸅(`  @"@@$@.7@ ``(@ `'`0.@@ "@'@>'`7@@@('@7@(`+> "@ "@'@/7@ / `6`(@ `'`0.@@ "'@>'`7@@/@'@7@3  (`@"@ "@$@@@.7@ ``(@ `'`0.@@ "'@>'`7@@@('@7@> o+> "@ "@#@+7@ +`6`(@ `'`0.@@ "'@>'`7@@+@'@7@@ 1"d @"@@"d@.7@@ ``(@ `'`0.@@ "@>7@'@ '`d"@(@7@'@d'@     *```` ` *```` 3  *``` `?*  0`* 2 b b ( "2 (" "2 b (   " 02 " ( "2 ( " (""2㿘ڐ" & 6 8*@  & *@  & *@   & 3 *@  &   @ `*@ & 㿐 "? 2& ?& &  ` " @ 㿐 ? ` $ 2`0 @W $  (  $ 㿘 2 1?  (  )& "  `"   "`  ( ː?"  `  >"< *@  "` ?㿘ǒ 㿘 "? ? `>~!*` € ܔ  & &  @   `" &  "> oc 2    > o"#0 &  " "   & &  @ ` &  "> ocH   * @  $> oc` $ `@B`      @``  " "~  @Ҕ `  "@ "@  b? `& &    * "` &"  `O  & &     *` " &" `:  & &     *` " &" `%   & &   " &@   "> ocx &  "" " ? ?`2   " ?"㿘` ?@㿘 F?`2@0@  "@"` 25?     `0 `  ?( "@$$$ "`G $$ "@?㿘 8 " <&? 8  `$*`(  2  ( @ @L @I (& 8& 0& & $& 4   & <㿘   ( @    (  & (& ,& 8& <0 ( $ @ p 0 4@` $ "? ,"` J>~!<*` €  *``` 4  `&  `/`2  `4 $@&إ4@b@耢 & & $& @&``$  &`&@& 4? && &  &4> o&#&`4& $& @&``$  &`&@& 4?  *```?c82   > o&#&`& $& @&``$  &`&@& 4Ҕ? ` &&  q ` & $& @&``$  &`&@& 42D  ,   0 ( @ "?" 22 & 4@ 0 4 "@ ,? ,"   0 ( @ "?" 2 & $& @&``$  &`&@& 4u 8' " %@%&     &  *`` `?, `& 4   ! > p& &`& $& @&``$  &`&@& 41?@ ( ` `(  & & $& @&``$  &`&@& 4? & &4&   2  @>  #Ϫ  *```  *@ *`"  & 2  4    > #* *`"  &  &   @ ?2 & $ `(*`$  && $& @&``$  &`&@& 4 &&  4   ! @  > o# @, `y  *`@ ,   *`    $@ * "  & R4    @ `]  *`@ + 4$@  4 @ ! @$@ 4   > p& 8&`& $& @&``$  &`&@& 4E?  ( ? + "@ &  4   ! @    @ג  4 #\&  `   !`''#`@ؠ ?2 & $ `$*`( && $& @&``$  &`&@& 4@䠒 2 @@& $& @&``$  &`&@& 4ߔ?`(*`$ & & & && $& @&``$  &`&@& 4@ @  @f @c 0 4@` $ "? ,"  `I& `&& 4@ 4 0 0 4@& $& @&``$  &`&@& 4 && $& @&``$  &`&@& 4q & $& @&``$  &`&@& 4c?& $& @&``$  &`&@& 4U& $& @&``$  &`&@& 4G& $& @&``$  &`&@& 49& $& @&``$  &`&@& 4+& $& @&``$  &`&@& 4& $& @&``$  &`&@& 4& $& @&``$  &`&@& 4?@ 㿘@ (  ,`(`$" `(`$ @㿘 0 4@":? "`5?  ,@" $"  8 <& <`@&` ,$@& 0 ("& 0〤& $& @&``$@&@&`& 4 2?" 8'H\'L'P'T'X''''''''''''''''*`  " H X "9"     , `" @*   ,``"@8 " *,  @   /`,` @?#  '' "@`  ,  *`#`" H`@ *  '?'p ͮ / '"¸  .aH . @``'+@`  "? " `@*8 `+@`('''  p@s`?X " 'Xp"" //'*` $4@, ""4H+ @'  / /L    `/'LT" * @ `P/P" * '4@)  ?, * ""  ) @)@4 @2@)@? @  %*.? @ F 8/ ` `2?㿐#\#`    ??> p"@ & @Ғ> pbh&?㿐`\> p> p#\T #`!q ??> p"/$ -@@> pb$ %?,`> p> p#\L!#` R ??> p" $ 2 @@> pb$ ?@@0 > > (#"܁> Ԣ   ")> %> +> '>  -> Ԑ"Ԁ`"#؀ Uc>>!b x?h'pH "? 6"  *```"a a *``a"a4 $ *``a"$ $$#\> p> p! !T #`ۚ`, "? 6"( $(#\> p> p #`L!Ĕ Ś0 %#c$?$c%(&@`,&0& 㿘  ? *`$`( ? 㿘 (    * * " " "㿘 0 4 @` $ " ,"` >~!d*` €)` '& $& @&``$@&@&`& 4   @e  0 4@ ` $ "@ ,": $   $ $ $ @ > o`  *`@ > oc+`@   * @  @$@ 4  $ $  @ $  $ $_   $> p$"&`& $& @&``$  &`&@& 4? @ > o`Y  *`@ > o#+`      $ $@ $ $ $4  @ > o`H  *`@ > oc+`@   * @  @$@  4 $  $ A$ @ $ :$ > p$"&`& $& @&``$  &`&@& 4H? @ > o`  *`@ > o#+`    $ $@ $4  (    ," "@  "$27  ,  0 ( @ "?"2% & 4@ 0 4 "@ ,? ,"  0 (@ "@""& $  ( ,   ( ? $ $2D  ,  0 ( @ ""22 & 4@ʐ 0 4 "@ , ,"  0 ( @ ""2 & $& @&``$  &`&@& 4 (m$& 4@ 4 0 0 4@& $& @&``$  &`&@& 4r $& $& @&``$  &`&@& 4b & $& @&``$  &`&@& 4T?& $& @&``$  &`&@& 4F& $& @&``$  &`&@& 48& $& @&``$  &`&@& 4*& $& @&``$  &`&@& 4& @&``$  &`&@& 4& $& @&``$  &`&@& 4?@ 㿘`(`$ 㿘 4 0@`  ,"` " `"&`&` 8 <& < ,@@ 2)&`  4  (& 4 4`"   " `"&`&` 8 <& <g@&` & 0㿘04@$  "$" ##@""""4 , > o. .`(  ( ( @`x@> pؐ# `!d7`(`!   7 (   (> p @@# `!97 `( & (  (`@!'@@ 7'@/@ `/@ `,& &/@ `(/@ `6`@2 1 (`@ ("`@` (` (`  !/@7`[1 " "$" ##@""""4?` e 1  "$" ##@""""4 㿘?c6  @`f a !E&@`@`@@`@ `@@`@`@@`@ `@@ @`@ @`@@ @` @@ `@@@`@ @ `@@@` @@`@ @`@@|#@|#񀦠,`㿘> *" >  $㿘@ 㿘"Ȓ 7 2 d $4"> p $"Ő 0Ɛ> #>>>aP!tcP $!$!$!$!8, k$!$! $! "  7  %4"4 \, h, j$ l D  #P"?(` 4"4 \$!<#P$!H /f * ' > *`$"""b$""H 0  㿘@АH/` /""""H 0H o&4"*@g"`""b"?""$"$"H 0"(z8  > *"  Ⰰ22Ⱀ 㿘"h @2 d "        6    @   `>  $   . L  ِ` L@  `H /f * ' "@@m6"H 08j 㿀?> 2 b ' x 2> p> p㈒  (c 2!  ;2   2H /f * ' \ `@@!2\H 0 b > ps#㿘? 2 . 2"F ?"~ @6"H /f   \!  0$* '  \ @6 \! 2!!` ` &!&!"`!?&!` !H 0"$";&" + 0`\?bA`2`\n2b1" `\"`\b2b`\" b" `\"`\b2b`\" b" "b 2b232b 2 b2b"`\b2b`\"b"2b 2 b2b"b2b2 㿘 H /f * '  a.a)a P"a"E \J"a1 Ea2 a">"R"hA `<@iD08D05#ҒҀ@(0# l. "+ /"( 3 4" 0   /2  h "( ! H 0㿘 \ A Ab ` hېi @0b M  2Y 7`"H /f4 D* ' D   !  `!Ȓ! !!@&&`蘿  7! 2" $!!$! $! ! $!H 0  `C >B< < @  H 0 `B < 㿘"`@?# @6"h"  "  "O'""㿘?2  N  H /f * '  `]@"[ \@"M l "@ w@""0 b}@ib~@"\0 ! @"" `v@  [@" 00a @a!@""0#ҒҀ@( # lH 0  + h \# @  3 \ ; x& h6 \6 |~&    \# 3 \?  @ l3 \H 0k  """!]3"? " """ R3"?# @M3"a  !€  !܀ !! 2!! "8& 5&#" ` #"  @)#"'&"( "xH 0" ( H 0 "xƔ 0 H 0  H 0 㿘? 2 V   b ` ? @# @4bH /f bH 00H 00* ' b  "a!> p!#e? b  a܀ *aa 2!aa    $a$a$ a?$a % b!`@H 0A #a€ ` `@4b> p!d  "bH 0 @8` S턐  `  "   ``B <`㿐? 2   9 ` (l@   @ % ( 릒  2` 7! Ē  쩖( ` (7  72 78 (+'  &$  8 $  S$ `  B  " 7`!    r( `Ϣ( ` ג   "9`B <" "`D "H /f * ' D H 0(+> *Ho  "`H /f * '  H 0 `B }<`"` ?" `?"`@"(0 > <!  >   ˰ /0[H /f * '   @&  $ H 0`B <  9 7ސ5 7"  `$"`  $ $  > ** Ho  "`> *@4``B <  @ ;`B  &`8>  &`8&` !̀`> pc@+ "(!! `$` ^! ! "!!̟€!`"(  D " &  `B > 㿘"  (   k . kZ㿘> *" >  <㿘#b 0 f @3 $"1ݒ \  d $"$">c"ic$"b$ 0b D#> *#"?Ҩ$" > p > c>>>Pc#%ܘ њ $ l$!$!$!, h, j$!$! $!4  H /f * ' ```$"x"x"b|$"|$`H 0  㿘@@ R "@G" "?`""`"@"" 1Y 2H /f * ' "x`""|"|"b|"|?"x"$"x$"|H 0 "@ \10 㿘` @ `` " H`@``"``?@"&@&``@ A @ i1  p> @ b'H /f * ' H@! = !@"`\ aS@ aP@ a@@GaE@Q  aZ@aY5@=@>  !G@%<@_  A@>?@  B@$ 耦 0S@$P@ !M@ "M>8 AU@ԐT@ >ʒ`0@ "!N@u ǀ F@"% 0 aO@ 0!C@aD@  0!>@  !B0!X@"yH @  `0`<   " `H 2 "  2 2~  `h 7 `\ ,В @`\' `4`\7a e  ` @`\ 4`\7a | M x  H $ 2C  $ .C    `h 8 c 3 $ $ $  $ $  $ $`H $" $ $ `0`<   z  0@i  2m@j`0`; p " `H  2 "   $ 2  $  - Đ!$ $ $  $ $  $ b $ "  $ $ >`0`; " ?  0@   2`"  "` "@$$ /r  2      " `H2  "  2 "  &   `Y.$ `| @R.% .& &( .0 .1 &, &4 >8 &@ >H &P &T `"   &   "   & ꀢ "   @&   J   F& `0`;? E "9 `H25  ? 2 ? #@2% `  @  $  @   " @ $   $ @ 4>`0`:  @ >`0`: c " `H 2 !"@  ݀ ڰ `0`:Ԓ Ԑ@ "ϰ&>`0`:ƒ Ɛ@$ >`0`: 2 N> #`@p+#@4 $ fɒ g & "`\@`\  @ `0`:  " `H K2~  "z  2 "s  ? 8m ! ` `f @ W e! Z@ M U>`0`:N T "H `H B   2 5 @ [1@U- 2 6  X6 R2 .V2`.T2 . d.b6 L.(>0&$B6 8>(&0 &4>`0`:   @H 0 > pi#ȁ㿘 H``2@ 㿘 H"`9`22@` 1@ - ` ` `  ` ` ` •`@  @ 0`2`㿘   ` @``"``@``  X  +  - * "W*  @``0@ ` $ ` Y,$` ":``@9,% ,& $( ,0 ,1 $, $4(`X`?&`@ `@m{ X` W0- b* " *  @D` `0@?` a$ ` X Y,$` @ ` X?&`@ `@mM X` W8ݒ0, - * "* &` > "'I`  ` İ `H 2 b`` 2@`2`  ` `   ` `2  I- "* "* @l n` m`0 @̐``0@ǔ  / / / / / / / / / / / / / //  "`$`$@u n V- ` n?&`   ` I- "* "* @l n` m=`0 @``0@|  / / / / / / / / / / / / / //  "`$g`$@* n  - ` n?&`   - "* "* &`  > pg#؁㿘 \`@ `@"@6 \"`d"㿘 \ @ de" @ \ 6 \㿘 H2` Ȑ     2` 7`H /f4\* '\ @ D " y  `B > `  8B > @J   Q  @  䅐H 0 `$ `$@ sH 0  @EⰀa``\ @W@   •`"N2a` # "Fa 2 aa@&a$a /      沔    2 *`B < @@ 2@"@    ` @`$ @ Ԑ2`H 0  @Ҕ`\ @ @ H 0  H 0 2㿘> * )H /f * ' !` ` $!$!"`!?$!H 0 `""x@0݀ 㿈 \ @ `B> `  ; "B>  2  "`  •``      2 ?#@     "  @  "`  •`` #   @2`0`"&  \ z @   `  ` ^k" @ d ` ` ` ^\ @ S @ K @ u` # 2 2\ `B > H /f * ' @H 00Q @"  2     •`  @ Ɛ00 @q )` `< "l @0H /f * ' @ fH 0㿘 H   `2?> p## @6 H\ @x  2 mD  w @A  # > q`8@0  2 `   @ J 8 ID   •`<   4 Ⳕ  . ~ H /f * ' @& $ H 00 2" && &H 0> *Ho  "`> *@` h    h`2  &  a@& ( `D v̔   6  ے  `B :   •` n  `h 2ebx@  "    T C@ ?bx ` @  @n k  D  v   `B ; B>   @; B> &  !@& ( h o  6  wg bx`@;     T  @6  "WR  2  ̔  "G  } H /f * ' @&& 4H 0) *%  2" && &H 0> *Ho  "`> *@` 㿘> !̀` > q`@͐ "`X`X "  •`"2`\ # "z`\ @"va  aa@a-$a@V 2b@ Y@` /   ፖ   沔 ᅖ  2 ࢐ `B 8> @@ 2@"@    ` @`$   @1 " a< "`l  @b@12q^㿘  h> < d`` 2`0`#沐    2& `B > a@ &(6`D u$  6``B >`㿘" @沐   8`    1 |a (`\ @" a  aa@a &a Ɩ   `B > @2㿘@." (bb@}  $ߔ  w |  , $ , , .b $b" "b@$ b`]$b  @f  " / 2 '  "/ D  bb@<  $  6 {ה , $ , ,  $$  "!' 2˸bb@  $   { , $ , ,  $" '$ b $b 㿘@* " "  @    4    `' `ṕ* `+ ( `* @ `" 2 "(""2 "  2 "(""2"  2  "( ""2"  #㿘""@/@D""@( "" ?  "$ "@"""?&" % ""@  2 ݤ㿘H o*@ a@  H 0㿘 *`")`?  2 `? * * "*  $ """"&" %e 2 cґ*`"`]"㿘 H`)`  @y 0!*` "`2>  @$  2* 2 c*`㿘 *`"`?`2 2 $ """"&" % 耦`cݑ*` 㿘* " "  ? @  2` "` "$$ "?&"$ے   㿘 *`"#`?2" " $ """"&" $ 2cؑ*`h> `"  `?'   "-Ȣ2"` ''0y  ؐ 0y  y  /` ( @x/鰒 -``?&``( ( ڪ`Ц-`* &` > q`& 㿐` $C ` 2?  h":  h 5@/!"݀@+%8, ` '  ?c*   #2  2 (   5(!"݀   㿘& (  ` @  2  ` @  2 2  @ߔ  "   2   ]? 㿘  "   `"(  yB `( y> ` `!, N`.`, 0`.4 4    , $ " &   , $ "&  㿘 "    & & 7 #  2      & & $ #   2  H> "\'``ؠ ``) 5"d`" V `` ?ΐ  l$ @c  d//ђ  ` 2 3d+' l0,d`" 1 ` `?ΐ   l @cǒ  d//ђ  ؐ 2 3d ld ۖ  d Җ'Đ ֖H /` * ! a@@sĠ Z $ V  R  ̀@2? > :< '   Ȗ B 8 ̀@ # ܐ ' $ " ȒZg @  Ȗ B Ȁ 8 ̀@ # Ԑ@' $$" hȒZL p  dH 0m H 0e d#\ @ԉ Y``d !@4! dՉ  !@4! d d۔d9  ɀ`, > #4`'`@$d! ` > ##!:`  d!   #\;`d@  d@) ' " > q^ (㿀 'T h.!"݀@*e83   -   і?c* "2 T #2T 2T( T T݁ `T| h!"݀@T T` T`  ݺ   'T> <`l`   "` T2` 2`> <`l`X "`X < > <`l` "`  ݔ  'T> <`l`  "` T@* `7 > <`l` "` @T T$  \ 2"@ "  "  \@T #\#d#`  Tw }TT`z `  C u'TT` kT`7 T@dI7 T` ' - (  'T>   `B X:T @ `>  `B : "BT"H`B::` \@ ( #\#d#` . T֖  T # ` T ڨ  'T  vwT ڝ  'T  vl TT   㿀    !@" @%h a< `l H /f * ' @H 00#e   j?c* " # (|    g  j @  `l #\#`#d@0Z`l@ EM `<&     uД    2) 7uĔ H /f * ' @*  H 0 H 0K2` > <`l`D "`D:㿀`h  6``B >`` @ ; B >` "+a< 2' ڳ  a77&7x  و    4 7 ʘ ?#ߒ @6a  aȒa aa@&&  7a 2" &aa&a &a "  a &a"  `B <  `C @ <`B < < `@ B >```B >`wB 㿐沔 ك  `ة0cd @g\ W  $ $   ,@"@&& 4` @z"@4`< "@& & *  @$@l4 4  , 4 @a4 tĔ t t    ߔ  t  Ք   t  ~ I0FlXܸ88Lh@ 0x㿘`\ @(`&`@ 2`@ V0 d@`  `䀢  2 `.@.`@V`.@ `@` ?&`p`27ر*2*@`2*22 //////``2 '7* 2`* @`2`* 2`2 //////``(7`*7`.7`,77@ߐ``/׀`//֐@0Ё㿐``v`\ @r ն  m $ $$a  ` @s > q 8s  4  / B//?*'  /'/`s̔ H /f * ' ` .`a  aȒa aa@&$W  7a 2" $aa$a $a `a $a ``@ < CB<`<`uH 0㿘` ` (` 4`` ` , ` **` ` -  5`   @,`4, @ -` @ `,@ @  @ 8@` `(``/``*``+ 3`` @ , 4  +`4`, ,  `,`  8```(`.`( ```(0` ` `!(0`"`"`#(0`&`$`%(0`$``(0` 0``(`(``  8 (`/ 866666 `(`)(`+(`,(`-(`.  (`*   0 0 (`/㿘`H /f * '   \ @!  !!@} w  x B` .....!> q 8 +` +` +` +` +` +` 83@ 3` 3`  ".> q. 4$` &3` ` r &`.& 5$` '3` ` r  '`} @$`$` ` .`!  `!Ȓ! !!@&$`  7! 2" $!!$! $! `! $!   @ >`CB< < trH 0 ` ``  `뀠2 @`h2  `怠2 `†" 0 `  `䀠"  "  ` ` 0 `" 0 㿐 X'P`VP` RP `M  $P"@ PN  A'P qݔ  B9P B5P 1P* @+P  /`@ `0` P@̐`0.`@#   P @PP@3PP Hh `  `p  /ϒ@>0` %8   & &  &q@+p `p` &8  Β ' &  'pՔ@ 㿘 @-* 㿘`倢  @?`w>!*` €. e.`.`+ " *. 2* .`*  .`)  .``뀢 @  ".`>`>`>`>` 6` "6`"$6`$& (!6`&@ .`@8+ " *. 2* .`*  .`)  .`@p -  .`.`, " .``ꀢ  .`.`.`*  .`)  .`@S㿘`/     `0! `0`@  @6  ` ` @  `$`$@" 0@& $ 㿘`` 倢  ` @ p ` 2   倢 2   @   @8> 2@ `87 @82?2`` 8+?` *& ( "?`   ` 8?2`` 8 ?` @  ?  㿘 "  @\` "  `  o /@  x  > ( 6 X > 0> @ & H R> 8 T6 Z V6 \ 36 ^ 倢 2, ? ? ? ?   @(' 2 ({؀ 2آ> (> 0> 8> @ !6 X "6 Z $6 \ &6 ^ 2  ^ (<  0$   < 4 4  X4 ( Z4 * \4 , V 倢 4 .  #@+ 2<@r 7@m  4 `", ` @ $`$@""0 @U & H 2  А@K @ِ@  @@ @<  2 (㿘 e   `" . e ` 2@ `䀢 "@ . e@@;㿘`䀢`,>!*` € e "``뀢 " `` " ``뀢 " ``  .`&`.`` " ``뀢 2`@Ȑ.``퀢   `  `  .`.`.``• "  e` 2 e@ e "``뀢 " `` "``뀢 " ``  .`&`.`.`` " ``뀢 2`@.``• ""``8 @ "``X 2`` 2``•   @y `@t `• 2`` 2.```` 2`` 2.``• " ``쀢 2`` "``  `퀢 " `` "`@p`` .`.``• ?` @2`` 2``  `&`.``0#`*@N`• 0`8 " ```쀢 2``` "%``` "`` `퀢 2``쀢  `  `  @ `.`2`@ `퀢 "`` "`` "``` 2`` "`` 2``• @ے ``8` ?`&``.`,@ ` 㿘 ?`l>"*` € ?  @0  @*  @$  瀢 "   2 @  @@ 0< ? 7 耢 3@ 0/   ?@ 瀢 @   ? (   • 2 @  ?   •  @ג 㿘 .  .   ".   "   쀢 2 . , e   &  .  >  > >   (>  *6  ,6 " .6 $6 &   2(  (2(  ((2(* e㿘 •` .     8 . ,@ 0@ 8  & 㿘 䀢J "  `  "  *.  " .. @ 8.  X*`*`@2` ,@ 8 . . . @/. . , e 䀢`>"0*` € @Ԑ `@֐ 8 . .  .  @̐ `.  .@ @. Ӑ㿘` `" N0 @ P. @ P .  ?& 㿘`? `@. >"D*` €@ h .  @ 1. . . ,. @-? `& Au  @ . .  . * .   . @x . @ . @h h . . 㿘 h      h .a*`@N2`   & `\ h`Z@ *`@C2`㿘  "!   H &*@ *`@42`0@1    "`" `?㿘   % `x 8 `x2 7`|#8`x 7 @WE#  @W@*@ 8    ?#@8 㿘> !̀` > q`P@   2  ,2   2.  N. 㿘 h 0 HH /f * ' ` ` "@`2@``   @ sH 0㿘`  &` \ "` k`"`` ``?.``倢  @ 0 @ 㿘 .`㿘 .`P 㿘H /f * '  \`@  H 00T@b    @E/ "3@L h@J `@H 8@F X@D @ @U@= H @h@6 P @k@/ 0 @h ?,   \`@ hN# H 0 2 2" " 2 2 2" 㿘 "   2   ?* `6   㿘` 2 `.`䀢  `h  `.͐`@``&`㿘`倢  .`ې`"`` `  ` `䀠 *` @   " 㿈. 6`. 6`. 6`@6 //////.6.6.6@6//////ϒ耠`?㿘` @0u "  !  `  6      , +`b4 (  @  - 5@   ,5`- -  -`   |> >&6 6">ahLh \`@" | 2hM     X * 4 V 2 /㿘H /f * '   ֐ & &"/ !#  6 R6 V6 T6 b6 `6 N. d. L H 0㿘   "> qu hw 㿘 "  |   | M h㿘`h  !   4   0. . & & & . a  Lʐx ؒ [&  &"  & $   .  & G`( >4- & 㿘   > qt `" `( "47 `"  "` ?"&& & .  ː L ` `䀠    " 㿘`0`    ` 0 ` & Y`  ?& ` . . `    `@ & U`@ ?& `@ . . 㿘 aU"@ ! aT@ pH 2`H 2 "   2 2   2  2 aZ@"aR@"X aP@)aQ@@0aS@/aY@Q00!P@ "`b  aT@UaU@]0!R@ "1`T !S@06<~ 04`bx `R."@8n 4`R`V `L .c !8_ 4`V2 Z.."@8S 4`T 8L ` H,`d,  2, B&C  ?, ("40 2    $ $ $  $ 2 `",`L 4`V , , `Lb p  X 2,   㿘> * ࠐ 2 > * "`> qsA > l T> *  2 > * "`> qs1 > l l㿘" Ӕ 2$"* $ > q tؐ 0 > q@ 2 " !4">>!b $!$!$!! $!iΐ{ސ  , j, h 㿘@ {jc  㿘&"㿀 \␐$6 \!܀ *!! 2!!! " \  &!&!$ !?&! " \`\ A Aa`$a BO> !ܐ!€ >  D `3 a<  ➐!@ ⚑*  ` 4 & 4  ’ 7➒ 7⚕*  ͅ7 ˕  ;  ژ  ` ; B<` ""a``B <`a aȐa aa@&$   7a 2" $aa$a $a `"  a $a"  `B c> BiZ> ]!ܐ ;6 \㿘`  `> *`&  a `  v  2  ` `B t<` " > *> *  ` o> *` *  `" @ "2""2""2" 2 \F  A A"`{> ` &`?#ߐ @6`` 6 ` ```?&` &`&` D  _ ` # 2 `\!"  \!2  "x@!  " G  B< xI 㿘`h  +"2 "."2 @" "@&"a< "`l`l & l> q & l Ȓ 0s `0`\?  @ 6 \!6 \@א`h. h`x> xa<  &!<" !@"`X!< ?&!<`X> *  X *`  **  `  f9 "x f3 6"H /f * ' "" @> *> *  > *,` 2  *` &" ""b * "&"`(>–0 &"`,> 0&"@cH 0 㿘"`R"  \ ~@Z6 \H /f * ' "`""""b"?""$"$""`""0|`("``0v`,` . klH 0@1>  % X$ l$"$"*    * @P*"x@P  㿘" k k . kx> xly㿘 \!" "sj  " "  "s] " ?$" x> ">'`0` a9@@X a@""a @"%" a1@ϐa2@԰ 0!@%"x a@%a@ :@x@  " `\ 4`\ ` @Ae "`" a< `l?@4 `-$ $`l  c  O؀ !H /f * '  `\`"`\k[`\ ?4`\H 0jl b  ^ 9 Z`\`@64`\Sؐ@O֒ " > q 0q"7$ c ;cg  4耢 80 -4"ؒ @O"``0@ "7cS  " @ " @i  > qJ!㿈y( 4P!    `E x”$ $ @   @  2`cÒ $" $% a1 2 `""`?"$$ yV㿈␤  xw` C  @v  2  @o  2  / ⠀``2@`" y% 4 !a2 @`"``"``?@"$@$`K 0x㾀> " b'`0'`4$`8$"`< $ ?  c8a a2`"  "` "@$ $ " 2 " > qIݐ!㾀> ""'`@,*" &%   b `02$`4$ `8$ `<$ a`0`4$`8$ `<$ a$ 1 2  > qI!0R` ` ` "``R`6`   R` `  "`  "``R`6`  @  @    ` "J2#  ` @ *J@@ `J@`  "  J   `?㿘   ` @:  2  @>       2 `  @ `>  @ 8@ @ @   @ ` @  㿘@V``  ` `  "``V` 6` ` `     JJ@   ` e` 20_: "  :  ,@8 ` V`4 `E ?``2` `@ 2@  "` T4& + @8          2  T    2 @2`  ` 8:`( 0 " ? 2"( * 㿘@`     JJ@ *J 5&& "@ *:  ` ` @ ``V`8`     $ $ &` &   @ 2& & &  㿐> * @ " @> *   )> > `@ 8 a` 8@a$ 8-> *@ '>  8L? "? 8$@4 6$n 6 8"@@L 8$*@! 8`  8@ 2 T`R଒  0   I ଐ@L``0 0 8a>C` > qaHl   0-   "  $L  :  `>  *`J:`@ 2 +  + @8`6   . 㿘 @     @_   㿘> *`       > qaxl:   "`@K  6 .  " & & & $㿐   ` ?  2N  8`x,: ,@2 @:`@2 943@ۀ`-`"T (h #    @  "  @2  @ vê @ ``$  ` , `$ $``2"`"``2`$ ` 2" > qkV!`$  $`$ $`  $ " ? . & 6` $ 4  ` ,  U ``@8 `T 65 F*: `@`@  2$  "  T& 2  &؀`` *V: @ "$@V &$@&`f-T`:  0`ak" \ `T`@2H,V: @&84A # ``  &`@2``> q  & )$ > qaj  c } 2<`V@&$~&㿘! V  @@Ҕ" 2$ `       2  "    12  `"k f ( `> qb "  Q"  $!` `"> q@ > qbPje ذ " <" > qbxjZ 5  ? /" `T V 8 4)  V 2> * 2""" 2 > q j*b   ` / 2  & 2 & & &   "   v & & & &  & & `2"`"`" _"`   `2"`"`&`7 V  "/"2(" > *& ? " ""  2 `2> q> qbДi "  &`& `& ` & `& `& " " ``2"`"`  # ` , , #㿘R 6 ` 2 "  R` R 6    l @  2  " 㿘  p     " &@㿘@H p> `< В  P * " " @8*` 2`& P`!> # `># ` ># `># `> @># # @aܖऔ&& & & & &  㿘> %#0 !> *(଀@4$ 2( `*`> qch 0)  R #> $`<> qh#8 *@H@  > `<>   "@ "8 *  **> *  > qh#@ h "  2  ` v v2  `@0 "   ` v 8  2  㿘 v  . v ƒ  2    @ `$ $` 2$`> qh)#P 2$ $  ``   @"      @2   v4 @G2 @:`z `4   &  & $  `2"`"`2 `& `" `&  $`& $`  & " ` `"  ""`02"`㿘 7 2 㿘 @` v ``! `2 0 `  @@ @    ڐ㿘 `  "l 2h  ` @2a @֐ 2\   +)` @@@L $`v4!`v@$@@ 2@  @ J  1  `v`, )`v v   0`0 @ @  v`v@ ꀤ 㿘`"  `< " `4 A  @S  :& 4@5> #$`>   >  `) %*@8?c  @G &@@ `P 2``@&`8 $`8㿘>  D` $ D`"  " h > 'DṀ  0 `@`@@@"2 "  *  "0 ""2 "  *  "0""2"  * ""0  ` `"2 "  *  "0 ""2 "  *  "0""2"  * ""0 ` `"2 "  *  "0 ""2 "  *  "0""2"  * ""0 `` "2 "  *  "0 ""2 "  *  "0""2"  * "0" 㿘  >  7>  7 "$   `4 4 > *`` $`" "`$  㿘  F"``"  "` ?"&& & 㿘  `8T8|8(8(8(8(88889 99@88(9H9`8(> * 㿀> * 'T'X'L'H'P @  @@28 `" `@20  "  @ג 2&  @͒ 2沔 –  hޖ  L  2 hɖ ̐080Ɛ 㿘 `  k -    \ -J`U.`>͐" €  M 'I "F 9CC "> 9Q0 8 1 8$ + 9 `€"  $ 3d   2   2   9Y& > qd#`S㿘@d   㿘> * `Ħ  *  S > %) #0 > *" "    $* €@  2 & Ā   * @ 2" l Đ * 㿐> *> q  cp!#\ x[ !> *"@Dq $> %#0> * *Ě"    +@ + 2 @  > qdM#x㿘  F >  2> * *   5  ݔ %> * * )> '> * Y * Y*  $$% > * . @ 2  > * Ȓ"  T > > *ȇ* @ 㿘@  @  > * ȓ. " ` > @> **`@  㿘`"  `< " `4   @ &㿘`"  `< " `4   @ &H'H /` * ! @C D @' I  € "C  2?  4!6'` 23 8  8@E "' 8 0$ 8  4") @Cn D ' ' 0' < "  < ' @' < 4 @ 0 8 $ 8  > *``  "` `   @CA D' @j H 0㿘 2 8> qc!#?;& 8 4 7 2  > *> qc #`? "`> q#d0 @! 0 @ؐ @`` ?"` @r t 4@"  Hb  _ > *!\̒㿘 2 > qbې#Ѐ ?L 0& H\  > !̀` > qc@. \ 2`  3t @' " 0 @2 @ 2  @@ \ 2 AC`` "`4  `4 2 #  V@B D''''''  8@8``4> * > *4`Ԑ "4  @M A  `'@#> *`̐ "`̀" $@BA D''''̒@ g P'D@B. DDD` '`'`0 '`4' `v@`< @ G  D`8  "`8D㿘 4@@ l̐ 㿘`> q4!2 > qa#耢2>> ra ` -㿘` `  E  [Ȓ  [[  [ 2 "   8 4?` & 8 `  2 @  @ " `   \; "㿘 8   `" 4 ` 2  4 [ " 4` & 8 4 2  4  " 4[Y& 4 4 2( 4    "  "   8`" \& 4`   0  0 h& 4 4`" 3 8 ` & 8h> "'H o *@a` @ 2`0 / 2&` "   "`40y0`` "   `P`"ܰ  `` Ѱ `4! `  " `h> r`ߐ 8  "  l`8 ?$`8$`h l``8?"`8$ lH  `` " `4> 2`4 4*@$ 4`4`@ ? $`4 > *` "`&`8 ~ $`8q0y"x `"t `4!2`@n ` "&`4&`4`@&``<@&`8`4 6 &`0`0&``D`&` &`0`t@֒&`,`4 > *ߒ H> *`4!Y! 2`0> 7`$`4 !`,`v$`p`@A` Z/) 7` ` `@0`U$  `0 `  2`h `k? ( `4`\ `4 $`4 `v ?`$`4,`v`, "`0@ 4`t`0%"6`4`$  ` `!2-`4    $`H`h "` ` j YؒҰ "`@ "`@*`4 /l p`4*@$`4  $ $`@ 9$`< @ `2%> raP P`@    @` Ӑ?"` " @ "`<  $    P<`P X<`X `<`` v,`v$`l`8 "`8 `  `v@   @4@ V `  `v@8 ?$8   ?$ `4@@" `h`l "`h:`h "` 4` Β Y<6 Ґ  `` "ܒ "Ò 2 4 4*@ $ 4"`4&`8 $`8`4!/` af`H 0> " > r:T 㿘@ ?     0 "  ?  8  (     2 & :  & h @& 0SSC  h `8 ?"`8& h 4 "   & h X 2   \" `\8& \ 㿘@.@ @`.@ `     .@`@ *@ @>"> "  '!B'| `=     2 7 - 2 "" 8 @?@ $ 8   @2   3 Ap[ Z$ @@>> D `'''' @ - ''3  |``|   @  8  $ 8`T`4`2b| . 8 @?!$ 8> r_}  @`   @` ?"` $ @ $ <   &   |@ Vb > r9   㿐#> ` "> *> r] > r` #\ $  U5 > *" !>  H>֔4bܐ H5t  $`㿘>  `  D 2& & &  & > *`&  "`"& "P  "D ? `"  "`   "@$ $ ` "`&  "@$ `$  D €> *@=^  `  '  v > * W0  "> r?& ^̐   2  `"  "` ? "& &   㿘 p -? `"  "`   "@$ $ `"  "` "`  "@$ $ ` "> r?"`^!(> *V  p 2 㿘> #> c#> * p 2& `? 2*  `"  "`   "@$ $ `"  "` "`  "@$$  ` "> r?"`^O!XV`` 2 `Uy 2$  7$ $ $ $  p $  p "`  p& p$ $ $  "@&  `  "`> @ > **``> * (@ 㿘   P> #H /`4> ** !> * `U ` "N` @ 6H`? `"  "`   "@$ $ ` "`$`  "@$ $  D €> *@<9  `  '  v > * V ` "> r?$`]!` " ` @ & ``2`H 03ϒ 㿘N 0 >   @  "7 , ऀ , (,``* `(2 @"@,02`#P@ 0 |   @  ,4 (`` $ ,`$$ `" $` (  $ ,$ $  ""  (>  * 0(22( 㿘. 6     @; " "..  @f 㿘. 6  ">   ?(,? ",`"`# "@"" ؒ 0`2(㿘>     `  `%>  #" `# `` 㿘 <2  4 a 2  # 㿘> * `%>      ` `  #> ` #" `# `` 㿘 <@" `k? ( 4`\   4 2   v& 4 `    ? v& 4` ]  llllsssltȝ㿘 H /` * ! `n ``R  T <>ْa & 1> 0 ` `  H 00p> 0 `8 $ 8> *bp  "bp !> *"p`"> *p` "`>  $ p `{"   @?6  4`;  p x h |# " 4 . ,$ 4 "2j  > *bp ?"bp !> *"p"> *p`?"`p` ?"` H 0㿘`  U `R[N  / 2I`  *`" ` 2 `$ 0" ` "`  "$ 8 2$ 8 `"+  * O ' &` ` 0 "@E ' &` ` 8"@㿘 4 " @ >   h`9   4  Ĩ& 40 "> 4> c` @: 0㿀 'T'X'P 'H'L > * w ` 2n@@2i`" ` @2_ "  @~Ғ 2U " 0 @~Ȓ 2K0 ` * "A`   4848?"4C` 8"4`@2&4 2"沔   hɰ  `4 "`4`2hɕ  `4 "`4E00> "'L'P'T'X''H  'd    ` '`  ,  2` 7` 2`> rX̐!`( `@@2  ` 2 +`WOh ( b   7 ߖ> 0 `8 & X6@&    ` -` >`0`2 "z  2   S 2 O  . `? a   @( 8 @8i D '@`2' ` ". "  "'  뉔   @  @}` "  7 ' /`>ؐ!P*` € 2 d dP$@B(d`8?"`8d"Dd `v . d`< X6d 4&ǖd ΀d8 i&8Y   /h "  ` 2  ^ 2 n @ v 8  &8I  ` 2 `   " 8 &8` `? `?"n  "    z0dV0a '0''D't Ȑ@7 " "/t @}S '4@p@7q  ! /q/pH''tH /. '' 0"<"'@'\ "'@ 'X6  @ @    2 7L  @ 4  &>(vP `. @T(&  耦`  0 " @|r @     Ͱ E "Q# " `    "Q .&@ P 2  4 "$ " @ " @  @` ?"` &@  $ &<% `H 2H  ? &HH2 b "*4&4`2 H  2H 4@   4*@&4&H> " $4*@ @&4$(@P< X6v . 4&@ "    2&D " t =6tXX$* &X$0v &X .  "&  @&  > 2 " @`> *"|`4  ,`25` ] `  "@b ` > > > `ДOఀ` 5` > r1!  ` " `"㿘@5̒ 0 &` &`  &`>@㿘@5 , :  *" ?  @  *㿘` `  X `    X$ > rU!+     3( `  3 & & & @5n `,``  @*@&@ ?    `` 倦`  ,44,Ґ 㿘 &    X   X ,` *@& ?    I`` ,` )? %$  '      "_    ' '    '  @4ڒ 4,,4㿘> *"|`"`( @ "" 2@" X2 2 > `2 > `2 > >  `Дఁ㿘> *"|`   ` X h4 !B 4 V \$  `I $ >  $ > >  3 P> *"| ` `k >  Ф @4u D   "     @' `'`''Т C  X`2`$"`"" !B2  # ", '0'' ` X24 "v `* " " !B22 5`> > 5`> > `Д}㿘> *"|` i  ` X 04 @yِ >  4 > >  [3 > "@'    4`@r @3ߒ D <  0' ' D'' @''\`" t' t Ȓ "@3 t " /Ȁ @y ' 4@p@3  H ! /q/p''t /   _` "(` "$` 4  4 P$  v ( ,  8$ < <X4 4 $ , G*` "`&`&` > r.!ЁP@3d D>  "v ``"X@2j`e @'Ē   `` ` "O'` 4K'Xh4 B 4 T\ G$ $ `Fߔ 2D`&`3'@ `2.`'` '` 'Д ؘ```"`` 4`` `X2`"`$"" `F` "`&```̀ '''2` p      @2ْ `   '''' '    > 0 `8H /` * ! ؒ?`U>ؐ!p*` € 9>߲``#I`  `@2`   `06 )2> * H 0C 2 7БH 05 i7Ґg H 0#H 0  䀦@ '"  &  *` * " @3[ &hhhhhhhLhh$hh㿘b@2% ( .t-* "?  .L$,   6 &. . 㿘  (b @2 @2/@/h@2/@`.`"* * ? @* "?  "* * $,   6 &. . 㿀> "'@?`@    ',@   @ @ &` `@2``@2  ` *  @ @ "/ @ &` `@@ ``@ @ ` *  @  @ 2&`& 2 ,2@&#$@" 2 @`` @ ,``@``@ 2 ܐ  ?*`@vĒ` Ґ 2   ?* @v Ɛ "  * 2`* 2  2`, , , ,  @ " * 2  2 , , , , ` @?#,2  4, ,,  , `  ?#x*2  2, ,,  , ``!>#ԓ-` €`` ^@\`2`` "2 ` ` "2` `` "* 2  2, ,,  , ` 2` `E$ `@"  `.$ `@.@ `@ ,$ @.@  4 "@& & , , Ew     & `En ` p.` `." > r+!㿈  #\@  @` & E>&@   E7$㿘\p"3   ? # @7 / *" *  * ./h ( ` 2 * …`E4`   ' '@$ ' `@   "  $? ' $ ? c 7 /  `*`" *  * /h ` .*@@ 3     + `   `0` ` "@    # W# `  `@"@ P#   +     * @3  3   + ```2    *  @ 3   ` 3  ```2    *   @#    # `` `2    *   @#    # ` "` `2 `   * ` @ 4`    ` 4`   4` &@ ``" 4` 4` @@`?# @3`@ @3` 8 4`'@` $ ? ` ' 7 㿘!> !<@ H!<㿘@"^  Δ 2 V >>>"$b"  $!$!$!> r, h, j$"x $PƐ 0EӐ` OE D =Ȗ @Ȓ  `Fe %?> *"@ > *`*  썔 #> *?b` %> *CS*bG $b$> *".`"  㿘"x   H /f * ' > *"xb* "@FK H 0 㿘! &!!` ` &!&!"`!?&!` !㿘 㿘 a@" \ a @a@"  \ a@ !@2  \ " ? @ 6 \ 6 \@.   `> *@> **` " !@  > *  > ** 㿘@2ؒ 2* ``> *"@ > *`*  Ŕ #> *?b` %> *B*b $b$> *".`"  . k 㿘!@  (&> *", " . k> *⤀?    > * Ⱁ*@` @ ba@b" *`kb  Ⰱ㿘> *""> G<!T㿘" l 2 V > r Os`0? >>  㴄8 %,`h4`\ />,`j$`l$a$a<`<`<`<`<`ab,b$@,`i$b$b$,b>a$bDWC`D  *`$bxbx"b|$b|"H 0  㿘H /f * ' %z"%x""x`""|"|"b|"|?"x"$"x$"|H 0D촒  㿈 \ `'D  b b  2'`(D!@@`( 0Da@> r" N   D@rx   a      cD A `?` 6`D`D :  b쀢 7 /> !t`D ې` *  D`` * @  D`@,ɒ  * 7 'b&  b@    7 'b& 7@ǒ7``<" G J  2 `D`+" 7?$ `$ `$ ` $ `$$ $`($ (`,$ ,`0$ 0`4$ 4`8$ 8` 6`> '# ` *`  $ $ `$  ` `*` &`` `*`" &` AI $` &``@&` &`  A9*` A4 J6 AD> !l`2 D`" !!DD` v  (D`( "` # "  H G`"i /   `"\ `2 bD 7a S"aD`"K  / ` @+ ,2 2 , ,  b, b쀢`7!b2 , 2 2 , , , b@* 2`, 2`2`$, , , > #3, , `* 2 2 , , D`B :D`చ 8B 8b#&`(b   @P  D`B :㿀> >' 0  H /f * '  ai@y (a2@a1@fa @" \ !@ǰ 0Ja@Ga@"EB aI@ ;af@8ae@ 5 0n0g@"a@ a@"0$  !J@0!@"b ~@"$`l h@|j@"A b  @0!K@"b @ /,b 7,b쀢"?$ $ l&" / ꀢ  / `/,b쀢`7"  \װ + \ 4 \?Đ*@4 \6ǐ %$b  ae@$baf@2b$bb b b``8 ݐ?"`8$b@ \ 4 \@*ǒ   // b@*   //b'?+ 0 M T!@8|  p!4v $b`$b耦2b$b$b@,b0g eb !$bbbAbܒ"J0Y&bV&  P 2L / 2H / 2D  2@ $b$b 6$b3$b "0 1b * 1@*S   //b'>> b'> >ߒ  8 O 2 Q$bb& H 0 > r%\"h㿘"@* "  $ , ,  \#2 "" `   $ "В S" &"`<2  \`8 ?"`8 $Ő $"$ 2`  ` ? ( ? 228 * 2 㿘"܀  ."@㿀> "ܨ"' !y""쀤/[" \ W" S" O G  2 `B D>  `$$$ `<* @ *@@ $` , @6x4 4 4 > #3, , "$ " $ @4 4 `@)t @)p  /H /`* !  H 0" > r$"x㿘"܀ 6"퀢 "" ""&"耢 " ""** ."퀢 &" &"? &" ."@""  &"&" &"""@"ܒ ڐ㿘"퀢    2  k . kDҐ`ȝ㿘> *> "bBc!x㿘" 撔 > rT "$b`$b`  2 $b @  bA 0;  b>> <$bt   t t >!>>?cؔܖ$a$a$a4`\$@@v $a$a<a $a`0> rȘJV ?cQs> *"""$bİ 㿘@AH /f  "H 002* ' @ " ?u"Qk@> *b" "bĀ2Ĕ?""$"Đǒ H 0 㿘 X> `*  @  ` *="*"x= 㿘<? @?,!< \  0?> rI"Ѐ?2㿘ȐL3㿘" (`\{ $2x  @i "`hp  k +Jƒ  2f 0 啔 > *] Y Y " "`h@2 "``@O$` "Ā @`h a>a ,`.`h$`$&a>`$`(&a&`L`bx$@$`< " 2 "` $`&"g"bx"$`,&"" &"p&!< a1@`( > $` "܀ "㿘"` ` "`,@`,`2` 㿐 `@ a2@M \` B J- , h $$! ( ($!$ L   ,$ , ,,2,,? ,",& ,? "$`2@@'.  "x<   $`Ւ$` `,`2 א$< 㿘 h  L` ` `$`@㿘  H /4 h* ' h   L",  0& !@2" N " B"$    @(   @IH 00H 0(㿘 L - > *" "!   , 2  "    , 2Ā2 㿘  0@lH  `0@lC` &` "􀢠€`("?`$> *` € &`$@"`$  &`$ `k?  `\ &`$@Ȑ&`$H> b 'H /f * ' @&" H !@"b> a@" a @֐a@a1@ڐa2@ܒ0!5@ے  a@a@>0!@"0 !6@Ē֔0!@Yϔ&€ &  &`,` H S@9p H 쀦 40`0`W 2  8 +  ̟@  4> r" > r@@ 2 \ 0G`$`@ `~ +N "z A "u $   6h 4>`0`  _ N [ A{ V RR`0` K N G Ag 2$@    5 ΐ1\ 4\ ` ) 4@ے$ 4@C@q=` 4`,` 4Iʐ 4\  @  @  @ H 0b > r ,#㿈N 4=! ⅔  3`N2b$ $ @j.   @j'  2`9b$%bȐ a1@Д @ 0 Nؒ 㿈  M` 2L" @i  2  @i  2  "8 "Ȁ`@2a`+ N 4 $a2@ " " \ > r#E 0"Ȁa &"2?!"$aÒ  㾀> "Ȥ"' # `9&  a2@Y"Ȁ! &"2?!"$!㚒 "Ȁ 2  > r\#P㾀> "  ' 08Ȁ` +> r ``8 ( "a\ ch00E{a`2 ` > r&#㿘  '> r 08  ( " ,\ h00EN , 2㿘!܀ 4!! 2+!!    &!&!$ !?&! / D 1w b b bП€ 2  `B > !€  ݠb "! `B > 㿘> !̀`> rc@ѐ `!  `!Ȓ! !!@&&`  7! 2" $!!$! $! ! $!:^  <`B<  `B <  @> "  '     ` ` .`   `?  (.`   `?  & /7 .`   `?  3`!@  @ sb@ /7 .    `?` h!"݀@#b0Y @n Q   .    `?  .    `?:b (@NȀ 1       .    `?  .    `?+( (@@ ?*@' .    ` b > r#㿘H /f * '  \ @ ;6 \耢`@ H 0㿘H /f * '  \ ;6 \쀢`@ H 0㿘  ԟ@  `B > 㿘 h  ) + L "%   "! "`2D  ` / "ؒ   `B  < `B :}㿘 \`> r> r#Chcȁ   "`"` k(  ,\" ,`"` , 2㿘     "䀢`@@㿘 ` @ `k? (`,`\ 2 k`,`""@ `k? ( "`\ "" k"` k@ `k? (`,`\ 2`,`2@  @!<@""   k . k=8㿘 @ :     ">>>>Ԇ`h@"""""""""""!<"""""""""" ""  ⼀" ⼁㿘" 2 z 2   2 ,k&" " >>>Ēa""""""""""""""""""""  㿘L" ~ 㿘"@  k` 2    2 Dd ?  . & 㿘  h >>>>>"(c pܘ"@&"&"&"&"&"&!<&"&"&"&"$  㿘"   㿘" @ "  '> r`$ \  0 0B ,`" ` , 쀤 㿘 ڒ 㿘`㿘"3@""*    " >>>Ć̒`""""""""""""""""""""  㿘" &  `k? ( ,`\  沒   2 7  2` , 2 @   " 㿘>!p>>>>>>>>!>#8``p!a<&"&"&"&"&"&"&"&"&"&"@)  " @Đ , 㿘" @ , @2㿘@] DE 㿘@ "?"  <P,<Tl猝㿘 "`  @|      < @ @h <  `   㿘 n% m  n 2 > s`@d  > s n @ @Dא Ӑ   *@*` x*` y*` z*` {*` |*` }*` *`*`  X(00*` *` <*` X(00*@*` 0*` 1*` 2*` 3*` 4*` 5*` *`*`*` *` 㿘     |K $ $> s`"`2`` 2`2  2  n2 2 2 @d\ ,, ,  ,  .3W  , , & 3P   , *, +, ,, -"4H /f * '  JH p@㿘  W   |Z $ $> s`"`2`` 2`2  2  n2 2 2 `@d ,` ,  H & H,  ,  @,  A,  B,  C,  D,  E,  F,  G,  H,  I,  J,  K,  L,  M, "4H /f * '  H p@㿘  k <  6 @0@@ < ` 4 6,*@$ `㿘 D  , < "  @@@&@@  2 < ,ޒ p> "'b@   /> s /2 G  4 > s> s 8`X?z0,"  ۓ 2$ " $$ $ `D $ `D "` `D$`D$  . @ @  2`, <@$ |y " > s p㿘   t"?@x@~@ `"  "`  ? "& &  㿘"  @ " *6@ ,6` .6` 06` 26` 46`  66`  8.` 6` 6` 6` 6` 6` "6` $6` &.` `| `@? `<2  2  .2@02`22`42`62`82` :2` <*`2`2` 2`"2`$2`&2`(2`**` <* < <* <㿘 |E  < A 2  > s> s> s `= "`4 > s> s> s `=" 6 > s> s> s `<"` "`" ?"&&  ?"  @ 2  < @@@E < . <㿘 < | *  @4 > s> s> s `<Ô" &" ""&  `"  < . < @ @ @0@" 㿘!X [ 2&" }$$!T$ $  $ $ D >a> ,c \ @" @' 㿘"  "  > s> s> s `0 s> s> s `X s> s> s `<)#&㿘   D& `  `d`z&`d``2`d+㿘@ar 㿘@ak 㿘 `"   `: @ x  㿘   )  ""`  `@* 8 2 2 2  2   2 `" `  `> s> s> s `;#" ` 2  > s> s> s `;# & @ `u㿘!P `?,*  H @  & `  `*"@`@ > s> s> s `;m#&!P  <  X\ x  A 8 2= Є@@ 6 8 22 &%@ + 8 2' }x@   8 2 沄@  8 2 @   8  2 @8  X k( \@?А*?** 2 㿘` 4 ` > s> s> s `0:$   &`> s> s> s `:$㿘`` @ > s> s> s `:ڔ$# &&`"  > s> s> s `H:͔$(2 @> s> s> s ``:”$)``"`& `?@"&@&`: 㿘 @ g    & & &  & & <& & "$ 㿘 @ ` *@`.`< . 8㿘 @` @.`. `. `. `. `. `. `. `` *` * 2 2 . . 㿘`< " `* "  8   @ `  *@`.@  㿘@_  2  `@_ `? <* <㿘@ʒ  <& ` . <@Ð * < ` . <. *㿘 | +  t $ `> s> s> s `:$  " 2  a r   & `& |㿘 t    |> s> s> s `9$π`& | 㿘 *'>2 2  ` `  \ |     > s> s> s `9є$ L * € 2J I@  <  t  > s> s> s `9$  `! "0 /@ 2+ `2(  2% $@ 2  `   2 `@   2 ` @  > s> s#89cP@  @ \㿘 \G |`>>"4.` € < `E. <;@8 t $& t <  ?> s> s> s ``9O%"$ <& tN & \ & t < $ < <`. <0@ & \_& \> s> s#89<cx& \㿘 |`<  ?> s> s> s ``9%K"`<㿘 *@``" p@ <2 p *2 p " p *  " p㿘@̐㿘 < ` . @@]@) <  Z  . <& l@ *  <* <* *" l㿘 < 0@o@I < . <㿘`   * <  `&    `-5  " * <`& 2 `& .` "  <`& " < * . * < `. <s `㿘 .v` `& < @Q㿘 *> s` ,  <`@. <S 㿘 V 2& `` * 2& `㿘`㿘> s`㿘 <  2  d * 2 d d ?& d d  P X    >  d ?& d d" d㿘> s ( l '> s)> s+> s   c8&Q"  ? $`" @ 㿘   n h "d m T n 2\ #> s`@]M  P  L    > s0D> s n @C  ; , ``6@6`6`6` 6` 6` ] & n @'    @@]   d ?& d`D` `d "`  "$<8 "  "  2   "   㿘> *"#> 0!㿘" # > sF  &"|&"x9) 0> c>>> b %ܚ  6 \& l&!&!&!. h. j&!&! &!.-Y D & H /f * ' > *`&"""b&""H 0  㿘H /f * ' "`""""b"?""$"$"H 0 .  㿘> *"H /f !Ԑ0] "!€ * ' !܀ !! 2!!    &!&!$ !?&!H 0 F  @ɒ  ` @ʒ  ,,  +    2 DE0     ?$ $ $  D$h     $ $ $  !,`<@`8 ?$`8㿐`(҅ !@@" &``(~ 0> s!@#8&`&`( 2 4@`H@!' ``> h 3!`` > !@ ' c  2`T 7 *@   ӐF .   H /f4!* '!   !Ȓ! !!@&&`  7! 2" &!!&! &! ! &! H 00-H 0  `B > 㿐 a@-  a @a@" \ a@"(a@",z a@"gt  \ 2p1vl " ? @e6 \c6 \#@8\ Z& lb| 2 )d'Q)X  2K#@* A 'b| <> *#` @b| b` @ "bb|@2b  2#b|  @b| @ &b|!@@ b|' @ 㿘> !`"(&    l  @ ,  _ @ ",`ʐ0T4` @4` & a@` & (`D  " H /f * ' > <!`` @``&`` > *.Ԑ> *& ` 2" "`"` "`> *Ho  "`> *@.`H 0㿘> !`"&  '& ( S * & a@` & (`D  " H /f * ' >  `` @``@&`` > *.s> *& ` 2" "`"` "`> *@Ho  "`> *@`H 08@~   !//'@t D  '/'' +   4ߌ `` `` ``8 ` "`8` ``8?"`8   "`"`㿘> -!㿘" Δ 1> s 5ؐ 0?`<6 \> #>!>b!  "&!&!>>&!&!&!<Жؐ _&  _Ғ  _*<ѐ  㿘<+[  㿘H /f  !>!!€!* ' !܀  ! 2!!` ` &!&!"`!?&!H 0`  B?> 0ȁ㿘 a2 a13a a A 0!560 !62 6  \ 6 \ ` 2 \ @+ \   @6 \ ?6 \  k !. k/A0 /= = `4"  0 _w8㿘H /` * ! > ! > *#̀`#> ` `@c8@u `2`H 0㿘> *`0 `H>  `" "!>  `>cp  ` Ғ `4 `< `h `l!@8&`\0倦 "` 0"B 02 `4` &`4`4a(> `<!@` ̐`<> `h`0,`< X4`<&`` h `X `\!@ `l &`\@" ` ``< @  > t 8`<`` `h,`<`X4  B   &`H> t`02ڐ 0~Ϭ O > *> *#А`##"@ $``4$&`4> *c̔c̀ $@c" "c$`> < d ] `<   U  2 0`  <  2 0 H &```< ,` "x'9 > !耢`> * x&`<`@ 4` ?"`   $ *&`@(> *c?"c@`"``"``?@"$@$`&`H`4 ;&`4` "!> *` #`$` $#` 2` ш 㿀)> " '  7 $$ !@$(` @$>  & (4  4`(  4 4 , , &є `&͔ `&ɔ `&Ŕ !  // " > t  P㿐!>  Q "  ^// /  / / / ذ `"`H @3'> t``1   !@@ "  @ '> t`1Ր  `2`` `0> # ( \  2  \   &W 0 \ > *#Ȁ`c*> # & ?: @6"     $ $   #Ȓ$ '#  2" $  $ #Ȑ $ `'# 9> *  #`$ '# 2 $ $ `` 2 ``> t2 > c&````"C `4 ?&`4 `> "8 > &``  @ $ `@`< h `"x"x > !`4``` &``&`4 $ 1> *  #`$ t&# 2 $ $  㿘H /f * ' > à a "a""?"H 0 1 2 > t0        *   @    h@@ 0 0h> `"''` ]'ȢԐ%Y %T > < d@`Ȁ  0D`0<@20 `h  `\ A A`@20ސ d< @ <20 `@20`  `22 ̀ bx'̐<@Uu    > ` @Uj   А@'> t`0> 0ۀ Ѐ'@zܠ8> ta00+ 'Ԑ`(۠`?В@J `0 = `@U+ c4@А@G'ܠ8[> tah`0/ 0< `h @2'< 08D> t8a@''ܠ8;> t a/ט`0 /$`<@", `H" `h`H "$  `h 2 `h`T"  `h 2`T А@'< 08 > tb`0/ 0E  `, $? ` > > Đ $`4 ?$4` +$`)> * $` $``#Ȓ`$`%#a `@2` $`$ $` `#Ȓ$`%#` 2Ub # ̒# #`(Ԓ @w  `< h`` h`#ٔ 0   #Ґ#Δ Ԓ#ʔ  (55# Ȁ 2'̒# (4`   //a b > t "PP   > t."` 8 $ 0`"  ` 2*`&  4 ?$ 4@ D ' ' < 2!@ v Z P>  *xx @ * " 2 Ք 2 8&  4? $& 8 0 `" H`򀢠4 @@i D ' 0'  ' v"  㿘`< ?"x`>`$!&`&`㿘      *   h@@0㿘   /  > *0) '0%#` > *#  #> *cԀ > *x @Sm  > *cؐ " > * c"  $c> *Ր#㿀)> " '  4 $ $ @ $>  "   54`  4(  "x 4 4 , , " " " !  // " > t"p㿘> *#Ԫ` - > *> * "c"#'> *%> t#> ??cc`ܓ2 : 9 #"?cԀ %#> *#"f > *#ܒ"a   3㿐ǒ㿘 2> t.ݐ"0> t.ِ" > t%> t#> t.ѐ? .̐b 4> t.Ɛ"㿘 > t."> t." > t." > t $" . 㿘 > t # . 㿐> t.#8 4> t P#H T `#\. 8> t.# > t.# > t.# 0 <> t.}# <`"> t> t#.u`0 @.q# @> t.m# @ > t.g# D h> t H.`# H㿘 I > t.T# >` Õ 0> u.I  """""> *>  㿘>    @2  $    2  8O       `""" $`$ ?㿘>   "  2  - 8    """ $   㿘>     2   "ْ 8㿈> *'L'P'T'X'H# ` "#$ #``$`0  ` :  2 ` $` "& @& @ `"0  "@& & @```0v> <0s  $ \`m 2Mu  0b"`"`8 @2D > < d'' ` ``h`0`'`'`F ` @2` 2@8 ? " &`lW 2 &` > *"# `` ``h`0`'`'`2`0< 8 2 `H$ 0 " > < d'' ` ``h`0`'`'`` @2(@8 !@@ 2`?`>!*` €` ( &`k &` > *"# &``2 `` ``h`0`'`'`2`0 "\`<  8 2" `"0?@> <`d `d 20(& `d` ` 2`0```h` @@  ``"~@ 2``w&` ` "`` "` m k i&` `"d b  d 20 <@R  # \`K<  8 2 "  `q# 0<?@`d`(& `d` ` 2`0```h`# @@  ``@ 2``&`  `" `` >!l*` € &`@<<㿘H /` * !   ?8 #&   "&  \ 2& Ð? H 00@  & j 2 & > *"#& H 0㿘    8 ?    \    `@ 㿐> *c쀢 R H /` * ! $c> < d'' `5 `h`0 ',  ? $   2  ` @M   @H  $  $c 2  ` `h`0 ' ' 2 H 0H(>  2    2H㿈 j  @> '# `$`  $`$` 2* *2" ""` ` ?$` $`*, $ @4 4 `> `  $`$`   ` @ '//   @. > *c`  "` 㿐` @ ` > *# J $   *#\> "y 㿘V> < d"  !@@ 2 0,( 20 2  <  8  ?     * H"*  @"   *  @   :@2㿘@   . ``:` `*`?&@ #: . 㿀> " !'@  !@ 00!@0  " r@} > < d   2 0 a@"'a@"< a a@|a@2 !0a#@ a!@u !@  !a%@k !      2 0 <@2 0 !@2  "0 1  I > u(g k     pH /` * ! > <$ 0`d` 0$ 4`""`  8  H X $$ $ , X, 9, 8\ "$ , H, I$ $ h\ > +` "`H 0/      "    < ``0` ` 2`0`< 2`0` ` "   1 !@"ٲ  a@"\ a @a@E0a@a@I00!!@ " 8 0a4@a3@ }!#@ "\ !%@0w& <& @& D}& \ x  H& L& P& Tn& X& \& `& de&\ b H /` * !  H' L' P' T'$ H$ L$ P$ Tᔀ a $ H$ L$ P$ TH 0."   $    H$  ۔ H 0  *”  H /` * !  @   H 00$ H 0"$ ,$ \  H /`4 9* ! 9   2  8 & <& @& D & <@20" 0 @0 $ X4$ \8$ `<$ ,$ d\  ! 2\@  $ H$$ L($ P,$ T\ "! 2  $ H$$ L($ P,$ T*4   `  @h   H 00 $_ H 0[" H /`  ð. * ! @7 2 0)Ւ 0`" 4 4"`4> <" h 4? 0"$ 0$ 4 l "$ @Y$ l$  Ԑ?$ $ H 0"@Ŕ -ᔀ " " > u 0> "'2 > u&+ @!@ "!@"Ȱ -0!@2ð - @" 2  2  `  2  @  "  8  !@ "4l!@"  -0!@(l - @2 @ @ǔ Ò "  //ѐ ai@ʒ  @0ll @@ 2[   !@l     `2 l  2  09 1!@p 8 8t\  H Hm0@!i \&&  @} @\  8 8X\  HP H XL X a} > u h㿘@x> "'H o&*@g  (`8&`8'`<`@&`<''&`@ `D&`Da' a  &`8&`<&`@&`DH 0kH 0> !̀`> u`@e &@`8&@`, 2`, ?0  ??&`,`,&`\`,`X &`(`p&`$`\  `,`(2@&`L `8 &`H`<`@&`L`D&`P &`T `I '  @"T`\  `l  8 'ܐ@&`l '͒ > uސ 㿘``L ` `     2$ `<`\ > < d "+` !@ a@ \  " < L \ 2 0@ 2 0  "  0 h  h 2\0 0 2 ϒ  ` $`㿘` 2` T `\   `L`<`\ > < d ":`\ `\    L < \ @a@@2& 0 2# 0  2 0`\ ` ` ő ` $` \     Ń    $  2 `\ ` `  q ` $`? `2!`>   "``"`2 <"L"  2`@ 2`\ p> b'H /` * ! > < d` ` 2`0` `h         2     j&  64  2 H 0b  &&  d 202&  6H 0I  3 `" h & h "`h"h&  a // ' a1Ѐ  `"  "` ? "& &  ` ϐ?"` ¤ 6H 0  H 0 > uZ p> b'H /`   % # * !  ? &&  `"  "` ? "& &  ` ` ?"`   /' !a2АK 6H 0 > u  㿘&&     & > u"     & > u" 6 *`2``` >  * 2`> +(2`* 2 @2   > +( ` * 㿐#> b  !> ;> u a#\     $b 2 2$  7$ @> #K> , O> , cS> , W>,  0 `8$ H /f4@* '@$ $ ` &`@" &@ > ` ` * ` $ ` ` *` "   >` ` * " > `@` @ *` !$  < ( >@ @ `@` @ *` $  < ( >@ @ `@` @ *` "   < ( >@ `@ @ @ `*`"   < ( >@ `@ @` @ *` $ H 0& ?$   @2$ Ԑ!$ l$ ԰ 㿈 @    ` @> < d`" 1 > 2  8 2    ` ` `_` `ݰ `< 8 `6`@, '@  ,İ 1 2",2  3# 2 ` )> ;  #\ 5`@~  "   @ 䀢@ 2 0  #\5` @l " ` @R  2` 0`& 826 > l > > "b  ޒ #r "X> > " b*`,` 2 2` 2 /> ;a$@4/> ; %?* 2`@45`: 4  a  #\  8@ ސ26 >3 1@/> ;as@4/> ;  * 2`@ 45`( 4  0  #\  8@ ސ6 >@X 㿀 @  ``@ؒu l!"` > u ! " i  " d / N> < d" 8  ? <2  8  \`" 8L&  8 2 8 @R`  H@ ࢒ 2  8쀢 ; 1'7 `'`'   >@ " 8% 0 2  > 2 `> 0   12` 1$ 8 $ ( @4 < #\#`    @w 㿘 @ `> !!` & `& (`& & $& (@6 < @ `@㿘 @ "` " Hx H " l l!@  @ 0@1! H /`4 * !   ` "`" ? "& &  Ā"  ` "`" ? "& &  ̀ " @p Ѐ " @p Ȁ @t H 0 ܀ 2" DH /f * '  `"  "`  ? "@& & ` "` "&&   @ "`"`  @ "@"`?& & H 0> ; a㿘`  @x&`  , , >4  8$ 㿘 @  @2`@a0   @^&`  , , <4  ($ 㿘> !̀`> ua8@ ` '``#= l!2  (2 . 2  @    怤P H   D@& H 4 P'' 0 ' ' 4  <:  4  v Ŗ А㿘 H & H㿘@ \/  7  / @  .2  2  >-`2 @2 `v  l!"  , 2 0 2  4 2 8   ,   ,  ,  ,@D   2{   2  2   2  "    2@ 2 @ $ 2@ ( @  `   `  ` = @CՔ  2D  <2@ 3 2/ ` 2+ ` 2' ` !  l!2,  (   2$  <2   8" 8  8 `2     `"  6    O㿘 H ; H@ $ @ `$20       $   (   . .   ,&  &  $&  (&  (   . .   8&  (& 㿘@ `  @28 8 =?"8&@2@@ "  < 2@  .` .`  &` &``@ @` `< \`"`@ 2  4  2 4 ͐ 4 > < d 2  1i &@< 8 2 8" 8> < d  2 0  8 1'  8㿘 H /f * '  `"  "`  ? "@& &  >    * ` &    *` "   >   * "  > @ @ *` & ` "` "&&  l!. (  <@ >@  @   * `&   * "` (  <  >     * " (  <@ >@  @  8 @   < ( >@ @  @  @ *` &  < ( >@ @  @  @ *` "   < ( >@  @ @ @  *`"   < ( >@  @ @  @ *` & H 0㿘@.6/ 7 @   *  8? l!2/ (2+ <2' >2# 82 2@ `"  "` "@&& @ &@" '@&  2 l > "` ,,> u!H23 㿘` @. 6/  7   *  9 l!0 @A  2+ <2' >2# ,@A  2 `"  "` ?"&&  &" $&  2 l > "`> u!,`> u2`!,> u!2`㿐@'  : k  ` #> ;> ;  . `2`    * @ "@ l!2 >7 @2 < 2 8@2  ( 2   2 l 2 @@,`7     * @ "@ l!2 >7 @2 < 2 8@@2  ( 2   2 l  > "`> u!7  `"  "` ?"&&  &" && 㿘  : j  ` #> >  ! !a .a  2`    * @ *@ l!!7  >@2 < 2 ,@@}  2  2 2  $ 2 (   2 l > @@_  67 a a     * @ *@ l!!7  >@2 < 2 ,@@?  2  2 2  $ 2 (   2 l  > "`> u"?7  `"  "` ?"&&  &" && g hlghhhhh8hhHhdhhhhh|hhhhhh㿘> "H> ; 㿘s 㿀& &  'T'X& ('P'H'L` r  :   @. :`U> "L" A ( 2  > ;`r"Z 1> <!& H /f * ' `` @``r&`` > * > *& ` 2" &@`&` &`> *Ho  "`> *@T`H 0> ; "  H 2  @  " A> ;``  "` 㿀> ;> `  '"` `   u/    Q$ i  `r_"E"@̒   //`> ;   `rK"1"  ` 2`'@`>`@2``@h& ݔ`@@ 2`> "`r"" > u"@㿘``    ``2t `n.`>"L € i ` e H /` * ! > ;`ȐH 0 M > > "04 D ``l ?"`lH /` * ! SH 0' !# %R@#     - -> u"P qq㿘H o*@ aĠ H 0㿐6 @      0""`0 >  ݘ"0 >  ݏ"4  > ;  އ   *> #\"8ݸpdpdpdpdplpdptp|p|ptp|ptp|p|p|p|uuupDpt8uurHuupprxuuuruuuuuuuuuuuuuuuuuuuuuuu㿘> "t > "bx㿘` @ , > ;a "a`?@ ` 2%`!  @* @          > ;a` "` # ` @| ` 8  @ @*  8   (8' n       o( ` py d ( & ( &   " ?@& `( > u͐"`> ;! .` ``" *"` "*  `2 *2* 22*qޒ   2    <?쀢 : > u"p ? & & & @& ? *@  #?* * 22` " `" :  : . :p0p 㿘"   @ @ 㿀'L'P'T'X'H '@` $> ;a` "`@8 @ :  r 2 > ;}a "@& & @ > ;a` u"`  "@& & (h> ;!*  `" `(] >"*` €{>"H. €   la ga ba   `#w?`#a  *`@`<  8 "Ia  )2 > `C0@6a` "` `*``0r @ 2 a`  "` * >  "&`  h` > ; @ɔ` > ; " > * * b  * `@  ( 0ڒa` "`> "``2R/  # aK/> "d`> "`` `  # a`Đ "`Ā`v @/' 1' > "\`` $ka> >  " b"   `  /\'  2    \ 2L " L&   h`2   @N w  avza``  "`* # @g b@E0^  > v`> "p`Rua`#( `  `*` @`8 a` <"`> "$` > "$ >  "&`  h`2  ( @` & (#\'   耣  > "t`> "x> ( גbp耢 kS @']0nSp>  " '  'u-   ? ?  <m $> < d  (!@@20<@   \`"0L@202-<@  * / (   " '> <lT`"Tm A= <P`B @:P`8 ?"`8< $ g,`@   ` k   $ "@`; "9  D 2 @    $ @$ $ @    (  `ހ   4    *@   $ "4@* @$  "`&  "&   ֔ ? @`6 &@  > u"㿘   , "@& & 4`@K"@4`  "@& &    @Ӛ 㿐@FT@a* &. . @Β#㿐; @  " `0)3>  rbt5> x  bt`  &xpbt &x > ;! V!l   *#\> "|نH  "4  4 @ 2- `> @U D' 0 ''  8  P:`P X:`X `:``> #D>a;  㿘>  " < %X\  `   * $ > `< l> "̔ X b̑*@( !' < l   "X\ "\ 8> "' 2 4> uא"  20 X@ג D  ' 0' 4''@ '` '`'`  v'` > ; b> * *   *    `  b "& \b > uߐ"㿘> "h> > ;!Sbl`?P 2 4> u"ؐ  @ D  ' 0' 4' v '` = 㿈 @ .  @ @  2V  "`P  "  ? @'2`'*@Q   /7//  m    `m  kÐ" 7 o첒 > u!# ` &``  " @&` 4 `" &`` @&` 4`㿐>   ?> c"  S}* @. 4@ 4@ ?#> c #> SV b @"  @. *`  + 4 2 4 $b<l㿈' `1> x `> u#\ ` 0   X> uc< $ؤ"o""""(7777> <> u77ʐ!Lc`7#\    Ø > ;> uch##\       gN  > > u-#p #@ *"@ *`" *  *  * " * "> ;b: > <> <#> +`*@@ 6*@> !  @2> " +`" + " **" "@ * *`  @ * *` @ * *`" "@ * #@*`"@ > ;" ``2 `4S```"`44`4:+ `4@ #> <a> #"` d d" > c4 > (c8> "cD`@  ` +` `* 2 *2  (@  +``+`   > 3 +` `* 2 *2  (@  +``+`> u> <cx @7m > u> <c @7g! > ;> u#c@7a 㿘H /f * ' > <` ` """`?"H 0 ` ` > uU#@ 0ց㿈> < d`a'D> < l`" l   ll  'D  P$ D 2` 2`l`X A"`X `<`l` 9"` @ lo 'Dl` -"`   "  2  $  \`2 $l`p "`p`?` l t `"  " t @q  l` "`# @3 $l`t "`t @Dl` "` l` "`$ D 2"@ "" kŐ D h` D     @͖  D D c( D>    `@ ,``"c@ D `: 2 `0" D 2 " @ 2  '`(@ "   \`2  < 8 \D`  k 'D > # `>  ``D@   Rl l`$ "`$ dD     0"  @20 h    22_ l|8 "|  @ ( "(hD0.LJD h`>  >    @ > #`> !`-D pP H /f * '       $@[  D#\ @a@ H 0 ɔlD@r0 ?@~D`   k 'Dl`  "`  > <"    2  @2   @2  @"  2   "2  4 *` `" l`` "``  * 4 *  3 l%> `> \`X  $`@ `d> <!L,  \`d {$`d `$\*D" @" q'D`@ $`@   `,`4 > @> !`El ΐ ? ` l< : )8 6 4D o H /f * '       $@[  D#\ @`z H 0  ll(D`g"(04> ; "4 b @ > * *   *  D  0g~D㿘> < d O ??c# a@ A  <B\ >  , ( @7> #<``"- 0`2) 0\ "% 0 L8 0      2 02  0` `!6` 0 2  㿘`  ` *`  " & .& > ;#;  4> <> <bb &@b" "b&` <.` ` .` `6` &`   &` &`3 `2iT` ``   `  `   + `2` 2> <` ` `  `@` ``  (```   $ `> < i`2`"2`8``  /`)>  @ "@ "@f` @`"``"``?@"$@$`> <Ȑ!L#\?` %#\`  4`2 @` $` " &` `  $ $@" %@$`  `  `` `@` `  u `? @c *   > <lh`@g"hc ` !> <he&@s!L> c\?`"c\  eL#\?$#\hM2 5``%` `%`@`"``"``?@"&@&`> ;#G @ * @& @  *  "@&   @& > <l`e"> <!L"> c\ ?"c\㿘 "?'> )> <e ` "` "$ $!L\? $\`"  "` ?"&& > ;#㿘H /`  > <Ӑ '$4* ! > <"'> <> < l ? *`  `$` 2 4``8 ې?"`8$4H 0㿘> <b  > < l `"`$`" 2`㿘 2#> <l `|"b> #X*` >  \: @?> <x   `-` `  `5> ``  ? $`D"{ ``Rت%@`2Ԫ%@> #,`"   ߦ $ (M 2?`%@ն   '@%@3 `2  (C   (n  (@'䀢  <`%   < , 8 @ @ ?  ? >  ` >  (#   <` (@'䀢  <   e,$ ꀢ{逢`w 2  `` ` ?*` `j'I%@ ?Ȕ   "   -$@W %$@  O&` p ' <   => `  (  /. 'ܒ ܒ  /%@` `` > #`@3    ?  ?  $  > <`l`P  "`P㿘> <!<?` #> <` #> <`8 ?"`8> <"!4  , ,$ < $a4a4   @ > <㿘> #@ `@> u# Ò + > x`?2 > > x"c"㿈   //7' s "K  4 $$2A 8 0 `: 8;  > ` `.a@2'`` "#` 0  @2     `@0U 2   8 ?$ 8   2``2a@ 8 ǐ?$ 8 㿘!> #  aE  #H > #@+ `& > u#  @ #> x`* #@  "@ > u /#?  *`*` `   @   %> u#@ "@ @$@ > x#@ `$> u#  㿘  @` , ?V"  "`&  "& @* @@ $@㿐> #@ `    > v`  ` `  #  > <`' 2 `> <l(`b"(0倢   2  %!4> <!<   (`@> <")> <> <!4``8 ?"`8%!4  ,,`!4$" ` !4      0` D8 c\    D`@8e< `?,` < @3>  4 0/>   )> #(`%$>  ( >  @#<,` ( >  4 "` 0 @   > v   <> #<`  ! !4 @ > < l(` "(> <`l$  `-"$, ",,A> !X* €  !4    \   < l`l`L "`L > C %!4> a> #$`!4 4@8 ?"8%!4㿐` ? ?`> "`*` €`> ",` >   #,!>  #4#4` !> #D 4> sc8w$#D4 s!> #D o k$#D!>  #8> cD_#8w 0Z > < n Q > <! d G > ;#Z => <!#\   ؚ1`. > < l Χ $`! > <" Κ 4>  dͲ $>   -#\#`;p> " @' @:Đ? {j  &@ l    {^ &@ l &䀢 2 ؐ@r   /؀/X77ؐ///ݔ {8 &@@  l`@  {+ &@b > v㇐ 8 0@P`p@ 2 22 > ?2 ᘄ > < (   2   @2 2 L2㿘`d>  ` 25 *` 0>*#*` €@'@#@@@@@@ @@  * `㿘>  ` ) * ^6 `k&`m`j  * `n * @s @ @@ _㿘>  `  0a3@a4@ 0@40@㿘H /` * ! :  4& 8& <& H 0  H 0?& & &  1> @*`> <# (  " "@ "  " 㿘#> `h > v R `PVp V 2M - R ``F -"D ` (@ ``> 9 `` ""``3 0> ?ᘔ  8a!> <"b> <"@!> !> <" >1 #c#Ԓ !> <>7 "hc<"h˒#!> <>7c"P "P’#`h > v`"  㿘H /` * ! >   `#> <> <#, 2 * @*`@`  @u  *  2`@ > > > <"#"`6 > <Ő"h> <"P b*@ @Z b> <"@撒!b 8> " > x @$b> > " "``H 0>  h`> v`  㿘>   @ > <# `@ P@@& > <> <"b @ *@ L" ""22L $ @  #"@ "  "  8  >  @ "`܁> ܔ   " "$  >   > ܀> <"  *```*`>  "  "   8  #   "   >    "@h> "' "~  (z  `( s *` > <* c  > e 0  "  2 \ 1 2Y -` T`\ > ;Q -   //'a a1Ѐ @H /` * !   8, ,  $  $ $ $ $ $ ݒ$ H 0>  `2>  h`"   "> v> v   > v#\ `    > v p> "' > ;   //' !a2А@- P" > vb!㿘 "S  >  `  G *> <  * c  : 1H o*@ a `> * `* `24`*`2    ?* @*` 4`H 0 h > va`  㿘>   > <#`   P`P@&`  > <?> <* c*  @  > <@ ?@ > <"4> <" @  ,  L`" `""```2`2L $ @㿘 >   `6 >  `  P`* @(@ / &@ > ;`L& p& p㿘@& `& & D& 4& 8& <& H㿘@ t L`" @\` 8 2@`"  "` ?"&&  88>  >  c' , P "  `   P   ,@ $H /` * !  >  h`> va( (kH 0 > ?2` 2`2 2  ᘤ > < b, J > <"7> v5> v3> v 2= 28 L"4 *`2    #\Hp>  h` a L LD$ L$ @ @ ?-@ ` @\ 8`2  2 -  J>  h`> va ,@  @2 @2 @ > <b @?*@$ @   x 8   H 0 7$ @$ L$ t@ $@" "$ H 0 " > v^!Ё@> "  '"J  , F   ,@  $>  h`> va C H /` * !    H 0 1@ t& t`"  "` ?"&& D 8H 0 b > v!㿘   hsB m [A?㿘>  h` > v b   $   2 #> `#@唐  $`> v b(̐ D  @8 ? < H /` * ! > < `" 2 " H 0@r` `   h`$` $`,> v b`   8   沑H 0 7 [     ]v 2   8H 0ذ 7> ?2` 2`@@ 2 @2 @ !> <@ @,`@   2 @2 L " 2 L 1> -` 2   > <*@ *`  2`  x 8  4 [:  *      ]   *` *`*` >  $``>  " 6 > v b0 $0 8 8Z2H 0Y 7 $ > <$ $ @$ 4$ 8$ <    *< ,` #  P+ *@  &+ 4 > ; $ t$ pb@ $@ " b " $  $ L  L` "`Β 8YH 0  ` "%%%H 0 㿘H /` * !  1> <"  4`> <",` -> <"  @ $?  $ @ ?- t` %>  t $ t t  ` h `%` > v b F 2 @`Ȗ"H 0> <#̒ 㿐 >   `*   $@> <*  c* ` @ `>  h`  > <*c * ` @ > vbؐ > < >  "<ܒ` &<, 2  > <*#@  *` "а      *`2    * * @  P `2 @2HD"@ "   +  "@ + А"@"@"@ *`" *  *  q" `.` Y  `  `  [`u 7 b&D&H`> *`*` *` `>  $`` ` t" ^ > v rb`0 7 U$`0  @ `` ` ` `" " 48 @&4&8' , 2  @`    `` @&`&`@ @B @ * 2`@ `P ݠt @2t"  @ 㿘沒 Y0   . `  `  [ `@_㿘$    @$?# @6$ VJ  G!> '#  &  & 沐&  X  &X03# Ē" @4ZԐ )>   l  l$ $  $  $  h$ 4 4 `$ `$  `4` ,` `&   `@vߓ*`4`  & @㿈H /`4* !       @V 0&`  '  //  @F >  h`> <#&* * ** > vc:c H 0  2 2 㿈 ' ' ?>  b  -    "     & 0 ΐH /` * !   2 tH 0g 1`* P ` 2!@` @2@`  @2@`$ @2@`( @2 @`, $@2@` 2@`2` P @  / $` @0$` $`H $`L $<`  <`(<`@$`$`<`8$`$` t$@@$tH 0 H 0  H 0 7㿘  @+Ȓ 㿘 "  ?{>  b v -H /` * !   2  H 0] 1   t$ tH 0O  t +    2!  @2  @2 $ @2 ( @2  , $@2     2  " ""`t@H 0J   H 0 㿐 H L"" ''Вb@ ??  O @ @4 8$ 8@ & H  + & L> @& > 8 8 @`C >` B@> 8> @"   8@8   $ <@  ~ ( @@y , D@r@r @ k& h @  @) 8& 8 @8  < $@ @ (@  D ,@@>@ @֒ 8 @`C >` B> 8> @ 8 @8  # < $@  " @ (@8  D ,@@ & H  +& & L> @> 8㿐`@ H L"" ''Вb@ ??3> `؀ ( @< > |`ؐ *"@ @ &`#` #` #` ;` (;` #`(#`, 8;`0 @#`;`8   #`   ` #`  " ` #`  ` #`㿀> ">  ؤ'  *'//ဢ''2'# ؐ SA  > > vc ِ &ࠒ   $ $ V> | ؘ Vߐ> <b`> ``$` 6 > v cH`0 $`0 > vצ#x.@@"H`(  :@""L:8В@?@#`#d?/@#`#dd``` c"@> xԑ*`" "#㿘  " c> x*` Ԗ     `@2 ` > v#" " " $& & 㿀@.4> x@" "Д$H /` * ! "  > x Ԥ4 ,@`v%@?/"?a` H' L' @' @'@?@@4 H0 $.  H' L' @' @'@?䀢   <" *@*4 *@ $ %@ %$   8 @8  < $@ @ (@  D ,@r `2H 0㿘H /`* ! H 0> <"h'#㿘>  b> <7> <"P#d| ,8DP\px8\    X> "''L'T'H'P'X'l 'p   'hl!l> v͐#l `> vŐ# @tt'll` <* @ &6> `* *` > <6&l8 "8. > @ h'pl #$@` Ȑ@ڑ @ ` 4 "@@2 @l` (@ " @@`8 ߐ?"`8$@@  `  ,,l$`($`l^( 2  l( > <   lC.< 8 2@ "@` > < d. l "+0"' 20!@ 2@ @2\> < l T A@< lP`B :P@`4 2`0< 8 > <& > a H /f * ' l ZI l``(`> v# ( `  $@E` l?'plZ #\ p @K6 lH 0p ?U "'p0H 0J ZT!  l`@` @l $@ l` @  lZ6`2`t 'dH 0l`$  " @ ː l? $c 2 $< 8 Xh@ @` < l$@9 %$@2`2@Ȑ@\ @ ` 4 "@@2 @l` (@ " @@`8 ݐ?"`8$@@  `  ,,l$`($`l)( 2  lS( > <   lC.< 8 2@ "@` > < d. l "+ 0"'  20! @ 2@ @2\> < l TL A@< lP`B :P@`4 2`0 2<& < 8  l ab3 `    .> < l T Al  T \@ "  \ 2  2  > < l T 3`" Tl'p  > <d`" d` 2`0`<& d` ` 2`0``h+   "  2 l  > `$  " l@  l? $c 2 $l@ > # `>  `` `2 l u q \ 'h0kl|'|F l \ `  1'p2 'p l@l`!2`? b 2 h` @ "   X   6 ŲH /f * ' l`(d@Cה 2  A'pH 00   lJU "l 'pH 0PclȀ  H 0> #4`l @"h  c_> ##:` 8  2W  (S      `?'hH 0`2@`  _ '$@"' 4  '  /'/''l'(   `$ \@``8 ې?"`8$@l``(  (. (%'p ?` 3 l @\ 'pH 0&p> a l W l!< 2 `$@H\`Ol A'pl`$  !<  H  @l l? $c !<  H   @[ l? $c 2 $ lIx * Al : `! ! .` `*:  `*:> a `> #`dl W1  d AlOe'pȀd"@ 4@"< 2!8816 !< l H  ll> <$l`2$x "x@n'6 l $ > rca,  "a, > wbT`0 "`0!l@N'p@l l'h ('p@> <4  `lX   l\ 8"\> <`l`L @"`L@\  'p 7'l; Gpl pl`"`p  !l@'pNl 'lp > <`l`D "`DȀ@#p` Ȁ`> `8 ϐ?"`8p (> #4` h`l @]Nސ> " > wV 㿐  -& N ( $  " '@L $?# @6 $' p > < l L  > ''#  & $$ $  $ $ `  #@6 `(& (@ = `**` $& %?Ȑ*:`@4  @ 4  & "@ 4 4 O   D&& & 4 < H   $ 6 $`x`&`x@m 4 `H &`H & $ Px&   444 < H  $> < 6 $`l`x  "`x> <`l`< 7 "`<@lԐ4 `  M& `2`㿘 !?` #` Y`@ 2$`     <" 6 KԒ  F# #  #  #  #  $# $ (# ( ,# , 0# 0 4# 4 8# 8  6  @#  > '  & & # 㠠   & &     @& &  & ֔  ``Д&`4`㿘  `,`쀤`'`  $?'> w `,  8 Ɛ0  0饔$@` 〢 ?& ,   㿐> 0  `     2K  6`"`4 * 0"x  0" ". y -"i   !F o *@rn "g  2c  `^>8 h*` €V.`q 8R P.`x 8L J.``l D&`l ?A&`l`l ;&`l ?8&`l`l 2&`l ?/&`l`l )&`l ?&&`l`l @ &`l ?&`l`l"&`l =&`l`@|"   2  "`l"`l " `l  ?&`l ?ߐ &`l ? &`l"  2  8 `Ā "#`H /` * ! ``"``"``"b`?`"&`&`H 0 ` #H /` * ! ``"``"``"b`?`"&`&`H 0 > `09)`04> #H 6/.` 2) '.`#L 6#.` 2 .`> #P 6.` 2 .`> #T 6 .` ".` `X @C`<*@ * N&`"L  E  Mj 2F "`  7 * 1 `Ȁ -  ) @D `'" $   @D`" `Ȁ    @C`" `Ȁ    @C `"  " `Ȁ 2   @G   &`  n     7 n&& 6 6  L"%" Y`2"AS`Đ?* 2  ?VJ `9` "`@C`<" ?* 2  )VJ `#` "`@C`&" ?* 2  ` "`@Cv`" ?* 2   n  ` "`@Cb`" `Ā "#`H /` * ! ``"``"``"b`?`"&`&`H 0 ` O H /` * ! ``"``"``"b`?`"&`&`H 0 - "*  (&  5 "  8   "&` &`"   2   &`  * JA!q # 퀦 0(OS  * " q 0T ! Ԣ *HC '` "$  $ `` ŰH3 ' `L$ >7#*` €D`qB`x@``l= `l 2 `l 2 `l2 `l2 `l2 -`@pH ' $ `l  2  G ' $ " `  "` `` n"Gݐ ' $ `$ >7#ԓ*` €`Ȁ 2 7`Ȁ 2 7`Ȁ 2   7 ``Ȁ 2 7`72V ;2@  h`Iu2   Hٖ( `2$ Ig$ 7$   2V Km G ' $  `"@ G| ' $  `"@ *㿘 `I9`&`  `U I-Q La`   F `&`  帒`@Ғ `$4`  "0`   `- )'``2$@` ?&` ,`厔 剔$@` ֐ ` ,& Hݐ x> "@'  5 (  5 # <&@  ,4$ $,4?`6>8 *` €"/  2+ > <$$ d`" ` S!@@2`0`<2`0` `  V\@"  1$"  2  ,"  2  8 ,"  2 <8 @@ 2  #> < /'ؔ *"؀`  `<  `4 ؐ O '؀ " 1 < d`" ` !@@2`0`<@2`0` `  V\@  ,  ` 2 @2  6 0*  o ,` 5\  *䔒 54$ l ;ސ ,  " c 7 _4"\  2X <8 @@ "N  > <  d`" ` x!@@2`0`<@2`0` ` "2 1   ,   ` 2   2  2  1, @ 7 6  , @  "? & ?4 - b@@@ b  5@ 5&@b > wb `㿘 E   &0  # -0+ ``"` @`> < d`""` 2`0`""`<"" `` "` ` ``"` `*  -㿘   6   , @    &  C 5@ 5㿘沐 H4  ` 4 `@f9*`4  㿐  @ +   " @fؠ * ` 7 `  <c7 `   0 , 2      H 0 2@ <XXXPXX`tX㿘> ?!˥ 㿐 > ?> !  `!"`@ f'`l!2^`S`P (2V` `y`" : @2N` : " `8= "E``8 `"`(@2:``(` @22`-沔 G  "&l"@ ht@  h^  F " 'F'X@'`a@2`l"# l"@ h H@  h^j  Fm Fg\X@0     P > <FX> < l 0 4" 4" 0㿈 'P'T'X 'H'L l d !`  ?`#@  F  2 qL 7 .`6` y.`  6` 8&`&` x " /.` ?#F2 ( @ "`  `@ *@6`F  > <^6`> <`l`\ "`\ & (  m H " A㿘`  P  LE k pd1  0<;m9 0' `" ` 8`  ` l  ?$ l #Ee| C ' "  l "@       >T㿐``    ``2 `.`>D" € "`> wӐ p >  >  \& > ?a@ `|, y` "w 9Z 2> > w찐  `@ ̏f $>  `"\ 1? 8V 1`@2 ' ݦ "F 1C$ 8 = >  `2 6 1? (/ /Z$ (+[r'`   8 (2 9    -ؒ > wC DԐ㿘> rh> ?* @*`"@ *`@ d"h"hs$@4 4 $  tࠔ!| t@#!|``* 4 <"4 8 4@ <4 p $ $ $  $ $ $ $ $$ ( $ ,$4 $ 0@ (4 p<<0<0<0DD<0DLM@N NTNNMNNNNNNNNNNNp㿘 |` @!> w!X䊒  /  @` Ԁ@DN `"`& ?"$$` Ԁ@"@"A> r`D0"  '> r ``"      `" $ )   ` $@ `$!`@` #`` ; BC;`XH0F^"&`@&``?#``Ȓ ; B;`C ` "`&  "@$ $X! "$  ` " $$ 6 " "2 F" $  6` $ $" & & $ $" & %$V h $S  "O     a -> w `&   ` `  $` &  ?"$ $  |`" ``l!" ``H  @{ ` " Cc ZŐ`h䮐X``   ǔ  t@ & tU t@*@& t㿘@@!> r c`|> 'L "`|'T'P'X''H'7  # 't'p 7n a'd @2    T ` ```'0 J`8 0 F8 0 C`@ I{   @: > w_      "'x`'`"% |  'xx<`8   ' S  x $ ` \/_`@F @bcL * *` @2` /_ 2   ?#@ 퀦  2    2   ?#@ ߀  2  2   2    π   ˀ $` ?`@ !( `"  "!( @|Ք ( `  "`?#ߐ @6 $a( "a( 2 , "`  "` ?' @@HȖ   @: > w鬐    `  "`'p 't$ 0 ` 2 0@B @2 0 2  0t '''t' 0   D 2S ` `2 0> w"8  x 'x> w`"8'̪ ( 0  " D 0' ܀ 2*  : @ `` "` > w"8  x> w"8' (; 2 a "a`x @ D> Vh `'TP- @` ǐФ@ @ ``a x//` '/x7/'7 // ' ' ' '/7/ ' ' ' $'7` `h7n`2`> rcxݴ (> rcݯ  `x> rc@ݨ > rcTݣ ` l` #` @~` 2`0#\@ &"k ` D IVh > ! `2 @r  "  "0 @2T`2` `2T`2  @ ڔ  x  2T`2a 6"aT`4@3#dtp#\d#`#h@ ! Vh 2 0> wC "" D 0' ܐ H H /f * '     `  `$@4   #\ @9`"  H 0〦Q A@8g  Ȁ 2 Ȑ@<   ' ȑH 0Ȁ ` 2  !x " "`!x` "` ̀ 2  !t " ' !t` "` Ѐ ! ' !` "` ` "`" ? "' ' ' H 0> !Vh &4> #`> w2`@4ި:`8 @ t`t$#\ (#`tp@ ^   X" " "''_  2 Vht@ &ta< "a`B ;`#`|` ``l! ``H  @Ƙ `Y,t" hp" *&th*&h̐"@ &&?i@240  > #`2`@Vl“:`ː@(`Ԑ !  @t &tQʐt@*@&t` 3 .t@2`h `h`p"@`|`x" 4 4`h  䀢 "a @ a  #a Ԗ@&ԕ: ``@ B  ;`#`|`" t`l!" t`H  @ t 2t> !``2t "t  "t  " t \ "tt  &t> w"$&tQ` ">Ԑ!t `"@,  > #`"@ @ :(@'&(&,( &(@A"V`ht@ &tQt@ *  @&t`p"`|`x"@@ @ `& Ԑ" & Vh&&(` &,` `耢 䀢 `T ua"@ `"@ `` `"@ `"@ ~`> ! `t@@ =T` &&ϐ&@ aVj`$tp& tܔ `&t& &Ԑ &> ! ``Ѐ P  `t  &ta0? "a0`4 " -`S"> #`> w2`@4 :`j6hs8t ` ` SR.P.Q 8@"@  p &  6h &Ѐ@"@@A `ؒЖ < `ДB;`ؘ '#`к`?&N&ؐ`  T@ " %v  *  @ '||@c'd !`2 T` <\" 4&TȒ :`` aB #a#`;`" @T  &`6ߠ?4tȀ`2`tȔ&t`` < B #` ;``` < B ;`#`@&"'"66` Vh  " @`G" В@ $ +   # В : ؖ B; Ѐ `Ԁ@`t &t `#  ؒ < B; ؐ?g "' T@  `" `` " $ &T&T"@ 4&T&T&\`/``@" hԀ@ @h?* : `>G *` €> ! `t@󀦠 = 64`86h `%" `> `t `܀Vh # " (> `R"> #`> w2`@4 :`6h8t ` `  SR.P.Q-    &> ! `*`@( t@!̀@  8 p@Ŏ ڼ2 t@ &t& &&$aL "aLa4 "a4` @t*@&ta8 "a8" 4  Ԁ@ H" ` \"`26nn  $ `i> n ̓* :`@ V6n  p2 @7̀@56n( ] &$ &xt &t&8!!P`B  Vn ̀ )@6   tp @ & &tVn ̀ @ 2Vn$& @ $ :6n@& 6nVǹ@&6n" ` g"`Ȳ"   >`B`;  # @)"@ 8" <" @"@ @2 4̐t  &t 2 > #`2`@Vlٙ:` $p َ@YVn  P?# * 8 & "`|`" ``l!" ``H  @ `@  `"@ &`T 0T "&@#`Ԑ !  @t &tMft@*@&tt" hp" *&th*&h̐"@ && ,&Vh "$    0E/ 5 0@ > `  PZ> #`> w2`@,:`P )6h' 6h@T> #`2 :*"@ P*`P;  @B> #`2 :*"@ P*`~` 2` @ @+` @ @$`  `  2&@2 &a "a&&H&&Ht  &t` ":"6Vh 42`h> a (6-ؔ@ " $&`h"  ? $`H` @4`NL ?.L@`!@ؐ"@ 4&2Vh`Vh` Ԁh  e`bt  > !``2t "t  "t  " t \ "tt  &t> w"$&t>Ԕ & ;`  B 8 ` |`" ``l!" ``H  @ ` 9t<P`ht@ &tLt@*@&t;!t`&t  @`9w`"A`Vh <  OtԐ `&t&Vh "    (` > "`6h6h 6h@> #`2 :*"@ P*`N `#`2 :*"@ P*`` "t|  2tn> r*:`x Q  tn> r* :`@ E t  @s> @o> a  ""a>  > > r#p+` :`78t`@&tS> >  > > r#h`؀ $`!` #\  @ 0` '#\   @  8Ɛ(> "| @`|  n> r*:`x ܘ 0 n> r* :`@ ј 8>  > wE Ё0> \7" '  y`s>G!*` €`2l@ "h@V h 4d@`Ɣ \4 `2Z@ "V@V h 4R@ t  @& t`@8G.!S` 2E@ $`ԥ `ԡ  "7@V h 43@ t> !& t&!\)&!T %`2$@ " @V h 4@ t"& t@d@`2@ `@d  2?@&`$ t@``~ $  t``@$w t$H !| ????'??  '  " 0%" 0"   // /'/' //' ''/'/'' '$'{.` Ж@+7  2  tV h  t ;& t t $ 0 > r# !|#\@s  ?@ߔ   > r> rca? "a `B :  b > w* " X   #?쀢 ''`` Ԑ" 4""`""   "  & @ؐ Ԁ & & &  6 Ԗ ""  Ԁk  䀣'"'`쀢 `" 4 䀢"" "`쀢 $ < "`"`   `''?+ 䀢  쀢 ''`"?"`"?  $& Ĕ  "" 耢 4  &  ?  + ??"" & & 㿐 ` ` @ !"@   > r#!ؖB:! `&  p > w   "  " 䀦`"@  ݀!" ؀ `" > s" ֞  & `$ $ $ $ & &   p@"> `̀ 8 $ $ " )> '> s  ,   $  p4" " 4 @  $ׇ ׁ &  V?  " $ $ @  $    $  $  p" @G ̀ :$ 54 " / ,  ] $`$@  $` $` " `4$`  $    $  $  p@"  ̀ :$ $   & "  @&> s"   ! $@$` p@"> `̀ 8 $` $`@$`$` $  & &  㿘 (V h $ `&@   #> s`"& `" 4 @`Ԑb  ?& <& ` &@&` &  "    㿘` ̀@<  &!8` ! "@" p  p&!  㿘 > w 8  &> wܪ! D L `*L*M " ч ?& ` b4"> r @* *`8 * 2@ 2@(& B(8"(  2B  2B"2l`((2@2BD`"82j @8@*`RB(88: 2l 2l2N㿐>   |  q`!|`< i` ( `\  ;"@d8$7"`W``\ `l,"> #4``l""!(' `l"bH @ `l "   ""@?쀦"`!| 2`lbH @ `l * "   ""@"?` * `45!2!2   ؀@* 8 @* t !5!0?􀊤2?쀦>  p*% t%!l %!h@q! Ң%! !` !.  * .  8 %! %! 5 p |  ( tሀ  2 㿘 | pL @ )`@: `p@@)Z> a@ 8 JԐ``p@@@I> a@ 8 JÐ`h㿘``̀@& ``Wa $a8`$````p" @ @ $a `& `$a $```"@a " $a $a a  `p $a ` ` > " 2 l   ("H l ` * (> "쀢 * 㿐> !` > s#""   > r> w"ta#\   O 㿘> r"p` > r"c<> r"bl Y  " l & L> r#<> r v Z*`l@  \@ ѫ & L> r `> r v  Z*c< l ќ  * & L!> !@ L* @> s*`㜤@ & HH /` * ! > !$@ `> r `B `:> wp! ` 4`@`"`H` "`#*` * ` " `?@"@$`$@$```"``"```"@$`$`#`H`* @*`@ `e2`"p?%"p` "` 2` `" >Z`8 ?w >Z"`8>Za.0 />  5> yad> ! 9> r"p/>  5> oad#!p->ZB:!p`!#* @*`@   :# " 2> w!P` 4`@`"`H` "`#*` * ` " `?@"@$`$@$```"``"```"@$`$`#`H`* @*`@ `2`"p?%"p` "` 2 ` `" `8 ?v "`8 & 6 0*` *  &    &   2`>Yc`2`@ Њ:`ad & ad "`&ad& && "@$#!X"p`4B %"p;!XH 0㿘H /`4 * !   H 00 @>   `А 9& > r`B :@ɒ  6 > *02 *` *  &    &    >Yc%> #`2`@  :` H 00\> rcahB:ah  6 `> s  "` H*` *   "  ?"@& &&  `"  "`  "@& &  H * @*`@ `2`> rbp?"bp " 1 `" >Z`8 ?u >Z"`8>ZaĒ H 0㿘H / * ! > r҇"tH 0㿘H /`4!d* !!d`Y > s#?``> w~!` 4`@`"`H`* @*``@"``@"@$`$@$```"``"```"@$`$``H*` *  `2 w> rbp?"bp` "` 0` `" >Z`8 ?u >Z"`8>Za?A 2`&!dH 0㿘    !> > r#<> r`*`l@ @  > r> r` *c< l   * > !@h* @> s*`#@&H   H 000*     L2  X@@ 2@ t@9 2 s̐s  2 LH 0 㿈\H /` * !  `{ 2 `H 0  @`"  `D @"  @H 0Ȱ?` 4`@`> s` "``H*` * ` " `?@"@$`$@$```"``"```"@$`$``H`*@ *`@ `o2`> rbp?"bpH 0E  V`     <2 * * @$ Ȁ " $ ` "` ̀ " $ ` "` Ѐ " l$ ` "` l  a l !$ l w, w`$ 4 >   `$ ,` $ 0`$ 4` $ 8`%$ 8 $ `$ $`|  ` $ H`$$ L`($ P`,$ T`0$ X`4$ \$ H`$$ L`($ P`,$ T`0$ X`4$ \`8$ ``<$ d`@$ h$`  -C  "`( &` `˥    0 l!  @S̒ .`(.  D`t D &`t`2`  2` .aS``2`.aR&`t` `t!&`t@   &`x@  7/  ` &``T&aX`P&aT`&``&`&`&`&a&`&``  '> r`t  &`ta0 "a0`  `t"&`t` %> `t$&`t`> !> 2``ܒ@  Д &a6`h&a4&`@:`I`8`"```"`` ``p&a ```&``2``@`V`l:`&`&`&a&`!`D $ ``Ԓ@a"@ 4&a`Ԓ&a`a`B:a`` "` .L` `" >Z`8 ?r̐ >Z"`8>Za 03`(#\ ` @  .q "`8"` "` . ` `" >Z`8 ?r >Z"`8>ZaƐȒ > r?`B :㿐H  *  { 2 H 00i  ?" $  H 00Z 6 `> s  "` H*` *   "  ?"@& &&  `"  "`  "@& &  H *@ *`@ `~2`> rbp?"bpH 0> rx`B :x  - `" >Z`8 ?r >Z"`8>Za:< 㿐H  *   2 H 00t @"  H 00i``  `6 H 00Z`6 `> s  "` H*` *   "  ?"@& &&  `"  "`  "@& &  H *@ *`@ `2`> rbp?"bpH 0> r`B :  - `" >Z`8 ?q >Z"`8>Za   D p h" | x\"@d@ h ?# @4`t$"''Ԑ@!|> 'a ' 't$d'  7#\ #``e "     ɋ `\) !> r `B  :਀ "&,&&P@ǒ ° c h @`" @" h> r"t    ,q X t   &&6&g&` 6`  `Y 6&D&PԐ !!ঐ O6&TԐ ` `2**@ * c 2 &ఀ #> r!> ?> #a*  ఓ2 `*`  2 ` &఑* * a  < &#> r> a   ঐ 6 Ԁ"$ঐ 6Ԁ$ঐ 6&@- 2ਐϒdcȀ " + ` `8 ?pa "`8>Za c`B : H>  Y b ' `0    (  /+| / 2     `  ` 2 `2  `+֐> ', 2`(  )  c    *(```+ `cA 7-``  2&`&`&` &` &`(@  Y   ( `  \$ x, $  Z4` v4`  `($ d$ h$  l$$ |$ $  $ ,$ Z4` v4( 5` $`< *`* $`  ,` > ! `$`  R,`  F  4`,`,` 2 ,` ,` `@A $`` 2 `@#@$   @B $> a T $  P$   `д@ @  Y X/ t/ u/ /"`0" `0` '` '' '''`'' '$'nm  @v    ` *~ ,  , Y  #\@  6  `k *ܐg  ,,  Y   %@ %@464`@I4`* 2 2 ,,6"4` @e4`   | Y   0`4 `x,> #3 , %@*`2`  `2`,,, Y   /> #4 `        <@h ,#\   @ " > w!` ` >   &    < `  2   `  ``  ` " ``<" > `t@" '`| @ 'l'h'd 5$`t `*`$`t- `t@'pa`@p 'pp > !a4T`l"@ @ p`p* $a p  `@`t $`t'p`t*@$`t`  `a@<````a "@ > T`h`# @l 2 L`r>  T`n@ &L`rT "L`r`  'h``" `p "@  `̀ a " $a L`r 'l `*  '` 4`jh  `@  "6`p`  ``4`j`4 $`@`p`2`    'l` `p`h "@`|`x" 4 % vp`t  `@"ja|L`r 2fa|aH2` `2_a|`a@ Yh 2Wa|? aQ#* 4a(`Ԑ" " 6Fa|*  6Ba|`t2>a|2;a|``" 45a|"0a|` ",a|a" ` `4 > #``2`@T`lf:`o  ` > `4  @4`j a|      .>  .>  ( <4`t``/$`  .. 7~~  `  @A`t"@A & `t   @" `t aR@#@& `t ` 2`t2`t  a"`t> !@BaX` aT&a, @ " "  $a,`t9> r$!> ' .`  *@ `'` *@  ` *` *@` E (T`h A (`t ""< (`䀢 7 $#`"B 2 :   ` @ @6+`쀢 ''`" `# # ``@&+`@Aa  ((a0> wχ!" 'l #(> ww!"i`tL`r  2`#`l "`l`a@ #`X`P <B ;`X #`P`H`D <B ;`H#`D %  #    '( ` 'Ԑ # 7'x & @ -& `(  &'u 7'x `)O & ` C`@"=< #`h "`h"``x "`x`" #`p "`p`t "`t %  #    &( ` 'v # 78'x &  & & & `x`2` > wː!&"`> wĐ"í `x  @  ?`t  `a@$`2 `2``4 "a`$ hl 2'l` #$ ` '` Б<Ȗ B`C 88`Ԁ $  p  2`<**` $ > a (@`t@#aD@ "aD`t ` `"@`t 2 , *$`t#aH "aH, `p2 ?`p& ? aQ#* @4a`Ԓ"@@ & 2 >@ 4 ``"@` @ 8 4  , `$``t$[Ю@( @$ a|       -`| )`| //  '\ /'/  '//  ('\' ''/'/ '' '$'`|i` @  2  `" a| #\\@= 6a| a| "  $  " $L`rL`r 6 $*` 2`?# 8"4   @` (4 L`r `4 2k``$`" ```t `$`$`t`  `h"a` 2`a@"@ $`a8  $a> !#$a8$a< "` h ` `a@> #``2`@T`l[:`d`4 "`u` 4`j` ``@> #``2`@T`lA:`J`4  [` 4`ja@"@ 4$a@`  T`h  > a  `t @"`|`a@,`|L`r "`|#a@  "a@`| & (a| "   xV"xR  2`|  `x't*`| q* *> #4`|```H ` 2'x  ?ؑ*  2 2 , ,  't, `|@c` ,   *  * *`@   2 2 2 , ,, , `|` H#\  @ɚ 'xx"-alx 7x`p P$a `(x`|@%?H x A'xx`A`22 `tT`h x 64aN`t > w"$`-xt@8$al#@  @`t``   $ `t`a@"@ 4$a`t`Ԓ $a`$`t $`ty`ld?'d >  > w"0㿘!@V!B* :   `:> w5"@ !D&V j> !0* )  񀢠x4 x> #`  2`@ :`$V j  j`6 j㿐> w " > s> w#\bX"Ԓ!  à !> w> w#\b`!X   y > !( !Xǔ !> s> wbh#\ "   i > !,  DŽ" > > w"8> %c4 ; <"c4> 'c < (>k> w͐"x@i5",@㿘 x`2 | "=  2!| "   > ' #> '#  ($` > '#` `( `$`   #T(``2!|#g !|  "'`N>` @  4 , 8?$ * 2 ( 2` 2* 2 + $ 2``3  # *4 ?,$ 0 $ 4 $ 8$  $  $ $$ ($ $p*  3 3 3 ,, , , , , @a, , ` (4 > 4* <*@< $ 4 4 $ $ , 4 x> " '   |`@ x p h |" " 4 !| `H@2     !  > '#   0$ D (# <ߔ (۔  ' ' ' $'  $  $ $ $ $ $ $ $ $  < (   $ $ (" `@4@4`$ $$` * <*@ $` $`$` ,` !Q=?#44` 4` | $(\$( > 2Y>  ` ,, , , ,    |@a ؓ*`2`2`, , , 4`  *@  @]c (4`  *` * 2 2 , ,  |  "#\ |#\  @w > @Y 4 4`@A͐4`> 4 #3> ,4 `  ( | P > " > wt"㿘> s" 2&T <6 l& >  >m6 p `6!0> w!#  ,``` >ib > ! > !`&  >   *`& t6!B& |6!@6!D*`:` 6 l $ 6 l&!$&! &!l&!h l!  &!| l!> - w> #3- x% D㿘 |V h  `@6 h2> rc`  "` > rc` "``<V!N 2@4 8㿘 |@I@@ t  ?& tĐ   ` !#> s`~b 2` x " t! t & t 7$Dh 㿘H / * ! > sW"ԑH 0> rc` "`㿘  ?'> w` "`$ "@$ $! 1X  ?  *!R !R *!R* * !R㿘 DR`h   @`A`3`@ 4 2aNR`j $2aNRaN "2aN4 8 644*x`>i`#@ ` `  `` `` ` `  `?#@v t r? >   >  " ``>  "x  H`@ N@ƒ  "> w"8[`  @l!@ 05> r@ /D`+` 'a#> "  0"p`> "  A 3 @U 0 > w#`"8#\ @Ff x> "`>i' Ħ`  > .    ? >b Ѐ T > #4`NL> w("8`' '`  D   !!l@줐!h @  t*@$ t >k t  !p<$!pj$ t$!p$!t 4!x _4!z"؀  >k# R G> w `' *`'ܢ  "8`ؖ. > r @ 7` D 4  0!,("p`#  A 3 @@Ē   //@7 ' "8\ > w" h%> '@  >k b   //'#`> w> '''"8x#\  @Em  > w"Ё㿘 DP & ` p`4 2  pn@  p@2 `X ? ?  $ `㿘 D"    4 C?(> ")> s"' %> s!> r #@V#@V  %"?`| P>?     ( 0 8 @ H?????????@V `|`<@V a|  `|`,@V `|`@V  `8@V `|`(@V~ @V> w "0" @'aX'`>  > w" 㿘 * 2  O   Lde   $!\   4  㿘!\ @ !\f L&!\   㿘@V4 > \p  '@V`" ``"8"4  'HH "7R'L/Q/P@V  $Ȓ (@o ' ' ' ' ' ' ' $@]'@] "/'@U ('h'X '\ 'dX'`@U7h 2 * "@" >l4$5 "!\ ?!\@U @U " > w]"㿘> wb4 2> w @"b4> wb( 2> w "b(> wb0 !> w @"b0"$ > c`@ $"$㿘H /` * !  t@ `H 00 & tFH 0H(> w> > w( *`! > w ," #!H 㿘  ϐ? 㿘 " & #> s b & `> b'H /`4 t* ! t  H 0 b7 |`3!p . p@)!x7!z* !v+ * & t'7`(!> "$  |- |> w`>k"8" (H 0b j`*`:  6 j > r6 jc`$ "`$V!N  <] 0$6 l> r c`( "`(!@V!B* : !D : * V j> !0*  !D* :`@ 6 l`$>  6 l> #` 2`@V l:`> #4`">V j |":V jV h 6V j 4 @ `".V jĐ " !| 4 "!| X 2!V j!|` @ג  //('e " V j X  $ Xɒ aV j $  h |!@!B* : @6!B6!@ h&!8?*  2 !&  & > ! ` t 2  & t ! 8  p2 @[ ( &!  t!@ &!$& & t#6 nT`"TH 0b > w#㿘H /` * !  t@   > rH 005c`, $`,!@V!B* : !D ;  * V j > w> !!40" > !d1  `0`$`0[ <0 . r. rH 0㿐H /` * !  t@ > rH 00Xc`4 #`4V hD  | @`,+> > w",  > > w4!4 "@ @/`8 #\ #`8 x  ?  8> #`> w2`@(̓:`Ր0 > #`> w2`@4:`ɐ 8H 00<`"< w",> !!4"@ @ > #`> w2`@(w:` P0ĐH 0\(<lĐİ@l4\М|,ќ㿐 `  `  @@CS K     H /`4`* !`  ` `8 " H 0z` `v0r  D h`U.`>o# € P 8@; L ` " `T` 2` x4``> D l!@>50 >   l!@>     4 h ` 4 ` `` 2 @` 2 @` "  @ " @ 2  >` 2  >`?#@  >  @>X 耤 @?"! `< 8 '{ Ѱ  >   ǀ    $ x 7`>  4`0S> #`> r>  "ȕ2` В@  4 h2:`; 8 $ $ $!$ &$  -@ l!|0~`  1@֐ |0`  v sr `1ki- 5d`&HH 0n `H 2`` @"R `!2N  !L  H  D #&  !M>*@ !L :,!L``"@``" 4 `U* 71`  , r $  , r l!@@ 1  l!@@ 5 > w#(  `  ,:`  M H 0㿘 H /`4`* !`  H 0 6 Ѐ D`  @` ` / @ ̤H 00i  Y *>'S *"P  (L ` t D$ t ?A$ t"?  (: `$5  p@41 /4 p"-  () T h 4%  t$2! `"$ $ "  8T h  $  ` t$ $$ t ;$ t*& 0& R ' " "  t *"  *  "@ p "@ "@ t $"@H 0㿘` "``p  > w` !> 03!h "`t!h$``t !> 0(!l "`!l$`t`/`t !> wb8 `L 2 2`h` ? U4`` 7 4` l!  "a| 㿘 |V h` @   T    .29 h@  㿘V h`>o#H*` €6 h  6 h V h  |.e`@V h  > #`> w2`@,:` PX> "'   @    @"  " ဢ   В @V  @Vw    H /`4* !ဢ   `> w"8V> w'"8' `" `D"  `@ `2   5H 0A!> rca "a`> w"8 $  > w'"8 n ` `@  ?'`@`'?''H 0"&@" > w#8㿈` ?`>o#`*` € >  !|  " u  > + k   c   [ >  ۘ! R1> !( ' И 2F!(@&> w!X  2:&!(1> !, '  2+!,@ > s"  k 2&!, `  > r#Ȕ ! >   *#\!tȘ㿘 |.H @ > !h!h` 2  p> a! " 8  p@X` `. 㿘 | @. `p > !l`p!l`t `p2*`!("  > !p> a 8  ? p@' X p`h-֒$8$`P,`4,$$$$$$㿘> !> ws"㿘@@!> wT> b 'L'P'T'X'"T'H    2  '|   0  /   /Ѹ  `@     @:> w#H   `ӒT`  T` X"`` "T $Ԑ E  ?#"@4 " T` 4"` " `' ' ' ' '`@ 2  2 ?#@    ?#@2 $T`  "` `@?a T  (`" ("  @Pi* `87`T` "`-` ,T $` ?a T``("`("` @5* `7`T`"# @6 $T`( "`(`  "` > #`9> #`6` 3 "  U   2 T` "`  > xTђ`"T  2@" р0/@  //@7  @'//`7 'А@  //@7 @Sے @ݐ//`7 @Sϒ   <  8  > w  '  퀦> w"" l!l!2XX (2>`@2"8, ,0  ,4 ,8 ,@  ` @2r"(   $ ( @ɔ  ` ` @2S<@@2N`D沔   <0?`l@`@ h@r | `l"`@ h|%`@| h, | TT`  "` '`@'|@` " bV`T` o"`0?`l@`@ h@q| `l"`@ h|@ؒ`@| h,_ BT&`@J# > w@"`g ' "'@` ( 0 " D 0&܀I :T$ @ ` "$> w`"F  > w'`" (*T "  c` " 7`  @X ' '  '  '  ' 7`  H /f * '     `  `$@.  є#\x @ x`" H 00U@ `P @@  Ȁ 2ѐ@͔   &ȑH 00` 2 !x ""`!x` "`̀ 2 !t "&!t` "`Ѐ ! &!` "``"`"?"&&&H 0'|l0?@@ h@p| %l"@ h| l"|` | 2   !- $@| h+# T%@`  "` |  > w#`㿘 @2 8%y @% @@> ">x'"`ƨ ` 2@ 2 ? >     > " ` @` '`'`  '` '` '`''Ȑ@PД  "`  @$   // ''' ' @E'  `@'`'`'` '`'` ''Ē@P R`C@ J@  А@   //``'` '`'`'@D' @Pp &  #> web@ @]/#\#`b@7> w> #\#`"x @7  > wߐ#p㿐>x`Z"` V@ R` N L>  . ?򀢠 > Ѐ  0< 2  *  > #4`> #`> #`"  2 @1 0> w' '" `@   ƀ0> w"  㿀'T'X'H'L'P l ! > w'#?`#@  ( (  8 8H /` * ! J H 00g c 9    2 M 7 @` .` 6`  8> &`  (&` >6` < 6`6` $/` 7 $` 3 *``2`  2* 22  + 2`3 ?# 8#6`6`6` x> w.` qT.`,`",  H' ( @` 0  " A$ 8fH 0-(㿘 `   l! @8 5/ ``2 `.`>t#\ €  H /` * ! > wbؐH 0` > > !'    l!> . w> #3. xH /`4 l* ! l! @4SH 0ŀ  l!") (   8   $   (  H /` * ! @5H 0`  8H /` * ! H 0` %{  l!" (     $  ( d 9H /`4 l* ! l!  > !!` $ ,`$ 8`$ 0$ 4$ 8cH 0  ?>6 &;  l!@ٖ;L4%@2$  l!@6\   l!@6l    - -> wX# 㿘H o*@ a% H 0㿐' @  " `0 > 3 } > w"T | 4   *#\> !ؖ|(㿘@ "Ͱ   M  2& ° 7& a@& (` `B <` ` @ ; B `/o<`0* @@ ``@2 @2`@2`!* @݀@ "!> 4 "`2h> < >@ > BH@4 G@;> y% !p`5> <!4  > *@Ho  "`> *@1` mH!W > *Ho  "`> *@1` !A  @9 j`D ,  ؐH /f * '  @ `& 0 &  2" && &H 0 㿐> !l'L'P'T'X`'H0  / Ƿ /㿐> !t'H'L'P'T`]'X@ 7 W V &  `B >  @ ; B >` ``*`*`@ * ` 222.` .` .`.` @ *  @ % s ``*`*`@ * ` 22`2.`.`.`.`.` `kג*  "@G0T. ** @ *`@ "* " @ "& `"@6` "& @6` `@-*`6` D> <`!  R H /f * ' `` @ `` &`` =0 & ` 2" &@`&` &`H 0㿘> *" !"` @2"x"`@2"x"`@2"xQF"РQC(2"x \ "x 2" 㿘`    *0 > !l> !py㿘`    *> y!t㿘 㿘> "` '> L $b⼀ C $⼐b  ⼢ ,   ?& 2 ʒ @  & @ > ";8   @    @X@ @ @ 㿘`\ l   lo   ;#`b `(!l@?#@88@@G dE &@? (=H /` * ! @5H 0 2#@$ &! "!$ $,! $ $@,!> "  $:< $ $ (0@ %@ 㿘%>  ! * @  2!2!2!@a 2p> "> b '  n   * @ +!2# `"! 2 !2  $ 2 ! !@) 2  !$@"    2! 9А@  /В * @ (!2  `"! 2 !2  $ 2 ! !@ 2 !% "  2! > x 㿘` !x "< @ 4 !| "1 @ ) !p "& @  " !!t " @ " ! !@أ 0 2  \!@؜ 0    㿐#> bd h0    b* @ $!2 !2  $ 2 @!@n 2 #\    2!㿐#> b` d0   b* @ $!2 !2  $ 2 @!$@4 2 #\  S   2!X!> " > x& 006@ @> " @",`   `` 2`*` ` @ " > x H )> x'> x%> x   ``px`` 㿘> "` 0 > " * b,`@ ``a@ⴀ@  2   @  2aⴢ@b㿘 $  @В @㿘 $$   ̀@@ @㿘 $  @µ $ & $㿘 $$   ̀@@¤  $ ;& $㿘!> " K-$" O* " K  O* " K * O  1> 3> >5> "*@  !! !* @$%@`2 b  !!  !* $ %`2   !$!  !* $ $`2 (""Q Kb KQ&"&bQ K&㿘H /` * ! > "'> `)> !> " K  O(* "$b`*` KO! "$⬒`*` KO %"!  !%> m!b+ @ b 0> b* *   bR! R!b+  &" ! G!⬑*  & "!!$=!"* > & "> 0; $0;bH 0㿘> "`i!! !H o*@ a b*  2 #> " !$)> '> `#> !$)> '> `" !@2@"@! !&b*  2  " `" !`2` "`!!ؒ "*  2  " ` `2` "`@9& 0?$0H 0㿘 K NX"($" " $"$""$"$""$"> c$!c: < >c (>c @>`, X>`\ p㿘   @& jԐ" ( @ X p?`"`&""@""""2" ?`"`&""@"""" 2"?  Ȁ`"`&""@""":"2 $ {]S& $QOM! "!@&!! "!x@&!!x "!|@ &!x!| "!p@&!|!p "!t@&!p!t "!@&!t! "  6! `" ` ""`  ``""`O\ K㿘> > "b@ .`2 @` `@*@     @?    > H  > L  > P@   `  3`` ""`?`""`"`"`"``"` "`Ā  `` ""`?`""`"`"`"``"` "㿈#> b' `  `" *` ` !>  * $b> x #\b*` . 㿐 ``  1> x '@9   " "  `?2  2   2      㿘 `4  > xV    ? & Np 㿘H / * !    $  >  `$;  ;`#`$H 0㿘H / * !    $  >  `$; * ;`#`$H 0㿘@@2  V ` @   P\> b ( 'J'p> !`'t &    ?&@} 8@y x@u  , 0`,`= /&   4,      { //y//x'| '   24 @ p c ^Cp@4'a  \ 4,  K   E0 @  //x/y/ @E@E (  24* @ 1 $2 4p4,p$J*20#\&#`J  A`"8`  8 ?"8 AJ  `?"8 2  A`>"$*` € A }  "   a ?0 >   bh >  "  bh @  2 a  a  " h  d 2  l 2   p 2   t 2  't  $   Ȁ` "`" ̒? "$ $ $ ` "  ?2 `2&@Ҵ | 2 &#> <b  b2#  ( @2 Ȁ` | @ғ 2 Ȑ 0#\     H Ȁ`"  "` "b ̒? "$ $ $   < b 4b` -``> ##:`< ` |  0#h#\#`#d p  $ $ " $ "" "b&#\#` "`ƀ   &` |t   `@\  ?Ԓ |Ғ"P  Հ` |a$@ a$ 2C a@2>  "  a|`"6  "1  "  ax`")  $ "$  Ȁ` "`" ̒? "$ $ $ $ b $ b"@'b&#\#`%> @2  Ȑ$` |@ѹ $ "C  Ȁ`"  "` "b ̔? "@$ $ ̐  < $ > " @ )"`  "``> ##:`< ` |  0#d#\#` p)  $ $ " $ "" "b "%   0 =&  7& 2?ꀥ` |t   `@ #& ?ꀢ ` |t   `@z #\#`&@ & > " > x!P  ? & `  2 @ D  0''  8Jl  "  Ȁ` "`" ̒? "& & @  Ѐ`"  "`> ""  Ԓ? "& &  " g " a " [ " U 2> x> a?"a> x; p㿐> bȢ  !> x "b> xa p#\ ؔ    p 2 %     2& . . . G/`& &  & > b b&  "`Ԑ "`"& Ԑ@㿘 0 (@(`(`0(`1(`}(`a% 0f 0`0`2 8? ` (< `  > 0` < 0` @  `<(`0`B(`@(`4(`|(` `80`D(`` 8 `d (E `0`0`2 ,1> ` 0"h `  4< ` 8  `  ` ` $ `  ( `$ >0`* <0`, @ "h (`( (` `8 `< `@ `D `H `L `P `T0`\(`X(`4(`|0`Z(`` , `h 0 `l 4 `p 8 `t  ` ` $ ` ( `㿘  `"  "`> "" ? "& &  > w ` "`" ? "& & > w#Y㿘 " @@ђ  2@ p  $  >  b̀  !> w "b> xa(##\    #   `>b@2 0 ,` ,`!,`P,`Q   "P4`"ϐ#4`"4`R ,`$ 4,`T | ' ' ' ' ' '' ?$`( $`( 8$`X | ' ' ' ' ' '' ? $`, $`, <$`\ ,`0 @,``  ">  4`2 B4`b 4`4 D4`d4`R ,`$ 4,`T | ' ' ' ' ' '' > $`( h$`,h$`0 $`4$`X$`\$``$`d $`( $`, $`0 $`4 8$`X <$`\ @$`` D$`d | ' ' ' ' ' 'Z' > $`8h$`< h$`@$ $`D$`h$`l$`p$`t $`8 $`< $`@ $$`D H$`h L$`l P$`p T$`t (,`H X,`x X ">  *4`J Z4`z ,4`L \4`|5 > #$`> b``$``""`$` Ĕ`$` "& $``@㾨\> `  '`E `?A  ?& `? 8` `? 8 ` `? *`Ȁ 2 `  $` 7` (`2`? ۔`a ࢀ@?a$|@Ka$ ?`Ȑ0#\చ ഘ h ސ?`Ȑ `> `a ࢀ@> a$|@'a$ > `Ȑ0#\చ ഘ D Ҁ> `Ȕ" "@8`2>  > :; D``Ț ``0#`#\#d```| ?`Ș | `)?& `Ā  b଀ u`Ȁ %> " @ 5">   /:; `Ȕ FDV``0#h#\#`#d| 2DB`H#h#d#\#` 2     R଀`"Ob`Ā@J &Gb `  < %?`Ȁ    $` 7`Ș | ` &?~& ?  (  2ଐ q&``&` a, C`$ $଒` !͐! b > x!8> "  22 㿘> "Д`` , 2 > xa8` ! "` ?0!@@# 㿐> "'H'L'P'T`'X  , 2  > x8 `!" 0  `  @H㿐> xa8  "a8  2   a8<(  (  >2   > x0   /   * *` 2 /L!HJ  a8`"0)a8(   (`"(0  } a8` "`)  C   @  ; 0   *`*  2 / @   0  * *`@ *  * 22 2 ` ,,,** , *`@  * 222,,,,  ">  \ 2; > "Ѐ`"6 B (>  `". a@2&`` ""`  ` 2 ` @]"  ` 2  `@  "Pa8  䀤``2a@ a8" :  B; )> x0 > <!   >    !HD @ H /f * '   @ `$ a8`  "` H 00,a8$`"$0%&   2" $ $  $  > **Ho  "`> *@!x`H 0㿈  Ta 2 `/`"]a0a%  > xa( 8a  > x8,`",&,    < * @ *@@ $ > 4  34 , a($ a $ 4 ``   ,      4    )2 /, 4  /@,  2a%a 2 a%a 2a%a > xa% > xa, a0 a4 a8  > x8,`*",& 7 & ??   ? ? ?@2* * ? ?  ? ? ?@** (|  2  > xa8` 7 "`& `,, , ,  > ?ؑ* 2 2 , ,  3a$,   @;  a @; ` ` ) l , % ( d )2 /,  @/ *  *`@*  *  2 2 2 , ,,  , > x&a8`( / 3"`(> x!8``#`&a  `` `?쒂B>` `?쒂B;`a 2 `` `?ؒB>` !8 ?ؒB;   "   㿘> xX!p \㿘`    *0> i"  > x!8 j 0㿐 'L'P'T'X'H a > xh> "Ԁ`  ,  > xh `" 0 @<0 @֒0 `" 㿘a> xah> "Ԁ`2` , 2 > xah` ! "` 0!@@0 !@@0` ! "` 㿀> x!h `$  `h`$h0 d ` 2   ` 2 ဢ "  `$ 0t n   i$ @ d H  `h`"0X h  @ :C  8 %  4 @6 耊  >  @Q   !"6  D   ֒ &  !@ # & ( `B < H /f * ' H 0 h`B"㿘> x!h `$  ` ah`0$ah0o     c$ @c ^ ah : B;  ? @6  D  !; & !@> y & (H /f * '  @`"ah` "`H 00#&  2" "" "> *Ho  "`> *@y`H 0P> "'@' @#   2``` 0$    ///9/  4>    ///(/  # > > xah  /"ah! !"x`"""| "" \ A  @> 2 ""|@7  " 2"x  > xh`Q"  > x}!㿐a%   > xa   > xa% `@ > x`` (h  h`!" a"`*` 2`  2  > xah` 7 s"` > x6 > xk! " P& > xah`4` #` # `( ; B;`(a  a0> <* @ *@@ $ > 4  3, , , 4 44 4 a($ a #$   `*@*`*`*`*` > ?ؑ* 2 2 *`*` 3*`a"`a"`a"` a"`$a,"`a0"` a4"`a8"`a2 & 4`// i & 㿘`    *0> fј"  > x!h g˚ 0`> "' 2 3> xa`, "`,> x> xa`( "`(b` "`  20 3> xa "a> xa "a 3> "؀` 3 l> "܀` l2  > "`2 >1 "  2/ 2Ԁ 3> xbА "b 3 l`   А` 'ĐТ@} /р  0 /А  0 /А  @8] 0 2 3> xa2> x> xab` "`ٰ .H /` * ! == (Ĕ 2 $H 0 2 3> xa2> x> xab` "` `!`H 0 2 3> xa`4 "`4> x> xa`0 "`0b`$ "`$ @2 H 0> xa`\  v"`\   lH 0n 2 3> xa2> x> xab` "`Y "% !Rp! 2& H 0M 2 3> xa> x> xa`L "`Lb`< "`<5   ̀@2# > :< '  ܐ ' $` " Ȓw @  ̐ ' $d" Ȓw p `H p@ > x{!؁8> "> ' :a >`a`2`3> xa2> x> xab`  "`    2 `2`3> xa  "a> x> xa "abА "b 7    `*`4 @4 4  9/ " `2`3> xa "a> x> xa "abА "bВ ,aA  aD` aA   }`2`3> xa )I " 'l`2`3> xa "a> x> xa "abА |"bВ (aA aH aL  aP aT ВaH@  aA   3`2`3> xa2a ' ( 2 `2`3> xa "a> x> xa "abА "b "@*` 2`2`**  ; ) " `2`3> xa "a> x> xa  "abА "bВ {aA  aD` aA   ̐`2O`3> xPa )2Wa " '`2`3> xa "a> x> xa "abА "bВ (@aA aH aL  aP aT ВaH@b  aA  "a`2`3> xa> x> xa`L "`Lb`< "`< a l+  (  ab`2`3> xa  "a> x> xa "abА "b   a + `$ a# $`2`3` "` $6 ` " a (2a   6 ă?`$ "a  6 aP1a ``B ;` ` ; @ `DB ;`` ''  @'`D `302`3`l`20) 0&@&@"@g`l`20 0@R@ʔ @ . > xyh!㿐` @ ` > x! c `   *#\> "c 㿐` @ ` > x! c̚ X   *#\> "b 㿐` @ ` > x"Д c H   *#\> #bה 㿐'L'P'T'X'H   3ǚ 㿘> <!H /f * '  @> x `""H 0% 7&  2" "" "> *Ho  "`> *@`H 0 㿘    @ 3㿐'L'P'T'X'H   2] 㿘> <!H /f * '  @> x `""H 0% 7&  2" "" "> *Ho  "`> *@D`H 0 㿐'L'P'T'X'H   l 㿘> <!H /f * '  @> x `""H 0X% 7&  2" "" "> *Ho  "`> *@`H 0 x> "'`eb> #4`^2` 2Y2`a'S`<@|   //'_ H /`* ! ܐM  $  7> H 0(1>  $ @Đ H 0$@ #8  $! xwn" p>  b'']@|" Р  '//@|  //'ԑH /`* !    2 /#)> 5> ! 22%  $` 2  !@Q 2 !$@J 2 @O"  #$ 8  $! xw"  㿘     2㿐@ '$ (* @ (  `'> x @ Ŗ 3 *  * 4@8 " @> xa! "a@ $@@@  !㿐'D 'H2 >  > > c !<> ! D 4%> H 6 ``B >` "D"H`0B:`0* @*`@*` DH>    ؒ`B :D 㿐@ '$ (* @ (  `'> x @ B 3 *  * 4@` " @> xa! "a@ $@@@   !㿘z㿐@ '$ (* @ (  `'> x @  3 *  * 4@∐ " @> xbа! "bJ@ $@@@ ʚ !㿘8㿀a 2 > "؀`3l> "܀` l2`> "`` 2`$R A a  ``̀@#> ':>````$` '`@qk```$ '`pzq^2`a " " (  " 7 ` * 2 a   0`$@+``% a ``@2`a a  aa aa "p`a@l  "j` I  "Ű 7  @  `4`*`@k4` 4`  '3 ( " 7 ?ؐ#@( i ?ؑ*  2 2 ,,  䀢` "   䀢 K'a 䀢 '䀥"`$    2 s 7 ` 4``$@ &`$``2a @d``2a @[W  "  4a  @ -, (   3 < 2$  + <a2a < <  < + "   * @  a l2``   "@@  > xD`"D@ ``@ 㿐> `$;  $>`> #`H> c Dc    L  22a 22 > x?22a`X "`Xa  " 0#  2`$"!`$ * `'?ؐ#@ ?ؑ* 2  2 **`$@ "   *lG `$ @   (ݔ  a\7   a + `$ a# $``"aa   Ơ? a          #\    @`  a2"`3?09?06`$( #`$a  2 `" ` `$   ?D  a " (0 㿘H /` * !   )> '> #&@ 8  " ? '"Ȱ   L?`t> *` €> "L>  > !> !t>  !>  !> !> !,> !P @* @L `"  `$`  . 6 &&   $ @6!*`2 6! `+` &> d*` €> "p> "> "> ">  #>  #8> #`> #> # @"& K   & &!d`&!h L6 * 52 &!`? @wY $  '''* ''   L 6 * 42 &!\ @w9 $ @ * ''''   @L " > xr\"㿘!\ " !`@ !\6 L&!\!` @ !`6x L&!`@Lr   > 㿐`$` `aa` `  "@` `"a`?@" a> x`h"  4`$@21   aadah@    " 00 E> xa`  "`< 8> xa`(  "`( ##`# ; B>` > x""" : ! 8@ B ; 8`$"`$``@8`$``@ @ R `$! ``@8` ``@ @`$ ~&`$ ` `2 @N `ߐ 4 4 L3  `А@N`P 7 |"`P&$ ,<`" ""@"a\"`4*  "@ 2 a$ "  " "@@ 4 < >!Ȓ $0$@$ $4` <$8$ ($ $`a$a , a$ 0`2$@a%$``$ @` aa '  8* a` '`  $` @$`a` $``* $`$` " $`@ @L`> `8 `4b '`(`$`, L5@N> xa`P  B"`PH /` * ! `0`@u ` 2 `,4 L> xa`  "`  #@` xa` "``,   "  @2`4  4’ L> xa`$  "`$ A 4 L  .$@*Đc Ē dh@  > x  a > x O) 0 a`  "`a`(  "`(@Mk$@  n  > x!`"!H 00j2    25  "0% @ *! ( ے"@   " "@% $ ͒"   2$  " "@%  $"   "$  "@%    "@ > x! `" H 00$@2Ȁ> x! `" H 0) ɐ` ʒ ۘ H 0H 0 @L > xo"㿀``aEa ")`$ `B <    ; @  DB < @t? a ``''$'(' D ݘ `$@a   `"`   @w`@w$   > xa 0 $ 0a  @@?@#@ 섐 H ( d$ H}` . \"` `# ; B>` `@# ; B;`@`$ !``@8`$``@ @] ➐P3 `$! ``@8  ``@ @E`$ ~&`$   "    X @ "  "   X" 沔   ``3%"$@  2 ` 7 %`H `$@2 ad'`&ad` :`M[  ͖  2`$װ 70@`   ,@  &Ӛ*U  2/ }  `2 @K `뤐H9 `<' 'a%' `$ @ 4ala\  aa 6   @ 8* a &   ' @' a` ' `* ' '  " ' `< 4 L0z 2 `_@K'`P 7 <"`Paa$a $ 0 ,  >" $` $`0$`@$`8$`4`<`$ `"$$a\$`*  $@ 2 a% @" $`$ @@ @I㿘 4 8 L1@Jې> xa`P  g"`PH /` * !  0 L 2  ,1Ւ L> xa`  <"`  #``@ <`H 0@Ir41 L> xa` "` ,1 L@J`$ @a " [alH 0H 0ꨐ@Jp` #dd#``2+   "@ : ( # " @ > x  0 2> x ( # (  (# h>   b'"$> "> > L > H > > > "p" " " #> #8> #ؔ   ` $  &!d& & &!h  L6 * /52 &!\ oȐ@q $   *'''@FU b > xl"Ё㿘!\ @> !\0֒ L&!\@F   > X> "`'`q 웒 &> xa 7 "a ,,4  44 ~  @` b> x ` 6! "9  *  $ `4 `&    7 `0  ?ؔ  % > w"В> x& @0     ( 2 '> x`c" (/  ``/ "7€`   `   `7Ѐ``ѐ ``ѐ   ` ѐ  7Ґ  ( (  ؐ L.2   > x`"ΰ 7 (ꨖ آ (  `+"K `<` 0 @  * 6%> x @2*  *  `$ / L   `> w"" `$ n/ L{  * & @RO@ 2L %?????@ @ @ 22+ ?'? '?'?'ו*  (А&Ԓ & ؔ (& ܖ&  '''3'. * /= L> x`V"  S`+   ( /' L  > xj"؁㿐`$!`'D   ɖa "3 `$2/ D鼔  aadahx  > x  " > x D 7D`"0 70  7D`" 0*`? > x$ D`"$0D> x` `""B>``! 8""@ B ; 8`$ !``@8`$``@ @Β D 0y`$!``@ ``@ @`$ ~&`$@G  D磰 7! <4"  "" L"a\"` * " , 2  D燰 7@GO!`P ;"`P 4D @ D> w @ Da   '.I L@G0D `>$ $ 0D!$ 4$ @`a$ 8< ` & (a& $a& 0&.  & ,@E@> "'84 (` $ , L.@F> xa`P  ""`PH /` * !  0 n 2  ,- L> xa`  "`  #@  xa` "` ,@F$@    @| 4 @#  - L> xa`  "`. 菘   Y 胘 - L  /$@,`D  dh  > x  a> xy 7H  a` 7 o"`a`  7 i"` X > x!`"!H 0pd  2   Ғ   ;4   *# ("    `" "@$`& 豒"   2& `" "@$`&" @ @   "@&  `"@$`+H 0"H 0`"@E֐" > xh"㿀`a'D?a "D B> `  ;   DB > @mY  a  `''' D Dz > x! ,`$ ,ad 2`$a  `$@ Dİ   _$ `$@  a  2DD? c  娰 (`H B"`H塰 .` ;"` `# D; B>```@# ; B;`@`$ !``@8`$``@ @ Ds 0`$!D``@  ``@  @i`$ ~&`$D  $  "   X" 沔 !   ` 7`D:$0"'D$@4 D   2  D( 7 $D滔  ?2 , 4 `> w$ D ۘ `$@ad$ `&adF} @D  DD 7  `<""`""a\"`* "`$@  44 L) 2 `$D߰ 7@D`P w"`P @G 3D k 4a  $ 3 6   7D 愘  8   7D s  3* 4/D i Da   +s L@DZ0-/D T D `>$` $`0D!t$`4$`@` <`$`8$ ($ $`a$a , a$ 0`$ @@ @B㿘 8 4 4 ( L+8@D> xa`P  g"`PH /` * !  0 א 2  ,+ L> xa`  <"`  #``@ <`H 0@B4* L> xa` "` ,`$ @  Ә * L@C̐>H p@H 0@C㿘"؀   @      > "     p/G/F'/E@k6 @ 0p @  6*@ ?( @ `* @*`` @-@- @G@- F@-   `@-HH $DPT@$H  x!p@[  @-k ,*  E@-b '@@?'@` @ `2 ``<@ @@:`'@```2@`@@-B `2@  ?x?pp't |'x'' @( `<`@ `23``0?'``4 'd`8?'h`<  'l? ? ?@2``7b@ޔ  @ؔ  6 ```'pdh'tl'x'|``2@` ,*  @, `p @  j*@ ?( @  > xe#0.#> b* ' - ` @,@,@, p@, @@, @,ْb > xek# x> "' ؐʖ @      > xeI#8 > b'H /`4 * ! `Զ p@   "# `@i D!@ @ 't' (  !@ 5@ -3  @€ " @ <@ 4! @ @ @~ ``  '`-*!@  <`?@i "  t   "//- t @n 2o` ` ~$` D@i$`@ 't@!@ 'x' (B  !@4  2K`"` 4!2`@id D't`!@ '| (   !@4 `> $a$`$` D@iK't@ 'x`!@ '|'(  ` $`!@ 4d`  @Ȑ`@``23@H 0" > xdQ#P㿐> x> "P 'X'H'L'P'T`B     ;"P< 8 `h`?  2%  bP`T 2bP`B :# `" > x> xc`  0 ch  > xt#p  bP`B :# m`> xc`  0 > xch  > x#0C V> x`.` `$#8`B :8 H`> xc` ؔ 0 > xchҐ  > x #02> xm 2 bP `B 3: && @*  "bP(`B :(# `> xc`  0 > xch  > x#`0> x#0  "@& @ 㿐> x"P>  ` B  : Ð0  h`" `B :  > xchg  > x#p`0> x#ਐ0 " `B : > x Nch > x #0 > x#0o  @`$@ $   $@:> y    2  "P8`B :8 I> xc`  0> y> xch > y ]> xZ#04@ $ @7& *  ""P(`B :( > xc`  0 > xch  > y 85`0> x2#(0 @ " &  @ !㿈  `h `T T`!<82 bcX  `? 2bb؀" b`  `2b`瀢`> x`\ A APH`B p:H``B<` ` ; B<`@2  > x"P 0`B ; 0`B<`> #$`P> xc` v`0@> y P2`Ô B> x`` > x"P @`B ; @`B<`> #$`.> x c`T`0> y" ph@m  2#c,`T \h> x"P @`B ; @`B<`> #$` > x c`3`0> y > x#u0{'*"@ *`" *  *  & `: *"@ *`" *  `* ' ' : ' "/> W U @ 4 `耢@ `쀢@@ `@ ;^@ F @  / 0+# ` @ `0 `@ ؐ`@ Ґc,* @@ '쀢@0@0@㿘`   ? > x"P L2    > . # K$ *㿘> xې# "> ` "`> #,㿘#h #֔ I$b$bܒ @G ?  $c,,b  5$b$c($c$# < > y$b 4b $c\$@Ɛ`0> #?a>!|>>`☘    %$a4`\$a$a,`h,`i,`j$`l$a|$a{$b`D t  %W  㿘! # >1 $`$`$`a`\Ԕ!>`4!\ϔ`L!\˔"؀   $` $@"$`&"&"܀`"@@ 2@@ $@@" "@$`"ܐ &"ܰ 㿘 @!}8@yb%  5% 㿘"؀  ] ] 4] L 㿘"Ā`> y@ &"&"@   \ 6 \@ْ @qH /f4 T* ' T % "`" TD ( T"` T""b"$ "?""&"&" ?  $  T  T"`T$ & TH 0㿘 T " 㿘"؀ " &"$  2&"&"܁㿘`h`l@`hw `hy   㿘>  ``T`"` `h "`@ "` \ A A2"@ " 2 \``2`T㿘"؀    2@ 2 H> " '`T ``B <`H /`4b* !b     -"@*`" * c,*  ' : 'c  x<`<`"PX `B h`B  x> xc` F`0> ychA > y > x#``bȐB  <`$bbbȓ* @ 2$b> yȐ@  $bbbȕ* @ & $bb̐  $b> yؐ@ Ғ?$b "c(cT ?$cTcT 2c(@?$cTc( Ɛ Y  2 `> x`B <`Ph`B :h Lb x4 ($$$ @c$ x  `- x p,,@c  /`T~/  0 @c   xc   ,,`T X(* 2 2 ,,,'xQ $T 2w$c` $ ($@ې* 2 2 , , `ؒ$` L`  B`C > x<`<`"P` `B <`#\  b@KX 9 7> h`B  x> xc` m`0> ychh > y > x#``bȐB  <`$bbbȓ* @ 2$b> y@  $bbbȕ* @ & $bb̐  $b> y@?$b$c`H 0 DY > y^! 㿐H /`4 * !    `2   < T"x'Pz#  2H 0㿘H /`4 * !   %>  `2   TD 0 @o y#  2H 0㿘#3'`(#H.#2Ṷ`/ #1#D/`#0+``* (@`  6 &(&&6 & 6 &(&&6& 6 &&( &6&㿘# / "&#L>   2 + #L &#L&#Pc ` > xc` [ 0#L> xchU #L> y!0> x#㿘 # #"#P "0 y@d\#P#L, "& "؀    `p& ?   2   T"x &   㿘# &"؀`"( #P "$ ;@d#P#L, " "؀    ` v&    㿘2` "1  \ A A2("# `"؀"!" 2 p@  2" `( ""x@Δ  " 2 \ 㿘# ? #`  "xv2 0pv. 㿘# "x@ `? 㿈  Tv v 7  2!&   #  @ #沐 bڃ  " "  2&   D  n  B<  㿘  # ($   #  ``#P    @ `  @c6 #L *@ @ `? 㿘   (> y!HC 00#@^  #   " ِ $#T@   > xPx`B :x㿘"؀ @` 㿐 `T 2 `\`\ 4`\@ 0    c$ 2bc(  b  `@ 4`\ 4`\ `d[ 0`    "E 0W@  H  0JXd  *"@ *`c," *  *@ *  '  : `'?$cT``` Lc$ 4 " c( 4W$c(  LyW0*"@ *`" * c, *  ' : ' dW㿘"?c* "   ,  2 @ "\ "*  $4 "$?`"`"""@ ؐ `2$@㿘 T @  ` V`\@2`h 1  `T`  N   7q    0$` $@$`@.   T "#$ #$ 6 #(@ `v 0r#( `@Y  ` t0b2&`T$ T`T@ " ""`& " 2#$2 $"`"$"`"@ #``$"""b"#`$$"` #`#$ 2 \#(  \ 4 \@OH /f * ' `(>L >$"@H 0  \ ?4 \ 㿘  ! `T !p ".!p c 2.!p .!p ^    .!r.!t.!w.!u.!|!~.!q.!s!ps͔ 0!p@^ 㿘"؀` "yҐ@`"y"ؒaq@8   "x"x 2 ""|?@2"Р"xaps "А@"  !  `s  s@ @C  㿘  ` ??@    2``0 2 ``2@#$&#X#(C#X< 8 &#$)&#(> < d` ` 2`0` `h 22#$"""@^a  T&" 6"#$ @#$  #(   \ 6 \@  㿘`  T \ 2#$@˒ #$  \ 6 \ ^ > < d"   @"0 `h "0R`\"0a@!@@2 0`,( 20 " 02  `"  @ . 1 1 2( T "$ 1#$ 2  T@  "#$ T `&#$ \ 6 \@o " 2   $>$ =H&" 㿐#X< 8 " 'Y    "4 &" , ,   7㿘`  T` > ` > ` >  \ 2#(@, #( k \ f6 \>  `( `#  ` ` (`0 `  ""h " P\2`" `2߄ `  T`"` ` @2 1 2, T "( 1#( 2 `@$ "`? ? " T#( &#( T  #(  \ 6 \@   h> "'В @]"< X   ///77ؐ@̠ ,@]  X ' 7'/7ؒ'@ 2&"@` $ ` "`"$`$ ` "`"`$`" " > yX!p> ">'`0` ! @ 6  @"F @" 6x1@2@ -x!@ "$ !@"! 0@K@Ѱ x    /x\> 4\$&&B\`4\`  2`ؐ\  4\$\ 4\ @$ ܐx א\`4\'!2 ͐xXo ŐxO\  xQ\ İ  2$X8 $Xj "``!X   0T9`@    ؀` F@`@Ґ "Ѐ  ~ $,?@W ؀`   &`@`pƔ   `[ , Ԓ0p  P  3 KxX @[ĐT``0\@ ؀` l`+@ `+ `* @`,' /'C!2 2X0p X'oG @3@Ā   @ʔx@xx@ߔ  " > yV!@`"2 @"+bb؀ "'b    @@ 2 @"؀"  2 2 b`Ԁ@ 㾐> "`' e"` @ ]@[!!   T` , `T 2J `4 `  @ 2 @4`t .`t:  #  .`tbϐ@Z     "# 2`4 @ 2 - @-  $ @`   > yU!㿘> ya@V  !@bĠ   @F 2  `,"`"`  2㿘   \ A A㿘#` " T` # 2a  a  3㿘"؀ @ 㿘 \  `  "܀ "> #$@ ; > x c`z 0 > x zch > cT.`+ @@ > y zʐ!> xzǐ# #$@   > x> x c`zg 0>  zbch> T.` + > y z!> xz#&  `` , k , k, kuΐ㿘 h  bĐ,"b"b  :> #/> y)> x'> x%> y@ᰀ ", ` `"`"``$ ` @ 2` ` #` z  0@ zh@ 0zS> xzP#  2` @``  Ā2 4 㿘 h 6 T 1#> y T `k "`\   \ 6 \  &" 2" {b@"   &"?mb@" 2 T㿈TV  4P!   `E $\ $ @   @  2`m\ $" $%\ a1 2 `""`?"$$x 4㿈 T)  S` C" @R  2  @K  2  / #\``2@`"  4 ᔐa2 @`"``"``?@"$@$`' 0c㾀>  T b`'+"`0'`4$`8$#\`< $ ?  ma a2`"  "` "@$ $ #\ 2 " > yS"H h> "'  >  >  x b& & &!h $@XZ  @'Ȓ@-, b > yS"`㿘@-   > 㿘` @0   4Ő2> x L֔ ' <" >" ""#`,@ "  " $ 4$ @$ $ 0` l< $ 8`aa`#@#`(#`$+` #`0l @/3 Ж@0^> xb`@ 7 "`@㿐 8 4 ( $ Lb@0I> xb`@  "`@H /` * !  0 ú 2 C L> xb`  "` `#  ; B<`> x"  : " (@ B ; (`$ ``@8`$``@  L @<} `$!" ,``@8 , ``@ @&`$ ~$`$ ,  #``@ <`H 0@. L` "`u ,ْ L $  @ $Ҭ c 7Ӿ 2а  W$  /@   5?1$ @ *! ( ."@   " "@$$  "   2$ " "@$ $"  k  ?$ $@/f b ֖ H 00H 0}@/E㿈`  (a > x``B <` ` ; @ `DB <`@Vђ a `''`D dy > xb  $ a  "  0 ?# @$`0?`#@ 8 8 ( $ 81` . "`# ; B>`  0# ; B< 0`$ !``@8`$``@ @ U `$! ``@8  ``@ @`$ ~&`$   "    X  $  "   X" 沔 ϧ   `А`$C 7"$@κ@.  2`<γ1Ж "  4"@"" " L" `$ (a$a , $ 0aj  >! $`4$`@$` $`0$`8`@-"<` ΅@.M`@ 7 "`@㿘84 ( " LQ@.8> xb`@  "`@H /` * !  0  2 ,2 L> xb`  n"`  #``@<`H 0@,ϐe L> xb` "`O,  L$@@-^H 00G   2  > xb` 7 -"` @Ux`4  a   > xb l , *  l ,* ` . "`@-%H 00H 0Ӑ@-㿘@`(`(`.  @` `(`(`.  ``` (` (` .  `` ` (`(`. 3 ` > }p?> p??` * `(` (@ @. @1 @( @@  ``@  ` ` `  ` ق```(`(`.  ```(`(`. 9 `> }p?> p??`* `(`(@ @. @1 @ (@@  ``@`   ` ` `  `$t ` `, `(ӂ```(`(`.  ```(`(`. T `> }p?> p??`* `(`( .1 @.   @ ``@`   ` `$ `(  `,% 1 (1 1 `  .  @ ``@` `< `0 `4 `8`  㿐ސ *  '* @ ?"@"` "`"`"`"`  "` " `􀠠> }bp`@?`2  c@ 2`(`2`@@2, @2 @2  @2 2`* c` 2@ @ ` * *`@3 @3 @ - * @3 @ @ `> ~> "pbp c-+`@  @ > + (, p @@ -(  !> > ~"p,p,  `+,` > p@ -  `> bp . .`.@@> @p. `!> -`"p@'@@  '`'`y'` h>`'D) /`-` *  +`(( @ . @+@(`@/  @D/`@@`@`@` @'P@@@M'2`665 . .5 6'Ԑ #@45 '̪#c4@42`(2`# `@+ c. @  `.`( (@̪ D@@@ @ @ @@@5> y1 p0`(7> z5`p5` '0`* 3`0``> {pc3`'@1  #@3` # ` 7> |܆ 'p(5`. (@ *1 DDc ``. @ @D@+  @@ ''D['2`6`9> }"p(@?5  #(@ %?@?@#@D7`(@ 5 #@ `4P(@1 @/` 1 1 4/@/`/`@#D5 @(@@ 2` @(@@@5`P5`5` /`/`/`/`@D2`@4(#@2`@@  (@@P@0`/ 0`0`/ / / @ D@` @@@3`/ 3`/ 3`/ / 㿀>`'D, /`+` *  ((@. (`@ @+ ) / /` D@@D@` 'P@@J'5 (22 #2 466. *`4 65 c4 5 # . @+c .`(@ @(@D@@@D@ `@ @@4 9> ~"p(;> 0`bp3`'3`1 *  c> 1  0`p3`#'. 1  # ` 9>  "p4 (` . @(0`@*@4 D Dc @ @ @  @+'D  @` 'D`'7> 2p(?@4 @ (@5 @#@7`D%?(?@# (25 @#P4 @/@@4 4 /`/`/` 4@(D@0@ 2 #@(@@@3`@3`P3`/`/`/`/` D`5 4(#6@@ @ (@P1 / 1 1 / / / @ D@` @@@0`/ 0`/ 0`/ / 㿘l   &&  ?㿘 ]  u 2?& & ?㿘 { 㿘  H;j&. ㉘ `v  " : "" " 㿘  (0 3`+ +` `? @@ # > `` e5@h &@ @b`@?` e 㿀;> b'D'`2*@`*2*2222 ///////*2@ `? @" / @?> 'c` D   . . 2 .  . @ǒ Xb > K("X< (. .`&5ک x@  @@0`(`@@:1@V5 - @  ۪@@5`-`@Ą @0os@ 1 ) @Ȅ =_㯂@@0`(`@̄@@*5 - @Є * @ @5`-`@Ԅ @?Q@1 ) @؄ `&؂@ @0`(`@܄@"=@㯨5 - @ ?ք㱪@@5`-`@ @"W5@㾈 1 ) @ "@@0`(`@@?f@ᓨ5 - @ )P㎄@@5`-`@ @m@!1 )  =@b@@0`(`@@ @0,@ 5 -   @Q@ @5`-`@@@:m㪈 1 )  5Ą@]@@0`(`@@ @S5 -  6(y@@@5`-`@@@9Ȉ1 )  xs@@@0`(`@@ @0ք5 -  =5C@ᇪ@ @5`-`@@@V 1 )  *x@@@0`(`@@ @?;5 -  @٪@@5`-`@@@#J1 ) ?B@@0`(`@@!} 5 - gX"@ @5`-`@@?yN 1 ) )/D@@0`(`@@5 - =҆`@@5`-`@@/p1 )  &߆Ƃ@@0`(`@@:I 5 - 5;̆@ @5`-`@@" 1 ) 6u49@@0`(`@@95 - 蟆@@5`-`@@1+e1 ) 1= H@D @@0`(`@0@ʿ㗄5 - 5*@㧄@@5`-`@5@?$91 ) 1Vք@Ä@@0`(`@0@#3 5 - 5?@}@@5`-`@5@!aф1 ) 1@O @@0`(`@0@?95 - 5(P@ @@5`-`@5@ᡄ1 ) 1=߄@₄@@0`(`@0@/N5 5 - 5 ⻄@@@5`-`@:ᴄ5@㑄1 ) @ % %%%H;j&. 0㉘ `va  " : "" " " 㿘 .3`+  `?@ @C ">   `@a! @g  @b @ @@@& a @㿀;> b'D'`2*@`*2*2222 ///////*2@ `? @" /@> 'c D   . . 2 .  . @ `b > G"H<'D (. .`&D @0( 1 ) @ 0(5`-` @ 0(5- Ć0( 0`(` Ȅ@ 0(5- @̆0(1 ) Є@0(5`-` @Ԇ0( 5- ؄ 0( 0`(` ܆@0( 5- @0(1 ) @0(5`-` @0(5- 0(0`(` @ 0( 5- @0(1 )  )@3a6 . 5`-` @-@ 0(5-  -0(0`(`  (@@ 0( 5-  @-0( 1 )  )Є@0( 5`-` @-@0(5-  -0(0`(`  (@@0(5-  @-0( 1 )  )@0(5`-` @-@0( 5-  - 0( 0`(`  (@@ 0(5-  @-0( 1 )  8@ 0( 5`-` @3zc6 . 5- 50( 0`(` 1@ 0(5- 5@ 0(1 ) 5@0(5`-` 0@0( 5- 5 0( 0`(` 1@ 0(5- 5@ 0(1 ) 5@0(5`-` 0@0( 5- 5Є0(0`(` 1@0(5- 5@0( 1 ) 5@0(5`-` 0@0(5-  (@3# `܆0( 0`(`  -@0( 5-  @)0(1 )  -@@0(5`-` @-0(5-  (@ 0(0`(`  -@0( 5-  @) 0(1 )  -@@0( 5`-` @-0(5-  (@0(0`(`  -@0(5-  @) 0(1 )  -@@0(5`-` @-І0(5-  (@ #܄0( 0`(` 5@3*T aN0( 5- 1@ 0(1 ) 5@@0(5`-` 5@܄0( 5- 0@Ԇ0(0`(` 5@6 . 5- 1@0( 1 ) 5@@0( 5`-` 5@ 0(5- 0@ 0( 0`(` 5Ą@ 0( 5- 1@؆ 0(1 ) 5@@ 0( 5`-` 5@І0(5- 0@0(0`(` 5@6.5- 'D'''    1@3(c0(1 ) 5@@ 0( 5`-` 5@0( 5- 0@ 0( 0`(` 5@0( 5- 1@0(1 ) 5@@ 0(5`-` 5Ȅ@0(5- 0@0(0`(` 5@0(5- 1@0(1 ) 5@@ 0( 5`-` 5@0(5- 0@0(0`(` 5@ 0( 5- 1@0(1 )  -@@3ta$0( 5`-` @- 0( 5-  (@ 0(0`(`  -@0(5-  @) 0( 1 )  -@@0(5`-` @-0( 5-  (@0( 0`(`  -@ 0(5-  @)0(1 )  -@@ 0( 5`-` @-0(5-  (@Ȇ0(0`(`  -@0(5-  @)0( 1 )  -@@0( 5`-` 0@3\b0( 5- 50(0`(` 1@0(5- 5@ 0( 1 ) 5@0(5`-` 0@ 0(5- 50(0`(` 1@0(5- 5@ 0( 1 ) 5@ 0( 5`-` 0@0(5- 50(0`(` 1@3\ b0( 5- 5@ 0( 1 ) 5Ȇ@0(5`-` 0@ 0(5-  -ذ3]b6 . 0`(`  (@І@0(5-  @-0(1 )  )@0( 5`-` @-@Ą0(5-  - 0(0`(`  (@@6 . 5-  @- 0(1 )  )@ 0(5`-` @-@0( 5-  - 0( 0`(`  (@@ 0( 5-  @-܆0( 1 )  )԰@6 . 5`-` @-@ 0(5-  -0(0`(` @0(5- @0(1 ) @ 0( 5`-` @0( 5- 0( 0`(` @ 0(5- @0(1 ) @0(5`-` @0(5-  0( 0`(` @ 0(5- @0(1 ) @ 0(5`-` @Ć0( 5- 0( 0`(` @0( 5- D    D@D@&&&& &> "'X @   @ 0`(`@ @7`/` @  @`1 @)    0`(`@ @7 / ` @1 )  @@  ` 6.  7 / @  @` 7`/`@@ 6. @ @ `@0`(`  7`/`@  @`@ 1 ) @@ 0`(` @  @`7  /    1 ) @ 6.`  @7 /  @ @ @ `$7`/`  6.@  @`(@ 0`(`@@ 7`/` @ @ `,@1 )   0`(`@  @`0 7 / @@ 1 )  @  `46.  7 / @  @`87` /`@@ @ 6. @  0`(`@`<3 @ + @  7`/`  1 ) '`(@`8@ `$@`< ` ``@ `0`@(` @ @ 5`5 -`-@ @7  / $`$`@`,@@ ` 1 ) @ 6@.@ 3`+`@ 7 / $`   @`0`7` /`@@@ 6. @ @ 2`4@0`(`*)z#`  @@ @7`/`  3 @1 ) +  @@ `8@` @ 0`(` ` "@ > 8ې"H;j&. 0㉘ `va  " : "" " " 㿘 + 3` .@ `?C @ ?>  @" `  RXd  ?` @ ? @  `  &RD@㿈> "` '  % *@:,@   > b> bА `  aa>     ? @" *`2 .   ?@ b > 8Z"؁㿘  > #Q  P@= @  > @㿘> P   22 **@2*`, ` `@. .`.3 3 + + 3 +  @ @  @ "`Ȑ  ``( @(@1 ) 1 22 ) **@@2*0`0`@(`(`1 0` ` ,  3> ,`+b@ `@/`@3 + 3 + @3 @+  @  @ @@  `?%@ @  @ $$$$$ $$$㿘7 @*2@ `?"2 @" `P! `P Q @, B> @@&& P ?" @bB > @`@?  PP @.B> @㿘 6`@*2@ 2`?`P`P *@ 8  P 8"@ @;@`@?P @"@ @;@@; 8`@@; 8 .`P`@>`ِP @ Ё㿘  > "P @ P@;Β   > @> H 'D P'@??'`?`? ?в`( D?0D?`8?` Ի0й(`@ `+` ` 3 6.7 '`(І '0  + Ї5`- `.*.' (0  ?3@@@ @ ?Ц -`,@4   @ /  @й,Ȗ?@  @   ,, - @@D   E ?6 > ,6.@ @Ȕ?E   +`4,3@й2?Ȳ   *@ ع6`/`E@  @ @ @ B @@@E??E@????@`?C'   '( ?(@ ?ԡ+ *24`6. (0+,`4  34 ,` * ,`Ԡ 3, 2`2`4`4`, @ *  , 2`@@+*`2  2 2` Ժ@ -*  @ 3 @ иȺ@?  ,,@ @D4?@ D @ @ F ,*@> @) @C@ B ?@6F,6Ȗ 4`?@   F3 ?ȵ,+`؆  *4`2,@@F?@@   @  @@@E??E??@ O&<@D@C@DB (@АBȺ@GDF08@FD@<8<<<<< <(<0㿘e @*2@ `@2 "  "`P N @,  @  B > @ @8  H2 @ D(@ H`B > H@& P`P  @dB > @ @ 8 2 H D#8 H`B > H` PNq @. @  B > @ @8  H  D H`B > H㿘 @*2@ 2` P *@ p  P p"@ @9c HP "@ @9Z@9T ~  H P@9N p . P H @> > 㿘  ȐN @@~  Ё㿘  > "N @ P@9)   > @> H㿘@㿘  M 0@} Ё㿘&0@@33#3. $(``@7`7`#7`.`$(`33#3. $(` @7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(` 33#3. $(`$@7`7`#7`.`$(`(33#3. $(`,@7`7`#7`.`$(`033#3. $(`4@7`7`#7`.`$(`833#3. $(`<@7`7`7`.`#((`D`@@&@&`㿘&0`D@33#3. $(`@`@7`7`#7`.`$(`<33#3. $(`8@7`7`#7`.`$(`433#3. $(`0@7`7`#7`.`$(`,33#3. $(`(@7`7`#7`.`$(`$33#3. $(` @7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(` 33#3. $(`@7`7`7`.`#((@`@&@&`㿘> cJƔH*`2`  *0 : *0@`( ` 2㿈.7 6ݐ, 2 @ + @2$@  7'' , 2`*`$@ `**`2 $@   , 2   .`2  `* *`+`&@2&  , 2  , 㿈/ 7 7 , 2 @ + @2$@  .67'' v'o', 2`*`& `**`2 &  6 ,  2  O'H', 2   * *`+`&@2&  / 2  נ㿘.;6㿘.6  V *`2 `  㿘.6   *`2 `  㿐 .``(`*`@*`*`@ `+ `+` @ @ ? 000000.@.`.`.`.`.`.`.` ֲ`㿐 .``(`*`@*`*`@ `+ `+` @ @ ?G 000000.@.`.`.`.`.`.`.` ֲ`㿐 :   @  . ( *(*`*@ + +` @ @ ?0.00000....... ʴ㿐 ;*(*`*@ + +` @ @ ?ђ?000000 ........ @ .( ɴ(+ (*`  **    ? 000000........@ .(㿘``) `((`@ #3+3> P3> /`P3 #> @P@` > `P/ +(`@`( @&@D@#@3+33c. 3 @. H#&3+33c. 3 @. L@ #3+33c. 3 @. P#3+33c. 3 @. T@#&3+33c. 3 @. X#3+33c. 3 @. \@#3+33c. 3 @. ` #&3+33c. 3 @. d@$#3+33c. 3 @. h(#3+3. 3@c3 . l@,# 3+33(c@3# (  ^p0#3+33c. 3 @. t@4#3+33c. 3 @. x8#&3+3. 3@c3 . |@<#3+33(c@3# ( 1 1 1 0`0`0`/ // / / / / / 㿘@`) `.``(((``@. `@`@ > > !> c#> | <'6.6cP66c#P@. #PcP@. x8'&6.666c@. @. t@4'6.6. 6c@6@. p0'.666(c6@#@( @l ,'&6.6#P.`66cP#P@cP. @ h('6.666c@(#.@ d@$'6.666c@(#.@ ` ' 6.666c@(#.@ \@'6.666c@(#.@ X'6.666c@(#.@ T@' 6.666c@(#.@ P'6.666c@(#.@ L@ '6.666c@(#.@ H' 6.666c@(#.@ D@'6.6(6c@6#.@ @'.666(c@6#(@ @0`*0`0`1 1 1 *******X   & 'Ȇ ''`   'Ā& (& @?(&? (& &ĸ  `'> P> > PP'Ąd„ > ׅ(#P. > г7`7`ȳ.`@2 (7 P('؅7 7 ۴. 2 @@'߇6(66@(2 @@ #@@@7`'7`̷.ӱ7` . .`@'''_'%> ߤP܅(. س7`7`.`@2 (7 ('ȅ7 7 ˴. 2 @@'χ6(66@(2 @@ #@@@7`'Є7`ӆ.۱7` . .`@'''''Ą V    0M  3> 000(cP@> P6  #6 /`+6 #> +`#P + 2`2 #2`,` 2**`, *@@ @ @@ @  @ @H `%> P0(. 0* *`67` 7` > c7 #P 6++ ,`67 .  7 @+`#,  @@ @@ @  @ @ ` ` `    G 'A> ޱ. .`((P$%> ձ. ˳.`χ((P7> . ڶP޳.`( (> ϱ. г.`Շ((#P@@``@`  @ ` ` ` Ā@` ```  @ ` ` ` Ă`8'Ĵ  '   Ą'ā㿐 *   * +    *`  *  * ''@000000.`.`.`.`.`.`.`.@''㿘0`.@@7`?.@@0` ̄3.@@7`?.@@0`UUU.@0`@(`7`/``@> P!#%'"$& @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7`` / 7  ?7 (`@7  7 @`?. 7`7` 7`@`0`> P!#%'"$&`x @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7``/ 7  ?7 (`@7  7 @`?. 7`7` 7`@`0`(`1 ) 0`UUU. @1 ?. @0` ̄3. @1 ?. @0`ð. @$$㿘0`(`7`/``@> P!#%'"$&  @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7`` / 7   ?7 (`@7  7 @`?. 7`7` 7`@ `3> P!#%'"$&`x  @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7``?/ 7 ? ?7 (`@7  7 @`?. 7`7` 7`@`?30`+(`$$> p * ``( > p ` `(  㿘> # @q     ` 㿘> #䀢`" א ? " ? *` @  *  @*   *`*@  * 0`#@ @ ,`) 33@ @ @4`(`@ @ 4`@@ 0`UUU@ @ ,`@1 ? @ @,`@ 0`@ @ ,`?@c`c@ *@  > < p 3 c 2> $'!%  h@  - `) (`1 0`) (`1 0` @ 1 1  < 1 1  1 1  `1 @ 0@ 8@0`0` `<*(" ?`? * + 0`0` 0#( `0` +`@  &*`  @@ @ ? @,`4 @ &@4 , ` &@  ` 㿘4㿐 + *`   *   **`  *  * 0c@ @*` 0)?#@ @*` 0' ̦3@ @*` 0%?@ @*` 0#UUaU@ @*` ?`?0@ @*` 0@ @*` 0@ @*` 0@ @*` 0@ @*` 000000.`.`.`.`.`.`.@.`㿐>  `?  H /f * ' >   C> >  `+  * " * `1  2. '` @ * `2 2 ?,  *`* "@ "*`*  `  8    ő+ ?, " ? , H 0" * "* @`€'     @ < "H 0㿘>  ` = > @ 5 H /4*`* '*` * " `* @`  ?"`` €` `  @o- H 0㿘H /f * ' > `   %  l"ܔ > ` " % H 0x?  *@ *`"@ @*"*`   >    ` 2   ` 2 ` K    L.  H 0H?* $, l瘔    H 07?!> * *" *>Ò *` * " * @)א@ , @ *`* % "`; l$ H 00*"H 00H 0?> @`> ਀+ H(+` > (਄ (    " ( ( അH 㿘>  `> ਀. H() @> (਄ (   &@(਄ ( H 㿘 H /f * ' >  >  `  . * "* @ .`@  . H 02 `"@ `    *`"`* "* ` @( ` ` `* `"H 0 㿘H /f * '   >   +  > * `" * `"H 0 > y  >  #G 0@z 㿘> y  >h  #6 0@  㿘 "a  d [ H /f * ' >   >  >   `Ԕ ऀ "  ഀ "   * `ଘ  ଀+  & @LH 0  * > `" * & `B : & @/H 0 㿐 "  @ } H /f4 <* ' <  >  2  & ,@H 0^ >   5* * " *  ` `?`#`` ' <` " `B ; ` ;  B`;`  ?2& ,    #& ,@H 0 㿘 $H /f * '  <`" > x!> x`4& <Ar# <`2`4> x#AjH 0㿘H /f * ' > x#@,  H 0( H 0 @'[ H??'> x@   @'N 8`<?$ 4?$`   !u p> y"`> x> #`x H   >#\> x> #`#\ 8  > 㿘 0  & 0 @@0 > y `@ ! 㿘> y `d ! 㿘> А/ > @* > > Ԟ.( (@ऀ ഀ  .`/@``.`." (                > "'0#e ( @   #g#i@ #f@ʰ @0#h@ذ `>!*` €>  > !> !,> !P>  !t>  !> "> "(> "L  @&^ $Ȳ@&Z $ &*`'' @h  @ d &  L : ' 9: R2'#  * ''  @  &  L : ̒'Ԕ9: , >  Ԁ `? ̚  ::;`#\#l#h#p@#t 2`W  & ;  `&`@j:`I LԀ ,̀`&`@j:`= L#@ @@@ @ @_  >   㿘`?#  )    "#  @' ! ! X@%   p&  t&  \&  l X&  &@%w L` "` h"@  @  @& 2     <4 մ  < X` 8` ˀ  $`$$ $ <$ @* $`    ?$ `$$ $ $$ (* $` X>$ $ 4$ @ $ 8< ``    ,   8   `9  $ $   $"`  $  `$ `" $`  De $ D  >   $ 0+  > * `" *  `  " $ 0€ $ , $ 0H /f4 0* ' 0   %>  U  0`H 0! x 2 , 2`` X8;`  ``   80 D Ӑ X@  L㿘 8 , x" ,`# ?  & 0㿘4 㿘     `>!*` € 2  2  2   L  А h >$ ( #T4 @ $4$d$   @\#@   " @ 2   L ᣐ$" 6  @ 7 9 `B ->   $ ",@ 2   $@ 7s   `$%    " `@h2` L  L   -㿘 (?`"`$ "@""@ 2 L& ( > ̀   㿐0#d@1  L   &@&`&`A ǒ L0 2` 2 >  ""`(&, ?",`0?"`0`, `0  2  " ? 2 "  ""   "@ "`  "  "`"  㿘`  Lࠔ  / 7`4`, @ & (\& $h& <l& & p& @t& & > Ғ0 㿘E  $ " <A L < "; L8 L㿘 `>  B6> >  B ` `2 B 耦@ :&@ %> `2 B"7|&  㿘 `> ! B6> > !@Bx ` `2 Bo!`@ :&@ %> `2 Bd"@7E&  `    @   &  `2 ??* ""?㿘`> !B# > !B5> `` @ &B,`  @6&@$ %>  @ &A,`  "@   @ Ҵ& ` ttt  ttt؜بشݘXdpېۜݘܠܬ݄ݘ|ؤ ````8ބބބ`88`8ބބބ````pppppppฝX> `b ' @$ '2'   6T Ԓ 2)  Ӗ   6<     u   } `€2    @Y WАK   "€`7  6 ` @  * & `€5ߔ@5Ւ€` 6  @  * & 4 @< qI  @  "' "' ^ @  G   "`€&2  &  @ @, & `€@5q`€&   @ @, & ' @ 4 C 2 ڰ ְ@-  @\ Z   "`€8    @  * & `€5 @5`€ 6  @  * & w"s -@`@ N@   "`€&4  &  @ @, & `€@4`€&   @ @, & '@` 4 @ @  '6 / > " > #(> "'?x` 4S  @`h`  `0` "D?`1>!*` € `$€4*`` ` `$€ `2 ` `$€ `$€ 2  D`` z  3`   > O#8> `<X`4 " ' 9 > ``ؑ* `" @   ```" @ 2``"  @   6`   2     8` 3h  4 2> -`" `0      3  2+ "  3       h` @!" @@, @,  2`@@" "€ @6K`"@C@v ,  €,  2@P @x  2 €@}@@"` 4 $ @`* $*$   $€2 `D` ?  2  > " > #P㿐` l r   [      "    l "? &`   01     $  "@?" ?&?  + @` :"`" "` l 㿘 `>  ئ`#> `ܤ :` " `ܔ  ,`2؀``܀2,؀``ܐ $` * $``ܒ l* ߔ `܀ 2 $`$`ܐ @uq 7  `ܒ22*ܐ l$ؑ,@`_&  lں $@?`F>!D*` €>  > !> !,> !P> !t> !>  ">  !> !)"`> "L`  :`  " > "p>  ">  "> "> #> #8  li "` `   l^ "` ` #> '> @  6*@ ` & : &`  €``* ` 2  `   : "`* 2b( @  j*@ ` & : &`  €``* ` 2  `   : "`* 2 @  \*@ ` & : &` }> #>    l "` ` ` &  l: ؔ "``  ` & : "` ` :1`  €``` *  2   $€ 9>  (>  P  l٣ "`  "ː  @$> #`> #> #  lً "`  "  @`*  2 `  " >  x"` @  @"` ` 㿘>  ܀@  >  ؀`.`@R `O   `"`=>!*` €  4 `@ 0   @`]`  l  "#`   @`N`  l  " @`D ܒ l    @`9` ђ lΒ l` 2  㿘 2 <j  ^  4 Y>      >  ؓ*   O& , 0      > `    5  2  . ?`(>"*` € 4  4 & ,`4& , 4'  & , & $ & ,`4` ː ( #> $`> :Ր#`@ْ p >>>`'ؘ#d''''''''''''''''''''''@'㿘 㿘 㿘  lD  )&  @?㿘@_a  l&㿘ݚ 㿘! Ӛ 㿘 l !& `` `a 6 @?㿘@_&!پ l&㿘 㿘/ 㿘 l ܐ H.&6 㿘@_`H٘ l& 㿘 㿘狔 㿘 l ׯ &( 㿘@^Ւ m l&㿘t 㿘e 㿘 l ׌!.D&  @?㿘@^!A l&㿘 .  @ǒ 㿘 .  @  . 㿀>    "`'`.     @   *@ ! 2 @  .@ $@ @^d b > Ő 㿘  l#!*&:  $!@? .T  @?㿘@^:!Ғ l&㿐.> #в `+ 3` +3 ?#@I !Ô 㿀> "#Т' @  + (@ ȩ Ȝ @  .@ (@   @ *  +  #А .#А@]ْ  > : 㿘 㿘 㿘 @ l? l օ#.&<6 :`@ !5 㿘@]#9 l&㿘.2 㿘.O2 㿘.*2 㿘.[2 㿘.߀2 㿘.޻2 㿘@ 㿘@ " Ȧ@ 0XP "? 6">>aԐ!'''' '̔   l,` % T "@ .`  l,` % T"@  $   PT''>  $ >   #\?  z 2e,`* I  E  T̀ ؀`2܀`K`I lս  C&'& &`'ܰ  lխ  2&ÐҐ # @ ,@@ l@X&@ $,@ l@L& ` @ 2@&  &; l` @    㿘. lX 㿘 l㿘     *@  (*@  @ @@  @ ,@,@  @  ( ..  @  ` @+@  `+`  + `+ @ `    *`@ * @ @    +  +   * *    (@ `@ * `  +  +   * *P> "'@ XƫƷ X & +& @ @ +  6* ``?$ Ɔƒ @@[͒ @b > .!㿘ƀP> "'Ƨ@ܒ @`+`X  \* ``?$ R^ @Z ƈ@[ @ > !P> "'@ ` `E & +~& @ @ +t  6* ``?$  @@[R @b > ! 㿘P> "'@a @`+@``  \* ``?$ طƔ @” @[ @ > x!0P> "'@ ݔ А &!+&!@ @!*  6* ``?$ ٸ @@Zג @b > 8!@㿘٦P> "'ג@ @a*Ő`Т  \* ``?$ ؽل @ـ ٸ@Z @ > !Xx` @ `'`'''''''8` 8> @''''`( (6`6 06 .`. (@?'쀠`'!! ! ! 㿘6   @@ $`` $ `` $ ` `  $  `  *2 㿘@I  @F  @C ! @@ 㿘.6 0*@&!0! * !0 㿘.!$*2㿈.6''''􀦠&` &@)  㿀> "a0 '.a/a `0` @  . $@ @Y b > !p*` `  @> !` `* 2  ` `  ` ` @  *`  㿘#6` @  ,`2ѐ@ ,2ɐ @ . 6 * . 2 㿘   & t&&  t > c"X& ,㿘 0@xt & 㿘%#>   @ & ,c@ ΐ " > > y ฝ㿘H /f * ' > y` ` """`?"H 0 ` ` > 4"@ 0ց㿈 `    # " 0 X     `  ?  @H   `@ > ! !-` /耥 Ȳ > * 5@@ 0 %`@@&2`` `T ` 0` 0ሒ @А ĀH /f * ' > <!   `>$   -q0 &   2" "`"` "`Ho  %`> *@`H 0 ]ሒ @ zH /f * ' >     `$   -'0 &   2" "`"` "`Ho %`> *@`H 09" @2  j  0 ~ PH`B  =P4@@ 2   0̀Ӏ 0@T Ѱ0    J 0 @ H /f * ' > <!   `o$   ,0 &   2" "`"` "`Ho  %`> *@`H 0@ H /f * ' >     `)$   ,\0 &   2" "`"` "`Ho %`> *@`H 0n@ 4< h "I 0 K    0C @_ @ O` 60D@  @ 4<   8 ?%8 ሲ`@&@@2@0 0 ? $@``ጒ8 ?%8㿘> !`")  <  " ?  @ , / "? @V ",`?@K4` 4`  㿘> !`"  '   ( 2 ? *  H    "  ,$@ @!$   @2  0 ܒ  " 0 x    +  2o @v  !,  /@ p$ ͻ  2@Y  `28P- 0 ?"8%  `B :P8 ?"8 27  <@*@ +$@4` @4` 4`    & & 4 `@4   ?`& & ,*   p  >  ? " 㿈    !"`$`` 2aa~`$ @@  !, /@> ! R H 4@2 `` caV "    U   @.  @@  D``; ` !" <!$ <` p$  '  P 8`B < P $ 8 ` ? $```?` 6` p$a  7 A 3`㿘 $  "  $A $?# @6 $ $    `@ɓ*`4  $?# @6 $> ``!    @0>  > "  8 `  "  '8 `       (     ( (       -㿘`   `.`> D € >  p 2 > > !|? -> /ې" 㿐@  -  @ > #\!ߚ > y #\`  2㿘     㿘    2    o"@ 0@ q"`* .@"㿘   "   @ ؒ㿘> a 1>  "a!4!4㿈a"@  o6. ڐ ' "  "`"@"`"`  o6 ?#\  @ `     ' 7  6X  \H /'̐ Д Ԗ  +   'Ȗ "  "`"@!?/# ``  'Ȓ` "` "В# ` q  " "В    ` b 'Ȓ` "` ,@,`4`$`> gȀ > 0Y"ۀ` G " "В   ̀` 9  ` %` # Z  <$$ @ <1> "a $$ $ $ $ $ $ 8$ $ 4   'Ȓ` @`'$$m 沖  o'В   h' `'Ԓ> `"/F̀ "'Ȁ !@''''#\̔ؖȘ 4İ # R$ ܀ ׀ Ҁἀ@̀ >  /#Ā` > /#) <   g   ' 7> "/``    ? Ȁ`' `''@`~̀ xЁ㿘` ? (  R    ( `2    & ""㿘   "    `   і.@&- 㿘    "  " " " " "㿘  ̒  2    "  &@.@ .` .` .`c  P 'P b> -S#0  2  6`$ " @b P@Q඀  `P%@ i'%P6 _@PȀ@" @ 0M@]$I0E0B%% "PPP%@P "8 4`P`'`> 4> y" 0`> yB "; 0 @ c=   ?  = !:` :`@ ?>   `\'`Ȁ X? `B D !; ; @  ) 2%`Ȓ@K "ڰ  0" 0@ $ 0@˒  " ` 0 $ 0``Ȫ`@ =``B  @ ZD   @ "  0"   0 $ 0@Β J' %@8  <` b @    %`$$   $  0  $ 0 0 > ,(#@ Z   "@&. -`> y`$`B :`  @ "=  0"2  @ 0 $ 0@l  @$ " @ 8    +#P`  2 H'@ꔒ4 "  K   `480    P` `` "> +#p` 2 4> 0  "4> +# K ඀  ?D4`$" @b@PJ"`඀  $ @` ) $䉖 =`` 6` "  0``@ B 2 ` 䉒   0h$ 0̞ "$ $  $`7> y܀`@ H`B ; H`@=  ` ? @`%8 !:` :` @   @Ę B<ඔ4` B 2`(`` B<   @|   B 8  2  (   @ @ 6  H$ , }  H鋔 y `@ 8@ $ $ $ $     &   @   $  $ 8  @ $  $ P"`$ 0̽ 0   0 $ 0@Gm@Fϐ 0 ?$ 0Y$ , "`0!  0`$ 0$ ,@r{ `j` '`    `2` 㿘 P"`$ @"! 2 5>  @:@ `+`ؘ "    ʚ 㿘 P " $ @ > #`!*` )>  4  `#–  `  @: " 7  `4   @9  ? 4 ?4 ɐ   δ 䀤` ? 4 ?4   㿘>  쀢`0> y> yȤ `Ā #> `$  Ȕch  Ā@` 0@> y 0@ & 0> y &   & $ "@" Ȓ`$$   > yH `B :Hh0 ''Ȱ @&`&`+&`<2H* @ &`* 0?Ѐ >`> y@`B :@&`@Y> yXȒ`'̐B :X&`@ZŔ0@")> y<H&`''&` 4  S> o 4!> y2`* @ " 8> (8`*` C H@`B < 8;H>`;8@Y  `&<"@ * $   @8H @ &<& 8  8 4 L@> P )> * ## #   > y>`h> (8B>H`0C `;hB 8H88 `@X(Ӑ# 0&4(&0Ȩ"> ( P04, @ @@`D `HC = P;@;0%@&`, 'ԑ=0B >`  @'Ѐ`&`'̐ '0@ &0̖@Z0ʴ  ̀  0`&0@E600 &0@Dʿ0@*@&0  %0 ! H /d * % H 00 Ȁ "`0$&0" &0(&0&&4ඐ 6&&``&@@C PH /d * % xH 0H> y`> "'> $7 +> /> 1> 7> 5>  Ѐ +> /> 1> 7> 5>    \  2   > '  0ݒ)|`    "> ' X0a$ "> 'ِ x- `7$ "> 'ː Z "> 'Ð Q')J@’  / , $# > '!@ ?'//!&"(@l "> '!0#'@)Xu b > ǐ! 㻐> "'@ >  !@j > !(&ab  > !(@iO :.` K.  * .  > x! 㿈 } '` "` #a b$$ $  "@  o$ 4?#\b'  >`  Z  %'   >  > 4b@$(9"( '> "H> a(0H 'f '> (j" H "l f㿀> "(> "@  '@ "@4 a#\b   ( Y' ''쒒 '#' 耢  '@   &..> ("0 H㿈#ab   2@ '( ?#\b  < `  H` #    $ '  : 0 H~㿘N> y`f >4> !Ȓ`?$F㴁㿈>  "X $ ( 0ƀ 8`>   ,>  4"#\ b#` #d ƀ 㿘N> y`f >4>  ؒ`?$\㿈> V "   ƀ `> !(!$#! ;`#\!!!ƀ!> !8ƀ#8`" 2 2<" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   V`V "`@Id  &` &`&` &@6$ $$@ 㿘 " V`V "`@I; & 㿘 "V`V "`@I$   "  20   " " "     2 0   " "  `H> ">'`0`b%> ł'@7dl  ř   `&Ŏ> 0 d &O8@ "8D 2o0> y   8* & 8& > !0cXŤ$ `p `0@H~    4 2 8 & 4 8 & 8  $ 4  " ?> > > #hcx" $ ̐&  > *#㿘> #Ȁ` ``< > #`8 )  24> #"Ȓ   $  > 0 `@Yѐyb (   4 ` `㿘 > cȀ  < >  ú  8 & 2P> #"#> "ĪaƐa " ? 9 > yX $ 0> y!+> /> 3> 1> ĆaЀ{Ш@; 2o aȒ`Ė$ W F $ N 0J@@8      "0@2@   k$$@2@  "W $$ @  "H $ a `$ $ ϐ2Ѐ > y> !#"aC ac` * 2 : 00l㿘 <  $ '> %> '> %> 2? "& אЀ 8 21 `> !#> `&  `8 Oþ ``  ?& Ѐ $2?"& 0 2 üȁ<`@ 4$ " @  2  , `@  " "  @  2  0 >T` 0    2_ >  D$`8>  T$`8$`<  ?????????????1> C!> y!` !>> "hL -> !Ф  2 "  $ """ """"" "$ $`$ (!ȁ㾰> $"'' ''>'  "    ' @7ܘ$ n$ ' H  $  H@/;   H@/2 "y4' & 逦 H   @ "  ' @7$ 0$e    @ " @7ܔ  0 '  @ " ' @7p$ x $ #\ @;] "0  $ @.š  @. "x' & o Hy  @: q  ! @( 2 `4       @( 2,`4       @@( 2,( S $   @.X  \@.M "xO'  &  H  @:,@= "b > ߐ x 㾰> b ``$` ` `@'''''>'  "  ` ' @6$ X$@ ' H`  $`  H@-   H@- "w' &`  H   @ "` ' @6R$ $  `    @ " @6  w ~ ' #\ @:& )(`  $` @-  @- "w' D&` < H: I T $``   @-Z`  D T @-K "wM'  &`  H  "`   D T@<@98" > ؐ  @> b$     ''''''>  "  ` ' @5 @ ' H  $  H@,   H@,ݚ "v' &  HƖ   @ "` ' @5I v   (  @ " @5  0\ '(; @`' @<   @ "` ' @5 4@`g  @ "` ' @4 @'`N'  @ "$ ' @4՘ vJ :?# @@> y /',"@2'4"@2'8 " :?H"@"'T'X"@'\*`" *  * '`'`#\ @8 0  $ @+  @+ "u' &  HӖ    O I ` @ @ # 8H  $ @+   x @+ "u' & n H p H?L?2`4 &  P`$0`4    @%p  Ւ < $  @+@  D x @+0 "u2'  &  H   @6   D@:f@7> " >   `>  ``$` ` @ b'L''H'X'`'d?  "   '`X` @3et oLt )X` H  $`  HH@*Ú\ L  HH@*\L "Ht'LH &` ̀ HB X  `@ " '`X` @3&t 0Lt  ` X  `@ " `X@3d  L0 '`X  `@ "'`X` @2t Ltm t 4 ? $ H H'\`  $` @*L L @*CL "HtE'LH &` V H˖  `p'#\#`''#dh@5!Xp` d  xԔ2p 3`  $` @*Ld   X @)L "Hs'LH &`  H"~ @5הxw p> (2#x@N @ P % %  P$  A $``  d @)Ld`  `DX`2 X@)L "Hs'LH  &`  H% @5|x d@9  @5o@5jx  D@8ǐ@5xb >   㾈>     $''?  ''''???>` ` "` ' @1 X@ ' H  $  H@)    H@) "s' & ـ H   @ "` ' @1  J    @ " @1  r Ȗ '#\ @5W 0  $ @(  @( "r' & t H  @4   4`  "   p   q($$ '    ?''$'''''  U  rj $  @(R   \ @(B "rD'  &  H!   @4    $%  "@ "@3@7m "" >   㾀 >  $b'     'H' 'p'L'P'''''?'  "   ' @0i  ( H   ' H  H@'Ț H  H@' "q' P"@  ! H    @ " ' @0* j      @ " @0g  0P '    @ " ' @/ 8     @ " ' @/ژ    @ "' @/˜ q7     @@4 `'.  H  ' H  H@'  'H  H@'' q' P"@  a H` #\H @3p ' 4`   `   ! @ L   @ @ L=L ' (  ,  ?`E , ,,& '    H @&  `P`dH@& "p' P"@  ဦ H    d@5> za$'T@5 H'D m `v@``$@ ` n1 a  of($ $`-  L "` 1>  u@` $@   @$$  $ ` "`:`"`"`"` О   qL  ' "o0+" @1`%@4  @ "@@@1c%@   @$> z!> z!$$2 '    H @% H @% "o' P"@   H @1 > " > = ؁ `>  @``$``b'L' ' ''''''&`>  "   ' @-  ' H`  %`  H@%C   H@%: "o<' &`  H   @ " ' @- V m `   @ " @-  0< ' $  @ " ' @-t $    '    @ "' @-R nǰ :   `.* `  "@ " " ` "`" " `" #"@"   2@@ʰ #\ @1  L' 4`   `   L@c  `3( .k &`&@ "" "2     &`>`&`&`&`ܖ> ybbhB:bh  LΚ " %``   @$`  `L``2 @# "m' &` ` H_  !@/  @3*      > !!    D@3@/ƒ3 %``   @#  @# "m' &`  H   @/V( > " > 3  㽈> " $ ``  ''T' ''P'`'h'l',?  "    'h`h @+ޘ lT )` H  $  HP@#<d T  HP@#3dT "Pm5'TP &  H. `  h@ "(` 'hh @+ -T  f  `  h@ " h`@+ݔ  T0 'h`  h@ "$` 'hh @+q T 4 ? $ H (  $ P@"ʚd T P@"dT "Pl'TP &  H"   h`','0#` '8#\#d@-`l  ؔ ' =@  $P @"|dTl   xP @"mdT "Plo'TP & D Hh ؖ @.%pl ] oY l S`  h@ "$ 'h @*Ř ST "     q'@ m'@ * T@1 ,! `  h@ "` 'h @* "T [   . .. pppfirmwaregroup protocolsd passwdtmpspwd.db servicesasswd.orig pwd.db  fstab  resolv.conf( hosts ... . ..chowndmesgfsckfsck_ffs%^ifconfig%^initmknodmount mount_cd9660 mount_udf^ mount_ffs^ mount_nfs^newfs  mount_mfs^pingping6reboothaltroutertsolumountsysctl disklabel^dhclient%^@dhclient-script . .. installboot . ..misckeymaps . ..termcapwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: _btd:*:94: _smtpd:*:95: _rwalld:*:96: _nsd:*:97: _ldpd:*:98: _sndio:*:99: _ldapd:*:100: _iked:*:101: dialer:*:117: nogroup:*:32766: nobody:*:32767: ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP  PMok0 < @ Mok0D(P  Mok0P@@<@T UMol3oMol3AMok1YMokMok p AMok1% Mok1% Mok1% cpаAMok1Mol3 @Mol3 @ x{AMok1 pMok|Mok| >AMok1 pMok1!UMok1!U 0AMok1 pMokW@MokW@ oMok51 0Mok52<Mok52< ")Mok6 MMok6 \Mok6 \ L2Mok6&HMok6+Mok6+ p P X ` hP&AMok6W0Mok6+Mok6+ x PU1Mok6W0Mok6+Mok6Rh Mok6 HMok6 HMok6 H 0MokWhMokWhMokWh/tmp/fstab.shadow?XMok"Mok"Mok"/tmp/resolv.conf.shadowd޴ MokMokMok/tmp/hosts^Q5 *MokW@Mol3 Mol3  "sMol3 @Mol3NHMol3 ht7NBp$Pb!m&>xOSy\..`Tn}X?t?K`mTb/$5lf)! <8vBێ)D%"| ~ջ:(<ˊ2}7{îJw8'>o5x2L/UR!uǃ2rnr5,YN4@ "낻 U˅w]٢5Cv,>2z"IV_E,N%ƺr)xE\q~s S}C[8jg%<,n(emv`zd:cI{EZn-SB/?N0.*FX_톸egɉjwR"MBXҼZwFoTNJ.B &qyCOs+afn7v WZ+dvy:Z10F\{G )7M:QZwnabţ:#H=,Bs-(HPC *sSz*q /> }dRӖ$brpx3qNj|fXI?PY P+$Q VXmiSNZ [R1gkyFn0 (iuCև+j.xȢ@bi"$0Bf۵56tzom읿!'.DHJWOI$SYc~'+P9 .|^EZbFwP7kg,ž:% 8QIwaX k$k J5X]5~k=X)#SclSr{ Ce?VWdRJj[yp-83J5Y0"9,bso(j\? Wi*/t~Fkr_:7Ja>Gև,XN/C16U3g@mh ؍_ExZEqI-:F`r7DfcI}!-͎gyZ3}ZE75(e:&NJw&~ޘIguc(ѻ6zOʜl 6IB,+P Ѫ{C&dV5 a( \Qvm_y&rN^?]BH OƸxPuyX,=tDdgx|0M]a^R|59g_%"[Bp@k۴p6eWi]1>OfhګGZΰzl:|7!A-lt%UOl 0I;B8ĭQR-Wy53Ͷ51PBPnobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3bin*Binaries Commands and Source//sbin/nologin1bintrootdaemonCharlie &/root/bin/ksh2rootdaemonCharlie &/root/bin/ksh3]Xdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody vm,'> >operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootQLbin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpTFTuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcpa  n}n`n_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3MPBPnobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3bin*Binaries Commands and Source//sbin/nologin1binrrootdaemonCharlie &/root/bin/kshn2rootdaemonCharlie &/root/bin/kshn3]Xdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody ul+&~==operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootQLbin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpTFTuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcpa  n}n`n_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3Mroot:*:0:0:Charlie &:/root:/bin/ksh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source:/:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico _dhcp:*:77:77:DHCP programs:/var/empty:/sbin/nologin nobody:*:32767:32767:Unprivileged user for NFS:/nonexistent:/sbin/nologin ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :5i:am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\017:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:\ :cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :eA=\E)0:ec=\E[%dX:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:\ :kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:nw=\EE:\ :pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l\E(B:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l: sun|sun1|sun2|Sun Microsystems Inc. workstation console:\ :am:km:ms:\ :co#80:li#34:\ :%7=\E[194z:&5=\E[193z:&8=\E[195z:@7=\E[220z:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:F1=\E[234z:F2=\E[235z:IC=\E[%d@:\ :K2=\E[218z:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=^L:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=:ic=\E[@:im=:\ :k1=\E[224z:k2=\E[225z:k3=\E[226z:k4=\E[227z:k5=\E[228z:\ :k6=\E[229z:k7=\E[230z:k8=\E[231z:k9=\E[232z:k;=\E[233z:\ :kD=\177:kN=\E[222z:kP=\E[216z:kb=^H:kd=\E[B:kh=\E[214z:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:me=\E[m:mr=\E[7m:nd=\E[C:\ :rs=\E[s:..sa=\E[0%?%p1%p3%|%t;7%;m:se=\E[m:sf=^J:\ :so=\E[7m:ta=^I:u8=\E[1t:u9=\E[11t:up=\E[A:  'D ?'@  h@ "$ 'h @*t Tk Ǡ,> 2 c` <@'@ '@@ /` 'D``  `    :?`  @``!,Ӗ > (< # >l $ ``@  '@@ !, ,<> ( ϐ#,[ $ X \'˖ 0v> (< # $ ; ??# @'0','4k'8 <> ( # $  "> ( ~#0@@;= ̶` $  P@! d T  P@!dT "Pk'TP & ۀ H ٰ  <> ( E#̆,5> (< 8#n,`0d?   @Κ  `]?`F   l@% @P %@ %`P$` l    l@7g  2 p' $ lPd @ oTl`  `DT`2 xPd@ YT "Pj['TP & 0 HT l  2 $@/> za" " @,'@+p3  @/ D@/y@,*&  ",4, " .> (< d#˥@!   > " > 줐  㽘> b$    ''\''X'h'p't'4?  "    'php @(Q =\  )h H  $  HX@l \  HX@l\ "Xi'\X & ŀ H h  p@ "(h 'pp @( \  ٔ  h  p@ " ph@(P  \0 'ph  p@ "$h 'pp @' \  4 ? $ H 'X  $ @=l \ @4l\ "Xi6'\X & S H"   ph'4'8#` '@#\#d@*` Ʌ 2h  $ @l \ x@l\ "Xh'\X &  H"V  @*xK   p@ "$ 'p @'P <\ > c* @` ` HD> ( # \cHE\@./  &h  p@ "$'p @' \h  ?c *   *` '  `'H$ Ȏ4 L > (D #E `4~ qD> ( #$44$0 4$ { 8[# ? # @'8'4'<]'@> (D # 2 8@@ $>  $ɷ x@ @ P % %  P$  Hx v $  l @ \l @ܚ\ "Xg'\X  &  HD 2 $@-> za" " H@)@)&  "44 " $> (D#$84 @  |  v> " > 7! > b $    ''L 'H'X'`'d?  "   '`X` @%t oLt )X H  $  HH@C\ L  HH@:\L "Hg<'LH &  H X  `@ " '`X` @%t 0Lt m  X  `@ " `X@%  L0 '`X  `@ "'`X` @%xt Lf ɖt 4 ? $ H H'\  $ @̖ L @ÖL "Hf'LH &  H `p  ''#\#`'#dh@'Xp`d   'p ,px 4 2 8 | 8    @I |Ljx |0RPp` d   ؒxvp $  d @HLd   x @:L "Hf<'LH &  H d  @'x b > ː! 㼐> "``$@ ```` ` 'T ''' '''''P'`'h'lp',?'  "   'h`h @$q T )`` H  $`  HP@Ϛd T  HP@ƚdT "Pe'TP &` m H `  h@ " 'h`h @$2 MT  ` `  h@ " h`@$p  T04 'h`  h@ " 'h`h @$ T 4 ? $ H "(`  $` P@]d T P@TdT "PeV'TP &`  H+ h` `','0#`#\  '8#d@&.`l  Xš'> ' C`  $`P @dTl   P @dT "Pe'TP &`  Hז X @&  @& l Ŗ  @`  h@ " 'h @#S nT ' H`  $`  HP@d T  HP@dT "Pd'TP &` P H `  h@ " 'h @# 0T ܔ ` `  h@ " @#S  T0 'h`  h@ "'h @" Td\  TdS H$ , #`'' #\'#d@%7`l  Ī'G '  ſ,>!> (<xԀ  4` 4 `l  l  25 4 ` | l`2 P | l PP@l  B l  B   D @@0 "? 2 ,a䀤ސ  "P,ΐ?" !> (# '   '<# $``  lP @}dTl   P @ndT "Pcp'TP &`  HE l  X@%#@% 2 "e "_䀢 " ,Y> (#,  "Lǒ,`@ @ ;> " > Ȑ!( H> "   $  ` `   ''T'''P'`'h'l?p  "   'h`h @!t̖ T )`  H  $   HP@Қd T  HP@ɚdT "Pb'TP &  ƀ Hז `  h@ " 'h`h @!5̖ T̐    `  h@ " h`@!s  T0 'h  @`  h@ " 'h`h @!̖ oT )`  H  $   HP@bd T  HP@YdT "Pb['TP &  V Hg `  h@ " 'h`h @ Ř̖ 0T̐    `  h@ " h`@!  T0 'h`  h@ "'h`h @ ̖ Tb  !4 ?$ H P'd   $  @ T @T "Pa'TP &  ߀ H #\ Ė@$T 9   $  @Tl`  X`2 x@T "Pa'TP &   H В @#   4`h Nlh  ','0#\#`'8#d@"t``l   ' 2)l` `P P@ 2  ,s,@d ,  "lZl ĒД 8'GEĀ $    l @Tl`  X`2 x@T "Pa 'TP  &   Hl l В@"@"8 > " > 㑐!8 h> " $ ``  '''''' '(','T?  "    '( ( @=䖒 ( )  H  $  H@$   H@$ "`' & Ā H    (@ "(  '(( @䖒  Ŕ     (@ " ( @<  0А '(   (@ "$  '(( @И䖒  4 ? $ H (  $ @)$  @ $ "`"' & R H"z  (0 'T'X#` '`#\#d@ `,  m  ' Ā`H, @%k T   (@ "$ '( @T䖒 ?$_İ HT  Ԑ    ?'''''''  ' @Y , 2-@   (@ "` '( @䖒 _ T`'L-@@ "D8d> (ΐ#DT@@ @S @ @`@TƘ ,x84` *X?# @`'X'T'\y'`  > (@潒 @@P$$@ P $ @@> (I8> (d#`   x'6 $ ,$ @,`  `2 X`2 x$@ "^' & # HK ,  2ܒ $@$0> za" "* H@ ܐ@ x* " 8> (d# "DDKT@@ǐ @ @ `` > " > E!H 㽘> "$ ``  '' ''' '(',?  "    '( ( @ $  )  H  $  H@P$   H@G$ "^I' &  H    (@ "(  '(( @   z     (@ " ( @  0̐ '(   (@ "$  '(( @   4 ? $ H ((  $ @ޚ$  @՚$ "]' & 3 H"L (   'T'X#`#\  '`#d0@`,  $ ' =H  $ @$,   x @$ "]' &  H  @:x,   ,  @" @   (@ "$'( @И ]E   /'L@  'HD͒TDI0D# D@Te @@䐒 @ P $ $ P$  yx $ ,$ @,`  `2 X`2 x$@Қ "\' & 0 HI ,   $@"> za" "  @@rx(  @"  D@!@ "DD)T@@ @m @ b > )!X > "$ ``  '' 'p''''?  "   ' @֘t ot ) H  $  H@4   H@+ "\-' & 3 H?   @ " ' @t 0t ^    @ " @Ք  0 '  @ "' @it [ް t 4 ? $ H '  $ @  @ "[' &  HȖ p  ''#\#`'#dx@p`  ( 'p ;  $ @s   x @e "[g' & m Hy ( @ n gpj  4   2 8  2  ˒@G 0 p 8p $   @    x @ "Z'  &  H   (@ b > ݌!h h$> 'b  'L'P''''''?'  "    ' @9  ( H  %  H@   H@ "Z' P"@  H   @ "  ' @ S    @ " @7  09 ' !  @ "  ' @Ș !       @ " ' @ Z :  #\ @ /  % @ 'ܠ @' "Y' P" u Hߖ ܐ͒ (QL  ' @ @ L !P  % @'   X @'ܶ `  @  4 4 L e  ''' ?''''' '' '$`' U 'L`Ԗښ` "   (L ' "L ?b( 耢 ""   %ܔ @.   X ܔ@  "Y"' P"@  H @(  FC % X ``ܔ @ X'`P"@Ԕ(@3  $$  @( > z!> z$$   İ 쀢` ` '쀢` "쀢 2   %  ܔ @   X @@ܔ@{ "X}' P "@  Hl  @V(@  $$ *-> z@> za$  $@ $@ @ " @@"` ?'쀢    ? `Œ '4 @j$  > z!$$  >  > ګ!x p > b $'     'H''px'L'P''''''?'  "    ' @T o  ( H   % H  H@  H  H@  "W' P"@  ـ Hx   @ "  ' @ 0 ܔ     @ " @S  0 '  @ " ' @ W\ 2      @ #\ H @˔ 0    % H @ 0 'ؠH @ &' "W'' P"  T H ؐ Ĕ L   @ @ L "   % H @ 'ؠH X@ 'ظ8 @  '` @  @ @ 4  4'L 'ܐ ܔ 'ܐ ?''''''''`'  'L?`L hL` "  " ; "b _    % Hؐ @ k Hؐ X@ b "Vd' P"@   H0 ؐ@A ( 7@4`H h% ؒ @ 8 V:'P "ؔ@ @~h $l> z$ a $> z! $  `@ @@@ '`@@ "@ 2 h6ܺ h %    H ؒ@ ޚ H@ ՚ "U' P "@   H ؔ@@ h $l@v$  r9> z'`_ P   ` `" 2S@ P ""  P $  L f2bt @  @ @ 41'܀@  +'@!$ $$ @Ғ@c! 'l''h'' @ @ ?@' 4[ @> z$  > z!$> za$   >  > А! H> b $  '''''>'  "    'ؐВؔ @ m ' H  $  H@  Đ  H@ ךĀ "T' & ŀ Hږ   ؖ@ "(Ж 'ؒؔ @C /      ؖ@ " ؐ@  0 '  ؖ@ "  'ؐВؔ @ T #\ @ 2H  $ @ i Ġ @ _Ā "Ta' & M Hb  H @X  >   $  Ԕ @ ! ĠԔ @ Ā "T'  &  H @̚ 2   @O> a"a`" > ֝! > b $  '''''>'  "  ` ' @N< X<@ ' H  $  H@    H@  "S' &  H   @ "` ' @< < ה  8  @ " @M  Sm ˖ '8#\ 4@ 04  $ @ I  @ ? "SA' & P H  @ @ `P `@4 4 $ Ġ @ Ā   X ``4@ "R'  &  HH Ā @ϖ :   4@&Ā &  @ $$  @  $ $   @ $ $ ( $ $ 0 $ ($ ,$ 0$  $ $$$ $ $ $$ b > I! 㾰> b ``$` ` `@'''''>'  "  ` ' @$ X$@ ' H`  $`  H@Y   H@P "RR' &` i H   @ "` ' @$ $  `    @ " @  R | ' #\ @ 2(`  $` @  @ "Q'  &`  HE  @ʔ(= K  $`  @ Q'&@ 0@` R@ @ @"?  #`,#` #`#`#` #`(#@#`#`#`#`#`$" > D! 㾠> b $  '''''>'  "  ` ' @$ X$@ ' H  $  H@T   H@K "QM' &  Hז   @ "` ' @$ $ ~     @ " @  Q  ' #\ @ 0  $ @  @ "P' & W Hr  @ǔ(j  Ք  ϔ   Ȕ (  ( / $   @  p@ "P'  &  H @r   @͐> z"> z"  " !" " " " > !Ё x !    ''''' &  @E ܔ @<܀ "P>'؀ &  2 H x  L   ' ' '''  &   @ ܔ @܀ "P'؀ &  2 H 0`2 4 P $`"  8 4    2 8#  8  @l  =`  D @" 㿘> c`> y@K *  "@@6"@  $?6$ 0> a(@(  48`"@ `"  8"@ " 㿘> !.`  ?  *  @   : >    *  ` >   #> %> yc`@: @: @* @*`@c`* @*`㿘$t t xWe| t` R $ 24$ M#   " "@ a   M   $ ** 2 " > WO ͒ M  " "@ a  $ " L 90X H /` * ! ` %`8`# %> > #` `6*``"``8 2 ```8@; 2`` `8`>   4`8H 00sH 0> #`*` 4`$ A"4`4`x` `Ā@ ! ;a `༐!Ā@ *  /a"` > ! ` Lu   "?$ ca ` R `2 Lb   "$  ` ༐!a* *e, ``Ԓ`@@4`4`$$$  ?4`H 0@;㿘 %> @4 #> ?\*  aT   H /` * !  ` `$"`( @"`$@`2`$H 0  㿘 t & t] WP㿘$ "M 7 t 2 ? @&$M - &$ R    " V` @? ` XR  $  @ &$ ? # 2 X> 0 &"@  x "+ t $@5 W   $`+  t!`@"- > y" 沔 Nl a8B y"''?''''''آȐ @'#\   Y #  # $ 2   ( @  #b `B >b # @ 耢    (" > b!   y *@@ ! ' >  (> b8X!ʐ d ' @'#\  Y\ #"'Ȁ "'Ȁ?"'Ȁ M耢I>   (b̘!"  ? !'''آĀ "Ā  Ȓ '#\Y+Ā`Lѐ #   # $ B #瀦 "Ȁ  > "x  " " '̀ M K?J L  & >  (bR  @ $ 6M "  @G $, 2/ -    А"@'''̤آ'#\ XŚ # $ 䀦 #"'" '̀ L^&@ p> y "@  % ܰ@C`$  ? #` `t 22 80Ԁ "L*' '  @ "    ' @ Ѐ L0> y"   BL< 0H /`4`* !` 2  2+ 2'$ $ $ ``4 $:@@@l `@@ $`$` $ ?$ $`$` $ " $` $` 2 H 0  BK<0dc  > "h> y ѐ!Ȣ P " $`$`+> $`8$`0)> y`/> -> y` @` I $`""`" @c`` @  x  ` K ` ?` "@`0$`(* $`4@ $`$$`$$` `B :H /`4 * !   "Ð $@ $` "@&  t = x   $(  @0H 0  $@沔  K  t `@ΐ $`$ @ !& `$` $`$H 0?$`4 H /` * ! @``"`& `?@"$@$`  g H 0`$` $`$ ?& 2 ` `$ > b@`` '`'`'&   "    ' @ .̖ U> y!@  > y"  ߤ -   ?@ " 6 @ _薒 0/'  @ "$ ' @̖  2P +  @ "$' @̖ۘ JP 9`4 $"(  #$`FJ= > c''iŐ> Ȓ K",@ҹc`* "@*`"@ұc`* "@*``F0`&&&`J^㿐 H > &"   '  I ( > &" `@ $` $` `> y` I& & > y> y!&   > za .& &` ?A$` > y" & & 9&"J& & & KH L  & &@  & & & &&@ @'&&`''@ > y`B : 㿘H /` * !   ˪ > !> y>b 0 2 $ 2 8@Œ " 4 $ $ $  $ 4 $h" 0  `?* 筐  4 ``&  $ 2  ( ( > @Βb $ $ $ ( @&  x`B < $u$ $ ` do$ ( dl$ ( t`h?$ 4``"@``" 4    &Z $(2   $ 2   @6M 沔 IŖ  "D $  `            *?( #"' ""4`8! $`"` (  $ $ d$ ( d$ ( :  & !& 8`B <8$ $ !& $ 4 2@ H 0> y"`" $`$" $ @" 쀢` *@!(  㿘 ` ``$`8*  ! @@#@'> ``͔ 2  & w!2> #` *`@@倦`@@& 㿘@@*@> 敖" & *&㿘  $ $*` @ % !'>   8 "   $`5 `a %2> #` *`@2  $ 㿘@*@> b# & *&=㿘@@ 2@#>  #` ` ? " 8M(`<c(`  " ` @&` J2&` `2㿐> bP  "bP' `    "E  ` a  FŖ($` `> bT  "bT  I\  `  ' G&p  ''!'  & '(  ' (@԰ > y $     &    ' @ɘ԰ $ $ > y!Ā@  & I> y!@   J    K`2 $  `$  `8  L   ` L $ $  2  > c* @$  r > y!  i ?@ & 6 @ 0o'  @ &   ' @T԰ ZԐ $@9 P $ $ $ ($ , 1 * @ & &  '@/԰ 5Ԕ  44*"  4 4 0 F H0% ?@ & &'@Q  Fq0   $ $   $ $ 㿘 8   >  (cP ``(`V I'` 沐`r&`(沒 "'̖А'#\Ԕؘ R̖ #Ѐ 2`##`(%   "`0" $&`&`0 "&` 2&`@M ;`( 6&`( 3&`(沨"ؤԢР̐ '̒'#\ RBЀ`Ԁ " ` "&`" &` "   `#2`(Ѐ ؐ  ` `( @㿐 ( " >  #h$ ( 4 G 0 $ (       `?& &      *   `?& &   0* ?$ 0$ 4 (  ( ?$ ( 4@!@ G ( 0   $ $ $ 4@$ 09   /  @ "@ F' $  4 "@&  4 ""@&  4 ( #  $ 4@Ւ 0$ "$ 0$ 4 ( ?$ ( $  $@@ 2@"@ ( "d 4 ` $"`$  $$ $X$ 㿐& ( "7 7 `'1 7` & "`& R`   @'$@%> z $) ($ $$  `$  &&` Dѐ$ 㿘 ( $> z!" (>   ? `""x 8 `& 8"  0 2 (> z & (`"㿘   @D   @" DP   . 㿘> bX> y 4S > y"a> y!"!"`㿐 " @g Y> y`? "` "@$ $> y$ "@"   > Ȑ#2 > y( `B ,:( > y8`B :8  =  > y""8 B:"8 沔E  &  ""0 B:"0,    ,  , o0> X3> y@a`B :@ 4 ' a`&a , 5> y%> y:#> y> y! %> y #> y3>  ,  c      ,  `"  "`  ? "$ $ `"  "`"  ?"$$ 1  , $$ "@" ,  $    `  ,  $ 沐 @,   D $  4  2  a * ` $   2  * "`  2`@a @ *`"  2  * $  ,  , ѐ 㿘 ;@f 6 `',  > * b\@ "   2> # > b*@    $  ,  D$  $ `,   ,  , 㿘> y! "$> y!? ` "`   "@$ $ ` "`$ "@$ $~ 42 > y"!㿘'> y%> y ᤓ2  * @ ") #>   @2    2  2   @  "    c .     .  2  㿘 @Ò    A($ 㿘> bĀ 1>  "b!dȐ!d㿐"  > > > #c"0 ,  V` ',` "@""  @Ҡ& $> y" $> y!Ġ $> y! $ $"  $ 0 $  $ 0> #*` $ $`@ʐ$ $ $ $` $` $ $   `*@$ $ $ `(@" "㿘   @$P%` $] @`2`W @@`*0"L H "@` u`<`` < B#$@>`&`$`@@`8@``?&`&@"@@`""`&4`&&6 @Ɩ&㿘  &`$&`!G8`` ` @$`  ?   @($ $@"&G|( ` ? $ $@`` @` $` &p '''''''Ё`Ē   ?'''' ''?ȁ㿘 @`&` `&@&@@'@> ; H( > ǐ#?E @$` $@"$`  '@ݣ&  " H   ݏ ' @"$ $  40$` & &@   "   H &" "@㿐> c`> y?a > y !> y> y> z> z"#> y%> y'> y)> y+> z-> y$" #!$b$$%"%a % # d@~ !> y $"$"@ W X> a> y> #\!Ț` <  ǘ 㿐> y " "`#\> y>  ؚ`!@  ߶  㿈 DP@"  $ b"  T :쀢 `+@?`(#`' `D> ` '〕*,` `H@  * @$'@> c`* @`> 5 c` <@``4'`8*`" *  * ''􀤠24" 4&$4>  X$04? > #$0P% > $ "h$0$nÐ&&&&&& L /& 4& 8P`& ` ?` @ ? ? ?&& `0 (@"`P 8& (& (`* `& `  & `& ``     @ > ``       > P`8& `<& ,`@& 0`L& <`P> X& @,& H`& ` & `& ` > ` 82* @* > P`(& `,& ,`0*`" *  * & 0& 0& H`< & <& @`@ > X& D  2 $@ >  2   8 2   $@( >  >@\> >> #& h$!"&,&0" &4&8 㿘`>  P "`@" 4 2    `     㿘 `` > #ؠ$  > y> y `B E:``B : ` 2` $`@ ` 2 `  8 `2  ` $@( `<  <``@\`<`t h`$!"`&`,`&`0`" `&`4`&`8 㿈\> (`$ $+#$`@  @@" "u H "K  /2,g `  @, ?'@"& & 2N``$$`#\$`0 @= 2=``4 ǐ 3 9 `$$`#`!$`d$`|Đ 2 ``@@`  pi  $@d$` `ː#    +" ' (0! , " "   ( #2" 㿘` @`> za" @~`> za"   "$" 4 "8" < "@" @㿘` @^> za " X@W> za"@㿘`&` & `&  0> @*< &`? /&` &`$&`P&`T& `N&$`L 3`  &(&,`&4&0`&8`,&<`0&@`4&D`8&H`<&L`@E&P@> c* @&@`2> > #` *`# ` &`$&`(&@ ?`L&`P*2 @ & `&$`&(`,&,`0?"&0@!#&0`4&4`8?"&8@#&8`<&<`@?"&@@#&@㿐> 0 \&Ɛ 2 Z F`0 2Q `   H` ` 2`c  R`2 `2012  $  ` &`&R 66     "R   6   $$`       @  H( ``P2 `l `\00 0`2`PH  82  (::"8 4  2 ($(( :(4 (2 8,(8(:8  "8: :(㿘 a8  . 6`.` ? @Ba 2aa  a2 a( 㿘 a8  . 6`.` ? @Ba  2a(a$  a(2 a,( 㿘``7`/  /` 8: F`2`#8;;4 ;2@(;4;8;㿘 a8D6. @. a;F42aa-a)a#4@28aa@4 a28aa(8aaa`@g4 8a28a(8a8a8a㿘``7`/  /` !8: F`2! `&!8>! 4 >! 2!(!$(!(>! !(4 >!(!,@>!(㿘 a8D6. @. a(;F42a a,-a )a$#4@28a a$@4 a 28a(a,(8a(a a(`@g4 8a(28a (8a 8a(8a  `F > l(R   P?# @ > X㿐`? ' @> za#@`#` @> za" ` ?  @> za#@` #` @v> za" `?  @j> za#@`#` @`> za" ` ? `$?" @P> za#@` ` #@`$#`@C> za"`,> #   @6 #@`,`#@`0 #` @* "@$ "`4> #   @ #@`4`#@`8 #` @  "@ "&㿘@  @o @  8 `($>   $  $ $@㿘`R` `0`  㿘 0ݔ p@''  @ "    ' Ԗ %> z!   @ "  ' ИԖ    /&`  @ "  ' Ԗ !@  @ "  ' Ԗ &`   @ "  ' Ԗ !@  @ "  ' oԖ &`  @ "  ' XԖ !@!  @ "  ' ?Ԗ y       >`   @ "  '  Ԗ Z ! "`` ?&``` ` "    ' Ԗ <&`, &`0Z`,  @ "  ' Ԗ   $ %`` ?&``` ` "   ' ȘԖ 9= 0 &`4 &`8Zi`4&$@@p7 e> zb  %> z#> "`$" `01 "`쀤:G `# Fl Z+谒 @쀢`h'hY   l 0" 0l`, +6`00'l@'hl 0" 0l`,  &`0 ` x  4 } "`@"`  ? 㿘( R`   > z!(`"T8r T @!!Oj "T80a`2  6  "?" cK  `2 R 2  6j  " "  K  4  Ԓ  ?4 4 Ԁ4  2 }| <"> z! " "" ""   $ "H /` * ! >E!$ $  "(z H 0 㿐'H /` * ! > z$$"@"> b̮   "b 2( @ 2  (   @7 ?,$(   ﷐`$ (  `> z:!$'H 0    `U,`` ""`L I  `2>  Г*` `  7 7@ > ybbB:b   ~7z ba@+ @  B8 "   @@!@ >  @ؒ$  $  7   @"@`ߒ (    O7N  "7G  7@ `@e`  ?> z!$@{H /`/ * !( 7@7` `> zf!$'H /` * !  " $@K$ `""`" ?"$$H 0}’ 4b̐? &b@H 㿘 (  ? & ( 0 $ 0&    FO"ܐ^   6y6   6  㿘 8? & 8 ( `"  "`> z"! ?"&& }w 2㿐> z" >  0 %b`'> z-> z/> z"1> z쀤 ? ( ` "`%  "@$ $}H 2`2 ($$$ b `%b %b" % ?% 2 {b <&!쀢`""`$ !$쀦`" > a> z> #\!$`` t   㿘> z"`!?  /> -> y> (+> y)> y9>     b+  2  +`qߐ b"  Ē`ภ %솀@(08 @Ā@ `฀ Ě`C + 3`  Đ`Ȓ@4% ̀ l ̀j !> y!  ̔ h  ̀`^! Z ̀`" $ $"`$ "  $? "$ $ $` 0@%`Ȑ =`?! H o *@ e  l   0 2  0`& 0\Hd   0 @& 0`T `p "`pH 0\ 2 `m  ̀ 2 " bĐ?""@%%q8㿐> z"  > , `2  ,  ),  8 " ",#>U!> b8p p?   > z", @  ϒ      , 0, 6",㿘` "> z!`!> %> `"Ȓ`$`$"Ȓ!x- "Ȁ ?,$"`  "`2` > z!`> z!쀢( ` 28  "("8$` 2`  ?$`  h"`$`0 "'`pӐ  4   > y`$@2> y@> y"!B:!`  D''ؐ ''`'܀ #'  @ "` ' Ж 8@   ̒ ,̀ 4w0  @  " 3  ` `4'`  4ܘЖ 4Q 0j``8 J&`"&`     @ (0  0 >`      @ (0  0 >`     @ @+ 3`  ; >`      @ >`( $    @  >`8&`h>`0&` ; >`  ; >`   ; >` >`0>`(3yp> y`B : D''ؒ>  ''"܀`#'  @ "` ' ;Ԗ '@   В ܀ 30M  @ "/$0 ' 0Ԗ 3 07 @a >&    & &  @a >&   & &  Ā@c <&  Ā & &  $@3T& $> b>' 0 Ȭ @!(> `(? > ڠ >  `@{!> @"4>   > )a4&& a4  "4"4" v)` "4 > u @ 1> b> wc #> > h!a?a> !85d> aPٖ  2&> >  aX@/@\u\ "`4\?"8\$a% `H > Ð!`> !ۿtۻ!$a%  > i! 8> !u͔ > !Ȣ$@"$@ X    j'''''' 0  @$  @ٖ > !㿘H /` * !  $?` ` ` +@ @  @ & $H 0` 0 `, +%> y#> @c`о @ސ & @c` @6c`c`@& @͒* " *@@Đ* "@*`& ` "  $`0  d4 d&  $ 2` e& `"` @ ` " `  > & "&   @   4&  @ 4& ` " `$  > & "&   @   4&  @ 4& `@" ``(  <# & $` "  &  Ā 4& ` " ``4  $& ,`@" ``8  $& `@" ``H`?#@$`J6 `@"  `L`?#@$`N6   Ԁ 86 `@ `P`?#@$`R6 `@"  `T`?#@$`V6   ؀ 86  t " Y x 2 %> #>  !> V `\ "@v   &  &$ &( &, &0 ,&4 &8 &H &L &P &T0> "' M  2t   HB ? e K X8 * ['5@ "> c, 6 $ "c,  $"` C `$ b '!tv8 @3  2- Y˪ 2$ Z$@L0ܒ Y˜ 2$@?@Q  2 '@  > d"H㿘`$@@ 0]  u ܢt &b> y"> `@*$`($`     <  $`$`$`,$`$`p4`4`$`$`4`4`ڒ`0` ``@ aє Z`͔ ZatȔ X$`$@$``$`` >B`ה  `$`|$`x   &`8  Cw1 0N㿘"6` w<  0 0= ɐ w 㿐"`p.`0  `&@㿘`& ` " P2` 2 \ l  u8  2u \ 2 P -㿘`(7   $ -002"p&* "o"p&$ !> y""p  bp  ""pd > #, X     - -xxxy<xxܝ㿘``T  L"fx켐  ''ذ/܁pP $ b $ " `4    2`˰ ` > #$  ` ` @ `?` a 2 aa    @  {> y`B :h H''ؔ  !4@ ` 2  @2  "2 @2 " ? s܀`#'  @ "$ ' 팘Ԗ '   В4 ܀ .0I  @ "$ ' gԖ .ܰ 03 2 . @& "`> `?> a> a $aa " $a0 #$`  $`$a$a0 `4  ``> ג"Xk    ! "  $!@ "@  " ! "  $! @ "@      "B @K6$ `4 2   <   ؒ 0$ )$   ̒ " "Ā@2`4 Ȁ@"$ `4 2   <   ~    @J$ $ $  㿘   4 "    P"`$     @   4   R $   ? 4  p`Pb$` "'ඐ c d2 > y- " B: `  D''ؐH ''*   'Ԑ -ư 0-܁㿘   H ?` - ? ?2`P ,?2 `P 4?2`P ?" `P $`  ? $?"D 4`4?`!>\ 0*` €x  4?? ,?? ? ?? ? ??c ?4< `P $`[  $    K   <8@J><?2`4 ,?"`4     2.  @+ "  ?2< $?"  <<8@J   $? 8  ` $@` `[˒``P> y" `$B ":'   D ` `<''ؐ  \    5> za;". `> y"`4`> > #@ *`#  $` ?2$ > y"$ `?2$ > y"$ `$$ `,$ `0?"$ @?#$ `4$ `8?"$ @6#$  ''`a܀ l  @ "@ ' ̖ U> z!    @ " ' ̖ ;' '` @ ܀ !'  @ " ' Ԙ̖    Ȓ}   'ĐĒp ,0 0,-܁  P b $  "'*@ $  % P $`" 4? m  4 i  'da' x 2Y%@` "L%*@$ L @ 2?%q7%q3%2 Dp   @ # bِd8" p 2 $` @ > y" B: ` ($  @3k  b@qs%q%> y"   B`B ; ;    `$`H''ے +i ?Ԕ' '߲  - &܀ #'h  @ " ' ǘl 1l   ho %h+/R !  @ " ' 領l  l``@ +  H0 ` ?@ "   '}l l d R`2  P`@ 2 P*ܰ 08֖d ld`M ܀ #'`  @ " ' @l l   ` `܀ .'\  @ " ' l l  \Ô y \ 'XX鸔 nX%*w( $ A@$ư R`e`@5 ^o M܀ #'T  @ " ' Șl 2l  T p &T܀ 4'P  @ " ' 裘l  l  PK P 'LL@ L ΐ@$ Pd ` *@z$d`M ܀ #'H  @ " ' Ol l  H  H܀ .'D  @ " ' *l l D Ҕ  D '@@ǔ }@   ){o]0*@y$ Pmd d)h0`M ܀ #'<  @ " ' Ԙl >l  < | 2<܀ 2'8  @ " ' 篘l l  8W  8 '44L )  04 2  Ӕ@$  "($@"%  2%7%(܀8`@ `  #`" n@      P`$ ?  "%($%㿘 `4 2     㿘 `4 2     p`P> y" $`B :'  D''ِؒ` ''ܼ`&܀ "'  @ " ' ҘԖ 5   Вz )܀ )  @ " ' 氘Ԗ (  H0 ɐ薒 ( 0(܁h P $` ' P<`` B `ΰ 'ʰ' HŰ' `> y"`B = @  , P 'ؒ<'ؒ ؀` `"` ""` """` ' a  '`&܀ "'  @ "$ ' Ԗ   Ж ǔ Ѐ   @ "$ ' Ԗ   '̐̒梔 x  @ "$ ' ژԖ e Y   V'?$@  `2   ` ` `4J` P"  $ ` "` '> ΄"p&`` <B4 38 ' 0'- ' )'`B :  ?`4X''U ؒ 2` $` $  $ $$  !` $ $ $ $ `' a  '`k܀ g   @ "@   ' &̖ > z! &  @ "  '  ̖  `'  ' ` 2 ` @ ܀ !'  @ "  ' ̖ X Ȗ 厔 MȀ`@ W  @ "   ' 优̖ /) 6@$ " "@;` `` b >`&` 2 $ "  $#2  ̐ Y  $% $@є   &I  ` 'ĐĒ& Ā`  L P" " %ަ$> y'2&`X P " $ "'`'L UkͰ -> y"> y" ؖB: `  `0`T  <''   % ? ! ܐ> c<*@ "5 ? 8; ʐN"L? @2  `@,"꼒 `> # > #*`  > y"$$ $ $ ,$ 0?"$ @ܒ#$ 4$ 8?"$ @Ӓ#$  ''ٓ    @ "$ ' 㫘̖  `E`!  @ "$ ' ㎘̖ l  @ $ H뀦   ?@ "  @ 'k̖ I Pܔ A `/  @ "$ ' J̖ (̀`"   @ "S  T㇔ T 0'` 'ĐĒٔ "$ `􀤠"j  @   m܀ j  @ "@  ' ̖ > z! '  @ "$ ' ՘̖ '  ' ` 2 ` @ ܀ #'  @ "$ ' ⭘̖    U $܀"j" @V&@> (M# ` 2` " j 㿐    2 i  R X` P `$` "` ''`  ` `9> y ;> ((" B: `  `(`L  <''ؐ# ?    $ ڐ M$ J 3$$1 - ɐ`> #  > #*`   > y"$$ $ $  ,$  0?"$ @#$  4$  8?"$ @#$ '  'נ    @ "  ' Ṙ̖  `E !  @ "  ' ᜘̖ l  @ #  H퀦    ?@ "  @ 'y̖ IP A  /  @ "  ' X̖ (̀`"   @ "S  Tᕔ T 0'` 'ĐĒ " "   "  `􀥠"h  @   j܀ g  @ "@   ' ̖ > z! &  @ "  ' ߘ̖  '  '` 2 ` @ ܀ "'  @ "  ' ธ̖   a "܀    #U h"    2 @I`"@c` 2`" ` P g0     $`> :"`<`2`4> 3" `2 ఀ #  1 2 (Xǐ      @6 "    ఀ 2 @ F > (#$gg`" P@  P; 㿘 `4     @  h P> y"`$ `B : ? ' $ H'' !N ? !I | ߴ ''Ք`k܀ g  @ "@  ' ߪ̖ > z! &  @ " ' ߐ̖ `'  ' ` 2 ` @ ܀ "'  @ " ' i̖   Ȓ Ȁ`  `` 2` " 㿐  $     $2`P> "`P@K  "$  P@D "  < (   `2  4 @ G 2  OH f  #\#`  @A"`O4 `"`4O/ `4 @  4 W~W|@fy fA f<fnfl " 㿐` ` #\`#`@`` P> y"`$ `B `:  '  ?  HM@''厒آފ傒`   ?    v`\? U`բ܀ i  @ "@  ' j̖ > z! &  @ " ' P̖ '  ' ` 2 ` @ ܀ "'  @ " ' )̖  Ȗ Ҕ Ȁ`g  @ "@  ' ̖ m> z! &  @ " ' ̖ S '  '` 2 ` @ ܀ "'  @ " ' ̖ ,`  Ēi "Ā %  2` 2` " " `  `Pb$  " ' P`P@ > (Q#@e dڐ   > y`B : D''ؐEAΰ ?:' ' `܀ -'  @ " ' .̖  Ȓ֔  ܰ  u p܀ h  @ "@  ' ̖ > z! &  @ " ' ̖ `'  ' ` 2 ` @ ܀ "'  @ " ' ̖ܽ    Ēf Ā`"> (p# ` 2``" `` " `" Lƒ  L c` > yP" Ш ` B $   ;  @'``  L(@ ` `< ''  Aؠ= y d ?B` + 2# > #> y⤒@&& & & ,& 0?"& @.#& 4& 8?"& @%#& ' ' `    @ " ' ̖ `E !  @ " ' ̖ l  @ N HЀ`   ?@ "  @ '۾̖ IP/ A  /  @ " ' ۝̖ (̀`"   @ "S  Tڔ T 0'` 'ĐĒ, " n`܀ g  @ "@  ' [̖ > z! &  @ " ' A̖  '  '` 2 ` @ ܀ "'  @ " ' ̖ `  Ô  ܀`"b> (Ȑ# ` 2`" K# bX`> yP" $  Ȕ ` ``B '' ; Ȁ$H` `<j''ؐ  ᪒8 ?Kڢ ޔ "w > #> y`⤒@$$ $ $ `,$ `0?"$ @#$ `4$ `8?"$ @#$ ' 'X    @ " ' p̖  `E`!  @ " ' S̖ l  @  H   ?@ "  @ '0̖ IP A `/  @ " ' ̖ (̀`"   @ "S  TL T 0'` 'ĐĒڞ "^ q j܀ g  @ "@  ' ʘ̖ > z! &  @ " ' ٰ̖  '  '` 2 ` @ ܀ "'  @ " ' ى̖   2   ` 2`" `  @ؚ  `4`2  `"`"I} @`"> (#`ːh   P $  b  '```> (# > y" 薂B: ` ` `$`Hױ''ؐ`  ?`z ~```'` 'Ē `l܀ h  @ "@  ' ̖٘ > z! &  @ " ' ؿ̖ `'  ' ` 2 ` @ ܀ "'  @ " ' ؘ̖    ȒA Ȁ``> (K# `` 2` " "H H P__ "      `'`P" 4` 'd   #` 2 `` 2`z. 2` Ā@2` Ȁ@2 `> y `B : `!'\` " ǰ  \@̒  .^  "@ "$" @b 埔 $^ h'X $'lX ''p't$>'h?x''`0`@'$@ p@yd #$@*@%$$@@  p@yd c "   ` -       @ &     h  ?2* `2 @ Ւ  'd'`  `` d $_    "  _ْ  " "@@""@ "=` 2 d > y`\ 2  > y(`B :(  " "h`P "  $ ` "`'L'P'` `#"`> $";> y` ''Դضb`B :  D``''   И#Ԙ #Ѐ`  Ԁ 2#  ##  ΐԘ#  Đ#`L'' Ɣ`%܀ !'  @ "  ' ܘ̖ d  Ȗ ׅ YȀ O   @ "  ' ָ̖ @% %  @ " ' ̖֠ (   @ "@   ' ֈ̖       @ "  ' o̖  ?   "`" (`  4@@ "@@" "`"@ &``8 3+ @@2 $,4, ` @&` "@`? "`T @$@@*@@"@@""`"@&`    "    ] 0'   @ "  '   @ "  ' ̖ h̀   "$'$ '$ "     *   @ "  ' հ̖ 8`?"܀  mb""@ 4@@ "@@" "`"@ &` Ԓ    P  =P "@0 H0  0` > ސ"`P `"'L'p`'P't 'l `#"`> 7# ` &ؒ'''h'd> y"`B : \''h" d ""`  2""""p"p`"` L''h܀`#'  @ "$ '     դ    @ " $  ' ژ %%  @ "@ $  ' Կ  ? Ɔ@  l "`" (`'l 5@@ "@@" "`"@ &``8 :+ @@2 't"`l`'l-5-'l` @&` "@?"@@'` '`ә @$@@*@@"@@""`"@&`    "    Ԣ 0a'  @ " $  ' 7 M  t'"@'"`   @"S Tk T 0*'  @ "$ '  M  @ "$ '  ``@`    "    ' ˘ U2`P@ 2`PZÐ '|-| |  R P 'x''xT |'' > c*@ x2 -``6L&W-  @ "$ ' t ` ` ? "    ӵ 0t'Z   @ "$ ' D Z  m耤   @ "$ ' ' 2=`?܀  2> yl""@  5@@ "@@" "`"@ &`      P  =P "@kf Ha  ` > O#8Zk㿐Kc` ' Y] $g $@Y$``4 ` > 0#X- 1>  T#p $`@͐$``@@ ̔  `@@  "`Z"`g5@Z h`P> y" $``B  ": '$H''R ?`K''+    ```  !  @ " ' 8Ԗ ``@  H` ` ?@ "   'Ԗ f@   '" ה 2 Tഀ2`P@K 2`PX 'Вiа e0T  0܀ #'  @ " ' јԖ "  ̖ y ̀ @ 2 0 'ȐȒe & `!܀`@  Y,0'@h P"`$   > y(`B :( D''ؒ` A $`$@$` '! ': ܀ [  @ "@` ' T̖ ^> z@!    @ "` ' :̖ D``'` '  @ ܀ !'  @ "` ' ̖ #@   Ȓ” ܀ &  @ "`' ̖ l 0`̐@;   !1\܁㿘   "   `P 82   @ < 㿘  0`  > # 0  > 0  0 ͒ 㿘    @ 8`'`P?"?' $'L'P*  !@  '  `P"`$S QH /d * % 8`l 0 238 0@ $ 0AD,"   3`+ +` ;B 2 (     "@ @ :`C 8 @     H 0HP&@!1 ԛ`P 7,  0?c $ 0  0 ) L 2L2I 0  $ 0^`H 0 țP ba> #` *`' 0 > #  0 27ː  0  0$ 0@mH 0sG0 H 0L `3H /d * % > \H 0 ;P a > #` *`'`l  ^  ?2 㿐   #\  Jf 㿘 >  #0, 4`2> y> # 㿘 @ 㿘> 0 0   0 2 >  ? 0a & 0H /d * % ;7 2  "  `0 "`0 `p "`pH 03@`  h 2`*  *`  a0@ ;"@YҤC  0 Yq Ӓ 2% Ӵ  a$ a,a $ 0& 0  , 0@* & 0 `@0ӼY 0& ?& 0& H /d * % >H 0 !1 `P  0@ & 0r2  0 & 0>P  `0 "`0:0    P $`"   4    2    p* 2    4Z  E㿘  a02y㿘  b02z̐0 ` c $d4 `<``P $`S !" ' ' ""  ' '  o|%㿘  a02w"㿘  b0~2wQ0 ` c 0a" 0n  "" 0h  $4 `<``P $`R !" ' ' ""  ' '  ow㿘w֐ː㿘`  =@  0@  \?`%@ @    >  ( ޘ > N X?@ > H p2 ##@u>   ?`  `@#$ <@ B $@@8 @ d@ d ?` \> `Z>     @oΘ "$8_4 2 $<  2  @  : @ >a@ʐ  8   `h "`h  `   B;    % =@  @oҘ > > !c` >   > `   >  ̒ 㿐d'  " 0@ @?` @ 2 \@ 8 :` @  `> 0 \> !(`> !@  " `@<@ B @@U8 @ d@ d 4 3> `1>   `ഓ-` (  :-` p d> 0!hۚ> K!`h="`h  0?6 " <\"@: :  ` @nߘ 2: @\'@i "-8  `"@B:d $d@W   "`8> !\$\> !"`<4 2 <8  21< 4\: @@ @S Ȕ ( 2&$ #>!$<?: @@ @= d 0     $> !4> " >a@p  _> ` > 0[ഓ? h -"h@)P $@ \@ ϖ\6 T :@: @ E  \ & @   `ؕ? ഒ  ?  B; d `$d@< \`8\> M"@"`<0""0H@Kd"@h2:& > !ϒ` ` > > `  u>  7  7'􀕀`@n  '\'d  $   'X  @ >GB??P!> X-@d@Y 0@ 2"`XX.d 'D'@8'<> -@ =`G ` "Ȑ"- D@+@  > - @ :` E b b@ @<@D@! <@?D@@2w  2t d @\ޘt 2j xP Tp@\d 2` t *  ('`?0?dl4  l6ڰ 0Gl `H'``@Ep  * ?@ `@t$ $ ?*  @2      2 > 4"h@#? 04{d @h H'\@F><``@?HH `, Hx'8X \8 d@h 0@  2X> #8` d@W :  @ d> #(P $@ ":&` (@ 0#`0@#dX=`G8 #h#\@4&@ =Ghl8;`X   8 #h#\@6&8 :@ E8  '8` (@>  5l@5l@>  ` &`   @ >  5jh 4h ?H d`P $@ XXd@ 0@ X@d< X d@ 0@ N 2> > ;#P `> #x8 @ :EƢ` @65h` (@ 5l  '\'d ` $ Ѣ   @ >GB?@?P!> ,`@d@_ 0@  2`#@&d.'D'@8 '<@> ,`@ <``G ` "`ϐ#@,`  @D@ +@> ,` @ :` E c c@`@ @<@ D@(<? D@@2Z  2W d @Zt 2M xP Tp@Zd 2C t * ` p'`?@0?dl2  l4 0*l `H'`p  * ? `@t!?* @ @2  @    2 > E h@#? 02d h H'\`@  @; >`@?HH `, H@k @2 \d@r 0@  2>  d@c  d>  H P $@ 3`` p@@@ 0#`0@#d<`G#h #\@2<@ <`G@hl ;`#h#\@4<8` @ :E @`` p>  3l31l`>  `&`  @  >  3h 3h @3H d`P $@ 2 d@ 0@@d< d@ 0@ i 28> V p` @ :E@Ҥ 6`3h`` p 3l 㿘>  `2   `  㿘& @<@ 2@,: @א<@ H @   *@ @ ?*@  > `<@Ø `>  P  @ `0  ` ` `  `>  Q>    `2h 2  '  "#  `  `h : " h" d   >  Д'  `  ഒ :  `" X  `  l`   `l  "`l P`   ``P "`P  `   l * "l P`2   ` * "P `    l`   P` 2 Pl? 0" "l?  ` "P > > !Ò` > > `  j> !, 㿐 ,: @ @ @ '  8`>W ,@c* , L*  @ 6 `& `&  ` L@ 6 `& `&  `  @ `< @@``: &@`$ : $$ 4'   0%@& 40  @ @8 ` @8 " ,L*  6& &H @?  6L6& &H @% 6 L*  6   L @` 㿘 `\@ .? 2Y`8`t :    @``D .?  @``\ :`@d @` `,@c@V> @ cL+`  6``@   @ cL @6``@`  $b`8㿘 `\@  .@2f`8`t :    @Y`` J .@2` @I``\ :`@  : `@B  `,@qc@> @ cL+`  6``@   @  cL @6 ``@`    ;`@; `8 :@B: B㿘 @ " ,1  @@6&@  @ . ,`@   @ ڲ` ,@"   㿐  >@Ǒ;    .  :  @ :`D @  d@,D `     ?. 0@ 0@ HbU  Ԁ 01 㿘` cL- @`T'@` : #?@ `8@ ?`?F @B: >   8    >  /  H :< $ `: @;`T? @ "U 8D* 2`@ c ` : ҄ `8"@   4@ "U @ 8D* 2` c ` : "`T `T? *`@ ?#@ *`@  #@ `T?- @"U-   8D 2*@  c ` .*@* $$ $dcLB? `0 :< $ `02`T@ג .β`8?   4/  `     `@ "  P  T@`  @M; `8 -  4@"U  8F 2*@  c `  -@*`8`8 $"$ $dcL 8B @; *` @?6bU -TT@ @?"@ ,  : :`@ @PB`$ @+D㿘 .`#P Ւ "а `H/ h%$          h? #P.`$"  "  : @:>` @ " 8    : @i@ ` lF+ 3` F+ 3`@*  *   p *      O> #  :`& <$@"U#> ` :@ 2Pa8$ J `*@ @f"/> <!X >3> : P@" 8(a,,  㿐'D .`L   'TD "   H` > ,y K # :`=`%`: @ .6 `@U b@`\@ : '^.``0` `:"    `@"U@:@`\@ @ `@"U@ b`\@ @ 2 ``0> !1> !@"U@% "@`\@- :   .`- F > !> !%`0'\U!@.'u6x`x :  F :`  hD f`t.'^6 D : V@v:  @+ G`x@f * ?@ :  D :`@ D 2`x@7 @O`* @ : d@yD  0  ,H@0xH#j  2  $ Px!`xx %`xD P $@  D@(`@U b@`\@   +  *` <%` T LB?=?"  -`%``LB ="*"*: @B㿘 0@> @ 2 8T>   ;` ;  8B2ༀ(  > 0" > "P: @ 8 @ > < >  "h>   `  p  > Ԙ" 0ڐm > `H :<$༒: @0  @`@U  `@ 2  > "> '"@"U@`@@p .$U`LB < !"\ ~ d@Uଖ @;  @"Ud@ -  P P X * @ 2@3@>ਖ @Z;  @;  d@"ଖ @; ਖ @;  @; ਒@  ; @D@>  @7; *`@ @@ 6@bU - T8?-``@"U@:c` ``  " &@  : :@ 4@?T >B.@"U#>  = E 2*@ c`  :@`  =  E b> T"ؖ = E 2*@ c`  * @ *Ɔ$$$=  LB< `# `@"U@:c` ``8 " &@  : :@ @ `@>@  "U:``@2 p$8" $$8 < L` < ## @; U $aLB<  # \@ "J d@.@@bUd -  P PX * @ @.@@d@.@ @@@* @@@ 4@bU - TT@ @ "@ ,(㿘 P`$ @ @/ 㿘 ``,i@ >  "_`@+l `> H :< $ `@ @bU 6` \ `:   > #0`L`Ҁ`2 > ,#P @"U@6`b \  +@* * 0@*$ 0 - $ d<`cLB  @ " $8> #x m > ݐ#  > $< 8 > #Δ : @L  א 2 O : @~ 0`H   @"U@" `#ذ `@  @ڒ, T > @ "U ;`D* 2` c ` : 2 `@  > u#'`?㿘 : @+  `C + 3`  `, &  : &`@:bU "@``@@ 8>  *  ?"? *@ @] *`@"U@ c``@ 8 *  ?"? *@ @>  >    >  " * : &`, > / >> @+ 3` `@U c@``@ @+ 3`  8*`  " #; " :@ b @  +  *`@ * 8 : @>’@>  @> >  X :`@㿘%$l`h * 2`@:   ` .@ )* 2`@:   ` ..)%$`p@@``8('@  . `. @ `&@ ,?``8('@  .> @ '@%$4. '.  '+ '%$ (#P .`.`& > 0' '|P'T'X@l<? 't 0 \>  x2" 6~ P`@  4 @4#02 @(D  `   `8 20 ` `8  20`8 0L`8@`` @ @0 @ ] `Y`(: 0#\T\#`#d#hך `P $@ ,ഐ (  :0\#`#d#h#h#\@$0P@D< @ ഗ,``("@ \  %X \$ %@ 42ഀ` ഓ-`(  :! `P@E ` \` \ I0\#s? @\%@0S`` <D@L @  @ `(\*0\#T? \%x0\" <: T\#`#d#\#h/ p`P $@ u\#`#d#h#h#\@#dP@E ` 2 0` (0DL `(T: #\#`8 /\  0 &5 \#@0&"`<\d@~< X` \H@<\" @`P $@ \#` #d#h#h#\ @#,ഗ-```("@   %@J  4> M '* `X@ :W'x + #`T#\: 0˜ T ' 0%d'@~r:<@H"@ P $@ 0 : #`#h  #d#\@"Ú ## 2഑*  X"'x`% k`$] e.` T ɘ : T#`#\0` .`&  0 %[d'@~:<@H# @`P $@ #: 0ő*   @$#* x*` & t`&'tX #.`#{.`@@  0?!Ě   H* @ :`]OT#`#\: 0 q\ &0 $ d'@}X`:H@?<" @\"@P $@   \;` #h#h`#\@#`X* `&" # # \"X0?!I #m0 $ 'd@}<< \#n #W#S  |x  t\ ` YX|x: 0   0  @xt#"  + @@?`0  ">   X*`H& "$`"`<` <` T @Y h""h`%|  `Y 'D 'l >'h 0 l'dP\'X'T@|Ēl%<  0 ?> Q!`2&@l= D P`@|` ` # @|~DD  `   `8ll ` ` ll`ll`0`L l`%8%@`` @ l@`0 ^ Z`pDHl 0T#h#\#`D#d* h`P $@ -`lD`0 #` p#d@#h#h  #\ D@ lDD`P@|D<  h@3D-````p@ :`  #`X`!2@!@D 8-ഐp ! l`P@{ݐE` ```Rl 0h?Ú  b Lle<`l eDL   D`30h? "@!@0B%" <`pT#`#h D#\#d腚 ,h`P $@ s`#`#d@#h#hD#\@cDl P@{rE`  l`( 0leD`L 0D`p]T#\#` D獚 ꀦ`l 0 h" l`0 'x" <l d@{9Xx:H@}<x" @x&@h P $@ `#`#d@#h#hD#\ @D-` `p@ :` #`h @G|  |D> ! `'|*` Д ^'pD  Tl#`#\ 0 D al?`0  "h'xl d@zŐx:<@}rHx"@h`P $@ l0 : #`#h  D#d#\@  JxDݐ )D ഑*  И; 'p`" gx   al D   #`Tl#\ 0D殘 - =@l`0 ` h! l't`d@z[t:<@}Ht# @h`P $@ ? `0ʑ*   x@!.Dt`?*  X*` :ixlxl- `0  h? x H*| cDTl#`#\ 0 D; ~`=@l `0h!7 l'td@yXt :H@|<t" @t&@h`P $@ |  * `;`@#h#h`Dx#\@ O|p*` `* :@XxP UxL ϐ `+Xl 0h?t tt#l `0h  ؔl't d@y< tH@|6<t" @t&@ xx؀@  dp   `hUd`Ԭ`o|l@0  h    'x`0 Wl༢: d@yZ`l` @ys;  @yʒlx   d@yF:l༖ @y_; l 8  : @ @yl ` D l: d @yD xT D`  l` V  'x`0 A ?0 "0 x ?0 "0x? - h`P $@  ` D  `" @ `lp  :D # h`P $@ !D  @ |/` 0x h? > a!Xx `  H* ;@x|!- l@ 0  h  'x 0@" 0x|- ؀ l`0 D l 0 < <TD@U" D @b: # d` `hT 㿐 U%\a\ #\0#\㿈 P $`  ?%  0 @-"``8"`5`I"`T"`Q`"` d"`$ $   `` "`@ ::   ``"`"`D "'  ` "` ::(  `"`"`@``B =` "  `ഖ: :`0  `"`HF ? %e\aT 2 `e, 4 ``r2`v2``:  @| @x% @|`* =`` D@ :`D @|@{`x``* @`d@wD    ?`0q찒 " P0E $@ @5j   ` R   >   R  > !x  ` `x@|b H* p! @|W H* e   P $`@mҰ 0'''T'ǰ  '`4 `2   `   @     @   ̀ 4 FP (`   :` 2(   2( @ ( ( h $̀"` > x!  p (`     :  @  `    :@Rې 2T@̐  > @> 0> 8& H P`$ CȀ`4 >`̀>@;=  > 0  RT "- *  `2  `h:    ?@S  Ȑ@> 0  T =   `&   d   `   ?  ? 4 e0  RNe0Ȁ@   e4̀ذ    #\`E  T  " ° :  ` : @9@C   `&    @e<̦2 `P  ` :  @uȨ   #\`E  T  2sP $@ / 4. 2e8` 8) e8`L e@`0 B 88   2 @ ( > 0  QT "  C  :   ` :  44`0`` ``P@uE    `  `8 2`0 ` `8  2`0`8 `0`L` e8e@   @@ @ @ c4`Ԓ$H@xԀ " < `0 :  : %`0  :Ȫ B`P@uEG? C??`t? @ :d?`tC?ϒ: @ ؠd''?`0P: ? 'Ę   ` - X :`- О  ;@ & ? X " `  Ю=;?ۄ       `  (  :` p @< ;2@8  ( "   `  p =` ؘ  ` &         `   (  :` @ (" p :  `  p@ ; `ބ` `   `   X  :`   X", Ю ;@  `,   8 `ބ  ` : Ȁ   ̀  > 0  T ;Ǭ ???`t  :`@ c C??`t 'ސ : В@ b B??  ` - X :`- І<Ȓ@`d@t Т #d#`#\@ 2'`'  X "  `    О;`0ݔĆ'  ^ ,  `   (  :`  (", p "H  `,  p   ; 40`0`P *  ` :  `8 2 `0 `  `8  2`0`@8 `0`L` e8e@   @@ @ w< '<@8   `  /`(   : /`p   43`0`` ``P@sLG `    8`L2 `0   8 `L2`0 8`L`0` e8`e@   :   @ @   ` :  45`0`` ``P@sG    `   2 `0    2`0 @8 `0 `L` e8e@   @@ @ ` $ > ! j:  `h" r"`h `T:@: @ E Ė< ' ; ` > ` - X@: @ - @ @  @ "L  > `  @, (@: @    p@ @  @ ")   ` :   ` ` ; B;`?  &   @O  X'Ԯ'' 'XԺ` X''ذ ''̀@  't ?'क 2 0( 0:@r^ 0 : 'l `0"$ > 0 > (`  `, #`, 8 HB`B ; H; 8`0`<`8$`0 $<`> "Os " d" `2`H`H''Ѐ?20";t0 2: '`Hs0t6`P    `̑, ;, "@t & `P $`@  2'   `''t?V: B? b;,   `̑, @ : %` d@q`?#d#\#` ?& 2''0lؐ ':` F?< Œ@8 `3 1:@qƒ   ̑, Б,  :`d@qA `;`#\ 2''䀢 3F  `0 $`0@d#ԁ㿐 `P @q %   @qD  `      2`0      2`0 8 `0 `L`e8e@   @ @ '`0?ʚ 0 " <e< H @ & '㿘 8> /  +-.`> > ⤀  '; ) @@2  8&/@/ 8 /`/  8܀ 㿀 <>  :  @ :E"D T"O  0@2J  E   M 2> `  @ 28  <`"4  40 :`  ):` :` @ B 42  @> 4"  <;   ;  BB;` > #\ "0_> ϐ"h   8    !* * "2@: @ *  (` @*2@: @ *  (` @2@: @ +` @ `? 8    *#+@ *+@ 2@:  @*` * **2@:  @*` *  *2@: @ +*@+@ 8     #+@  +@ *2@:  @* * *2@:  @*  * *2@: @ +@+@ 8 * * `?2@: *   *2@: *  ( @  `?2@: :   ,D\t4X㿐> 0 > b!> $#/#  > > a#> /b4  > m!# F0> > !(a0- #b4@  "-k18 #0l0jb40$> )4" "4@  #a4 "@a4"`"  Ԕ Y= @Ւ 0-A @V$4  @ l y `$ @ @@p  b L Ҁ( % $`$ `` @`$`@$`$  %  @`$* $`$@X % `$@2 %L Ҁ 2%@ $`$%  `$@ L Ҁ  *@$`$ `$@0@ C`$@?<’ `NB !J  Kr L р 2%`$@> > !h  !@ %   `@ Ҁ , . $#H     D4% ` .} Z) Y Z }  @&&(&$&&,&f 4 "| > `h    .Ɛ/ 㿐< 2``0b -Ē  \ ``  4Қ "@> !: @q @mŒ @q* @ E @ :`D @r>@qx`* @d@m D  0?`  "@7.60 x@r# H* @ 1  ` R %! . x$ '  `L   4g I  > !Ȓ`h ?H͚  #耢*B*2 @:   ?ܰ   H@ 2 #Lհ 0w0t$cL#P$cP ,`: h h#@40 "0 %(%(@#@V0@m  4@pT (#L 8 0 4%$$H@  d<@lrC ?eܰ ܒH 8ސ% @%$ > ,  #P%$" , ''''.& \%\UFT2  0@g h8   8> (   㿀|  '  @?1 / > "4  K͒`  3r  H $   ?Gb  `h GϚ > !ܬ @'쀢?9   쀢" @0  "0 '@ !:` :`  찒 NF He\aT < @"`e > `@?ͨ > aܓ-  2e- ,`L`ѐ ?`$e`> $@> !@` eL> !h` eL?  ` > ! O +!``h + %e\F!T@  % `H`h`h#@0 "0g'@JL`р 2`e $e`,``4?@n e$``,*  +{  )$cL`8`0`4Ð$dH@ `d= @kC 찒 H"'`8ݐe$`Ԁ +> `,  $cPe$ "`, &&` " ` " & & &$/e(@&(&$ %%%`t %$`d%(`8%," 6"|@"``"`,$cH + $cH!Ӗ!Ԑ`Ԓ" @mW@e0=Xa(`0 4 :    @k! e0B? 8 %0<  @j %0 B >%0 H L8 8   ;`; >%8>%@$ 4$&$$  @&$ 㿈%\U-?  ȸ ̲ $=` (<  ą< Ӛ' 'I Ӗ) !% 0<`8`==9#!#\9$09$89$@9$H= 9#9#9$9$\FT 4" "" ""́㿘6`$` `@ @G AL Ҁ 2` %` `, @V   "#H/, #H+ ` |`"`IO` ? 0 L Ҁ`   `D?*`#L+ + +| $*@$$$㿘`$ b +` & , `@H  , +l `I `EcF5 㿘F`!T\@" 4U!@"4> "@ &`0&`@>`8 @i; @ B >`<: @i@ @i% d@ d>` ,? >`(>`83>`0㿘 4  ` 2` l `)?  ` `E ` 2&@`Eْ * 㿀 L`Ѐ   L`Ҁ " '> "P`> Y"`'''`'>bd*$ `` @ P 2䀢 2'耦` H`` D 2 E @IDL`Ѐ`@A 2㿐@< &  > 8 'O > z& #> x   "`l%` )> " a %`%`%` %`@<%` ") ͐0: @l @h @l*  D@ :`D @m-@lx`* @d@hD    ?0  "` )%"& `> z> z a"X%`x@m*  H!`@ 0 R# %`x@l H* @  P $@ "` @%>  ``R %`> > a̔`@Y "` (_& ` `  lʸ` * "l P`2<\`  `ʨ` * "P` `   ` l`  ` P` 2 Pl?  P "l? ` "P P`$2\` %`\F!T@ ,  ``"`p`"t &㿘"`  `,`@  F@J~  2@ "`  lP"` 㿘  4?@j 0L804ː%H@ <d@gC  X  H~`@ 8 > 28&8 ?Td@g"    h 1 ,> cc; <0 H~shL? H#%P, 4X%8 %H"@"X ;%0` 0  2㿐>  2)  !> !"> z> #\#b   И > z> #\# b   Ƙ > z> #\"Xb!   @@I㿘`f ?``> x*` €> I"> C"> = > 7 > {1#> +#8> |."> }+!> |( > |% > |" > |"> |"> | > |"> } d> ~ p> ~!XM > ~!TMє -㿐  '    > " 4`2' P (   @  ( 2 ` 2 ``h :  >  ` 2  > " ( > "%0  2 %4@(0 i   P@eْ  %<` 0E $*=@@e`   ` 8 ` ` 8` (E?,   ? {`2=(`@$6`H '`HFА   '    ` @ b  8 P  k `P $@   %p '  ' > Ր" 24 C > 0C C> 0?`   `  =  `  d`  ) X` !  z  vp " 0j2> "# , @  0B " 244@O 4   2  @ 0D ` 2  ` @ 3   `  ? '܀` `޴ P@d  <0 @"* $#\  <   ` B   `8 - ` `8 $`8  0@ D : `@ D:  `   @c '@< `@%``  `P@d'E    `   20     208 0  L`8@ @ @ @ "@&HET H@f܀`"0 !  > "` ` (  o     k  "  $`2'@(  "  "   `@ 32@@ 䀢    @ @'@ @ b %=@ ܀  `   㿘 4 2 |  "   $@"  @#   `?H /d * % l  =# 0 $ 0  l a> (-! + 0U  0  > ސ#"  &I   0     0$ 0+  0$ 0H 0 ސ03 SH /d * % l  "  *> 0 *! H 0@# +H /d4l* %l   j4 > #@&H 0   ด  `?@ 㿘  @7`  > z  `> z> z"X > z#  > z#$` 㿘Fڐt $0<HT`|  44'L'`*')))****)3h3P33<3(3h3xH@H IIF(G`FIIIIH]|] ]^(^(]H^(]]]]^(alaaabb`bpbbc cDcTcpc?" " " " "㿘 `&`2@  TU ` &@H 0  > 0 ``8 & @H 0  㿘 > > 0  `8 > w  &&VT?& 㿘  " > c h> |6 b b&"b& > |> | Ж`&" "& > |b"А "b㿀> 0 H /d> * %> "4> a̠  > `H@ > }"Y`""`?"""#4H 0  0> T+  €> }%"> {"#> { > | > } h> |"> |!> }!0> { "\> { !> {#(> }#> |#}ɒ 0>  (ܒ H /db* %b$#4#4H 0 > )" > {  "#> }c  ?"c> {a   @'> |$"pU4 > }a   @&a> |$a"pU& -> |  a@&> |$"pU a  @&|a> |$a"pU "@'"'А"@''耢  "?H /d4$#4* %$#4̀ > `H@ bZ#4`""`?"""#4H 0  0> +  €> }%"> {"#> { > | > } h> |"> |!> }!0> { "\> { !> {#(> }#> |#| 0>  ( H /db* %b$#4#4H 0    @> }cQ 2O? > }> }?cc "T 㿘 H /> |* %> |> b"#4 `     "`@4(   ;E 2 2  c4H 0 c ?*@4 `"  "` ?"$$ > | И  > |Ⱂ `"# @ # ∐?c4"∑H 0   "  "    2  " @А0"" @ 0" @0 " @0` > "*` >  > >  ;`㿘`  > 1 ȑH /d4> * %> "#4 '?``""`"@" "` "`" &` " "" ""  24H 0 㿘> }#` '> }#> ##`$# `Q # $#?$&@"  @ &@`> `;T <& $ S㿐     2? "  㿘> !̀`> a@  > } P> | >  Ԑ "* @@ &   @  2  2  $2  2  '  @F D > |?'>  "tc4 > }H /d4$c4* %$c4"y $ 4  < $ $ ($ D  @"?H /d4$c4* %$c4@ $ @ "`&@$ "t' 㿘> !̀`> a@t > {c> > } b*  @  @2  2 &b > |]&> {#Ȁ@    %>  @"  %> ٨ %> '> }P"4 H /d4"4* %"4 > {`$ Ȓ y~#  ??4 $ $ 4 < 0$ $ $ ,$ 8$ @$ <$ D D$ H$ L L$ PH /d4$4* %$4@ $ @ "`$@$  P& 㿘> |c> > { a* @  2 2 2 ' 5> {' > }"y $ < $ @ $@" &@$ ː' 㿐>> (>>>>ג ⼘ c "`"`"`"` > {"#$> |"b> #>  @act, @ 8 > {"#@aI > } N? > |"b> |>  "t`` ct> { O?q > }"b> }>   PcQ > | Pㄔ ?b @> {"a> {>  c B > |>֐"`V !> !> }> #\"a( H  wi > {> #\#a8 X  w_ > }> #\"ؚaH (  wU > {> #\ ĚaX   wK > |> #\ ah P  wA > }> #\ hax   w7 > |> #\"a @  w- > |> #\!a (  w# > }> #\!0a   w > {> #\"\a   w > {> !a#\   w > {> #(a#\   v > }> #a    v#\> |> #\#a   v P c 0_@_] @, 6S ; @]*< vE,  :  @ :`D @ d@\D    H $Ж@ ;B ? @ ;B ? ,Ȇ @; B?  @ ; B ?L  "  " " $" },&s @ 㿐H /!> * %!> $#4`  ֖  c4H p@> ~ڐ"?" ,  @ @N2  "`$ $"`("" (#4H 0 㿐 ' > ~"(H /d3> * %3> &c4@" $ "` "` "" c4H 0 㿘> !̀`> bP@   >   4 2 > #4H 0 > { w$  6 6 & & & & & H /d4> * %> "#4  @6  & "  $ & 㿈'XX> |` hv  7`d '`07` ?`?` ?`('`4'`Ld'`Hd@'`H   > ~ "hH /d4> * %> "#4   '`D` 2`$` '`@ 7`  '`@ `" "` ?` `""` "  `'`8 `8"`< # '`<`" "`?`@""`"> }w"؀`2` > }"  7` ``'@`" $``'` 2 ` ( ";> #4H 0 > }" `  <@  $ L<@  쀢    2 ` "@`"`$`"  L `" '` 4$2'` 8'`  ` '` "@ #  4 @? 4H 0 04`  4 @8 2 > #4H 0 > } "'` '`"" 4 @  4H 0 㿐> !̀`> c@h `( @> `,$@> `40@ > ` > 2(` > #4H 0 ` `> #`#\`(#0`, |$(>`(4&`4H2`H(,@2L`H&`H&HL$? *@2 `""`?"""L " > |#h  2 `L`"`L" `L&`L"@ 㿘8 ` 8T>   ;` @ ;  8B 2> |@(> |> |u# u4! 2` ` `? r? * 2 ` "$` P"`  :" " X  ?'@' 'X8   'D`| $ 'L 'P+ԍ$ p> |!v!㿘> | t"  6 6 & > >  `0& (㿐'XhX`H /d4> * %> "#4 `   <@   "`<@ ` W `   2 ` "@`"`'`" `2 > {Ԑ#  7 ``'`" '`' c4H 0 @2㿘  H /d> * %> "4   2  `" "  & "4H 0 @㿐  > {# +> ?H /d4%c4* %%c4 ` ` 2@`c4` `  4`  `$@ " &  $` c4H 0   `  > {H H /d* %%c4 2$ &8 6  &8` "`   "@" "` &00"`4"&4`"  "` "@" "@> }t"  $&,@   /     &   2    @>  $@ > #4H 0 > zא (  > (  (&(@# (  &   "`$ &`  `  H$*`"  H*  ;c4H 0 `T`$   `H /d * % > }bb $@b" "b$`H 0  3> } s@ h  4`4` `  `2$` 4` $`$`  @2`   @2 `      4ך `      <$` H <o< H0΁㿐 > zE H> } s!0  55   `  p %, %  `% `P% `    ==   `    h Y" h  ]: %(03>        `   (  :` ("  p @:  `  p :@`        `   X  :` X"  В @:  `  В :@`   `   :  `   : ม:  @[} @W @[s* p D@ :`D @\@[cx`* @d@VD    ?0֚ > @k x  ` x@[  H*  m 0 x@[  H*  m!H /d4&c4* %&c4  H` " c4H p@> yJ    5 `< % <"`"`< <%@U@ D D`2c4H 0  H /d4&c4* %&c4@ # l @G(0 "0c4H 0 vH /d4&c4* %&c4 l '@`  2   Ӗ @ c4   ` 5 jc4H 0 @Z㿘@ `'> *` € !"  > #4H 0 > x !` 4  @ `   >   @>  @ > #4H 0 > x H Hmo < ?*@4 `"  "` ?"$$    4  ` $`"  "`  $  )> }*`,   @Y, * D@M D  ("+ ? `"` """  `"` 2 Ð  (  2 `<`"`<" &`<`<" (2  ("/` `< !>   2 2 >  ?*@4 `"  "` ?"$$ @ ` #4H 0 > w!?*@4` @`"``"``?@"@$`$@` `"``"``` "@$` $`H /d4"* %"" $@"" %"$`H 0 2 @- > #4H 0  ` *`> " >  > w!8> #4H 0  ` *`> " >  > w!h 2 㿘> !̀`> a@ ` 2` `8`"`<`<"`<`<?`8"&`8&`<` ``"`& `?` "@&`&` ` `2`H?*@6` @`"``"``@"@&@&``H   2 `H`D`< "`D`H <"`H`D"<`D`H`<"  `L-? *@2 `""`?"""`L > w!   2 `D`< "`D <"``D"`<`D <"@ H /d * % > }bb &@b" "b&`H 0 㿘> !̀`> a@@  ?  *@ 4  #> } D@ D  ,    ,`@ ",  @( `"  "` ? "$ $ H /d * % bb $b" $b$ H 0 H /d * % bb &b" $b& H 0 㿐 > { o+"\ 6 & 6 &   &   P& H /d5> * %5> &4  ; @( "  c4H 0 @0  6 `@ & @"`"`@ @& 4H 0 㿘> !̀`> a@  `2R  8 2N  < 2J  @ 2F  D 2B  L 2>   ` 8 6  $` ("`( (? $"& (& $& ,  @?*@6 `"  "` "@&&  L O& @   > #4H 0 > uĐ"`   2J `82F `<2B `@2> `D: `L6`2` "` 0,"`` `?` ""` "`H(> }"@  "`H > |Ȑ  ȁ㽰  "'`   : ,"`p8' "  'P'X "'D| 'L  :D ` ,"`  ? '@     0/> }( `t : @S  ?@ B <? `0 : ' 8`d@Rt#\ @{ 2`0]'? - @: 4/`0`P D*   ` :   2`0     2`0@8 `0 `L`e8e@ @@ @ 8<  '?‘-  (@> vK"(> "X@H /d * %  &" %& H 0 㿀 \'''  #> tkH /d4$c4* %$c4  ^'`[c4  >  2>  a2 ?> #4H 0 > tY"x*@2 `""`?"""H /d * % > }bb "b" "b"H 0  ` c4> #4H 0 > t "H 0  c4H p@ 0?Y " K `  H'  H'0t? 3:` j,  : ,d@Q2 @ >`G #\8 2'0%&@ִ(0 "04㿘> !̀`> b@  2  0`" 4 4"`4 4? 0"& 0& 4  @?*@6 `"  "` ?"&&  `"  "` ? "& &  (`2  0   2 `<`"`<" `<&`<"H /d * % > }bb &b" "b& H 0 㿐'H` P'T@P < > { l! 4T $\4  $ 4`2@` `@  `> |#k  55 `  4 H /d4> * %> "#4!> { 04 #(kƒ   4 #(4$ k  4 4 $ $H /d4> * %> "#4> {c$ c$$c$"`$c$$   4 ``$`" '``$#4H 0 H /d4H* %H'#4   ` $c$ ?# @4 H /d * % > }bb $b" "b$ H 0 Hc$ $ c$ "`$c$$    4 `< $ <"`"`< <$ H ՘    2  "@ "` & " $>` @U[*   ,` $  @UQ*   , " @UH*  " , @UA*  ,@$T ` 2 @ \  4 `< $ <"`"`< <$\  #42@` (@H 0 8 @v`?  #4H 0 i  h&HH /d * % > }bb %b" "b%H 0 #4H 0 @    2> q" P` > >  > #4H 0 > q"` (2` %   @5 L %L" L"L%#4H 0  㿐H /d4> * %> "#4  P 8  <:`   Ә [&&  @Tj<*  0 ,`"  "` ? "& & @TW *   ,` &  @TM*   , " @TD*  " , @T=*  ,@&   2 >` & @T+<@T' 2   D  2 & e4H 0 㿐> !̀`> c @a  ?*@6 `"  "` ?"@& & ` "`  "& &  2  `  h"`  "`  "  `0 U> }> {#$B#?  8  *@6  @2 `""`"@""`""`"@""H /d4* % "b" #b"H 0  `0  > #4H 0 > pn#0H /d * % bb &b" #b& H 0 㿐@@ `( " `( "`"`( ("> c4H 0 0"" (`"  (` ""(`(" > `"4H 0 @ 㿐> p#P> {c!> }2  "Б:  @ "> }`$"А#h  6  @6 6  P& & 'H /d4> * %> "#4` ` P8  <:`   4    2 ` "@`"``$`" >`& @R *   ,2 2  D2 1 2 > #4H 0 > o#h@> #4H 0 > #ow ?' c 2 "  `j6 㿐` > {e<!` @ h   4 4 $ $ E   2  $  " $ ?# @4 $  "`   `  <` `4 D $ D "`D&D$    4 `8 $ 8"`"`80 8 @R*  ,` $  @R*  , "`@R * " ,@Q *  ,$    4 `< $ <"`"`< <$ > #4H 0 㿐`  H /d!> * %!> $#4    `   R @    R @  > #4H 0 > n#  ` R""#4H 0 㿐 > `0`  > @j#0& H /d4> * %> "#4   Z 2  c4H p@> n^#耊 @X  ` `?2`   $ `    R @    R @  > #4H 0 > n6   ` R" "c4H 0  > }bА?"bБH /d * % > }bb &b" "b& H 0 0 ` `?2`   $ `    R @     R @ > m 8  ` R" "c4H 0   `  @ > @ ` $ >> }bА?"bБH /d * % > }bb &b" "b& H 0 0KH /d4$c4* %$c4 6   &  쀖 c4m  c4H 0  0%   6 `@ &`@" "`@ @& c4H 0    $   `  8 "X  '|`  ' '''蒒 > @+ H /d * % > }bb &b" "b& H 0 㿘 0@> m H /d4> * %> "#4  ` > *` €@ F%\aT @ޒ@+ !" > l Ѐ Gc4 ( 0? # 0 *@ 4 `"  "` ?"$$ H /d * % > }bb $b" "b$ H 0 c4H 0 $ H /d4E$c4* %>$c4H 0  < S A $ H /d4$c4* %$c4 ?c  4   Haj < `H <ae H> #4H 0  ` *`> " >  > lc  2V c4H 0 㿘 ""> mې!(046  *` ,)`?#> > `H@ @@ > #4H 0 Xl-ax "#@  #@   2  2`H`ґ*`㿘  "  > #4H 0 > l!" 6  x@Nm `H*  0@  > #4H 0 > k!#4H 0  O   & H /d4> * %> "#4 `R @Kג 0` D> 0  > ` `44 H p@> k!`* `( `$ 4H 0 > > `"kbH  * `X@`$  4H 0 `> > "hbHkxB ` * ` 4H p@> ` kg"?# @ 4` ` `2` D `\` 4X` S`,*`(" `4 H  0 D :@I!``4 @ ; B >`` `X*> >  < 2 "c4H 0 k"""   > > @ * 2 "@#4H 0 kb"@`0:` ,` 0`< @H֐B `  2` ``(*   *`"aؐ: >`` `X`?* "@` `2`㿐 ? "?> j#"6 `x@M$ `H*  @  O> j#H U!& _%!@J!0'` D#> 0  > ` `44 H p@> j!`* `p ` 4@H 0 #\#`> > `#xjdbH!  * `Д@` 4@ H 0 `> > #\#`#bHjAB ` * ` 4H p@> ` j0"?# @ 4` ` `2` D `m` 4i` d`p`(* ;`4 X `0 T :@G``4 @ ; B >``  $`Б+  > >  @=  4H 0 i  <@    >  @*  > #4H 0 iĐ؞  ;  0@` /``0`< @GB ` " 2` ` + `p@ @ `  ? @"?` : >`` `И  `?* @<` `2`㿐 0("' 0@6 '?*@4` @`"``"``?@"$@$``` > ؓ*` €@В @  `  4` `$@" '$``'> }?"$ "`"  "`  "@"" `2`? "@ 2 8`"<<"`<<8"@"<"8@ِ `2 ` "`? $ 8 4  0`" 4 4"`4 4 0"@$ 4$ 0@` 2 `?  2 $`"(("`(($"@"("$",`2 H /d4* % $@" $$`H 0 ^ @ڒ Y ` `@~4` R ` `@4` K ` !" H> h ` ] <`  S` ?# @``4` $` %> @`h( `   4` `$@" '$` 0 > |b "b붐 `` *`> " >  > hd H `2` `##?  ` 4` @`"``"``@"@$`$@`  4`  `$@ " & $``2` 㿘> !̀`> `x@㚐  * @ " D> h$ ``D 0   2 4  `     `D 2 㿘> !̀`> `@b  a 8 " ,> g  ` `"  "` ? "& &  &  "`"?& @" `H  * "  H*  @; `"  "` ? "& &  ( EH /d * % > }bb &b" "b& H 0 㿈 > !̀` > a@  b2?> g!8! @ 6 \F!T@ x @I `H* @ @I `H* @ `[  [ܔ! В O& `0 > |`Đ "`꒐0    D  6 >   > g>!`7 `  *  ?(@ (:   ," $ (> #\#` > @! gS#@?* X@ `"  $ > @> !ؖg?"@ `$ *   ? p@ (@2  (@  , "  (@;`> #\ > @! f@:?*  А   @ "  > #\ @> !ؖf˘ ;@ ?# @`3 } `"  0`0 2 0> |b "b 0?  4?> f!2  2 0  4@? 0  < 2 0  4@? 0 < ??`> 0ː D " <K  <J  ?*@2 `""`?"""%>!* €`) > f^" @y " < @; < ` ` 2   <k  <` *`> " >  > f:"@ <2 ` q > f,"p  f 2  D 㿘> !̀`> b@~    ` 6 "    `"  "` ? "& & D & D "`D"D&    6 `8`&`8" `8&`8& 㿘> !̀`> b@E  " > eԐ" * 02  2  ` 2 `"  `""`? "" " D "  D "` D# D" `"  "` ? "& & H /d * % > }bb &b" "b& H 0 㿘> !̀`> b@  b2?> et#! ( @6 ? `"` """  "  (2  (   DU  D   *` , 0`?#>   e?0`H   "    ` 3  `"  "` ? "# #  D #  D "`& D D# `2 `ˑ*` "  `0 > }`d "`dM- (2*  `"  "` ? "& & H /d * % > }bb &b" "b& H 0  㿐  ` R & H /d!> * %!> $#4   㲖  #4H 0 0  `" & #4H 0 㿐H /d4> * %> "#4   ㇖ 2 #4H 0   `  R  > 0 R  > d|#X `   R`"  >  R`"  > #4H 0 > d^#? c 2  `  2` ` "@`"``&`"`@a D " @(#?  2 `""`"@"" @ 2  <`" <"`" <`<" @2  #42 ,#4H 0 0 @q#4H p@   惐 > @֐# `> c#؁㿘> !̀`> `@D  L D< ": ? @4. 2   @( % ` "`& P  "@$ $ $ $  "" 2  L @2 L  D枒 L 2  ? ` "`& P  "@$ $  H $  H"& H L 2 㿈`> 0  H /d4> * %> "#4 U  4H 0  `@ > `<  > `D > `L > #4H 0 > c@ 0`84 > #4H 0 > `  @> "*` >  c     `$   > #4H 0 > c h`  (" `8!4H 0 [ `   ฐ`     (   ^  `0 ; %``  ``P@@ D   `     2`0     2`08 `0 `L`e8e@ @ @ $< !H /d4&4* %&4 \  8204H 0  㿘  > bS H /d4> * %> "#4 l B'> > !̀`  @ݤ 0 22 0 2  > #4H 0 > b' Ȁ "   2e4H 0 MH /d4$4* %$4 l > `4@ 4H 0 㿘`  # 2 |P $@   0    $@H /d4> * %> "#4@  4H 0  @^ l @+ 2 `4H 0 u ` "` ` >!$*` € 2 @@  4H 0  ` 0'伐H /d4%4* %0 2 8@ 4H 0  9 0䕐H /d4%4* %0 `"` 2 ` `8 @ 4H 0  H /d4%4* %%4`2`  @  y4H 0 0 , @  @ 4`_ @t W4H 0  ʐ 0&H /d4A%4* %0# @Q 44H 0   0nH /d4%4* %%4> #4H 0  ` *`> " >  > `  2 ` @4H 0 ѐH /d * % %4ߪ  H 0 H /d4%4* %%4@ l 4H 0 . H 0 㖐$H 0   | `  |  ``  㿐> !̀`> a@ۗ  '> 4H 0 H /d4$4* %$4  " * DH 0 <0א  H o4G$4*@ e0?H /d4$4* %$4`` 2` `@@N 4"` `4, LH 0 0 H o4$4*@ e$40H /d4$4* %$4`` 2` `@@  4"` `i4f  w   㿈> 0 'D> !̀` > a0@ې Xb 3> 2c4H 0 D `3>    AH /d4&c4* %&c42.   H p@> _8!H c4H 0 ``         @ & ``` 2@`@r c4H 0 '#c4H 0 0H /d4&c4* %&c4 T 'c4H 0 F H /d4&c4* %&c42 "   H p@> ^!p  ݖ  > #4H 0 > ^!` 2'c4`,  @'c4H 0 찒 lH /d4&c4* %&c42Yc4H 0   :`@@0 @<= @@&* UU@ E @ :`D @@@@x`* @d@;D  0? ߋ찒 -찒 H /d4&c4* %&c42  H p@> ^!2 H /d*  >  %> "#4㿘> {# * * @?" > }2Б: @ > |> | Ȁ@ > | b  "b㿘> 0 > {cU# 02 > {c@> > |bC 0Ho  "``  0> #4H 0    ސ Ho * "`> |b` u"bH /d4> * %> h"#4  b  `0> |> { > |a` > |# #a"> }> }!> |a` > |#!#a"" > > #4H 0 > ]X!؀` #> H /d4$c4* %$c4> |> |pb  ` "p> #8`& 4F c4>  ("p, "p$c4` &"pH 0  㿘> | !> |"p`". "p  > #8`& > |4"㿐H /> } b> @"0S* %> }b>    ?"#4> |> <bԗ*  ⴀ  < < +( "4H   Ζ   [ > @" @d 90 2(bԘ  <4H 0 㿐'H /4> {* %> {#>   "c4> }"> @ *   : @ ` **  @' #4H 0 0u> @_"80q> )!4!44 $@"  2x @@ ?L C "?D@ : ;#4H 0 ` À@    > @"P0   "> @ "h@ H /d4%#4* %%#4`@#4H 0 㿘 H /d4> * %> "#4 W ` 6>!T*` € 2 D`F D >`@;  "7`7 `.  ,@ " `( ``2  > #4H 0  ` *`> " >  > [" 2  > #4H 0  㿘 *> !̀`> b@  0 `' #> %> 2  0@& 0c4 +# $c4 0 ` 0 "  ڭZ  㿘`> H /d4> * %> "#4> !̀`> b@ֱ  p `#> %>  D p`& Dc4 * $c4 p 2 D` > #4H 0 㿘 0(2 > ["`P 4@ > [#㿘> #@\㿘> ƀ#p  @ H> "'`4 .`*  *@2*@ ` > "*` >   > > #c#\ƀ ` >!*` €>   (  ƀ $b ,>  0 H  #\ ;`ƀ yb>  $   ƀ pb>  ƀ jb 0>  4 #` @#d D#h H#l ,#p (#t#\  $ ƀ Sb>  >! (>  ,!0#\ 8#` #d#h ƀ @b $>  !p#\   ƀ 4b >  (! , #\#` #d #h#lƀ #b>  !  ƀ b>   ">  "0ƀ b>  "H ƀ b>  ƀ"`b > 5}"pM t @`$@"> b N`Ҁ ` @   iN`Ҁ ``$@2\.`_ H  M| W!> !?c |?# *`# 4@ | N "!> Y" . $!  $|" |$  $  8$ $ $ %|b x`Ԕ!M*x!Ԑ`Ԓ" @9ΐ@`N Za YMxx Za" @9@atN t ?\$ 㿘"   $`H 0 @’+}H /d4`* %` ?2 XH 0 ?J?   쀢`" 0(@   c "ʦ 쀢` 0(@? *@Ho * $` > #D> А(  㿘i ``@A  0@ !taDN t -㿘Ͻ㿘  4`> Y"؁  㿐> 0    D `<  > X" ` 8  @0H /d4* %& X"H 0 * 㿘`. `<"@ 4&`<`0@ `HLx`<&`4`HLx`<&`4`4 "&`@`0(&`0H /d * % H 0㿘 $`H 0 *xH /d4`* %` 2 XH 0     R ` "?> Y#?$`*O 㿘  ``" > X\#(    㿘  . ư $ 㿘 > `#X   Y 㿘> X<#㿐 "   ` "        #\ @  P'D P' " 'P\ `> `> X #@%@98? "`"D@N I@ k'  ` (ഓ,` (  :@57  Pഗ,`p @@5. P:@??#:" 7`  ,   ഓ,`(  :ഓ,`p   * p@B   0*(  @; B  `%D  2` ܰ   `2   X*`   :0 `Б* @@    '  8D  `0"2) 2(> WT#@4`0 > (>` &`0 8 HB`B ; H; 8 >`0` ,`B",   `3 `H* V SQ: @ K`%D $ 4@@?:`H,`,@ B / `H*@  %:": `%D $ 4@@ ,``H ?, @ `? ' DC  `V`@S``"(2(@4 P ;@??;@ 㿘 P'T" ' `  ?>   #V42r ` n   F?f_`$ @4V  2@(ﲦ@ >D@ e`@b>D d "&>& "  @3В @3ɒ@4 >&:& D@4@ d 2`$2`$ T> "T (V  2" 㿐 &'> ~ p   ` : `8̰?2  `  `8ð?2 `@8?  P`(43 ?> ~ p   ` : `2> ~ `  `2> ~`@> ~> ~aTX$ @? ` @  "?  `    `>     `>  ! > > >  X`hU ` 2   @5  ,4: `&` : -`  aB * 2`   - 4> ~-`  -`P:` !<@ր > ~aT !> ~!X T@ָa<!X2  : 4?@  2?Ta<@@֧&T!P    $`   ` $``Ԡ /> ~ Mt` ,  "@    ?` * "@   @)  `($`$` $` $`$ `* &`  ?,   B"@ $a@$a4$a8$a<& P `8a` y " `      2y`  H  "" $E i` 2  @y` ; *  *` ?"``    ; *  *` ? `; `  $`*` * "   @n  <    ` 8`   ` 8 @Ոa<$aH> ~!L aH$aL"@"  $aD@a<, ` "` 6` %> ~` , @`" N;t &` ` Ò `    & @Va<Ta<"@@Օ&T?㿘 I> ~@F!<@D!D !H`"!L!L"aL> ~"!P!L?!H"$!H$!L@s@q!< !P '> ~  @  %> ~,` `Mt @ x  u  * *    !P k!<@& T!<"@@F$T㿐 `2aH#? 7!> ~@!<@` +aH'a@@@"aD 2 aL> > >  X`hS!W?"LaLaH"@$aH$aLH`$aHaH"aL> ~aH"aPH"H$aL@!<` @Կ` 2a@@0 ?4  $a@ ?P"@8'?@Fa8`= ` * @ *` ?a<  `   :*  *` ?  2$a8 "`@Խ   ` <  ` ,>  `  `  ,> ` ,> SD! " ֵ =`     2n? H ` !""@$ ֘ ]?,@x &` @?2'@ց?0F'@a8 2 a<2  $a8    ?@$a< '0&@` 2a8@B [? 2H$a8` @  = ` *` * ?e?@"  ;㿐 `"?@ϐ` `@ {? ?`:  C , `( C, @" 2` @g? > ` `:` > > >  X`hHRs!@ې , <`    D? `6@ " `  ? "@  !'"#@  @   ?"@  '!@&" @ > R:!հ?0խ@"&㿘 )?@< 2 $@z?  ?`@n?     ?  @ "?@] . 㿘 [@  $* &  > > >  X`hQה"b* @,  : @&`@609`@ :*  *` :    :*  *` : *  @ * ?2   $   " ` @z @㿘 )@Ү 2 $@Z0* & `> > >  X`hQs"`@@Ґ` @L@͐㿘 )@Ҁ 2 $@Ҿ,0* 6> & `> > >  X`hQB"`@u : *` * "@ҟ㿘 +@R  $* @ `> > >  X`hHQ"&a >` @`@|0  $ $ *!4"$!4@o㿘 N@"  $* @ a> > >  X`hpP"&c :`  : 6 !4  $!4@C0% ?$!4 $   (>   `PԐb &  > *@ PȐ"B*$ $@㿘> ~!H`m i@ʐ @v0]: $ > P" (+> @ ` "$@Pc 2  @  @  `? " @ !$@""> Pv#0 @* "> Pn#X & : C8 C *> , @2  " PZ# C,  ?> PQ#@ѩ㿘'D! D*@  `` D * @   ``?@2 㿘`&a >` @>  $@ > > >  X`hP#z   ` C C&>@*  @ C C &+  (@ *` $@ ?  C @ ` C2`@ ? #@@ 4#@ ?"#@ 㿘  @ > > >  X`hO#~  @  > *  *` ?2 >  (O㿘 >`* `*?"@    2   `  >`* `*` ?` >`*` `* 3 ` ?>`+``*2 ?+`*"  `?&  ?>` +``*+`   > > >  X`hPOB# a" ~    @? 㿘> ~@G!<> ~> ~T aX@ Y > ~!L5> 7> 9> > ~!L @2 2!@Xh hO#? $!@@g@e<;?!H`!L"aL& !L?!H"$!H$!L$!D  ,` ,`    $ @I$ @G< 6 '> ~,  Hːt&, T  Q@<TaX"@@ %T 㿐> !#\!> ~> `    tFC$ tJP"> ~!<@˒ > ~!L"!L"`> "  > ~"aX> ~*"`p㿘> ~!L`" > ~> > >  X`hN$5G t㿘> ct> ~ `  > ~"a\> ~ `> ~  \(  222㿘> 0 '> ~%> ~` @\*` "  @2 2    `0 2  㿘     l> ~a`> ~ @ \* @` `2 @`@2@ l   `2`!`@ a\*   & " " &    2   "" 㿘 >  cȰ  ``< >   e  ` 2  [ "W  R $ `PD  $" ( 4> `P $`29 @L 2 ?@  @   @?  `   :p  `  2  $ `P`$ " ϒ       `        ` v㿘> #Ȁ`"   < >   Y   "  &@ E p  ` '`@'`*  ''$`'&   ` ? <@   ` <@  `$ @   P $`@?  ̔   ''䀥2 P P`  ?@8 E  `   `,       `    '   ``쀢   0  H @Ѱ   `   ! >$ 2!$    ` 8 ` 82$  `  ` 8 2$ ` $   '$  8    찒 R> ((8`B :8 ' ' `    aB 2` * @ *   `쀢 "    `:   찒 ! `쀍!2 H?' H@   > #܀`@ ` > @ ! "" @$ J`") * `2   ?"2 ' `2䀥@ ' 䀢2  "'  "  `2  `@q`  2 $  z$ '   $      z`  '$ I2M` "I`  D` `  `   aB * 2` @ *  $ $  $  $ % $ $  &, ~$ `ܐ(` $`В `@$`R?`@F  2  > ((0`B :0     ` ? @   `8 / `  `8 &`@8  0    ?   :`> @  `    ?   :`  $ ΢  >$ c ^`  a$ "@$   2P'& 谒  `    b / b)`耢 #` 2p&  `  p@  & @ < 0&' 0؀`+ (` }   2Pv  谒 o耢 &`($`g В `@]$`1В `@$`P `  А` C`*@?$`܀`0 -А  "`0.*@ $`   2Pw& 谒 ܀   В `@$`&`@: 㿘 > `P!   K 0`> J!H㿘  ""  @ >  ? @ $> K!P     > K!` @    J@ `@ &J@J   㿘`(2 > Iߐ!p&`.``>”  P`($ .  ` 2` .㿈 ` ` `" P> I!! $@  ` #\:`  " "`  P $@ ̓"`:  :` ``"`: :```  $` ``   @"6 Pb`8``H >T@` " P`!`aH`@ P $@ ="`<6 `"`H2 "`<&`H` : #\  /``   @ 2;` ` $ P`$`2`   ```    ` : `  2!` `  2`@8  `` :  8 `` : 8```:      P $@ ׀ ְ˺Ұ "   ? ` 6"@4   $%   ? `"` `$ & @ @   P $@  `=i`  : 6> Ho!66> Hj!4`   `$ @ X=<` ` "   P $@ `" : #\/``` >$`` : `  ` ; `` 8`/ ` `` 8`&` !` q` "``` `@:   ``㿐`   " :    _   `@ / "  2    ~"@  a# `P $@ ` `&`ْ S颐 0"`P`?&`` ` ``?2`` &``P $`@  ~   $ 㿐```:  `  7" P`( * `?&` P`$ ؇ I``  ```?2`` &` P`$ @6 `` $``  `      2F A`ܒ  >#h#\#` 0#d    #l 2/ ܀ 2+    `4 M  .`2M  "  M .2    D4Ɩ@8–ܰ `` ` '> < 9 >  0 23 ?  *  @ꀢ`% .ܔ`P 찒 2'4   #`#\#d#h` #l     2> H!܀  " 㿘 X      p  @ X  " \ \ 2   `  t  \@    㿘@)G     X .2`,`@  @r 2,``.  *`,` X    #>  4  b–     , @ 4 $ ,`ߐ  㿘  > E" 4?#  * )`*` X $  " ,3>  4  b     ,  " 8$ ,$ ,$ ,   4 `Ӑ  㿘. X@ , $ %`"$ (  2| E  `   p@"  p E  @2k E > P#. `> F"PZ  ( Z`"Y  , (. > 0c   $ <  `   p@"  A   @2<  > P# > > "`Ft/ > # < $)   2% E  `   p@"   E  @2 E > P#. `> > "FK  4  E 㿘@  `    X,2`,`   @h `,``,  *`,` X    #>  4  b     8 ` 4 $ 8`ߐ  㿘~  2?> Dސ" #ߒ  * !`*` X   " 8#>  4  bw     8 ?$ 8   4 `ې  㿘. X@ 8 0 %`"$ 4  2| E  `   p@"  p E  @2k E > P#. `> E#Z  4 Z`"Y  8 (. > 8c   $ @  `   p@"  A   @2<  > P# > > "`Eh0/ > # @ $)   2% E  `   p@"   E  @2 E > P#. `> > "E?H  4  E 㿘    @> D#p   > !>  " @   X ` (D#㿘 4  @  ᵒ    o f0 Hbߏ 2 @> Cݐ#'أ.''''ܐ є ]` 44` ` L @a @  *`$ @ &`$8N &8$b  0@  8 "`  &&@ݘ > < 4& @ 4&@ >`⿔   -@㿘 4 @+   ` *X @" א0 㿐b .> CO#ئ   @1 @> ,@''b~ `   $?$ @ ?,@   .`"`$*@&`$㿐" @Y   $6 @g p"6  @=Ԁ   " ,3>  6  c     ,' 8'   <' @'܀ " ,@  ( @ > . 0@ # '耢 " 8@  4 @ ؙ. 8> @  '& $& (& ,䀢 & 0& 4& 8& <& @ ?# @6  8 4@? #ߒ @6  4 2  ( 2  0 2   $ 2   6 ?# @6   6 @ΐ  p"6 [ @Ԁ R  " (3>  6  `   2  (`" 4 ,   > . 0@ # & < 4` 8  쀢 . 8> @  & @& , ( & 8 ?# @6  8 4@:  ?#ߒ @6   6 @j  㿘> 0 4` ߼    ,  X `"  ` " @m  $ _ 㿘" `@   *`">`   㿘> ct> ~ d! > ~"at> ~!h"!h"`p>. @  0  @ `> ~' ad<> ~at *  $> ~!h? 2 2   ` "` "  "@$ $ ' 2 > ~!h#> ~` > > #tap*`  "ap  h  D  ap`0$ap h> AL ' D  >   > AG  ` "` " ? "@$ $ `"  "` "@$ $ $ @`R $" $$  4 $ $ 4 .  .`@  #@  $     $'?''''''' (а  @ @@  @Q    Ɛ 4 `"  "` ?"$$ @2.' 4 2  ( 2   0 2   $ 2  4   "' < 2  @>  0 $ < @ 2 ' 8> @ $ @' 㿘`` ?&`` @`?  &`> ~&`ah``&` `""`p> 0 `> @v 0` 2`Y > @j @`` %> `6` P  `   5 ` `* ` 6`  ?ؚ`$''''''''q ` " ` "``?# @6` 㿘   X`"?o&?  㿘  `>`#& `  ` 떒 F``B u  < #.%!" 0.&$ 0&" 0#kO ːP 㿐 `   &@㿘"`D  `0`4&& 㿘> a  "a 㿐 `` )&  ` ``  ``l  &P"& F& ӨӨӨ         L L L   L L H L㿘 > c* @  @ "   a  㿘 > @c* @`  @ " #" ( "C ` "`L"   ` ::pY " 4$`  d2 ``X ``   "㿐 `< ``T  ` (  V  &  "`    " ``B > `  ?> # ;"`  "` #"`> # 0"` 0   &   ` : :`      ` : :`( ``B > `  "    `>  ::0  ?&  㿘  ``4`>#*` €`P $`1  2,   2 Xd @2    @"    p 2t `4㿐     ` (  V  $  "`    " ``B < `  ?> # ;"`  "` #"`> # 0"` 0   $   ` : :`      ` : :`( ``B < `  "    `>  ::0  ?$  $` $`  `  /$` $` `   p $`   `  t $`  `  ( t$`L  `   <`   `   $$`,  `   D$`0  `   ,$`4  `   @$`8  `   4$`<  `  $ H$`@  `  d X$`H  `  l P$`D 4  ( $`(2 P@$`( 8$`(  `  h :3`+  +`  2`*  *` <`P 4$@ `<`X 㿘   @    `?2_ `?2[ `?2W `(?S `L?O`T?K`D?"`HE ?"  P $`=   ` `  p   `   "`u '` 2   `     d@     X@ > ",`   `H9"X `  d X@  `H?# @ " 0#"d d "d `Hcd  "d `? X "X  `? `HcX  "X  $ `H` Ű   `   d`   `  X`  ` 2 P`?"`  P $`  `@ ` ?2 `$?"4`,  `    4   "  P  " P  $`y  @ ` @`$ n` 8  2`,`$(`, `,?2 P`4?"H` P $`2V   ` `  p  `4   "`4玐 "`4`` < ɖ 5`4?"`,  $ `,?   P $@   "  $  ``4`, `   P $`   @  㿘   `   p     " 6 "? "  4 b" 4 O  `  t  2 d" "  ` @ 02@  ` o 2  $  8`"    ` b2 @ 㿘   `  `` p ` ` 2``t `p` 2``p@ 2``t`  斒 2` 浐 `  `` t`  2``p2``h: " "`_ 0" t" pՐ` ` `" `  ``" > Gh ? 02% > : X2`` $`  `  ``@ 72@2  .`  ``@ ;&2@ " t" p_` ` `" `  ``"  !@(֐   E㿘 `4  $`  ` d X` 2(    `  d` 2    X` "     6`" i  d ؽ0؆؄㾈>   b '  $ > 9 p4 2P P@     0`  ` `R c  ` R c k `  `2 Xd @  ` @ېU ` $`` ` `` 2`` $`P`$ ɒ P`$`2   ﺘ `?$`` ` ``?2`` $`P`$ " ʙ  > (3L#"   ̐ >  㾀> "  '     `' ' $$2`P> 9, P  #  P  I Ő׍ ׇ6׶״Eb !@    ` d X` ԰   ` d X` Ű @ + `4  PN׀ ` @%> 8Ȑ  % bk\    `  R c   R c  v  `  dX @`  ` ` d`    X` ڒ Q   <   0?<  : ` U`    ` L`  )  @J`.@  `      $` "r    $ ` ` 2` $`P $ 7 `P$ 2`   ]  ` ` R`2+) 퀥 T`  "`}0@2> 7ǐ В  m  2 `@> 7 PO`  ` `R c   `R c  ` $`` ` `` 2`` $`P`$ ȳ P`$`2  `?$`` ` ``?2`` $`P`$ pȑ m t 퍘 #\Z`?$`` ` ``?2`` $`P`$ i ``   > z բ`@> @> 7  @2` > 7!`   `b  1 ` b* `   `# 2p@2  @"   ` `  p@      @    <   0<    Ұ B`` ɰ Bǰ c    `2 2,  2 `?$`P`$   ?% `P $ ǵ +P $@ &2  `  ```?2`` $`  ` `?2`   %     @` g  ː   ? %> 6? Η B䀢 2  > 6-! i "> 6 ! > R#$  Ž#   % 䐂 `R ` w rԤ 5b i g`ԙ ?$  ?$ ` `?2`  ?$`P $  @bpb > !8`> "` ' `$`> 5!H  ` R c   R c  L/> (` "`p/> ( !  ̰ 2:  ` `  ` "``  `   `` t  "t `` t "ڐ 2   # "` > (/4#``  ӾӼ $`` ` `2̔ " 4$``  ``2 P $@ X  $ ` ` 2` $P`$ C P`$/> (2  2P (`> #`"+:>  '' '  '"' '`/> (''`#\  2h`  `ؐ `":``  $` ``  ̒ @A ȐH/> ()  P`$ Ȕ"`<6 ̖"`H 2 Ȕ`<&`H̐`P$ `2`  "Pk  $@ bȰ  ꞔ̔Ȑ귖 2 "`Œ `*"@?$ ` `?2` $P`$ Ŏ $``  ``2 ` $``P $ |  ..Ҿ > !`㿘  @ | " @א0ҠҞ      B`` 2`  B `` d X` t   `   d` j ` X` a `)$` ?$ P`$  `  ` $` `$ P $@=  7 mP $@# `  ```?2`` $` `  `?2` `$ P  $ @ @?` @ E ]ޒ 㿀 (`  @E B  "Œ @ P (@ 6   `  ( <`: p (G  ` <`:  $   #\#` >#d 0#h   #l ) ѵ㿘   !} "$" "@   R 2N  "J >  > 3!p "@"  @ D  4@#@ #@<  М, "@ " @ "D @42 8$    `      2        2   8# #㿘   `   P (@ 2   `2 h : "   @2    `p( < 0 뮔 㿘  ` P l㿘  `  lF`㿘 `2 l㿘` 4? > 2W!  @25   @20      쿚 "  0$ 4($ 0H /d * % {H 002?2   ?2  H@) <$ @ ?2  ?2 H /d * % TH 0  `|` $ D0`€ 㿘 ? >  ! 2   3w  `  R  >  3m! `   `   p ` 2  t2  > 3S! 4`@ l> 3H"( 㿘 `"㿘 `|"㿐 `< a`F  ` )  W  $  "`    " ``B < `  "B ?> # ;"`  "` #"`> # 0"` 0   $   ` : :`      ` : :`( ``B < `  "    `>  ::0  ?$ 㿘 `"㿘 `"㿐 `< a`ɐ  ` )  W  $  "`    " ``B < `  "B ?> # ;"`  "` #"`> # 0"` 0   $   ` : :`      ` : :`( ``B < `  "    `>  ::0  ?$ `>(`  `   ` $` "`     㿐    `h     #\  㿐>  #`` ` `2 * `$$ 4>#ܓ*` €$ 0`  `` ( t >  & "h$ 0$  ^$`$ 0`  8 $ 8X``<``* *" * *" *<``& 㾀> "`$'2<> 0-"0&  `   > (*#0A` &"`p ` `    ``  t   "t ``  t  "`  ` ` "`p 2  깔 "`> ()ʐ#``  TR $`` ` `24 > #` `<  " 4$``  ``2 P $@  ` `   `d `d 2t2 Q  `  ``@ ;2@`P$ `2`  2嘔屘 2@> ()T# &> ()K#ې$``  ``2 ` $``P $ " " 4 >  "H P >  2 >   8> 0 8@ 8 < "  <  ` 2``?"`" <`@   3  `  4  ` `   #  ,  #  @ `@" "  2   , `@  " "  @  2  㿘'` > ."X `"0 "  @"( : 2 ` (@u?& $@p&&>"d@Ӑ   `&: @"` $` '> @> "/$ 㿘& ` N<@ 2@R`(@:?`(%i > @ "4 P  @&0/ `"" > "/Θd> .>"@D > ~x>   "x"xര x "`d> @> # /5d 㿘& @  ?&,    $    㿘` ` ` @ *> ?# ?*  *2` 2   & `.贆<.`  (@?$    㿘  "f. @@6&@  , f@   ݲ`f@"   㿐 .`f, `[?f (` fʔ f, ` 0j H``$&@5 2  &@˒>N:@ `/>&@2   2`"  6  N "* &N  6 N "* &N @e >( >N :   > #P.d> -#x * . ` .`f,$` @` ?2` ,f`$$ ` 㿐 .`f, `y  ?f (` f; _ 0e H`( @J>L:@ `(`5" : 6  @S   @R   > #.Ed> ,#"@L *` .`  *``> #.2d> ,#>  +@, `<f,?$`  ?2 ,ff,@ ` 2``(# 㿐   $@G&@ @ >  - >  @ܔ00;&,*`?& (` & 0& H  $@&@>`L@ `:  @  >  @-ϖ$> ,? h * +,@  &,`$   2 ,&+㿐 @` 8 (>   , $@ &,,  ?& (` &]  08 `H@m (6`L@ `: 6` >  -$L&`6`> + @ ` +@*@,@  ,&,`$  <  @ 2&,@ `?2`,&ʰ 㿘 ``$@1&`$2 `$ `6" @Q@   @Q   >  d-5 > +!" N@*   *   > #-#d> +!8㿘> a`$+Ԑ   ?'X'T''@ b 2 ^ , (?# 3?* *@ 2 @2@ !?f? =0 M T  @*` @+` @2  2 % %  (# `% f  ʐ'f*@ \ :``: H@ &<" @ X"@j  > +!x? ` '*`( ?# 5?* *` 2 2 -?B'   T! |  % 'fw'f*@  :`:  H@  <" @\ 2' * * @ 2 2 @ + @ X"   ' %  T `" N.`   Tט .`%@  ` % f )f,  :`' <; @  H "`@ `'+  ? *`,    2 2*` & \`.`W.`  f? ?? c H+`9? * * 2` 2 @-? H 0 Tf _\ %@**` ?`,  2  2`%  + % `& ff  f,  :`\'`;  H@  <" @ X"f \ f?3 Wf t 'f,  :`:  Xd#@B>@  @Af`@  &D!"@* f? "\> )!` H*`& '@!.`@@  f  ' 0`@" 0@.` 4  " " `  "` 㿘 "   ` "      @  P P   > ` > )<!`'@8@ @?" ">`    S'ക.` ( ?c ?+  *2  (3  *  >?```  @.`  ?ക.` ( *`*   3`+   ( 2` 2,  3   Ɛ`` '@& ?ഐ * (c ? **`2  2?   > "*B > ("( v"$ & ?   8 > `0"2% 2(> ("@,  `0: <`$`0T>`0`> (  `,`#`, 8B; 8 `?`H+`c *`*?  2 2 `, )`($`@#@.` ?, @ @` '@$@ @ .``H ?, @ "@? '  ?    `z``"((, < 0??> 㿘$?#? ** 2` 2 &@  ** 2` 2 &`  ** 2` 2 &` ** 2` 2 &`   ** 2` 2 &`  ** 2` 2 &`  ** 2` 2 &`  ** 2` 2 &` ** 2` 2 &`  $ ** 2` 2 &`$ ( ** 2` 2 &`( , ** 2` 2 &`, 0 **@ 2 @2@ &`0 4 2`*  6`4 6 @ `2 *`@6`6 8 2`*  6`8 : @ `2 *`@6`: < 2`*  6`< > @ `2 *`@6`> @ ** 2` 2 &`@ D ** 2` 2 &`D H ** 2` 2 &`H L **@ 2 @2@ &`L P 2`*  6`P R @ `2 *`@6`R T **@ 2 @2@ &`T X 2`*  6`X Z @ `2 *`@6`Z \ ** 2` 2 &`\ ` ** 2` 2 &`` d **2`  2 &`d Ș @ @ *`+  3` 2` &`ȁ㿘6 @E?5? ?`. (6`0& @. (6`0& (. 6`6 & 0(6  0(6 (06 Ķ 㿘? @ `2 *`@6@ ?  2`*  6` `( @ `2*`@ 6` x (  2* 6`x z <  2+  6`z   3 * 6` +`( 3  0&` +`( 3  0&` +`( 3  0&`  +`( 3  0&` +`( 3  0&` +`( 3  0&` +`( 3  0&`  d+`( 3  0&`d h+`( 3  0&`h l(+`3   0&`l p  + (33  Z&`p <     l     <@   #`l2 6  `L2`d 2  *f "`d8  2 &   㿐 >  cȰ  ``< > "pƧ `4@ 0` ,`  `P $`2 @   @?/ "  `$ -     @  ߶ "  <㿈  P`$ 2}   "  % ` @"`    "  ``B = `  > # "`   ?%   2 P ?%  `(? @ѐf,* @@i@f$`?f(  f>찒 " b0+ ?%  f$@N?`L` H`Xڐ *  2  2  2x  2zD  0Q   `4? ` +`P ( :`ː82`P@  `P (`  `" > $" ( @  J 2  @2   `%   @  2<f(9fff @@D    :  `#\ȚT 2Y@Ð@ T qT `%    ;2fb2f@    :  #\T 2Gf@@aT$H@T " <Tf.Tf  : Df@PB??'f2`$ 'f2 $'f:` 'L  <`(TX'H? 8 @ 6  (" "@ @$   ,` (@"  `%   o   <H ( `( <ݐ  (> > 0   h?'f2`" 'f 2 ?"@'  8 ? ( @ @ *`* 2 2` f@, @tP 2P`   ("ؐL@ $Դ @?# ,` ( ? @ @ *`* 2 2` # f: @4  >  X 0 H@# b (>   H @"#" `h > `l > #"< ` ""`"`  % 㿈  ''X'P    &2 ߒ?P@&: >`'   g `0"& > 0 > (`  `, #`, 8 HB`B ; H; 8`0`<`8$`0 > "#><`l PX" `H& > &&,2" * @G 2'&2 ?y?)&@?#, ? @ @ *`* 2 2`  &. ??l 2'֒?ݲ@ $P "`@O,  ?c ? + *` 2 3  &. ?> 2'`  X`0 $`0X"THTPTTXTT`TThTTpTTxZZZ@ZZ@Z Z@Z(Z@Z0Z@Z8㿘 !@Gs?c ?*` * 2 2 &@   .`.`@G``` `6``> "  ' 4 ` & ?   $ ? ???'''''ؒ Y    4 .P "@' ɔ 4 ?$c* @ ;  @E`"@&@`@@: <`  * 2` 2ݠ < ڐ`   2  @8"@ "@`  '@ ""@"@> " > }#0` ? @' `''`''    &''@ `  @ `P $`?  m ' '耦2 `P @"`P  ?'`P`8'  : 8$2 @ ($  '$Ԩ  :    @ 1 ''ܘ =; @  B  '@@ '@?#Ԁ@  " :   @   2 H?'' H@   > #܀`@ > H@ %  $U /   2`*  * 2  ?"@`䀢@2'  쀢''䀢@2@ ' "  2  @E  "   2`*  'ܖ$   * 2` '@p  '`$ 2O @"K `"F`P $`"]  V@ =B @Ζ@'$ $$$ؐ@&'ؒ@̒$`$А(` $Ē &@$ ?@@ ? ?* +  2` 3  $  @ `2*`@ $ `   :`82 @ ( > TP  ?:    "0ِ $ @*$A @<W $" $ 2`Pm'@  b "'@" '@ @ "'@  '@'`0̀+ @( } 2`Pv   o '@($g Ē c@]$@1Ē W@$`P `  Đ ` C*@?$Ѐ`0 @-Đ  "A0.*@ $ 2`Pߐ'@  Ѐ @ Ē @$'@@@ 㿘? #`  `  * 2` ` > $#h > #` ? > # > #@? *` * 2 2 > #耠?@# ?*  *2` 2 >  ۔> K H X> " '(&> < ` ?# ?*  *@2@ 2@ '/ L %` ` ""/ < @ 2` ` > L*` €           //` J ?>  x @ `:2+    ?Ț'''ؒ 7'''''`P`4@  > ̐ @ = B =`@@   $:   @ ?`c 2``*    ?耤@ &" @`   *`@ @6`@   2 *  "@ @ @ @?> d # @ `*`2 @76 ?>  В> R #  *2  *`@ @76`@` $ [ :  @   :  c > Y!㿐  ` :   @ ("" :   @  ?  @ ` *`2@  * 2 3 ׷ `$ 㿐 :   @ A`?# ?*  *@2@ 2@ "` `L &`` !<` @ 2` ` > |*` €           * * h `$ `>? 0c D   #\#`#h#d    #l] 2< ܀ 28  ""  `4, L .2( `" L .2! ?*` * 2 2   *2 @ D g@  `` ` 'J H E >? 0*c 2= ?  4 ? *  *@2@ 2 @ @ހ`% {ܒP  ܰ 2'4 ߐ  #`#\#d#h #l   Ϛ  2> h! > ؐ!@ Mp   > > !PŒa`4P(@ 2  `2 > > !pa` ( > > !a` f  @; B?  2 (0  c'@  ff D%? =`@ @f8@ (D,f ?'#\#`#d ? (=(`@%6`H `H ' Q@ b 4f`8f "PP  $@  %x ' > > !Pa 24  "&  > (> (> #> 䀊`" = ` "   "  2 > > !Ȓa!Œa , f  : @@D B?Ű 24@ 4 `@` 0D  2  Œ  ? `` `m f@  ff @"* $ ` ; #\@ O=  B8 @ C   5`   @ɔ @f@"@@& H  f f #  "  %`2f@      @ 32@䀊 H'@ @ b % =@    㿐  f@J :`'  f?* N0 f H @ & '㿀 <>  :  @ :E"D T"O  0@2J  E   " 2> `  @ 28  <`"4  40 :`  ):` :` @ B 42  @> ! <;   ;  BB;` > #\ !> k"  㿐< > `c` 2 @  )$ 4  "$$ 0#`$ 0`?`(# ?*  *@2@ 2@   >  & "h$ 0$ 7$``  8 $ 83``<``* *" * *" *<``& 㿐!> !> ~> !|bh#\    > ~> #\"Dbx    z㿐> 0 > b> c  > > a!> "4 > "> > "b "4"40H@O  "tA v"406> )4" "4@  #a4 "@a4" b"d@ ! D `L` `@ @  ? 7 @w 0; @IP`0  ; l  `$@@"gbN #`@  @7 @6   :   6:@  ؐ .`$@0@+ N )`$@% `m !5 ҝ : .6: 6: . Dk @&(&&$&&,  4 " | > `hy ã "`$`$ !!`  ^0\ I`$@@2@P  | "bw0A! "d@Ò" L  ` ? M @"@ @  Za Y  Za@@" N  : .> #&0> "@R  㿐`< 2``O 9  I ``  G "`> h"@ (?@/,* @@ǐ@'$`?(  `  "@0 $@?L` HX: *  x`$ 2b      > #`h ?` " (:  @$ :`  $?Lܰ 4`$ H `@ ,b`ݒ" @$*@ ? :<` 4 8 ` $$$ $@$L` $ X@>0:4 ( @$$  '$($* :   ?ܰ ܐ`H , ?@͔ &>''''b̔㿈 |  @? o > "4    B `$   ?7  `h Ϥ'  $찒  @MH 2  !`  &0%`#H'` , %` : 2 4:4: ," @$*@ ? :<` 4 8 ` $$$ $@$L`$ X@ː4 ( @$$$(      ($,$* :   ?*찒 .`H Ғ, ?@B' &` &b&``$ < &`(&`&`$%`%@%` 2 %`$ %`,%`( |&" , 쀢 "`ʔ  ΀ ` `  &b㿘6` `@C >b`L& 2`@;  2 ` : 2` 4 :@ ``4 "``|" ``҇L&`   `;?`&,   `$*@$`$$b㿘"Ē  `] `λ  ύ 㿘"; cS`8 "f> #(f( ```L5@`d 1 f  f 0/`    @   +` + *@ " @ 􀢀 񀢀   2݀f f 0` Ӑ&`f&``" >``   >``b>` @@  >`(`  >`0 `  Z`!  Z `@:  㿘 4  ` 2` l ` `U   ` `` 2&@ 㿈" Lf   > #8d> x#H>b''''耢 2` ё`  2  Lf  > ,f#$`0@ 2㿐b Ԓ & > P ~ > ~&  !|> ` l  "$ $ $$ $$$ਰ "( А0@ې,* @s@$ ?(   H "$mj_&@YL` HX  *> ~  "D $TN$x* @$z* @$ 2"  > > `xU " -!&` d > ~x>   "x"xx# d`P $ $ &㿐"`   2* F ( &( " F` & `  d`@ݰ F&&   2@ "`d"` -㿘    $  `H4` ѐu㿘`f   / f`$f* *  :`    f f, ? H@f`?f &f  2㿘 8?c  * 2p cS " L\ ? * *` 2 2 ?> #h   *`*   2  2 `> #T 08 "6  T @*` @* 2 @  2` > # ` @*` @* 2 @  2` ?>  / 0`2  d @ @*`* @ 2 2` ?  㿘 > c* @  @ 㿘 > c* @   @   @` " L???# *  + @2@ ഑3 @"(@ΰ @" 4U@$@`  `   㿘     `"  4 㿐      $  "`    " ``B < `  > # "`   ?$  ?$` #$` ? /$` $` $`  $` ( *+ @ 3`@ 2@  $`L<`   $`0$`,  $`8$`4  $`@$`<  2` $`H ` 2$`H  d$`D4  ( $`(2P@$`( 8$`(    * 2@ * <`P4$@ `<`X 㿘      ?2԰  ?2а  ?2̰  (?Ȱ  L? T? D?" H ?"+`P $` `@"`) `` ?"` ` H` `2 "  " ` $` H`  ` `0  2P ?" P $`}   @ t ?24 $?" ,4 "h  " P  "P  $`Y   $ a P ,?2P 4?": P $`2C `@" 4 " 4 ` 5  . 4?" ,` $` ,?  P $@ ` " $` , 4띖     P $`  @㿘  @" u "/ "  4 b" $ O > 2 d"  o@ 02@  2 `$  8 "   b2 @ 㿘  "  @ @    2  ' " $  & @& @  & @   @ 72@"   "  @ ;2@ 㿘 4     `02 ` ` "  "  @  2  $ @ѐ0㿘 ` $ `>  (4 2P6N P@.F   ' !09 #`(` '  0  2` `$   ꗖ   " > (  2  $ > (` #% 4`` `  ` `'`'`$``$2`P>  @P@  " P@ ɽ؀ 9؀ ɪ*(0F  ` 0ް  ` ؀ (  4 Ѱ Ɍؐ` ` @%`> N X %@ܔܐ l #`@ ɘ   0   `  Ɋ  <  8     ؀    ܔm p ` `J`.`   `  ܔP S $`  ب  ` 2`  $`鏖  ܒ 1u   Ǿܒ & 2%# a " ( y ]@2>   Oب  2=  `@>   #@, `2 `$   5   &   2   $   ѐs` @> `@> K  `@2 > C b"   `"   @"    <@   Ѱ B  `̀ʰ Ɛİ ;      2  $ { `?2`  *`2 >      1   % _` ? %`>  ې X3܀   "`>  ː w 0e >   OM   ?2 >`$ #`#\ 0#d#h#lܐ   Ɏ 2  > ?  > d !?#?*  .@2@ 6@ '#`#\ #d#h #lܖ  ^ ^ 2    2  %   ?%   ֐ `0!   ` ?$`ܔp   ` 2 `$`0܁`` `$`>  '!( #@ð  !  ޗܰ 2܆       $`` `$`$`0# 4`3`  3  $粖  @ `?# ?*  *@2@ 2@ , '7/` `L  .``  / ./? ?* +  2` 3  '   f? * 2 7/` `L  .`` 2/ .  /#\/#` >#d 0#h #lܐ   Ȁ 2" P " @&4 >  !@:   潐 2 ``$`/ "` 2 $ " ``2`` $`"@> (B#Ґ㿘     Đ> ` `2 B 2) B ` % ` `0   2$` `?3`  ] ` 㿀 (`  @h 3@@5 P ( 6 ` ؒ`(>   $ ` $`  #\#` >#d 0#h   #l ǹ E㿘 ``P  ( 2    `2    j (0 ܔ 㿐  А   #\  h 㿐$`>  !X!<@& @  > (g#0V @ > #`$  3`     $ $ 2 " 4 2` d     @ ;2@    2 2@> (## &> (# 2`  $ "`4㿘   `?    `?֔ 㿘> #Ȁ`   < > !x'    "  `"> ~> ~ې"D> ~א!|$  㿘M֐㿘 㿘? 6  3 >    㿘@㿘@Β 㿘?2  . "@> ~*`# `A @@y { $ 㿘 $㿘> ~#  4  @`@^$@`< ~# ?c 4    * @      < 㿘@> ̇2 (> ֆl* >(`@ ? 0 (  0H`x""  `?   "`"@ "   "`" "㿘?2   .  "@> ~# *`@ 4 2  & 4  @& 0Ð  㿘? 2 * "> ~*c  `4  ?>  !$`4 ` +> ~` Q   0۳$  "``4 "`0ۨ`0 ?5 $`0? 2` *` *  * " c* `  9    @Ŕ H 㿘?2  . "@> ~*`# @ `$`8S 2`40 `@& 9 !X  : "`0>  $`4! "`4   㿘 ?6 *"@ > ~*`# @`$ 8`@ 0 `@ 0`@͐@@ 㿘. "> ~* c   4 2&@   &` &   ː $ $  4  ?& 4b   "㿘. "@> ~*`# @> 0  4 2 8v    88@> ! j h  `>  b"`  |   w  r  $`$@ & $ $$   4 $ ?& 4ڍ0  4@?` > PI "& $ &Z fS " _ i   㿘``E>(#8*` €@@A=@@_7@@1@@+@@ې%@@ @@@@@@ߐ @@`>  "X 㿘. "> ~* c    >  ` 2   b &   㿘. "> ~* c    >  ` 2   sb & ̒ Ð  p` `  '`@''''' (㿘> ~. * * "c* `@ >  C#  `@w @8`"8㿐'> ~. * * "* 㜐@@`  S . @a @P 20` @8*@(0>  #@ 㿘. * * "> ~c*  @Q` &`  & x  2 `(> # x ?& x`( @%  t `X (@| ,`X 0 `x , `.  H%> ~. * * "*  @` da@.a  . a؀ @  $ $ D $ ($ `'$ , ' 4> l ` "$`` $`x`(`@ɔ `t 2@@`(@|n`,@`4  `Xa؀ `X@ `X`ɔ `x`Ŕ `,`a $`p`#> #`[z0> U > R X 㿘 . * * "> ~c*  `@ +`@ * `< "  `4 "  t $ t " xH$  x <$ x`4`2`<@`<   㿘. * * "> ~c*  ` @˒` >  㿘`< `@ " >  > [ f㿘 `. * * "* `> ~#@/ "Ւ`a``   㿀 '` ''  d""  㿘>  㿘@ e``` @y*  * |2  @2   2   䀦 @ |@2 ` @2 ` @2 `  @2 㿘`| e`` ` @@ * `䀢``"``& ``"㿘`|` e` ` @& *  &``"``""&`㿘   &`|&` &` &`0 ht(0<HT`lx㿘 >    1  @n @> " @ $$ |$   $ $   $ t$ x$ p , $ 5$ 2@> ~#  &@㿐 " 2 ""`p ,   &    ` @ `H  "4` $ x`h  & 㿘 P  b&  ?$ "` ܀ " &  "& ` 㿘o 㿘  "+ @   &    $    `; `> !` 㿘@䴒 0 ?" @ &@ &` ?" @ &@ &` ?2@ $?" @ &@ $&`  ?" @ &@ &` ?" ,@ &@ &` ,?" 4@ &@ ,&` 4?" <@ @&@ 4&` -"x € &`( &`( &`( &`( &`( &`(  &`( &`( &`(> 0!H㿘"W " &` " &` "  >`P>`  " &`  " &` " &`0&`, @" &`8&`4 " &`@&`<!" $&`"* (?`!*`>-" €&@ &@ &@ &@ &@ &@  &@ &@ &@> !h&`(&`H>  (  㿘#> a $!$a$ L$! L$!㿘#> aa! 2  @)   a!  L@   !L@&? 㿐` `@,  &@&`(?  `> `!&@&`h`` 㿘@[ @& & & && & xؒ   㿘`0 &`&`㿘 K % `@` L ` ``?  L  0 ` Ē  ? 㿘  ?  K?2㿘> !@! 㿘  *  * 㿘 "@x@ &@& 㿘 ܀ "@k@ &@& ܁㿘@"  @@Y`R   !  /  㿘 2  ? #*`@㿘Ԑ T    %T  * @"@  4 $ $ & 㿘!> "D#>  $"Db@͐ "D/#@b@ c$b@$"D @!> "'$s `$$ @$($( $$$,   &" > <!ȁp> "'@ P ' ' $€؀ 2 ` 8`  " > !؁㿘   ʔh㿘 @@6Y 㿘(8 O d "V "DZ |$(($(,$(08$(4V`> !> `"(  A" V % ( 28V  `(8V$ `$ $ $ $$``$  @$  _(8 "  "     V 44(&   㿐`*  2  (# I 2@֔  > "" ` *   2    `> " Ȕ   㿀'`  7` `ܖ -` ";@ "`4"<":@ @0$0䀢 "0%㿘@, 㿘@T㿘> 0 @` -㿘 0!   - -㿘  -   㿘r 2   F` ` 2& P!> "'`  , ["֔ T"4 H F - = -;  6 2a`8 * " ``@ "`@2` 2 > !"` "(~ &" > L"h0&$ D&( &&&, ^4 " jU  _ Il ?B  2` +` *  * > ~" c* `1  "@ " ' " #$"Tq $ " bg$ 8< P$ 4< @< H< `$ 0$ < X @% Z!@% Z>  bx@%  㿐$ ?    $ 8   $ $ٖ  o  㿘"@  > #Ā`   {  2& & 㿀"   2''А'  F " " @  @ `8 "`8&@  㿘> Hf  㿘> "܁㿘> "܁ 㿘   @ 㿘   @ 㿘   @ 㿘   @+ 㿘   @O  - -㿘   @~ 㿘   @ 㿘   @G 㿘` %  *@ `?* $ `@X`      2?   @h$  ?``@  @     @$ 㿘`> ( @> ( d#㿘   @  2@ߒݐ㿘     @ ͒0ŐÐ㿐       #\#`@@ސ  Ӑѐ㿘   @  2@㿘     @ t0lj㿘    `@/  9  5  >  > Ӑ"  @"$ :    ,k  @ # :   " "@㿘  `4   ʐ) P`P@   ` " 0  @ ޒ 㿘    @&   @ 2ҒА㿘  @L 㿘>0 @c㿘 @$ 㿘 `  > 5#   㿘 `  > '# 㿘 ` 㿘  $> (#  -㿘 @| 㿐   #\(,  K  - - - h P "  x `''g' |'  0' ' ''` "܀ " xp P" J  x" ` ` ''' |'  (' ' ' "䀦 " x` P "  x  (  , ," ` p@"  ` ''' |'  8' ' '''h "Ԁ " x㿘 `  b`8 '''#''`|`'`'`''x` '' ` " `t ?&`t㿘 P  "> #0  t  㿘 P " 4  `  t  㿘  6    @` " > Ȑ#p 㿘 `" @ `    &    ``ӐА` 0ڒ`, ` + ```t "`t` 2`< (< X$ <$ @@p$ p`ʒ 㿘    >@ >` >` >` (>`  0>`( 8>`0 @>`8 H>`@ P>`H X>`P `>`X h>``@ P `" @2E x`"`  @2= x` 2 (`$?" `  (@21 x`$ ,@2, x` "` @2$ x`"`4 @2 x`4"` <@2 x`"@ @2  x@"X  @2 xR   `t  I"`t'f''#'' |' ' ' ' x @$ 4 2`4` ?`$?`$ ' ' ,'`4'ܐ @' @' <' x ?$ x` X "a " `" `@" 㿘        *@2 ϒh> `'``P`b&`` W ?`4 S ` `J`.&eF # @4 <7 1?`  ' '''' |' ' '` '``,  !( "܀  @    "  > 8#0>  P' " '`|'`'`!'`@'  ?''Y''#'' ʔ!` "b > #h>  P"' " '|' '''*''Ȓ@z! (  ?!( "܀ bb > Đ#X>  P'"`\ `PP@  "  P@" 2  ' |' ' ' !@7'Ԁ `|'`!'`'`@('䀢 (  ?''@"8 "̰b > r#Ё8>  P' " '`|'`'`!'`@'  ?a''#'' !X "b > 7#h>  P"' " '|' '''e''Ȓ@! (  ?Ҕ!( "܀ bb >  0 2'א` @ *  ``А ͖ ` 2``@  2 ` @8' '` X>  P' "` ' |' ' ' !'`|'`'`'`@@'䀢 ( ?'' X!8 "̰b > ӊ 㿘`  Pb)X   ) & |&  & & w&`&P&T @(' @! (   ?)X "~ 㿘&`d @   `` `Q 㿘 + 4    – > ] 0 t $ t x 0 t   +0 $ t $ t p`P`b x  <`$ xW $ ɒ ' | '  (' '  ''a㿘 >  | `    x`"> >   >   x`"> >   >   t>  >  p 㿐> !!> #\> " ,`Д  ژ "㿘> !(  !(> > >  ؒ`4 @  6> > >  ؒ`(( 6@  #> b "% *` ޑ* @  .`$ b$ * $ $ $ $   $ .`@@$ $ b    @~*> ̖̀ & $̐ $"`("& (㿘 >    > > >  ؒ`P֔!  "  > > >  ؒ`ʔ!O b ?"> G b> "㿘> a(a( ? $ P"@   L> > >  ؒ`!3 @ 2 > > >  ؒ`!46@  @ ?@ږ   ` ? 6 " @ǖ  $@  *  " * ? ""$  ,`&* @<   ? -` b  -` Ԓ b?$ -`*  b   -` Ē bb     > > >  ؒ`.! %@  *` 굕* $  *ꯐ *  @@ $  *꣐  * @ #$  *ꔐ * @  $ " @F  $@2* *  % ?%"$ $ j b ?c b 㿘> !(!( $ "   P> > >  ؒ`(Ɣ!2 L` @ .1> `, @ "   "€ &`0 '> `,   L@  @6 ``*`  €` &`㿘 "  > > >  ؒ``! 1 $`" ( ("`( (? $"& $& (  #>  ,  *` `` ?lbx "`@O   & &j& 㿘`P 28"*`$`$> ` a0"2   , @F@@?@x@* `$`$@@`$` &`L"@Ւ &`P`8 > `8 ?&`8`$ ` (" ? (> > >  ؒ`"~ 2  9> " ".* @ƒ  . $ b* $ $ $ $ $   $ . @@$ $ "Œ a`P   `8 &`8&0R@ 5> `L+` @ *`  "  @ `"`` "`  "   *`"   & `@&`L +` "   @*`$   ?$   ? a(` `$" `?`L@ʕ2 `8&`L ?&`8&`P̀ & $̐ $"`(&& (㿘`P  @h->  -`@ ,`2> "c $S `4 2O `( `(Ho  "`В"  @     @:D  `  `"> @> @C" @>,?$  ("@ H  ?#@>% `@& 㿘> a(a(? > > >  ؒ`#X6 2 > # " " 4 > #8 2 @   &``"&@㿘  b* ~ & ? &   8"`"@㿘  @@- .`,``  8 @&@ $  $ "& $ $  @@ڑ,`` -`  8 ? @@> y#`S,-@,``  8 @$ $  $ "&  $$&  <> I#@ @`8  $$ %8 $ $ "`2@@@@,`㿘 6@:  6   *  -* , @& ! *@"@  @  +`  ?+ "    *`"  ?& ` @ːˀ8> ̐  ? ?????'???? k'Ȧ? ('' ("$ ( $ ' $"`($ $ $'  $' # +  *`  @@ $  `@$    $      & 쀢 $`> > >  ؒ`m$d쀢`"`("@''`"`("@'' " (㿘> a(a(?@  > > >  ؒ`>$y6@  &> C 0* @㿘> !(!(@   > > >  ؒ`$ 6@@   &> " X.` 杕.㿘> !(!(@   > > >  ؒ`$6@ @ @ >  .` @`>  @`"    > " €   .`  > ߐ   "  *`"   $  "㿘> a(a(?@  > > >  ؒ`$6@` @ @ &`>  ؗ.`@ 2"@ >  `` @  *` ?.`# `@ `* "`?#`㿘 &  &     "  ?    0 㿘? &̐0' 2    ?&  2  2   " { ?   ?0?㿐> !#\!> > "В a  賘 > !8`&`"컓:`㿘> "   & && 㿘 7 4  @m .   " ( 4  ?> > > ! a0P ~$ 4$   (Ho  "`09> " €@8D   > !(`p 4 ?> > > ! a0h "`p@ "  > > > ! a0  > > > > ! a0 "ꘒ㿘  @[ & 4( (H "4"4 㿘  @`"- ``" > > " k! @[G  (& Ho  ?"`>  ( €> b€ @9㿘 >`  * @ @ >` 2  2 >  #  &" $& > 㿘`  > H !> !` @; @   `5 > > > "8bHh!R* @ "@ $  " ?" `""`?"""> #鼒 0`.`@"@㿘  @0   &/>  *@`> !(+>  `,  " @Z p?$p  , @鎐c  &   c` /> > !( , @ " @Zk `p?$`p  &   c`f㿘> !( ?  . `6 > Ȁ > > i"x"̒ $`$` "``> > `"> U"  ">  ` $`$` ` ")>   ` @: ! 8  c` $`> 0". ؒ c $`> &#`` ?$`> c@.J!> @p-#>  $`$`$"`("$`(@pd#㿐>   !> !"> > #c0 X   v#\> > #\ `c@ ,  l 㿘@ " 㿘@㿘 ?F? C& !> @o# $`" ( ("`( (? $"& $& (@p#  ,> !(#>  ( >  (Ho  "`"cHS  " € @@@5  2 (Ð㿘` > a(    * : & > (8    +@; 8D ;`  @ `  ` > #Pa(` * : ` qZ  (Ho  "`> " a( : >f` "  43> 0>  4,>  4 + 0 '> " €@7  4  0 > " €a( @g @p@5`#@6a( :F  ( 㿘d@   x /?i@6Δ G> a( @)      @  m  `* `  ,`@ '  @3   (Ho  ?"` (Ho "`  ( >   (Ho  "`& > !( :D'`Ȱ ư    @ 2> > !> !( @ʨ 91> @6> 2 ( @3<  (> @< #7@Ho "`,@  (Ho  "`"# @Ho  "`&@@ @ S>   "  @   `* ` ,`@`2@7R$ (@X!   ( ( ??@W  (Ho  ?"`@40Ho  ?"`>  @&@> a( :DE` 㿘o @Wf 㿘> #@m> #  #@mϐ`@ 0@mz $ @m#`  㿘  @,  &?  + @`"? `*6 ` *`@-@ " &*@`2 ?<  6  , @ 6  @  2  &  㿀> !0'.@  :`  #\'  #`#d ")  #  ϐ@Vɒ (Ho  ?"`>  ( €> b€ @5j㿘 > ֑*bl * ` @`i>C!@d>C!@`^ 1> @?T!( :F 5> #> @lc̀  2  $   >  & Д"x 0 & @lߐ В`@l&   " ^ В @l& 0/@l̐В   @lc̀ >  2   @lАҒ 0 cܐ@* &`&`cc̀`&``"`&`$c@lа " 㿘 ?:&   >    > > > #Вc!#!> @l=#    > & cЖ0"   `"  "` ? "& &   @l^#Аx  㿘  ( 8'L\  ` P@; N  > ֑*bl * ` @    0&@ @ B />  <⨟@   P @> @9 @( > !( :`@ D @ L> L,ŀ2   P @㿘!> @   `8     2   8`@ @9w P@ 㿘> !( `"   > 0 a$@  "@> 0 a$D "D> !(    4   .  ( ! ( Ho  "`А $ `  @> ` @} > p"ܖ 0!  @0.   @j> `$@9  0 @_`$@U\  @O (  ( (Ho  ?"` ( > " €ΐ` @, ԰  ?$Ԁ  2 > > >  `齔!&@T ?&@1)`@  " >  @@3̐`  "  L N" @   =$> a('L'Ha( 'P" .@ `?''''D '<<@Ւ # ` 2> Hu ؖ P`< @ <@  H 'HL H 'HH 2'P8 P<(  <@ <> !(` "`P  (`D<@v ߰ D`1T> * `*  @  > > > >  `"a(  @ 2 8 $@ "2  ?.     'D      L%   T`2P'@ L &% #`, " " ( 2 4 2 0 2 > " €@2h&,`> !(   .  0%@B :` D . > a(`. '@@T X ? > "T  ;$ "8$@ X2$#@ ,'@`%> `4 %(`( !!(@2 > a( > ؒ`"   `H   0b@8> (> !( ``@``@`  @#`P#\` <LX "ڰ ` 0Հ`{@`2y'L> !(X "`  `0%`8B@ 'PP P #\ @ T#`#d PP`P'L L> !( -> ;> `9"8> `( > `!Pؔ#)'L@1 `>  $`8`H   08b@(Ho  ?"`> a(  @'L@&-`</`L ``> 0> 眐!P 4 `a `2 ] Z`    @- 2 <@̖> @6p!<@2 > " €`"`4?"`4" (Ho * "`@1m`2 $(&Ho  "`(Ho  ?"``X>   T> a( $     @-+  2$@ <<@^ph@ > > >  `$ဢ@> Ȓ`$@5!w<@1(Ho  ?"` Lܖ Ȓ# `? $`a( `"  HP` `0> "@8@܀ <@ > a( h p  > > >  `栔$> @5!(<L@/(Ho  ?"`<@0</`L?'L ? P> > >  `i%  `8 @ L  > 0 a$@ {"@ 0  a$"D<#"D@ > a(`  "`'P 0" @8C @P P #\  T#`#dLP ` `> > >  `%BͰ > >  \  Җ <@<  ܐL " < @X  `L`(  @0LL(Ho  ?"`k<`~ > !( "8`2L4 P`    @+ۘ )LL`( L L(Ho  ?"`@/L<@ > !(> `"@4"0%<@09(Ho  ?"`> " €LL`( Lo L(Ho  ?"`L    @, @,'L> j"@C  L 8 @?   @+f DLL<`( 0 @/_LL(Ho  ?"`<@ > a(ph@ > > >  `&+@̰  $> `$@4 "p (a"a@/  > " €LL`( L L(Ho  ?"`L@. > !(a  "a  Lܖ ’# HP`  0> "@8@܀ 1L( ((Ho  ?"`<@ > a( h p  > > >  `䓔&> E @3"<!@-(@(Ho  ?"`> !( (@ (@.(( THo  ?"`< @ 㿘%>    @ 0(  㿘 O@g㿐  > > >  `& 0@ >  4 > > >  `' @U @>  "C%> '> )> > " 3!> ` @:`$ࠖ# '@  > > >   "` $ `8є''$@ H`@S@, "!(@-@!(@@ > 㿘 `"     0 㿘 㿘 $ $ `""       "#>  &   b0F    2   &    @   2 "  $  " *$  `8 ` `( ` 2$ ?`$   $   `$ 㿘 >  a( ؐ $  ]   @  ܐ $ o 㿘  > !,%> @8$ @= $@=$R`㿘> !,@ 8 @  $ 㿘> !,@ 8 @  $㿀> !(@8@ &@"~ $ x5 1> %> $`, "@ ^쀢    &$> 'S `$@ K ''ٱ(>  #`#\ @5˜  > > > #xc⊔ 򀢠?%> `"`'"@""P8 (@ @> > > #xcc  '㿘> !(@ 8 @ $" $ $.@s̐@> `$@ޒ㿘a$&`$@" @ $&`$" &`   @   `֪"\@㿘@ $> `$!$@& $&!$㿘  `0>0  `088  0;8  5> 0(8( (0 >`P> ̒  $ > < 02 J 5 8  4    `8  2 0` > !(  ( 8 @㿐> !(`2> > ᶐ#Ȑ("a@$J@ @@q=@,j?@p #_㿐` ` ?@@  =#@y (> $ > !( @  8      ^+> `$@[  R(@ O( 4`* @ *E D $@8`$$  "!>  & "0    2 &`$@ @ } `$` `  @7   `$㿀>' > "b!> # @*>  #@$#E#'#`&  #\#d ?@ ? c> #c> " $㿈\`@> !,c'  . #`#\#d ?@ ? "@>  &@q  @@ 2 @> ౐ P@ٖ$@@ > ࡐ 㿘> #@  > > >  `!  9@) *5> `( `(Ho  "`> " > (  :@  d( @ː@'( @ :D̐Ȑ㿐%> !> #>    > @)% 5a@'> !(  x>  @ h> > >  `0 !j  > > > >  `X!m!( 0 . '6## @#`#\#d?@?   ` >  $ `0"   ''    (  p6  h"@ @     2 #`\#\`d@2 @@  R A`"`'?"&&@%k (Ho  ?"`` > >  P 8 ("8 @ ( :@ D    > > >  `Z!ā㿘> !,@ 8 @ @  㿐 >   "!>  &   "0   ϒ 2   & > !( @ 8 @  @     @ B 㿀>  @ > > > >  `0!!( > b| 0@ #'.@ '#`x#\#d?@?  > N & @  G  $` `0 "7> 0x @$ (Ho  ?"` > <@> @-!`"8 @ !( :@ D&@  `2x @&&㿘 @  㿘 @㿀>  @ > > > >  `0y"`!, 0c'>  "@ '#`.@ #\#d?@3?  㿀>  @ > > > >  `0R"!, 4@  0.@ "@@  #> b| x 0c''#`#\#d@  >   b|㿘?Ŗ?㿈!> "@_> " > " > !0@:@ ;  $   &$ ` (("` ` *  "`"``  %> > !(?#\$ #`#d#h  ʚ , ` "@ ` > # "``,   " ""$ >U!`rL 㿘>U> > !q H3>   b 5> @^ѐ @b 2 > #  b @   "@^" B` +> )> /> ?`$ !(#\#`#d#h  b ,   $ @^  > "   , @*   # 2 O @^Ðb  `,  `$!( , `@ 0㿈&@    2''> a( #\#`@0[ b >  "> > >  `#B@^b@$M ?'"@&&!> @^0""`  `9>  " ` b  # * > 0 @  > &@Ӑ#@^Gb(Ho  @"`>  P 8㿘> "@] ` `& $  $ > #@^㿐> ">    > ܰ"@%  '> > > >  ` ܓ#(@n !> @]""  * "@$  @]> `$(#@#㿘`@L "` "L$ `2&$` @ $`@" @`$`` &``@@2"`"@&&@$`@` &`@$ $`  $   $ " @א$` $ @2"`"@&N$  " @ 2@$ $` $ L2&$` ` $@`" @`$`` &``@@2"`"@&&`$`@` &`@$ $`  $  $" @$` $ @2"`"@&$$@y `$ @s$```"` "V`" 㿘 2 ` 2'& &` ` &`" @P`&`` &`@@2"`"@&&&`@? &@9$ `    ` "& `` 2)` 2" &   & " @&` $ @2"`"@&$ &@ $ @&`` & &`  2" ` &`" @`&`` &`@@2"`"@&&`&" &` @ &@" @͐`&`` &`@@2"`"@&&&`@ &@$ @   "&  & Y" 2*`  2$ &  &" @&` $ @2"`"@&$&@{ $ @u&@` & &`  2" @ &@" @c`&`` &`@@2"`"@&&&`@R &@L$  " 2@2& 㿘@2`K` F @ "` 2``` $" &2$$@$`"@$@`$``$`` $` ``" &@2"`"@`@$ @" ` 2" @$    0`` $" &2$$@ڐ$ o㿘@  `  ? @ `  2  &` &`&`  &@`6$ $@$ $@  " `  @ ?@   2    `  @ ?@   2  "  20   " " "     2 0   " "  `㿘` @`  42 ` > > > "@bPpb!`$"@@`8`  8㿘Ր&`&```㿘ǐ&`&`   "> >"x` @ܐ㿘` ` @ ΐ ɒ㿐@   > #X`N> H /f * ' > "| l ,!>   ?   > "%>  #> *  ` " `!(@ `?@ .`* " t`0 > c"Ȗ!(P"|  "l"PH 0 $. X $ > !̀`> b@T% >  y  . X!̀`> b@T > #0i 2. X㿘 X  H /f * ' > |l> & a(aP"l?"aPH 0 0> !̀`> c@S >  \0 !̀`> c@S֐ > #0P:@ :` :` :` :`  (:`( 0:`0 8:`8 @:`@ H:`H P:`P㿘`$` &`H㿘>   $!0"  L2  P㿘>   $!0"  L2  P㿐>  d> > "# "`"` "`"`> > "Đ#@"" ""> > "ᜐ#X"`"` "`"`> > "ᰐ#x"" ""> > `"`#"" ""> "> " # dc" " " > b| > "`l##> #l""l`!> !> > c#\#   [ > cȐc0#\ `  R > >  Ԓ `c#\  H c0U㿘 U$ $ `(`&`0@ B >`0&`  P  L㡒`L p`& p`$ `$ #  O"`8  @  (0 `(€㿘b &`$$ `  (`& 0@ B < 0`P `Ld L p & p$ `$ &` "`8  @  (0 `(€㿈` 4 04 d   5  `> !̀`> c@R  > !̀`> c@R  " b      @y `?`   &  &\" G  \  "!>  &   "0   y| 2   & \#d#`@#\@ʘ " > c "c  ? ? > > > > "@bPְ#M $ `0@" v`$@@q @m`(i"`8` `0"@B^@\`8 W`<S`@O`DK`TG`H C`P  ;>  $  > ! > a -"aߡ &> aĐ  "a `"`$@`$$`$ t& t2 $> 0਑6@}"` @ @` @> a "a 2 @ 2g y c @$ $< 0$ $ ( $ 8$ 8  8 $ 8 $ 8 8 $ 8$ <$ @$ D$ T$ H> !0 *@  ޠ $ P$ L$ L$ P p`& p$ `$ $` " t & t2  $> 0਑6@" 2 `$ @:&  2 x   |   >   @  "  p$  > ؄ /" p4 `  ,`  "" @*$@   (  @* "# |  2$"# | 㿘\?@ @uX  ?@" &@@@-^&@ 4@          㿘> !(*c#    @",㿘 $ {>* > , .㿀`'X'HXd  > > > "@bP%@  H> > > "@bP0%H`0 @ 'H`4H@0@`0@ ``@ $'H @  $'H@H`4@ڀ ؐ` @"'`|` :'`|۰ #\ H= 2'`|` '  H`$ `"``$:`$`:  `"* `$ * `(`@ `"*'􀢠H$@ *'H#\H 2s @:I`o`$'H#\`Hݚ "`]1> `'> > '  :b@bP`$%" * '*  $'H#\H + $'H?H@s'H H?@А'HH`4@ ` @"'`|` *۰ '`|H&1#d#`#\㿐   "!>  &   "0|   vP 2   & @  v  @˒ 㿐 0@* 48@8  > !̀`> `@N  !̀`> `@N ǔ  @ |2  & |   @   &  '& ~ $ה $    "@ ( 2  H $> !0ਓ4@ " " H  8``2: |P  `  $ @d, |"& ( 2!>    > > > "@bP &m @d< $>  $`0 $ "  (p"@  8$ ( ?$ 8 @d+ $ |2 p & | p& p  #   " t"& t$ '@` * $&㿘 *#> %> '>  H " Pb@P”&倢  8  @  (  "   ( `" @   2 H㿈> !, 0@  * ' #` #\#dZ `?㿐ؔ `  `$2 `( 2{ `P u + > >  @ t$@ (> h!0      > ^!H  > W!`2 > N!x"(`& | @"& ` ""  &"` p?$& p``& | @2 p`&  p& p"`"`m 㿈> !( @'L `> > > "@bP' `" 0> > > "@bPܔ'0'L 3 Lð  @ '   `'  "!>  &   "0z   tN 2   &  ` &@ ` @ & |  `q  `'  `'耏` `$ 8``     `8 C`  "$@ @'J "6 $ $ $  $"@ $ $ $ $ (`$ (@ "€ 0@B   < 0``8$ 8 @ <$ < @$ @ D$ H$ D P`$ P> a( 4@ L $ L  Ԑ$ L쀥``' T$ T%``$@: Ϡ  " '`  @``2%L      @sl`?`  &  L @ 3 `  2 s `G " '& | ` *'& ' *  &` @a$ ' p?& p  #   \"$  '` @߀`` "   2 sR  sJ ` `2G  L "!>  & "0   rؒ 2 &L@   s      s 7`F `L@ D 㿐 2 0  "!>  &   "0   r 2   &  0@* 48@81 ` @&`$\'`! ` 2 `$2 `( 2 `P 2 `8 2  "`8 "`( @; 0  r 㿐    "!>  &   "0P   r$ 2   &  0@* 48@8Ŕ  ` @  ' @` `8 2\ `@2W `@ "L ` *`8F ϔ `<&`<&`@&`<`< 8`  H`> `H?&`H>  8`<`  ?8` `$ `H 2` 2` `$`  @՘  2 `@" ` *`$ q 㿐4\ 6 W     "!>  &   "0   qq 2   &  0@* 48@8  ` @ ' 􀦀8" D`'@" ` *`$ 2 q  㿐4\ 6 W     "!>  &   "0=   q 2   &  0@* 48@8  ` @ ' 􀦀ؔ" T`'@" ` *`$ 2 q$  㿐  > > > "@bP('**  2 0  "9>  &   "0ז   p 2   &  0@* 48@8L  `2  2 pڐ  E @3   ` $  @ ~`` z` " * H􀦀M H | ` * $`2ذ  2԰ p а  ^ Z H 2  8 2 "  <  ( 2    : @Δ $ H < ` ' H $  @ ` ( ?' H ` $8 H`2  2| p= x  "  * H   &  oے   @  H 2  $ < " 9`oioW 瀊`&   @> &"H?' H " * H` H? ' HÒ 2 H`2# o  瀊`& ܐ o) o%o 瀊`& ͐  㿘  > > > "@bP(ɔ+%`  "!>  &   "0|   oP 2   & `` , @ `H b`@2`H `& o ð `  & 2  , 2 or   @ `< " ``H 2``$` " `@ 2`<> !(  2  H@ @ (   2 oI  @% `<`"``H  `8 2`H `2` `( 2 `H` `$  `H &`H`@2`<   & nʒ  ,@ `H 2 `` `$`<`@"`H"> nWnE 瀊`&   @> "h`< "``H?&`H`@ 2`< ,@" `< " ``H? &`H`@2`< nɐ  瀊`& Ȑ n 㿐   > > > "@bP,m 0@ 48@8 0mϰ   8 $  @`  mԐ   *8  '7> P@ (> > "@Py,# m k>  8`"h $&@"` L/>  "S> @ N "6 4D> A>  4=>  4 <>  0 9a( (@2    /> > @P6,`> > @P-,e" €@Ґ> 4 4 0 > \`? $` >  #> a( 4&@$ $  `@ "`8 2      2 '  [@m㿐& @  @" ` @*  `< 2 `$@ ` 㿘>  Ä#@ 㿘@ @ސ`@[ː @[3 &`& @j $"`$ $ 㿘 $@n 2`  "     "1>  $   "0+   l 2   $  `$ mB  0 4 @ja 2 (  "1>  $   "0   lӒ 2   $  ($ 0@$ 4 m 0  g & $@j]@㿐 ? =&  "  2 p  "!>  &   "0   l 2   &  p  0 4 L    @Z> #&㿘  g @$㿘&   > & x& 0& 4& & | c8& (& ,& p& t& lL&  x" x㿘 x?  & x 0 4ؖ @Zvi$ 㿘 2 "!>  $ "0J   l 2 $ 4 0  (,@'> `8`" ` > r#@ 2`D> l#x "9 4` 2``     : P $ H  (`"  p@ " p€  p ( & p$  ($ #  "l`Ȓ P   (`"  8@ " 8€  8$ H` $ 8 p ( & p$  (`$ " "`P "`H  `H    ӝ `H  `P )x&` "`@`8  `@ " `8`<8 ` `$`8 $`8 @  < $ 8 `@2O`8t& t 2k 㿈 0>  4ƀ# p>  t# x ƀ > `4ƀ `2  ,@.>  P%> `0 `P` `$`(#``L#dƀ#\`8  F T  F T  F T`D#\`H#``T #d`<ƀ`@`@2`0㿘>  ƀ   > ƀ `> ƀ Ѐ`%> ƀ  @ ’? #> 3>  ƀ`@O  ƀa@ i  @B  > ƀ!㿐> ƀ! 8>  (  ,>  0#\ƀ! >  ! 4 ƀ $> ƀ"`r@ (@8@"  "    > ƀ"8# (> ƀ"h (`> ƀ"`@ ^? @   > > ƀ" (ƀ" (@@@)G > [" > V# @  @>  ">  "@> "| `> ƀ#@@ 2 > > ƀ#X0ƀ#xL0ph@0H@44@@4㿘> c@  2> > @!>  <> 2`@:` X 㿐>  ̪ '􀢠53> J5   &     8 8 X " ``" `*`@  "@ 2J5>  @(  .%,` )4 $> 0  *   "P`@(  *  `@" *` @2 $P2X=#` '\#\ @4` ` >k"$*` €>  @ 0> ( !T> !oĘ k> !( X'  ^ \ ` _V S*$ X@ d$ LM > !( \' o @ X `  _8 5*$ \@ d$ P/ > !( `' Q " X \  _ *$ `@ d$ T >  <U -"""" """"" "$"(",> ̀`(> `02 `J`5>kP( a> 2<`: `22``2`0> !( ",   l  "  l "  " "(""" "$\\\t|ôØ N N㿀` ` ``@@' ` 2+@   } 2` ('    2 $ ' $ @  @ `S > ,@ * ' $ 2 $  "#>  $   b0S   h' 2   $  $#`#d#\v 2 $`  `   @> ,@ * '&  $ hE ` `0?"`0`, >`0㿈> !( `''D@ $ ` *  8  ?2 2   b  D   `g>'h *`@` 7> 9> `8 "` > ؐ㨒#!':`$> 㨒#!( `"c  ]  $@8 "((` ?2@> 㨒#Ԕ!9 ` :> !( , 1(,P `,  Ll$  2,> L a(` `0$ B @  2,> a( ٤@'` *`8f`D Gd `` @`@` ` '#@2 ```` ذ> !(  @`8͢@d  " `("` '8>@    d $   '@u?> 20̰  $0T `2 ( 4       @D 4 @ 8   |@8+`  @0, $0ِ0=  42````   w ```|ۖ h @ \  WT     @2$`"$( `0` * b2  (2 ; #\;` 0d$#h#l@Җ  d U '#\;``0 d$#h#l@ ' 0,?`$0?0㿐`@`` `  "`> !, 8 @ @ $ `@ "( 8`"  $ eFp $ "@eW"  `  `:@㿐`@> !,@ 8 C &@  "Q 8 @8@ >@4 @ *D  $   "#>  $   b0   eh 2   $     e    e   Ԓ  㿘`@  `> !,@ 8 @@ "@ `@ "  8 @@  $  㿘@`> !,@ `8 @@ "@ `@ "  8 @8  $r@  㿘@`> !,@ `8 * #@  "$ 8 @>m * €  $@    $@ g    $@ `  㿘`@> a( @ 8  &@  "" 8@a(`` 4`H  #m     $@ ǘ   㿘`@> !,@ 8  &@  " 8@ m     $@    㿘@` mt 2  0 $d   #㿘 $ Ԕ  㿈\` l Ҭ > ( :  а ̐`@ *  &@@@ #@ @@ 2`,#8-`??C B 4 `?@1 ) %`@6Đ!`` |  ?Վ  ` |? ?} `  4 m k 2/ @/ -`  @#\#`#d L`"O  2   "7>  $   0–   c 2   $   > !(`` 6`H   cϐ  @@@   " @@ 0   c  @@"" " " 8> ''(@b@%   2 `*    #\#`#d????????' c 17> '> 3> 1> / 2(8H`hr ]` 8H xj ^@(Ho  ?"`ؒ ؒ  @ g` "`" `"'` @> a(  @ +@ ;` d ; E  @㿘" @ $ 2 `(> > >  8`H  > > >  8`H @ | > !( @ :`D ߒܐ`"2 2< " "<  2"`" `  "`2  ""`"  "" "  2" ""> " 2 ""3 2"` "`  "`2  ""` "  "" "   2" "" "`"" ݘ  2l` 2 "`` "`  ` `@2" "" "``  n"k 2`2"     "2" """ ` ` "` 2 ` "`  ` `@2" ""m  "`` "` ` `@2" "" "`` "   A" 2` 2"     "2" """ `` "`2 ` "` ` `@2" "" "` "2`2"㿘`2` @` = "   2 " "&  2# # " `"` " `"`"``"&`2"` "``" ` 2"     2 ```" "& 2# # ` 㿘@   @   &`&`&` &``6$ $ $@  㿘  @v    㿘 @b    "     2 0   "  "  "     2 0    " "  ` `  4? `$ $     $`$ ?㿘'D'H!> "|" $"|>  ""`>  ""` @>h @>  L`> M!@ ` 5> > ! "@ (` (,@`P,, @ @⩔L 6c(> !   ("*   @ " (> !p@&@ *`(  +@ '  $@+ `` +> ` @ @ "`8@  " @@ @ "`D@  " H@ @ "`L 3 a(@a(  ! a(`@  P&*   # *` @ * @ "@ @ːL((> #  >  * D"">  H+ @=">  P > "| $ P#`$     $ ($ ,$ `$ \$ T#`($ X$ L㿘> a( a("a(a( "> !` "    `* 2`# 㿐> !(#> `T . %> !> @@!# $`T#8  @ $$##@"> "> [!@@,$'> %> @ PK !( 㿘>  L ("* > #>  a(a> "`a> )" ` @x> ` @ 7`  :3  `*& @ `   @ #@  L 2?> "P! L> ` L " " """""   @ 27? @ 1 * &@ ? #@ @ i  L 2?> ʐ"P^! L>  L " " """""M ?䄀z L? C(> "a* >  a(  `   :/*&`@"#" L 2?> "P! L>  L " " """"" ?䄀ˆ 㿘      㿘> !(`> H"x > "A*> > <" L > ">  #(  > #`0  > ! `2 L `@ "L`?`U &@> $, @*`    (> #> #0  . `-)> `("8"@"D"H"L( 3  ` Ho (""` "0> ϐ#(`P ٖP`2L&*` * @@&L )> L (! !   `@:("L* ! + " * ? ?""  "$"(","0"4#@#`#``#`  #`, * @?#`#`L#` $L㿈!>  L>    L $> ! 1>   @ ;`    X#\`L  `> ϐ > ̐ 㿘@@㿘>  A&  & ' A& (`# ( (  `> > >  В`  Ho  "`  (` "`Ho "`㿈  > > > >  В`ה#;> !(8  :  @ @  > (> > >  В`#<!4> (<   :`  ` ;  ;`2 @  @d4I> 2a( D> a(  @ 4   :` ` ;  ;`2 @  @d4)  & a( D:  ( b;`  82 `@   @ D4>   > N"   a( ?2 a(,@4(d (@ > 0 > b> )" T   ''#\#`     @  @  >   > > >  В`#` (""  (> > >  В`8#cHo  I"`  (Ho  ?"`㿘 `'` (  `> > >  В` є c (Ho  ?"` ?" ,& `& ,`' ,>  ( & ,` & > > >  В` ` (Ho  "` ` "`㿘 ("  4> > >  В`8# ;` (Ho  ?"` ( ( 2  > > >  В` b  Ho  ?"` `?" ,& `& ,0 (  Ho * "` "& `"  (> > >  В`X##@&#> `"  "`> "" ?"&& Ho * "`> a( ?" (@- @ `2   >  ""`"  "`> "" ?"&& Ho * "`a(`?"` 0 a(& 0` ?"`   "& Ho * "`Ho * "`ay (H * "@ a(``$ >  P> "b㿘 M> !(, C?"B (  c ( * ( `> " € (@ @ ِɐ!Ho  ?"`= Ho  ?"`,> L  > `28@*  (@ 2` #  "@ 282?㿐> a0Ց6?* > "@*`+   *  H ?0a('> " > ?"""(H@("@> ( " (-  2 >  " > ?"""(H@("@( (  0"0`0#"`0> "@"| "`  " > (`( H "> ( 㿘 (@'`"  "`> "" ?"&&  (Ho * "`> a(`?"` (@L 0   > > >  В`p%[@"> > &"&" &  ""  (Ho  "`> a(`> ( "` (  (>  T@ Ho  ?"`(.  2 >  " > ?"""(H@("@> ( 03( (>  > "| ?"""H "> (>  "b|"" 㿘 (H` "> cȟ€㿘`(H #> П㿘> 0  82 > > > >  В`4%*a" * `@㿘> @!> !|@6E > """"` >  X, @@` @ , 㿘 "  > > > !a " > > > > !a `$g&㿘> @6!|#> a .?#>> `0"|  "!  aȐ a ` < @ 4   :@ "   :@ 2 > a|  Ǡa*@$ @6|. @6| 㿘> a  > '> a @8 @: 2 > > > !a} װ&6   > > > !a q @5| :@ 2  > > > !a@b **@$ Q  $@5|> `$㿘  > !( @.@ @  > > > !a`2! @ `1 /%> '> +> /> -> @``ᨖx!`( > ᨖ!`8 b@ 0  @E:c (@ڴ㿘> !0> .@  @E' P㿈'X X` @$ > 4 ??耢4 ?> 쀢(?>  (@@3b :  2  @ ( & &(@@b*`&   & `(  <` B s`( }`(@2/`( v`2*`( ` `(>  T@ Ho  ?"``(Ho  "``( I`(Ho  "` `(Ho  "`> " €`2?&* & &D` 4 ``耢4}`m`㿈'XX`` ;`#\`  &'@ &   `@1  2 N L `E@B 0> `9@6! `  `(@> ` " !0@`  `“  ``@`@`  '@&@j㿘 o)> !(  @b ` 2@ (!"@  " " @`@   S @`( "@M @( (Ho  ?"`> " €@@6`)Ho  ?"` >  (€@> `€@@(Ho  "``㿘> !̀`> b@- > & !> @3&"& > "  & $ "@" ?@3]"ā㿘> !0@: * 2  2  8* :@ : #@  `> > > !aؔ#9> !̀`> b@-J  0(  4"  0 2  @ > !( H,@@@,``@$  H (@ @y @r /> 3> ` ( @@ "  > ᘒa#X(Ho  "`?`"  (`@"> ᘒaf#i`( @2> ) '>  (€ > `€(Ho  "`(Ho  ?"``@ > ( 0  > ( "> (U> (!@㿐> ">    > > > !a( #  > > > !a0#㿘> >b| 0  <@ > #@> c`: @2 ސ 8> !8 "㿘> !(` @ `: @ $`< `, @$`<$`<`< @, $`@ $`@` @ $`H㿘> 0 > "bH > !( ͤ+> > (3> /> (b @1ʐ "c`    $  @Ő@ $D`$D4: @@   c:  :2 `   ` $4@ : (D@   b ;`  ; 2 `   @ @  1T?@@1lb!(,@ .@1b0㿘> 0 > b|`H"`D+> 1> /> @1P( b%> ` p `0 "b" %b@1?ؐ!( &  0@"   8: "@$ H /* d %  @H 0@1┒!(`,4`> "@1J0p> !( @:@ .6 :@ 2 * *`#2`p`'D2`'*`# p'  '   % > (4> (  ȑ;`@ b (2 `8   (@" *`  `  ' $(a >  $a bȐ€ " (a, $a,@ 2   7` ` > > > #co!2 ( 4  ?> > > #ca!ǔ ($ 4Ho  "` ( (a0 "a0a$  "a$a0 y$a0a( $a( ( ! (`p "`p> " €(a` _"a` 2[%@> > > #c!(@ * @4Lhp@   > > > #c"  @ ("`5( h l@ $  (> > > #c("3 @ 2 ("  (   " (@˒  "  (@"  (( @G  O  ( @@  (Ho  "`> " €(` "`A (`" ``  @ %`@ !.`( @:@ '@  2 Ho  ?"`.``& %`( @ g`  @&''@  "@@O(6' '(4 $4   ;`   #\<  ` 8 `$8m$ (@fDgd`2 (> 7 P  ( (Ho  ?"` (  (`2 %@> > > #c#:$ > " €m' ` `> >  (@ >  (€> `€Ho  "`   (@D     㿘> (!4> > ( Ȩ a( a ; `  "a2 8` `!( @" 6!! ˹$!!  ! d > "`> " !(!(a 2 `d > "!( @@ D"" lh@ > p > "# > "|  2   2, (   `> > > #cM#2 ( 4  ?> > > #c?# ($ 4Ho  "` (`2O=@" (   " (@   (" Ho  ?"` (@!( @|    `@  (Ho  ?"`` > " €!(a< "a< `4x (4u (㿐 `> > >  `Ȕ X?" > > >  ` Y  > >  > > >  `  Z > 1 !(` > !X7(@@o`` . 2 6 6 6 2( \#\7 #`@ Җ㿘@  (@ `"2 2< " "<  2"`" `  "`2  ""`"  "" "  2" ""> " 2 ""3 2"` "`  "`2  ""` "  "" "   2" "" "`"" ݘ  2l` 2 "`` "`  ` `@2" "" "``  n"k 2`2"     "2" """ ` ` "` 2 ` "`  ` `@2" ""m  "`` "` ` `@2" "" "`` "   A" 2` 2"     "2" """ `` "`2 ` "` ` `@2" "" "` "2`2"㿘`2` @` = "   2 " "&  2# # " `"` " `"`"``"&`2"` "``" ` 2"     2 ```" "& 2# # ` 㿘@   @   &`&`&` &``6$ $ $@  㿘  @    㿘 @u    "     2 0   "  "  "     2 0    " "  ` `"2 2< " "<  2"`" `  "`2  ""`"  "" "  2" ""> " 2 ""3 2"` "`  "`2  ""` "  "" "   2" "" "`"" ݘ  2l` 2 "`` "`  ` `@2" "" "``  n"k 2`2"     "2" """ ` ` "` 2 ` "`  ` `@2" ""m  "`` "` ` `@2" "" "`` "   A" 2` 2"     "2" """ `` "`2 ` "` ` `@2" "" "` "2`2"㿘`2` @` = "   2 " "&  2# # " `"` " `"`"``"&`2"` "``" ` 2"     2 ```" "& 2# # ` 㿘@   @>   &`&`&` &``6$ $ $@  㿘  @    㿘 @    "     2 0   "  "  "     2 0    " "  ` `<"@2 <42<48"8@"< @8 2"@`4"8`4 << "`<<42 8 4""`4"<  "@"@48"48 << <<42"8"4"> 8" 4@24 @"@"@3 2"@`8"4`8 << "`<<42 8 4""`8"<  "@"@84"84 << <<42"8"4" 4"<`<"@"< @ݘ  2l@`8@24 @"`@`84"`84 <`< <`<4@2"8"4" 4"`<`84@ 88n@"k @@2`@2"@ @48 48 << "<<42"8"4""8 <`8`@ @"`@82 @`84"`84 <`< <`<4@2"8"4"m 4 @"`@`48"`48 <`< <`<4@2"8"4" 8"`<`44@8" @@ @ A<"8@2`@82"@ @84 84 << "<<42"8"4""4 <`4`@ @"`@42 @`48"`48 <`< <`<4@2"8"4" 8"`< "@2`42"@㿘`42`8@`8 =4 "8 4 28<@"< "& 4 2# 8# 4<" `4"4`8"8`<"<`@"@`<`"&`42"`8"`4`4" <`8 2" <   < 2 <``<`@"< "& 42# 8# 4` 㿘@   @  4 8&`@&`<&`8 &`4`6$ 8$ 4$@  㿘  @  4 8 㿘 @l  4 8 8"  < 4 4 42 40 4  <" <8" < 4"  < 8 8 82 80 8  <" <4" < `48  *`  * ` @ ?㿘 $`$ ?   8`8 @ ?㿘?쀢  @ ? ?㿘` > > > !a!`..  .   "  ?쀢* ? 㿘 `2 `<> > > !a!  @ . @? `P  ?㿘 > > > !ao!5 &j &C& > !0 8 <2@ `8@ 2 @2&* * 2 &ߐ ܐ"& > !0`8`<2@  8@ 2 @2&* * @ 2 &2&㿘7 (& (㿘`< *@`*`"``" `?@"&@&` `P㿘ߒӒ㿐$p`"ː`< <@ &`<" <`" `<< "< &`<: (`$ (㿘V`<  *`*`&@ &` ""  `P㿘㿘 > !0  82   > !( % ! P``8`2 ` 822@`@ "㿘@`2 > > > > !a["@ !(`8 @Ƒ2@)! 2  8@  88 8" `8"@ : @28 8(`8 " 6 @ ? # %`"@&& 2$`<Y `( `882@ 2 < 8&㿘> !(`8`<2  &$@ǒ , , * @82@@, "<" " "@' P82 *"< &`<` &**` @ * & < x'H'D`'L'P ''XH  > P` 'X ?> XD > @  X> > > !a(p"D X\ '\XDD 2XD '''D\  2' ' '' GX`?' ' '''*  @  '\ @ '>   @#PbDXP`> "\DH@jLD> @> "`( H`L @:~, :w,-`. T'> !( HH䀢` 8 2 H@ * X Pj%P 8*  <3  @% @ 8L 8 D$" 8@ $D W'䀢 Ƣ '``-`" ܀ 2`2 ,, ", $$@`,2y(`@ \   ' '\   @`  @ \     @` > @"b > W#%> > sB"W > !( > "@@"$ @ J'@!88 (Ho  "` (a\ $?$ $\ (!"   $  `$ (Ho  "`" "`, ",@ ' 㿘 G5> > !(-@ ('> )> +>  8 2@2@ "ᐒ!c۔$E q#X> ᐒ!xʔ$MHo "`Ho  >"` Ġ P@!ϐ`")> > !(%> '> )>  8`@2@ 2 8᠖#$V` 2 "8& < ݔ `, @* $`@> rq!8@!㿘 6->  '> )>  (@> #X ( (᠖#_$tHo "` (Ho  >"` 2 (@!d > > !(  ̖  @$   > r!8@!㿘  / ?2 , 2  0&`, `,&`0 "@$ `,&`0&`, 0"& 0 㿘> @!%"@o #   > > > !a %@!S@@! @T >   > v 8@!A0%` %`  $%`$`(  > > > !aXŔ%9ƒ? /> 3> > !(`82@@  r  `8 2  `  > !0 82@ @ > > > !ap%CK> !( 8 <2 B > > > !a|%L 8 <2@@  $> > > !aj%S > > > !a_%T $ <,@*` "`< ` P `% b@ 㿘> !( `  8  6 @ 6@ (&> @ J"> "? / > "? `  `" ,  ,`>  0"`0 0$ 0 ,"@$ 0$ , $   $ $"@  Ғ ـ @ X"&@ > > > !a%㿘> "` Dj D <   > > > !aȔ%@~ޒ D&   "@" "  `㿘> """$ > ""$`> a0?2  $` ?~> ݒa@    ` 2>  ( 48㿘> !(  82  o H  a( 8 82@ <2 @ @  㿘 > a0 8 <2    > !0`82@ @?> !(2    8 <2     82 連  sn>  !("e ` `8``<2   "`8`2 *>  !(F  8`<2   " 8`2 * )> !(%> '> )> `8`2  `8``<2  ᠖!&cM q 㿘> "ǰ Ā    "(:,( > !(, ` `8 2  :@  ``8 2@@:@``, ` "tD T`<`8 2  M".`<"* @*`$`<@ "`< `8 `<2   > > > !a3&Ē> '`< ?$`<* @*` $@ `<* @*`@ " `<*` * @&`<*` * @&`<*` * @" `<  "`<`8 2  8`<`< 20ΐ" `,,@㿐> x!> b @ 5> 1> 3>      C  ? "% <%? "  <t 2 <     $E (,`@@"``,`9b0 , 2ɮ> "@1㿘>  d #>     bP!  2 㿐> "`!> !(> !(   "x >  "    \>  P"#\ T X L ` 0>  4#0 8 <>  @#X D H >  #  !L!P>  #   >   >  ̐ 0 П  >  ܐ `    >      > ! !!! > !(!$> !!H!! !(!<> !0!!!,!4> !8! t d>  x! |  h>  l"  p> "P> > "h㿐> ""> > ##` "> b9  "> > ">  "#\ \ u > "b> ܐ"> > " b#\   T > > "ܚb#\   J @ w㿘> "Ԁ` ``> !($ 2$D  :2`*  @y_*` @ $D2$` `2`㿘`:  \ 9C* `>`.`@&$*` \9: &$㿈#> @b%> (  ,"    @Րb 2@ ''s(>   #`#\  `* $( ?  ("Ho  "`` "`' "@" "@ߖ 㿘 ,  ⓠ ,  $("@ ;  $* @(@ $* @(@ ("@   ( ": 䀅( *@ @  㿘> "Ԁ1@(> !(d "dD` :2`*   @x*` `2`*` *d@   "d@ d ?dD@2d 2㿘> "Ԗ #>   4 "$ $  $  $   "` " $ ԔԀ $ Ԑ "`"$ : \&  &$D &$H 2 $ "$D$ a(`d "`d> Ԁ-> "$ ?a($@2$D`$D $H" H$H $D" D"$D"$H`d #`d 2$@ 2 㿘> "Ԁ?@ "$  "@""  9 \ 2㿀> bؔ #`#d#\   u "> "&$,&$(> Ԁ```"` $(&$D$, $D 2$(` `2` @> "> ` h'< @  > ! &6> "Ԩ -`$`!> !($  :@w`* 2`  $ x$ `$r$ ܨ $Dd` 2&ΰ EN ` > "4 7\  @ ( > #$* "@> #$ $   D'''''/ @ ~   ( 0 2 `4 "`|~ >  z"` \ 6 Ւ    d0O`Ò \  \ 6$ \ 6ݔ  $ $$@`4``| ?$`4  D@$$|U \  6$$$$$ "> #8@4 # `4 2$D$|$8k \8h \0s 2     @7X; h > t#P(> d@ b4 @`` Q 4  2Ȱ 4  > Փ* t"@*` `" @ ?+ ``Q 4P + 3`    0 24P>  8c0&dL0   &dPdX  > <  2* &`!(  @v(* 4  ?   > s `pd4 "`p>  ` #\ ? \  ` &d0   "4> D#p48> (#`P02  @v  :`(`3`+ @+` 8;@ < `@uْ  &d0> #Ö  "> > ##ؤ$> #6,>  x`eԐ`( ? &`&d`h  "`h4``PԒ 㿘`d( d,&`[   d(d, "d  d$@4  "d@` 2&` 4`Cd|6md@> d@"4   `P > !( h d" " h0d@ >  [ > bؖ d(;d,d07 \㿘 > 2* a( @u@*   u 2d( 0 (& 4& 0H /d * % H 002$ @t< d@* 2` 4 ">  8X H /d * % d@=<> H 0R0@㿀H /d * % > "  H 0 %%% %%>`<4,  ,  `H `&`@$L$@: '@t   Qt䔒  耢? ?>  X"$LH /d * % %< @t `֒"@4H /d * % > " H 0`0 @=  $ 0$ <$ 8$ 4$ H$ p= @ B < `,>!P c!$ ,$ $ $ $ ` > $ $ `<`""@$ `<`""@@8$ ` 2`<$ $ `""@$ `<`""@@8$  $ $ @H /d4* % !   %  `0&`4(&`0> " uH 0㿘   & ! &$T0@`p "`pPِ $T$P@6  K$X 2$T  ?& 㿘>Ș  \ p 㿘  H /d * %  < @`@" "@$`@ ?$  4 2$  > ;> "  "`@`0($`0 $`4  2'T 2#T> " T 2T "  > > >  `% 2 T> " Tx$TH 0㿀> !`$^ > "Ԁ`Q``H> !(  ">$D$ $ 48$D$0   #`#d #\  2)$D$D@$H$`"dH$H@$D$`"dD?$$H$$D`$$H`@2`$`"$D$`$  $$  l % l$( ` `2``` & 㿘 d$"d$㿘?c > !( d` `> > >  `&2 d > > >  `&6 d(> > >  `&d0&   > !{d > "$d  l"@ ($ l  ϒ "d($: * @d*` `*` 2@  㿘@?@+ 㿘> !( t'D` $ t> > >  `H&2 p ?$ pD @    p $ px> a(`@: * 2  2 * 'H#'P`<6''D6@q' 2`  *  @? `2 ' '쀣`'ܔD '  >  x` '> ` ܀` 4H ܀ '> ᜔ D*@`8@  @( '쀢`耢   ǰ ߿  '֒  d쀢a 䀥N> !( 3> ܀`(H$(" : * @$*`   2  U `| &`|  4 `@. `. :  :@ E> (J-@(Ho  "``.@ߦD'   'H /d4* %耢   > 0>     > (M@H 0`2 '쀢$܀`"@  H$(" :`*` $* 2$(":* $*  ` @HN PP' 'PP   `> !P! $`0$`,$`쀢$`H$`H$`p<`$`H /d * % > #$`9xH 0> (` .$`8%$`<$``> .`$`ܐHޔH /d * % > cp "pH 0耣`> >b 0 `0 2`@ @@> $$`0$`M耢  N ݐ`0 2` M ``0(2J쀢`䀦: > !( >  H $($: * @$*` ` ѐ - @ 쀣`- `-:  : D @ͨ쀢 zw 쀢`AH /d4`* %`  8  > (` "@7> (@BH 0㿐> !> Ր!`0F/r  \> ̐!x0= /$  \/  $ $$@ j$  \ /$$ $$> $! ">> ! 0`F  0$@$1 \1~ \0` Lk㿐`*  >    -0 -03> `x'VƘ    &`x |>  Vא㿘@@ > ` "`㿈> `  "`@s > 8 8''7` ''!/#耧`@ &` &`# &` !& ` 㿈>  `> ~!@8 > 8 87`''''#  耧`"@&`&`c&`  & ` @&&&& 㿘>  t@ `> #``> #  $ t#  $ t㿘!>  t > #@!$ t㿀> !(  $@ @ .@ @ /&@   0  ( 2a( $"a(   *  * @ +'@ &@ ##`#\#d ?? > &@ !  &@ 2  @"@ " 2 "@$  㿘 $@ > !0>* "@@"@  02@ 0 @ni>`2$@ ($p`$   (  , n> !( 8 " <> " 2 ( a @2Y  (`> @#܀@"P  =#I $>@ 8     * "* * 5 *` #* @#@ aH ''' #\#`#d#h#lL:    D#`#\#d#h#lL&    D&  2 8㿀 $`,`Q> #=> c!(' <'' 8 " <> " 2 ( ! @25  ( " "-  ' $' $$'> 8'` `* #* *'쀢@  'ƀ "  `2' 㿘 > ̐"0 > !,@ 8 @  㿘> "!> > !2@bP(   !>  & ""X_Y     4 2  |> t*`" * `"  " 4 `- ` s&  "o>  &  "`$"& $ "a&  `%&  |> ct*" * ` @> 0 `h@  `  @  ( B@m-  > 0 `HN " " >   "& a& " `^   & > `& >  &  "`$"& $ "& -; ` " 㿘 ? X&  8  ?` & 8    @ -0G`&     @   ` & ` !>  &  ""h^  `     #""  `" $ $"`$ $? "& & $  "  > > > "xb! & `-^㿘  A  ?&  `H&     @6  `" !>   &  ""h^A  `2    & > ~""&  `" $ $"`$ $? "& & $&  `Np> !(@: * '2  2 * #p''䀏`  8   ; ;`` @ C  8   ;`; ` @ C E @ @  @ 2@     `0@ `#> > > "xb"ْ `(Ho  ?"`> a( :DP' D``(` ` ? ` <` 9' ` @> " €`( `(>  T@ Ho  ?"``(Ho  "``(2 ` ``@`(``(@> `0 a(> " €,> `> `( `(Ho  "`> "]' > a( : Ƥd> " €ʐ> Ho  "`> "€ ` `(Ho  "`;`2`'#\'`   `"`> (#(`Ho  ?"``j>  f> . @ X ,` (  (^ߐ (Ho  ?"` (Ho  "```>  @``(@%`0 2!€ b`   `> ` F#h> C# € > a( :D䀢 ` `!>  %``"#\? ```!"`^h`` >%`㿘> @4 >  @> m#@  > B?(8 : :` @ B   @   (  8 ;  @ 8C  @ ?㿘@ 㿐d @@    2 ?#% '( " ( >  Ho  "``&> ( @ :D Ҷ'      @ >  ()%> ( (Ho  "`"([} @Ho  "`&@@ Զ ' Ѵ '> ژ @@ 9>   @@ `( ]s (Ho  ?"`0"(Ho  ?"`>  €&@> ( @ :D s` p  @ ` 7> %" !&  0Z  ` 4 2   @? ٔ 2 2   & ɒ> !( 'г. @ D 4      &@ >? 0''''''   @'`H!`<  `D  `D   @ `> 0  E;`耦`&@`( (Ē@ (   . "@2 ֬  ?`&  \ `  㿘   "   `& ( !> &  0 D  G`  㿘   4  2>  ( >    > 㿘!> ,!> a" "a> !`#  "``P2` ` 2` `  (k`  $` !! $`(`("`$` `〦 `$ ?   ǚ 1` ``"` ``$"`$`$` "$`$$` ` =$` `(` ,Tጁ㿘> "!> } 㿘" ' 2 D > H  0> c?>>>`0⌘!% $ l4 \$!$!$!, h$!! $!$ D x H /f * ' > `$"""b$""H 0  㿘H /f * ' "`""""b"?""$"$"H 0 7"x ""|) "| $"x) $"|(  㿈H /f  !T #'!€ '* ' !܀ !! 2!!  '  &!&!"`!?&!H 0􀢠 \ $ "x`"|  ` @ H "( D`#? @2"x `   0  @m  @<ᱠ / @  D "G "x         `  (  ` )  a      !    " "# "" Dv`""` " `"` `B "x>    0    К 04#\    @Pњ 0,C0)㿘'H \ "x` H"| "H ` @"`H* 2p`? @6`"x    H0 @ʔH  @H /`SH@ NH /f4!* '!   !Ȑ!H !!@H 7`" !`H&!"`!H &!&! ``! &! HH 0`   @ :`C K> H 0` `B > 㿘 !F@] % a2@a1@La@"a a@ a@"aI@")"x a@" 0H@"B"| !J@. !F@( |G@""xu 0H!G@ ""x!H@"g"h @0!K@"2"x_ [2Y /X !F@, !F@  K  !J@D  `    " @1 / @  2+  `  " # /     !F@"   !F@> >   /> !`"d"x@"]bb| "YbbxT ` @2Qb 2Lb  `@2Gb @@2Bb @ 2 bx@ @ ۤ 1      `b| `Τ 1 ` 2$b  2 b 2b  2b  2bb|` 2b` 2 b` 2b`  1b`@"x " @&z @ $  {"| &"x&k  $  {֒&"|H /f * '  \`@6 \H 0n ""|&D &"x"| "e&= `&"| \0!G@0H!G@S 1  4L ."| D0!H@0H!H@; 1  44 `". 1"| ) @ {r"| @{j#@8 & l 8 " 2 &"& 1㿘'D @  D@Ŕ   @   @ ^  D {1 f  > `P ѐ 3͐ 㿘`2> +  .@     `.@ `.@㿘` >  "@  @      .    㿐`2>  Д2`/@* * @&@㿐`2@> Ԑ 22` //    * *@ & H> "x "|b@': 8  4 0!(!@@ (! 0> !@! "Ȑ@e"(@e  //<'// `''7```!` ) /` %@⼖ a `!Ⳗ   4 "@ 2"  &(Đ  > `!h㿐 'L'T'P'X@'H ?Đ*@I6 > !`. bx "'bb|`"#b  2b ` 2b!b! (2b`\ "bbx  2 bb|   "b`2bx& @& (B>  8B > k0HH"|> "x" '64  0 ,Ȑ@dՒ"(@dђ  // <'c `' ' /'/' ''''7```!`:# /` & a `!   d    b > _!x㿐 ` , C'> ! (`"x"!""|`""  2" ` 2" \  @  2 ""|  @  "" 2"x`!"`` B<```;@C<`@ܯ0n!㿐 @>   `   t  > 2  , 2  0 2  4 2  8 2    `  `` `|`` `` ` /@ "`u &`  `` 2 ``?#@"g 1` 2`  2)"(,` 26`` 2 6`` 26`` ",`6`&` @ } "A 1 " ,` ,`8 1,`2  #/D 2+> a4 #\d " ` @R  2` 0`& ,` & 0`& 4`& 8`2 6 >@  , 0f 㿐`@ ``   `  `2`l `l > > "b  . q #"X> > " b*`, 2 2` 1 7> ÿ$4@7>  $@?* 2`@4@5 :` 4@` @ `| #\ᤔ `,d/ ߐ16`>2 1@7> Ï4@7>  @ * 2`@ 4@5 (` 4@` @ `L #\ᤔ `,c ߐ6`>eu `` > `"`''?'` "` / " 1` 2 ,` 2  ,`?#@2 , 1 2 @ 0 2 @ 4?#@" @'`'`'` '`'`'`'@A "&`{  ,    H@&Ƞ 2  HȀ lȐ 1'hȀ`" `4 "`<'@ . w ,` ` 0   4 2 > 8  >  cu#\ " ,? 0 2!` 0 2` 4 2` 8 2` > 2 > 0  & , & 0 & 4 & 8`> & ` ?& `& $` p& (! `6 < & p@1 p?*  & pd  > ]X!p> `" '` ` > ` "` 2 `` 2`` 2`ϰ `  `?#@> n! > ''' '''"x"x`'`''`` '`'`''Ԁ `> > !!`  `'`'''` > > " .6l!v`!/ , / 0 / 4 / 8 / H " /  4  / X`@  L/   `@ ?p*@ ,@͔  4`@Ɣ  23@ "/4 `> 2'؀ ,܀  , ,䀢 ,@  26`< 2  2l> " > \`!؁㿘`  @a&`  , ,`>4 `,`,$ `0 $ `4 $ `8@$ 㿘`  @`&`  , ,`<4 ``$ `  $ `$ $ `(@$ > "''d@` @`ܒ > > !!hh` ` '` h' ' D//'''''/@`/@$' 'l'p't du   > > " ` "@ `0> b ݘ dd  @@ ` ?"` ` d &` "`@d+  d`8 4  "`8Ed`8?"`8 > ["㿘    4  < \` i   8?$ 8㿘>     0 @  2 ``$ `  4  < \`8?"88 ` "@     "     : 2   8   ?2?  * +   >  b0 @ !k '@0!j@@;ȒS0l@20 !L@ ",0aU@"aV@!N@W @0HaP@ aO@aM@ ai0J!J@ 1!K@  ai  @a@ag@ ad@ af@  !0!e@ > c i -!@ " !@ 0Ha"0!@0H a" "T @M@a!@. H! @ - a@'aF@!@ !8 ! !aI@ aG@a%@ aM@  aT@aO@   %  "0H? ?  `"XX@" 2 `"X@ "@ 00Ha"@a!@= Ha@   !@'a @0HNa%a@אa@0HEa%aI@"" a%@0H:a%aQ@aR@0H1a%  1?   / #0H  0H 1   > ## @   > ## @  0Ha%@"N | H!@.0 !@0ra!@a"@'0jaR@" aI@>aQ@W0]aS@9aT@C0U (& ,& 0& 4& 8&  <&$ @R&(\ O  `& d& h& l& p&  t&$ x?&(& & & & &  &$ 1&( .&,@^8 Hr "  @^,!Hr!  & & & &   #" @ &&  #"  $ ' ' ' ' > c ' '  > c ' ' d lװ H /` * ! @ҒH 0 b@ @]Ē `P ' `/ ''' '$'('P'T'X'\ ''Ė ? @"  d 2 * t* p@'?@s ', @sc, rb, 2  > c@} g  ,' ,`\ "`\@uJ$@]f `  '0F `  2/ ('< ,D'@ 0 'D 4 'H 8'L <'P @'T 'X '\ '` 'd ? @" @rĐ    \? & \ @ "$@st$<Ԓ    -ᔀ b > XF#px> '' > !̀` > c@Z  '`"  \ "  ``-  2 / ` "`H / 2 `  `   H@ `P 4  \   \`, `0'p`4't`8'x`<'|`@'`D''q 2`-x 2`-y 2`-z`" X X@"`-b 7z`- `h \   `> #d`> c|Ґ N  > #d`> c|ǐ C `h`` 8= > #d` !>  (@`| 2D`H) 2@`H Ȓ    7&Ĕ( .) .(> #&&& \  `&&> |&` & `` 2`"`"`&(`&,`&0`&4` &8`$&<`(M&@`H (q|  > #d` !>  X@0|T  '`H&|`L&`P&`T&`X&`\&``&q 22`hxh@[  "+`h  c  > #d`!>  @X0|# p ?&p&`t&dx&h|&l&p&t&x`h&`l&`p&`t&> c &&> c &&@X d'`d&`d`> #&& ? &@   &U V \@7@[ `$< X 'c 7'/  7//'@k 2> #d`0!>  @ܒ 0{ 0%8D "Đ"`&Ġ"@[W > "8"8`` '`'' '/@[G/> "/А"' /   X''7''   `@{    8 ?$ 8 2 8(@[ D(!'@'X'0','4   Ә ' ِ؀ ?$ 8ؔܢ @ > Ā "Đ"`&"> "(> b@@ < &ܐ@Ӓ 2> #d`!>  @Kܒ { 02 "Đ"`&"@Z > " " '    X//7''''   `@    8 А?$ 8 2 8@Z D(!'''''   L B' R܀ ?$ 8ܐ@g 2> #d`,!>  @ߐܒ 0z 0! "Đ"`&""@Ɛ `d @h|  ܀@L@  > Uv!8㿘 @h   `    "  @ 0> aH z_`00 ?& ѐ Ā ? `"`"""@  Ā`2 Đ@㿘H o *@ g };> `@2 `"` 2  > `& {Z!` "`@ڐ` @"` ``2 `\> aА z0 א0?"`\`&` &`@q` ?&` H 0p> "'2 > y"!@ "!@"/ -0!@2* - @" 2!  2  `  2  @  " 8   !@ \!@"  -0!@P - @ @g " 1@ڤ ` Ԣ ` xܰ  x@Y8 xn n' '  n ' ' /@c *@' a@Y   @$0@O Аmߔ А Ԕ '  ''@K'܀ 2  !@  @(  m  `m Т @  '   ''@'쀢   ` 2۠0F 1!@ ((m\ ` `m|@X!v & *&@X xmh  ((md\  , `m[`, @Xr |mQ| H'da" > S"0㿘  H /f * ' ``@ "`  "``2@$a `h a a   H 00*H 0`p`&`$ `a     ` &`> $&`T`\ @@c㿘   ,>  "   2  !>  J  `   ?"`   $ &  & " $ & `2 0.!     2  > w"H   `  & ?"` &  & " $ & `2 >  2 ` "` @"  "@ " "`2"`" 2㿘> ! ` `@`2` 6  "` "`! ! "@! " $! "`㿘> !  ? 2 @ `"  "` "@$$  60 2 p> b'H /` * ! &`` @ "`  2`` `   @i  2  ,  &  6  2 @H 0% 7 & `& `& ` & & & `   "   2  2& A 6H 0 1&T  `$  & " $  & А@V a `  @`/`/`''''  0 a1@& `"  "` ?"&&  6 ?$ H 0  @OJH 0" > Q"pp> b'H /`   v %А* !  ? 2& @OO`"  "` ?"&&  `` ݐ?"` А@V6      / /  ''''!a2 6H 0 > QP"㿘  6   7 &֔ &k 6 㿘 "^ 6  ?? " 2  2  2 㿘  `"  ` 2 `@&  2  , "$2 @02`42`82 ` <2 2 > > (@ *` > @ "ܚȘ   :  2 23 *@(2  0 2  0*@`*@` *@`*@` 0 @*@ ` @*@ `0 @*@ ` @ *@`*@`$ŀ  ܆c(* *㿘      0%>    "    0 0  !@t  2   ``   㿘̐    X    @ `  (0  㿘> bu   : . "@*     @ "@: :   㿈> "'        ///////` /> bȔtܐ "@T ``: * @ &@ . `@ &.  ?. " > O"㿘= ? > u#0>  `/> ^Z2|`` "x` ` n?` h2f 2c  S#@6O 6U  > ! `"N  "J   "8 "<  2* #@ "!+  4&  4  $ 42 `  0  2``| 2  `B &: ,),*h B;   h `B ;   `B ;㿐@g   ' `2   @aȒ  2 \2  hAA`? > `4 bH,`\2)` `l   8 ` (`    :```2bH> 㿘      $  ܐ!$ @N$ $ $ 㿘@N`@ `  pDDDDLT<LD(DDDDD㿘>  > P<!㿘ˎ x& &  'T'X& ('P'H'L` z  :   @. :`2 2  2 "_> `"`  "` "`"`l ( 2  > `N"X 1>  & H /f * ' `` @``5&`` > *lh > *& ` 2" &@`&` &`> *@Ho  "`> *@`H 0>  "  H 2#\  @: > a`  "` p> > aЦ  '"a aШ '  ͠ (   g$   Д`"["@R=   //Ѐ`,>   `(@  2`' '''`ʬ"7"`@  2`' '''ᴐᴀ@`>`@2``@h⁖ ה`@@ 2`> "`v"" > M#H㿘``    ``2t `n.`> 8 € i ` e H /` * ! > aO"H 0 M > >   D ``l ?"`lH /` * ! X H 0' {# w%߬@# I `   - -> qP#X ܐ㿘H o*@ aQ H 0㿐6 @      0""`0 >  5  >  5   > !Д 6   *> #\ 6(%> ' X@Pt> "(> b@~`eÔ `   .`@> L#h 㿘`5 `   .`㿘 `"?@  2 `"` 2 h``2@o?   ` `G` 8  `G" ``" `%` Q? M?"K?`` D?2B?  2=?>  a @ڔ '> a(@Ӕ   `eJ `2`  .`  .` .` .` .` .` .` .``   ?  .`` a @  ? 㿀x `> #d`N> c pr 0Hcde  > > #d`;> c>  `!> @O 2`  > #d`"#ؖ`0 pF 0cd``耦@ >  0qy @"?> #d`> ` p+ 0cd > `h#l  0   #\ #`#h#dp  㾸> "x'@Oǒ x 0 @А \< X  b//77' ''n  > #d`B> `o ?> bHܞ?bH      //'''''''H /` * !  tH 0/ > #d`> ` 0o \?u > oS!Ȑ  \   h " ?ߐ $ @OF ` ''> ȆbH/p'@'D'H'L'$','4,'('0'8'<   @"d   ?'d'T'P@d    @d    > J>!8> "x'@N x 0 @> !!> bhbh ''  ܢ?  ''//''''''ܐ////'''''”  > #d`> aPn ? b > I!> "'`"Z?N@  ." "J  ."&" ?H?? /G@G,H<`#  ` * 2  X@NkG G%@N[   ..6 X .6 c1   > I!㿀>  h b'"M"4 lF" l$> #d`=> a h 5 V \@  \> #d`,> b 0nY '"> !!'` `'`''3 >  "> !`   """ > I%"H> "'@+03> @K `@ `` 2@ `v@ `l``? ? 2f`Ā +> ?``"`""" `Ā`2``  `(   D@M4`|' v'' c'    P p֒`  ?$` `@ 2 ``%` `` 2``  > `"` #d`> bX m 0` ?$` `2@@K@MO bb  '    X//7'''   <@@M2 D4'p  'D0 'H 'L v  > HW"㿐 @ > "m@M   ?/'?   ? ? ?@"```?`` `  `  ?` `   ?? ?@"``` `` ` ``       8 &   " `&  * 2`3 ?# 4#  * @+ `  %@`` ` ``  `  `` ` `` ` `` ` ߚ` ,@`` ` ` `"5* 2`3 ?# 4# `@`` * 2 3 ? 4# +   @     ? @ * @ ?    @  ` *`&  * 2 3 4# @ * @+ `  %@`` ` ``  `  `` ` `` ` `` ` ߚ` ,@`` ` ` `"3* 2 3 4# `@`` * 2`3 ?# 4#+   @     ? @ * @ 2i > k{" ?#  * 2`3 ?# 4#* 㿘  `'@`           2  2  2  "@ ` >  *` 00@? ?  ? ? ?@2 @>  @ >  * |  @ `  р``*`>   ǀ``   @I-  <x " @0 $M 1  4 @8  " `8 ?"`8$  < 2@J  ,  ,@$ `$ `$ ` $ $  @`    @-  0 @0 A 1'@ 㿘   ` ``" ``>  *` `\ 耤``値`  `0  ```ۀA`p`l " ` Ǥ /) $% $ `  4  2 `@  "`" `8 ?"`8$$ $ $  $ $ $ $ $  2_`" A`4 ` A`8 ?"`8$ {$@H< 2 `8 ?"`8l$k<͐ "&ɐ K&b`  4 " 2  @F  " `8 ?"`8& ` @Iѐ&  $  $  $  $  $ $ `"` )``" `<`2 `8 ?"`8& " A`` ` ` ``\ ``X` A`A" AA >  `B : 2'`2'@㿐#\ `  `2bH> `#`  # `# `# `"? ? ? ??@= '`` `> (`$3 ` ` `` X3 > > +`23  2" @# `?# `?# ` # # @ @  ? @??@  `> > *`"# X "#  3  ? @? ? @?@?@@2 㿐@     @:> h"   2 X!   ,  Ǜ   @:> h"   4? +>  @  $  `  ` `B =  `  " `   $@ @?" ! $ ۢ@&@ ܐ!>  8 <`'D'H> ''   ;Ĕ   @:> h#    ! &'Ȑ@H $А +  /  #  #   #  $ # Ȁ  @ 2 `8 ܐ?"`8'  * @2  @n !H`B:` "@   @Z !H`B:`>  `B:`H`xB:`x H /f * ' > a$   H 0    'a$H 0    > > #c8i > g#X>  > "4@ ;> ! 8"$!  *  *`@*   28@є  2 8 (@ʔ  "!8!耤2 !耤2= >  5>  `'0 0 H`&0  @$ $  x *  * *`@  $,, ?$ $ $  $$ $( $, $0 $$@$4$D ? *@ #@2 ?$@ , ? * @@&@ # 5? @ H /f4'a$* ''a$H 0 İ!# ? @j H /f4'a$* ''a$H 0 !1 $,?#@  @ *      $ ( , 0 4@* $2@ $ A N *  * *`@  $@  *` 4` `,` ,`  4` $`$`$`$`F 2 2  ` ` 4  #2`+" ` 4  "  $ @ ```@" " `` " $  ꀦ @]> "4D`""4 $D> "H /f4"$* '"$H 0 !  `"H /f4'a$* ''a$H 0 ɰ!5> ``@-"`@' 2$I 2`A ??ؑ* 2 2 - - % %  % $% (% ,% 0% 4% $   Z  %%   @ 4D "  %40?I&0 _@*@4D " %40?` &0   @%>  h`B :hH`B:`D"@H"H /f4'a$* ''a$H 0 % > H`B:`> `  `B : ̐H /f4'a$* ''a$H 0 !> " > @`#h㿘> !$` > > #xc8f"j> e # '> @*)> `@J``           $  (  ,  0  4@v ${Y @2`@P4 D " L$4"0?%"0㿘> !$` > > c8#xfR"> d#& `& `"` &`㿘> !$` > > c8#xf<"> d#  "`  " 㿘> !$` > > c8#xf&"> d#& <`8& 8`8"`<&`8㿘> !$` > > c8#xf"> d# 8 <"`8 < 8" <㿘H /` * ! H /f * ' > a$   H 0    %a$H 0    > > c8#eД"> d@#X> !`8)> '> >   ?,  8 < ` `(`B <`(  <2 "0@`< >   `0 <B<`0"0@ < 2`0H /f4%a$* '%a$H 0 H 0㿘H /f * ' > a$   H 0    $$H 0   $> !8@ >   `  8B<`  82` H /f4$$* '$$H 0 @AA$A8ALIIKJ J(sst(tTv@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@v@tttuu0u\uuuv 㿘@;> ja0> "aT> e@> "a``6 `` `"+(\`;`"SXV`R>τ *@L:@G:@B:@=: @8: @4:(" 8*`0@(:0@$:8"H"@`" P`@:@@:H@ :P@:X`@:`㿘> !P` `@`2`  2  2"`> b#!P!P "@!P" $!P"`㿐> b8 B:b8> "h ' (   #    2  ``̀  2  2   2     ?' ) @ 5 :23  @  8   @:> b#   `2 J@b8 `B :    @`2  b8`B z:  @ b8`B m: $$В"@ 0    03 0 2  > #d`R> c b!x0L? ?#  #  #  #  #  #  #  $# $  @  ? @? ?@2 , ,  ? ?  ? ? ?@2+ (, , + ( (6* 6* 6b8* * * .`&  `B ;@ ) (0㿈@'`"`  "H @B:@쀦  > 8 `B : F@  @  m   @:> aQ#  '쀤2 > 8 !`B :  :/ "> #d` #> `뮐`aw > "8((B:((` ""H `B:` h`>  >   `"` > "8(@*` B; " " "U  +> #dW k> |#d4M쀢  "l  "؀  ?> f#d" D 4_> \> @   "H `B:` p>ϐ" ,  €`   [ "H `BT:`R P   L "H `0BE:`0   "H ` B:`  8>1 /    "H `(B:`( "!   8%"8    "H `8B:`8 8沔     2T  :I T   2 Ґ@'' ` 4 ` @4 `$ `?$ `$ ` $ `$$ $`($ (`,$ ,`0$ 0`4$ 4`8$ 8` 4` ` <$  T ( (T   0 ("$ $ $ (      @:> _#    , ,8(8$ B`B ;$ ;(8@q쀢 @   "H `@B:`@    ""H `pB :`p  " "H `xB:`x沔    @8’f'@8^@   "H `B:` L8O@> aH I   =  H沔 ܖ  68@8 / #8  R "'@$ $ > b(?̀@ 4  T; ( ( T6 0@?P > "@ 4T. `4ѐ@$ $  . (, 8(8$xB`B ;$x;(8@ƒ (@ ߔ8@   "H `HB:`H Д8 沔 u  @OQ'@OL@   "H `PB:`P 8 沔 Q  @Oߔ'@Oڔ@   "H `XB:`X 8 沔 .  @E'@E~@   "H ``B:`` e8 h沔    @ICc'@I>Z@   "H `hB:`h A8 'D沔   @ @'@8@* /82@#d`>  ݐ`ڐ` `" `X^ L  @ !08`B :80`B :0@@!Ȱ!> "'/ > 8 `B :   `0@ 0%   0@:> ^ #   2c>  Ҵ )> 33<+"< ,"  "   2  `@    @:]̐#   `'3 ` *  * @ @  <`@ |  | @:]#   >   *,  2' @@הx  x @:]#   `> ` 2 2  * ?@t@ `@ pt  t @:]U#   ?  * @@ 2 LB 0Mp  p 0@:> ]1#   @=/   / /`'`'` ' `$''' 'Ġ 'Ȑ  2> А@=   //`'` '`'`' '   > #d`K> `X]) 0F@?`* `*`*`@  * 'Ԭ`''''/'<'> l** *  @'l'> # > * * a0 * `@  > 8 ?`B : ,?b > 7Ґ p> b  '   * *`@ *   $> LaT` > !X @z> !\ `> !\ @oА@  4 8  X 4  \ .  <"H` l  0H `` l@ 0 >  > 8 @`B ;@# \ >  8 ?# 8> !P   @ 2  > 70 `>  '  8'Į  `   ̔   @:> [ʐ#   ` @;Ē  ؐ  /Ѭ /P U  ؀ ?ِ  ;  *  @ " ?-     z-  ` "@>      j ` ؀``ِ ``ِ   `ِ        " X7ڐ@  <0 `*@"( > @"@ @ ` А  @@`AȔ   @:> [%#   `` @  - 2   2 > !H`> !H`2 "  <  "V     <@ʔē* @*` 8h4(V  <V   nu L h` hd  (``\$`$`   (O```(O  "     A, - ;,, , 5, , , , '`8O , , `> , , * 8 8* * * (> "@@4 $@@ ` ` $`,  8$`$` ՐĐ@ 8$`$`  , `  " > 5 㿘(` ђ   `   ( `  $ $ * `O# $  `@  J ." *J  lh   JK  .2   e >c .    А S   ) %А C0 ?   А `-3  ` *.4  J ."*    .  &$  , 㿘@ @~ c `_\@J?`2Y J? 2T GE& 4H & 4B N`&> N9`?48 ?45 `ˀ`ŀ`%#@ 2" 4 4  @~ &&&& &  㿘   * @ `    B ?>  : .  `2& `  0`@~h  " ̐ " `  ` `   "   `@"    22&˨㿐2 >     * @  f` dx [ `2R    `"GF ` 0 2@  0u "    3  / "-   @"' (6` `> ? '@$'"@'Ma `M\  0? ? "4```  2 2 2 `* @`*`2`2`.`.`h>  ' 'Ȓ`   E̔   @:> X)#   @8#   //ђ   > c c u l!"l  v :2h  ,  , 0   , 4  , 8  , @}Z  2R        $   (  @}D  2<  ؀   2`*  `* "/ *沔 ,  "0?l@@ Ȓ@Ȑ h<  ?Ȁ " '9'¤@'Ȥ 㘀2 l#0?l@@ dȒ@Ȑ h  Ȁ {@ >  PB?:P > 2 !> "' ''H> #d`> > `!(  (W'0(آȐ  (t@ 0 0 " L (  ` 0z 0 "  : `(.` p`?`('` '`  '`$ '` ``&``&` `&`@7 &`$/q/p`'x`'|` '`$'   홒P@6 /Q/P'\'`'d'X  큖 > ```0@|<  2`` 2```? ? `  @2`2'@@6 $   GL``8 w?"`8`2@> #d`!> !pxLVߐ 0 `&`` :&` `&`` .@&`.`.`.`.`  "> "H  `.` .` : (-e-* 2 2 -- ? @6 ߐ#\    @H  H ""H `B:`H ""H `B:``>ϐ"4*` €H  "H `B:`H ""H `B:`H ""H `B:`H ""H `B}:`H z""H `Br:`H o""H `Bg:`H d""H `ȖB\:`H Y""H `BQ:`H N""H aBF:aH C""H aB;:aH 8""H `ЖB0:`H -""H `ؖB%:`H """H `B:`H ""H `薂B:`H  ""H `B:`." > 0Ր!㿘@/㿘1> > !(W5$!(㾈> "'  ` `*  `'@` 'D`'H`'L>  ؀`> !<`@ @]   @:> UA#   `2 `> 8 `B :  ?'0` '4`?'8` '<`' `'$` '(`$',X72 @X7"@  > #d`K!> !߃@ ` > #d`>!> "v@ `U@ 5> В @4   //ВئIє  : >> 0`"#d ` > #d` !> "X0G@U 8 !?`@@z)  '> #d`!> "00(T 8 ?$8#d`!> "04@r 8 ?$8  0> #d`!> #80? ? 0`?@y `? `> #d`!> #xT > `(?@0@0V > #d`!> #ŐT 0}   . i ?> #d`u!> #ޭ iTo d> @7 `AP)> !`'> !$ @C@4 @4  p@4   //q///p/Hߔ H۔ xHה #\   !`>b P @3ސ  /Q/PXH \ _"> > 8 `B ;L" > . Hh> "'> "  >  ؀`T Q`P``4 L``< G @3   //``'` '`'`ރ''@2Q -` ` ( @ #`     (` %`%` 8% i ? 0 k  ``0  0`4 ? ?  ` :  `,, , ,,H,`H  ,((,,,,,`4  Ӑ0H `@H   `0G @G  @1J %( i&@ ?&@`4 $$&@`0  &@"%`    ,(< .` *  iG̐@&@%` ,%`% ? ? ``$ ѐ ` ?@ Ɛ  @2Ȓ <  .@.``&@%`%`   %` "`B`?`? 2`,` ,` ` 2,`,` 2, ,  2`,,` :?ؑ* 2 2 ,,,,  ( * n* 2 2 ,,#\    @  "H `B:`  "H `B:`  > "H `B:`> 8``B  :`` ܐ א > -~ `㿘`:  D `Ay=  $ 282 *`" (` "` ( "   ؀` F ``2 * ؀   w ' &`  ؔ F`㿘> !D> > !((aL`?H 0 ".  4 > @1Ւ D '' 0' v   P:`P X:`X `:``> !T>b  P 2 4> Q x  2 X@1 D 4 ' 0' ' v '` W 0 "& \P 2 4> Q}  @1~ D 4 ' 0' ' v '` 5 㿐( @  >  8Y   * @7G    *#\> !hW㿘   %   ``  @/@1 , 4`@4   @. @1 㿘  !]& 4?$ 4 V& 8 $ 4 O& < $@ 4  G& D$@ 4    & @+> & D D @3G  Z    ,``"@36 2` 2  @3+    c& H & , 0@& L ?*@ & 0㿘 , @> # L   ,    4 , @` D  4G@2?$ 4` , < 4$ ,  H>  8 0 㿘> Đ!1?*44444444444T444t444444444444444444444444㿘  M  > > P, ؔ0#@ *"@ *`" *  *  * " * "> c : `*@@ 6*@>    @2> !0+`" + " **" "@ * *`  @ * *` @ * *`" "@ * #@*`"@ > #  ``2 `4S```"`44`4:+ `4@ > "> `@(O"` @+@ 㿘!>  @/Ґ#(>b,#(&͔ #(' 㿘H /f * ' > ` ` """`?"H 0 `@ 0܁p> "' (?'''D     >  Ȯ `B 3:Ȕ  `B ,: !@> * x> `X  * X  >  *  @ `B ;@>   `B  :>   `B :D  "  "H@B:@ `B = D` ' `  ( 'D``B {<`"H`Bt:`D` ` `B :` c"H`B\:`` h`2   :      L  *` `B : "`    ? ? $ 2 ?``B ;`D? ?@ 2 D` @2   `B :`     ?#@    ? #@ @D    B: D` " D"H`8B:`8D  " D"H`B:`D    ' D'  ' $D'u` D ɔ  @sߒ  @ 2  2    2   D    D D $ DD``\  g  `B :4`D `\/ ? ?  ? ? ?@ ?  * @ ? ?  ? ? ?@?  * @ `B _:? ?  ? ? ?@2  D`X* 2 2 . .  ? ?  ? ? ?@ DD`X* 2 2 . . D`\   ? ? 2 `:    D  Y b   `: " `ݨ  J> ` " D"H`B:`D `` @ "`  2`` `    @s  2 >   ܀`> "`D ఒ`B : ? ? "D@`B :@D D  `(` `4   @rӔ  `  h`B ):h3 $``  p`B :p8 ?"8$`>  @-M `  **   "  " " $"*"`'D4  2#< h`2@ `2 `2>  8 #d`f!>  א ׍ MW 0Y h`>   : >      I>  ؀`2   @B: @D` ;"H`8B4:`8  * @'  dܒؔD@Ԁ &bD   *` 2*` ܀ 2&`  `B :` " D"H`8B:`8D  " D"H`B:`D  5 b` ( )   (Д   @:> L!  'D`ؔ `B :? @>  ؀`2 DD`ܘ؀  `( `B :` ( ` "@ #` D ("`^    >  ܀`> "`D@    `@DB:`@b  DDbD@b  `2   2   ?#@      2 P ?#@2 P  B: D` ]"H` BV:`  P`B ; PH`@B:`@!I > > # a< > ! D`@45  ` `B >  ,"H`0B%:`0 2  '   W b * @*`@*` DԠ!>  bؒ`B :GDb > &!0㿈   *`   (   ( ` 3) 3 < +" 43  `. `* 2+ `     * @` 耤 3 *  * @耥 Ð ` 㿐` )  ([   @:> K?!   2 &> ` (` ( ,  (`  (6   @:> K!     >  ?`B :?@  && ?㿐Q?# @ "  06 01: w> `5 q> ` 4`?  '&c> ` .   *` . `?  4(?>  'H֔$@ @O?H &@C Ր$@  . ;?$@  ' 4?>   ֚`C : $@   &?>   Ԛ`C : $@    ?  Ԛ`C : $@    ?>  `B :?㿘 @/ "- 0( > 0#>  `B : Ք ? `B :`   ` #   ?Ő?h> " @' `@|S?   & l@@4ؒ`> ؀``ِ ``ِ   ` `ِ  `7ڀ` ` 2 X l'耊@ .  – ) & l `' / ̒  ) & l@ = ` @* *` 2  'ȐȒ  ) & l@3` `2- l (@ ">    * 0/>  `B i: l@ 1   h ) & l@T (` + 3  <  +0FE@J π 3 `,` `,` @ 3")  < # +"  l0 l@@  2  @@ 3  ) &ɐ  Ð 3 > $h!@㿐3 <+> !PJ @3..      ( ` E " & J & 3 `(   (   ,3 ((    X> "' 2 > H!p "i? d3"< <,$ Z2) (+B Q?> M?: HlF;@ C (Ȁ&@ 7 ?#@.?&(@ $ & *  @b?@  "& * ?b > #!㿐?'t ?㿐`R ?`+@>#*` €>   ז?> "  7> !  /`, >    ֚,x#`  > !P  ʚ h> #   1$#\  -> "0 ((`> "'  # 'D'̨  ` > ` 2/ `` 2+ `` 2' `` 2# `>  >  @> ,> `B  :@` ,̐`D`> `a`0G 0  D ˖ "?,`7>  DH /f * ' D  D `( > !G (   $  D?'D9 #\  (̘ n DH 0̀ ?C "X'0VH 08 Ð [$!!  D  @  !@D $!@ D @l6  Dj 2 ;  !H 0D$   (   >  `#`?  ? 4 > `H%> >  ``8 ?"`8$" ߀`8` $? ? 4  ` @k  > 6%> >  ``8 ?"`8$@&l   .. `& ` & ` `& `$& I#  D>  `B :  ϖ D"D`?<;9>   @ B`B ; ; @< " > "H`8B:`8>  > > !,  Ќ#!,Љ`D> <b0 `#\`0FK  Ő   VH /f * ' D`(̔а 2 !H 0 A!   Dǖ DH 0 ADY' 2 H 0 ?` 2D  '̑H 0: > <bH D  ` l  84"H ``  l@  +4'  "H`B:` =<"H@ l "H `" l l* l ! 420`2" \`2 \>  䀢`0 \ @$     D> <  \ D  `? ?  ? ? ?@2`,` ,` `? ?  ? ? ?@2<,`,`< D DDG D : `! !` `*:  `*:<D@) '<  > "H`XB:`X>  @`B :@>   8`B ; 8<  `"H`HB:`H`  H`B ; H ̀`A>!p*` €`>   1  > z $2>  `>   4@ "8 ?"8$" > Ő"L\@ 㿘 l> "@ ?V ?`Q>"*` €"J  ?@@@#<9  5@1.  *@t&#  [@  [@m    @ -㿘> "@      k& -@㿘0 !k 0!j  @ @\㿘H /` * !  >  >     $  ( ,  0 aP !*` B ;aP    @i+  2  $ $@i$  2  2 `P`B :H 0`2``  < 8`h< @`p< H> @*` * > P *  @(@:0@:8:@ :  >  T "@ > T  㿘V 2. - R `:`' -> # * >  0"b> "!@#Q$> !@#M!> "!T1> >`Ȑ!XE > #``&`!XB:` p> b'H /` * ! >  `'> <`)> -> +> 3> ;> #5> 07> @, > !!#P,`2 * @*`@*`@  ` `   / '''' ! a2А`* 2`@ ܢb@"#P4aX%T> ! *````    D 8 2 `= 8`2``*`a@"Ē$7c&&H 0> " > " 㿐> #`7 > #P*2 * @*`@*`@`@ * c2`@ 7> > !a @ *@ " ""22 $ @ p> "?' * *  > * cP `z 0 >  r >  * 2 i  ?%> #@!> > > bؔ @h! \ 2\2X4. T\ @K -H /` * ! > !!` `/` '''' a1аH 0 %"H /` * !   <`8,@$`<` <`(<`0H 0>  `2 " > "p> "'> * > *   #* cP    G H /`4* !  > !!` /''` ` '' !a2А@! hc?* @*`@ P*`2    ?* @*`@*`@ ` 4cH 0  > "㿐>  >  a    $  ( ,  0 !P `*B ;!P     @f  2  $ $@f  2  2 `P`B :`'H /` * !  84`8 <$`< @$`@ D$`D H$`H L$`L P$`P T$`T X$`XH 0E H /` * !  a     $  ( ,  0  ,`} > ! 7> 5> `@fB  2n` $`$@f:  2f`` "b``*`2   <9` 8#\ @0 $@  $` $` $`  $` $` $` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4 84`8 <$`< @$`@ D$`D H$`H L$`L P$`P T$`T X<`p$`X<``<`h$`x ?-` "$` ` @ܔ 82 $````-` ,a `Q > !  ` @e  2B``$ $@e  2;`$@ $` $` $`  $` $` $` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4 84`8 <$`< @$`@ D$`D H$`H L$`L P$`P T$`T X`x$`X`<``<`h<`p ?,$`x````H  8ݴ  2 H 0A 7 $@  $` a$` $`  $` $` $` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4 84`8 <$`< @$`@ D$`D H$`H L$`L P$`P T$`T X<`p$`X<``<`h$`x$`$`#H 0 P #>  '؂  @ $@ (@ ,@  0@  4@ '`b' ' ' ' '''''''''đH /`* ! > (`!@ ؒ @d  2  $@d  2  2 2  H 0  1&ؒ 8H 0  > #H㿘   h֖ H Ր?p>  b'H'3?  ?@@ -?@* `..  *  &  ">  >  @> ,> `B   :@ Ʉ ,Ɂ >  cX`0?G  H /` * ! >  >  a        # ' !P *` B ;!P     @d9  2  $ @d2  2  2 `!P`B :`!PH 0H@`B :  8M   沑H 0 7      X 'Ғ (2   8H 0p 7a *` *  *  * +` @  +  ( *`   @  *   ,   (  *  -  * @  !+`@  ,+ "  *` *  $  %,  +  &(* #@* '@      ,` `@cz  2` `$@cs  2`` "``2`  8ۦ  k 8H 0 7  (Q  2 W 8tR 8H 0԰ 7  ? > ?  ?   //''''' d l0  ++ , ," 8? 8H 0 > > #cP > H " `*`2  hH 2`dl+4 ' !P> c= !P``B :`ݒ 8ؒ 8H 0Z 7`B :@Z   ,`,@  $` > $`  $` <,`,`$`# a$`$ ,$`( $`, $$`x$`0  *4`8 $`# !$` 8 8B: 8ܛH 0   `4!P ` "H&@&`&`H 0 > " > =#㿘H /` * ! > ! 5> 7>  @ 1 - ,> !P `"!x ? $x@``> 8 2@@ @B=@?-@$/ 82 ˒H 0>`ȐX > #``&`X:`p> c> 8" ' (* > * P`" > !P 0B: 0p`C &>p(* > * P  > !T`"   @2   (Ŗ        X   '  ( >  7" d l" 0   ( ( (( ް > #> P `#> Ѐ  *`2  h     ?Д  ?//?؀`d'耣`l" P(' '' 0' '''P bB<    ` 7`B < ` 08( @< B`:C :h` B#> c`C > >`>hPb >  <  .`2 2 * @  * I* *  * > #P ` ?`8* @*`@*` 2$8 2 8Ɗ`Ɔ2 ਐƀ`|" 8਒`B >਒@ߔ`( B`C <(<8 @`> * 2`@ h  #> b > #Ё㿀`H /` * ! 沔        X 'q ( 2  H 00"4 `>   //> '0#\  @ H 00i!8`` @ "`  2`` ``` ` @`J  2@`  ,, $ $  !8$ $@$bH` `l *    `@ *   >   ,, $ $  !8$ $$a 0 !` % 0+H 0p> 0> `B  :0' *  > '# ( $  $ 沐 ږ  $I 7 Ē"@@4 > P&@ *" * "`($ *       ? * ??ؕ*"   //'''''* " : > *`*@!P2` > bB> ۔Ѐ 6  ``B > ` > ^#؁㿐>  `B @: @" '`!`B ;` 0 /  0 @@   @:> 9#  ' 2 !`B :2`  !`B`:`0s2`    g̱  `!BK:`0^  V '> > B# 48 ?#/ @2B/4 !(`C B8(#806 ` ( ; `  !(B8(0$ `0  !0m`> * @*`@P*`@ `> cc '@5ِ!㿘`    *   > ! & 8 D L  X x d  h h h h h h h h h $ h h h h h h h h h h h h  h  h h h h h h       h  h h h h h h h h h h h h h L h X  D D D D       D D D D   D    t D  D  D D D D D          | D  D     D      D      0 8  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 ( 0 0 0 0 0 0 0  $ P | 0  0 0 0  0 0 0 0 0 0 0 0 0 0 l , , , , , , , , 4 4 , 4 4 4 @ , l , l , , , , , d l l l X X X l , , d l d d d d ,    l l , l          \    p  4              p  `   !D &L ' ( ) * * , , , , , , , , , , * , , , , , , + , , , &L ' ( ) * * , , , , , , , , , ' + , &( &( &( &( &( &( , &( &( &( , , , , , , &( &( &( &( &( &( &( &( &( , ,> \'X" ''X'P'\ '8   l!X> 7ʐ X```'` '` '`$@'`1> `0`" `4 `d@L* 2'\`4`" `8 `h@@* &'\`8` l `@5* '\``` p `@** '\> !`dH /f * ' X Д X `( >  7j (   $M  X?'\X #\  (\  XH 0\ ?@ "'\0ƑH 05 ۢ!!  X  @  !@X $!@ X @\  X 2 x+  '4!H 0d   h "l l "p p  (   X  XX@  '\` 'XX?c? " X @ '\M'X` 'XX`@ B'\,`,`, 2 2 ,`,`p` X 2@> 6 P <"p#@p ``*,`d  2 > 6 P *@+@d"@`d#@dh  2 > 6 P < *@+@h"@`h#@hl  2 > 6q P + *@+l@"l#@l $    '\  $`  $` $`  $`$ +9* * "?"?"?"?2 `` 2 `` 2 `` 2 `` > `  > >    -B: '\ X`B :X`Ȑ@ $`'8`8 2`<`%`d   @ `* `*`@ *  `     "`` * 2 2 2 ,@,`,`,``" `@?" `` ,`  >  ,` ,`RH /f * ' X`(4x 2 !H 0 Ab!   X  XH 0 A2 H 0? @2lX@  '\H 0\@  /` '`'` '`$'/TP '\ 1 A T> ` `B :T "H`XB:`XP P%@%`%`%` %`%`%`PP`B @:P T  `"H`PB:`P`P` P `  `"`4` "`4` 2`0 X? ` p2 X?b "2T  T"H`B:`T S \ 2 >  `B :"H`XB:`X 3n'\` @ "`  2`` `   `@Z7  2  T  T@ X `>  ܀`> "` 2 `TrX 6 ` 2T \`.?` ?@ (X`T"@T8L@ښH '\L%%`" ``h  % `  T`%`h %'LT \`-`? @?   ? @? ?@ 2` ` >  ` @ @   `> `*` * ? ` ? @?  ? @? ?@2`,` ,` `? ?  ? ? ?@d,`,`dXD`@ @2`X`T" `X* X p'\?# @2X" T X  AX'\]XY : `! !` `*:` '`'` '`$' `*:X`  `l @ H  (T"H@` l@ @ "H `` l@@ 0@ (9'\ TH  L@  TX@S'\d ( ` `* @ (@ L?#@8'LL"?? X ('\T  "H`hB:`hl` `  ,$*h 2 d " `  , *>   >  ``B :`> `  ` 7B: `'\ ,,`X   'X" 'X# @2X> '%X   ( # X'X ("` X@8< '\& ?* <2 2 *@* '@<  *`  * 2 2 **?* 2 2 .`.`f  X@4 44 @@ 2@"@X "`X> " <* <*`*`*`*`<*x`B :xT "H`pB:`p T " "H``B:``'XP&X\X`"`\  TX@`'\<X'X\  > ` p`B :pȀ Ȁ` 8`8g \8 \Ȁ`> `8 ?"`8dh l p Xې>  >   x㿘4 7 ߒ    ( ``  7`$  '2& 㿐     $ `$` ,8&  4(` ` (4= 7      ܖ( `  ( 7$  & @& ` @$`  ,,` ` *` , ,`'&ޔ `  "`㿘( ؒ (O  * 7&@ 2   /      & `& `  &`C  2 7 " && 㿘  ,    4  @W  " `8 +?"`8& 2@ $  .`.@&`&` &` &` -"<H @` l@:  \M &   *\ $  "%(!'X  "\" AH @`l@:      *''`2'@@> `>b 0'  ` ) @ R ` '  2 ;>"* € @[  "  2 7@'>!* €`!8ܢ $  l@2բ  @ڐ*@ l@ʢ   /  l@2  Ő*@ l@2  *@ l@2  *@ l@2  *@ l@2  y l` t  l >   , } 0 y 4 u 8 p> "䀢` 2i `f  2c`  l@2[  H`*@ D Y lM  H@ 'b "?  2: 4'>!. € l $ l @/*@ l $ l %*@  l $ l  *@ 2 l  $ l   *@ l $ l *@$ l l@ "   逦    @ݢ @ע"բ  2Т `' `" lâ "  l  ?$ l l ?ߐ $ l ? $ l"  (2 H / * ! ` ``${@   H 0"  2  ^'6"> 75`0> <,`09> #H  ) 2. +, #L   2! , > #P   2 , > #T    , `8 <*@ * .$ ",  2' #$ ! @@@@@ l l   @ l @@@@$ l *g  ;> * €  '" 76>#* € l,2  l)2  l&2 % " l l2  l2  l2  l2 > "䀠 @  l       ' l2  l2  '` ` ' H 9    ?#@8'А@  '* ' & # 퀢`|>#*` €  l l2  l2  l2  j' l @ c' @"r @*lH /`4 Đ* ! Ā  $   ' Đ !'! '!'!'!'!'! ' / '̴' (& #0 (H 03  ' 6& 75" <"   '  ' &  "@  *  ] >  I 㿘`)  = :C 6 2, *  2( "$  2  2 ` R `:2"Ԁ  ` R` : Ԓ J ' " "@   㿘> 0  @Ւ?$ p {U $`` ` { = "  R`@ $ @? {㿘@  p?& h&& d㿐 2  { p &#`#\@ h> "ݐ?''Т  `U'>#x.` €   @ J E  = d 69 d<  :( 0 5(  8 0( 4 +( ` '(  !,  (  ( @   h " ' l  ''̢ > , ( ( v  &  ( &` `!Ҕ  > # 㿘`.   "& G {& `/?&`=?& d`0 `"  `8 ?Ɍ & "`8&   "&  {& `1  0 "& 0 {& 0`#  4 "& 4 {& 4`3 8 " < { <` & 8`8 ?T & <"`8& <`2  ` "& ` {& `㿘@&`d& d`l& l``  { & k`""" " "`  {  & S`!$ `0  {  * ۔ & 0@`0!`4  {  * Ȕ & 4-`4 ``  {  * ɵ & ``` `8  {  * ɢ & 8`8 ؔ ? 7㿘 ?T {X> ">' 0 @`'  5w  2&@m 7$@>  ,`,`$`?`I>#*` €B  >   Ā>   @ >  * ( V \ @2$$@! 1 $@    p `! >  ,`,`    W   ,`    2 2 2 2   ' ѐ > Ȑ@ B $ /ЖА *"" " o"Ȁ  1 <  @ >  *    V \@2 1? ?  ? ? ?@2` X6` `2 `@PZ  2  x 0ޔ "s@` $ ` "`$``g$ c  _  2 2 2 2 b  G' C >   @ >  * 1 ? ? 2`6`  `2 `@O  2  2  1`"  "` ? "$ $ @ -'@ >  `@  `  ` @Ԓ 5&@ >  Ё㿘 ͐   &&   -0! ``"` @`2`X" `` "`  ` ``"` >  "`"  -㿘   ? `"`"""  `2 z 5㿐 `": {   "- " '  (# (  ?8  )2 #\#`@ 2   ?ߴ 㿘\` ` `> +C    ` ` 6 *`  ?݀`> *` €?퀢`+v>#*` €2q  . ` @ ` `  `  .Q > . `"`@ 2E ` A ` =` 9>  `   >  * 2*  2   {  &'  /` * @`! & @`!&d ~> 0  @ ` < 2 /`` ` 2 `` 2`` ` ?? ?  ? ? ?@2`>  `@  >  * `6`  0 / 0@ {u  &  ߒ 1  ` * Ӓ 1 {U  a&0b  ~ v (t ` / 2n  #"4 2 0  0 8 `4` {!  -'@ZL  3D B ``* <` 8 ` 5 32 ` /t 3 {  &8$ 7-  @` &h "l@ l ?&l &l * 㿘沔   =   ' a ( 0 '8 0(? ?   ? ? ?@2 + +  ? ?  ? ? ?@ + +  Q 㿘 (C  ~~  2 c; 7' ` 3   @3  #  ?#  #  #  $# $ (# ( ,# , 0# 0 4# 4 8# 8  6  ` <#   ( #   ؒ`(& & #  &  (&@ 㿘> '"㿘> "㿐@ !      @:> 'l!   2 >  !`B : >   ?`C : "  ڔ  ! @ * @&@ 㿐> !> !p"!   , , , 7, ,   > "!㿘H /` * !  >  Xc$2` @L  "& $  & $ & ( @z g 2  & (& $> "!H 0㿘 >  Xc$3  > X#44  $   @LS     @M 㿐 `       @:> &Đ!   `2  > 8 `B : ?? @@ "@A0ɀ  " 0`\ ` ` 2 `` 2`` ?` ? @? 2 ``X* 2 2 .` .` `   "   2  ``* @``*@2 > `X#$2  `p `#$@K  1 `  (-@` ``  `` `` `@K  2@2 `( @ $`( $`$ ( @f $`(> "!@`Ƞ`4` @9` 5?` ? 2 ``X* 2 2 .` .` `` @ "`  2`` ``` ``@K`  2@`"`$`$$`(`? ? .` .` ~x㿐> a耢 H H /` * ! $>  '' ` `` '' #  (  ? $ ( @ $ $$ 2 ` `` '' 2 (H 0㿀   ऀ 2  |/   {  2}ɐ0 @ ($$ $$$*+`+`+`  :  `* +`0#`4#` 8#`< #`> !!` #``#``#` #`"  #`#`#`  #` #` #`  #`$  ........ ?& &  ?&  &. .  (  :* 2 2 ..@ > > "8.`  @ `B 8 //'耤`bH `B:``"```$>  > 怤`bH `B:`bH aB :a` bH aB:a> ax`?#\   =l =l = =l =l A( B B @d A A( AD A㿘> c  > a0$ 0>  * * > !>  +  (+c "c "  #c>bx#@ #@_.㿘  |8 8a0 @ , $ d,  #2 * * @I$ # $ $ @㿘 |㿘"H@㿘 h  ` l!v@8&` l&` > `> a` 0$ > `! 㿘@D (&`& & &㿘 2 > $+!2 > $%!`"  2 `   `*  @ & @ ( 2  & &  㿘  > #!  2 > #" e > 8 `B ;@ (W?   뀢0> `!>!*` € *  > #d`> b0$  > & * `"& & $> #d`> bX# > #\  > "8@ `B :> d  > b#    㿘H /``* !`  $& & 0> #`@> c@ & &@ & w $0 $r& H 0㿘H /`* !  # " "  0 "  H 00`2`<> #2" 2"H> #,"`H `` @ > #!"耤2 > ## * : `q>!*` €> #P  6  > & `@%#sQ & `<$   |  2{& @ 0@  => #`  7@ 03 >   &  6 > #`> #`> X 6 50> #L  6 > & `@Ւ## @  0@В H 0㿘H /` * ! !> >#(b, > #DS#(> # `> #> `" @c:@@@ `2`>  $> #>  c" (3 " c"   ?"2> ##> 8" cH" (@ 28H 0㿘> # `#> `$ @` 2@ `2`$ `> `$ @` 2@| `2`$> #` > @` @T"`\ 2@> #X X > @ >  ؀` ch>  `ch@ch`!ch@`@0` `  ` X@ @  ch2` > "'@     / /'''' '`4$ ` `8 ?"`8' 1` 5 S \ '@ D`> $ >''@a?  ; 2:  "6  H`?2` 8" 84 $$`0 ``H  "@ @"`> #d`> #00> #`!   > p#h㿘 ? ? >  `X@>> #+> 2#P " ( 2 , 2 0 2   4 " 2>  ؀` > # `  > #X`X    @ 8> H"> ' ' ''؀ R'H /` * !  <@   "*V  `"&V V  2"V `"V %> !> #`@ #`$@ 0> XH 0' 2< <@ @6 @H 0@v D  ' v '1 " > #x㿘   4  / 4 $$* H`& 0 "  V` 2 ``> c`  &`` ` 6` <> bH `% x> "`< '`0"`H`4  !> `  !@Ew  2`4``"`4 @ `!@Ei  2 `4 @Q 2" $`4 zb@  `4 p  @  `4 ;e&`4"` b0]""\Zb`4!2` $`2\` >  `0` h- X5 - `4!2=b\  `  > 8 hc0 *b- X5 `$b < C  &`H> cې b> !> !`" <@$!>c,$``$  ?4` $` k 4` `4> $&`4h> $@a"hh@$``." ! &+` &    "`"#h"&#h""` " R ? 2   4`  2 ` `<f` ")`4@ ? 4`  $` ` i i- > #T`> * x`@ &`< ?"   $ &`@@u? 4`$`T\ @<` #'  ' ''7X7'/'܀ f> #d`b!> #Sܔ0 XbU`4@7!> T\ @2<` #` '`  '`'`7'X'7/'` @ "`  2`` `   @D  2 !2!`@$!"`?@"$``4&`H ;&`4` "w b > #㿀> "0l' , 0 !L "` 0aUaV!NW30HaPm aM,aO/0J!J1!KN@5!(H /`4> * !> # 2 /,"*  #>  ?&` &` ?&`  &`6` K` .`  6`" &`$ `X6`( ` $ H 0}@'H /`4> * !> #` ],* +@ "` "`(" `,"L`0# X *$8 <#@ `X24@ T +` 4$ ,`-  @ 8  <  @ ? D8?  0:(@  > `HӐ  ڢ`* * @2 6* %` ,H 0@t 8H @`" l@* $ H ` l  $ H `$ H `$ H ` $ H `$ H `$ $H `$ (H  `, ,H &`&`&` &`&` &`$&`(&`, &`0$&`4(&`8,&`<0&`@4&`DH`$ "`@"@.H /`4> * !> # !  ? ?  >  `` @``2 `2`@?`2 H 0qH /`* !@ݦ > # @: @H 0R`?` @`?` ''''? @? • X7H /` * ! ג "  H2 R H 0&`(&` R&`$&`,H 0 > #X&`@)` >  㿘  > Z `2@> T `  ` `   2  4  (2  "  4 $$" HT   0`` `@   `` i@Az@ @    i`.`` i@ `2 2  `    ?`% 4 > #`> XP `$  @   ta $ 2 8  "` `0 ```4 ``4  `  24 ` 4 `T   >  ؀`>  `@㿘H /` * ! !> >bx#@ #@A.>  `bH  `"` 1 $ > #[$  #2 * * @'$ ``2bHH 0㿘 Ǡ @ € C 4     8 <?@' 8 4 & 0 `X " h \   A "  0 4   0 b ' h " A  4$2 HՒ   :   H  2  \ k "H `e ]> `% | "` "> chch$"ch$ "  \`T   > #`> X 4 /T  2T > #`> H 4 $  T  ) ?"4  " s4  $   2?  $ "H> `#`@# @Ș *  zؔ  \  `"!a<  ! " !!< 2!k`  r hG" " 5 0 0   0  㿘"` h* 3/ // / / /   `0` > ! 0`` @  >  0Hr 㿘`9 3  `     %     *@@g  ` ~8 㿘   H /` * !  @> # +  `(@ (  ,`,@ `$` $`  $` $` ,` 4` $`   X4`$`(`( ڀ &@ &@H 0㿘   H /` * !  @> #` 5> k<h@R <` $`$`$`$ `$` $`$$9@ " `L yx`L$ `X, `8$$`<$(@ X48`8 $,`H#" @ $,$,`\$4`P,!$0`T % ,2 * "@*`  * -    " "  " " ` ` , 4:`T   ,2`*`" *  <@  `` @&@ &@H 0> > '    ' ''''' '$''`@   wd  d @:> !   `2  > 8 `B :  `'` '`'`' > #d`}!> ! 0 nd 'Ā #Ȁ ̀ ?#@>   >  >  > #d`G> ^a  > #d`:> Qb   > #d`.> EbP? ?  ??  " X?@h X7h`ɔ  l> #d`> bE 0 "  -`     > #d`> b# d  h`?  ` "   ``1`А@   //''''   4@  0 `     0 '` `a`@' '''`   " i ?> #d`w!> " i ld@<Ô   ϐ> c0 0V QĀ NȀ K̀ H@E0D +Ā (Ȁ %̀ !> ""` '`'`'' X` 7€`". `@0  ` `".0`@o/> d  !> #Xi4 d  !> #p^) d  !> #S > 8 `B ;o^> " > #> "'@ $ Q> ' i c ?  @g$   > #-(> #mG  9`c    nK(`nِ &`$@  c "4/|'x/}c @$@ $ $*@ ,,, @  :  `*@  , @j,@f   ///р` /` @'`'`' ' < Xc'Ē 77'/' $$$ D$$   ` (`]  @'`'`'` *'     t 2> #d`!>  tK ''' '@ ؖ $ܲ($ ?$?$,(.`.`.`.`.`&` &`  &`  &`? ? ?@ .` .` , @ ` i  ?@$$ @ .`< ,` i  `, 2 2 ,, :.`.` (* 2 2 .`.`@ #\ xݵ > "H `B:`  > "H `B:`> 8P`B :P8 ?"8K G 0 ``8 ?"`8m >  X0> "'    ' ' ' ' ' ' ' $'  > #d`!>  h  0t >   @@t,   @@:> !  `2 `> 8 `B : ?'` '`?'`'``* `**``@  2 2 2   `? ? ?@X7 > #d`T!>  L L> Ѐ  `> #d`@> ` <> `x  > #d`)> a 0$   . Ր ` `@Ґ 0  > a0א 0Ւ  > #d`> aXɐ >  i ?> #d`!> ! i >   H`0 T` 8 i  , ` i  0> ` 4``$`<> bH ` 6  #`> X  +4` 4`@ H4$ ?$42    ` i@9{ @  ```T` ~> #`> X  4`m0s` `2.T`  i , ` iΒ  `4``$`H>  `  GT` ` > #`> X  4`7T` % 2$4`  H o *@ a @< "> @ ؀`<@ H 04`4 ?$4` $`$`  B` l$` lb> 8Ș `B ;l b > !ȁ> "'@k $ i> ' c ?  @g   > !ؔߖ(> O" i  3c    j(`k  $@` c"4/|'x/}c @$ $ $* ,,,   `*  :,,@ @ `  ` `/@/`//''''Ā < Xc 77'Ķ. ''$$ $ $$t  t 2@> #d`!> "@Kt  '`('`?'` '$?$ $,($.`&` &`  &`  &`? ? ?@ .` .` `2`@   ` i@ ` @  ` i  ?@$$ @ .`< ,` i [`, ., 2 2 ,,666.`.`.`.` :.`.`K (* 2 2 .`.`#\  xm > "H `B:`  > "H `薂B:`> 8X`B :X8 ?"8  0 ``8 ?"`8j > V" hG""x""x5"x "x " "x"x 2 "x> "  22 㿘 >" `ݐߒ㿘 㿘> ̀ 2  > """"` " ``5 0 ``0> "> b 0x '>  2 o& 2 \> "؀ f a 8 |=   0 ``0> "> cː 0K@ $> " $"@" > `"> #d` #>  c8 0 0  `$ & $ $$$$@H > bH `N@o#n0@ > Qc` c`2  Q: @@&@[㿘> #̀`(@ #X`"  "`> "" ?"$$  | ?.> & > a?"a㿘H /` * !  >  cX 2 > c6 0a 0 ``0> "> c> R 0 ``0> "> c 0e#@ > #d`>  `(0 `2>> @6@ > bH `@Ȓ#ǐ0<@ `2   @:00*> & > cd  #>  `P 0 0ː `""`> ""?"$$ | ؐ?& > a?"aH 0㿐o   0> ` 0Cp=> Ȑ#\ > `0   `m&   0> `|  > a(0v `""`> ""?"$$ | Ő?& > a?"a㿘 `  & \  @   `& `0  @ 㿘  0> !P> #Ā` > #d`!> !p^ 0' 0"     s0 "㿘 > !Ӑ ` "`[P> "' >    ' ''` '>  ؀` > #d`}!> !  0А o>  &`2  2  2 [ @@n|   @@:> `"   > 8 `B H:  I  > #d`+> b  0& `  ,`` i ?> #d`!> "P io >   g> 8И `B ;g > I"> "' >  bH 'X '\'` 'd   > #d`!> "ZW`0 > ? ? > #d`!> "AX  >   @@mĖ,  , @@:> "  ` 0> 8 `B t: `Xꑐ 6 `> #d`W> cԐ 0R` *` * ` *`@  @ (X> '\ `'d''` /``*@  '7' "8`  "` N%  #2 * * @> c% % ` ` *`*`@ * ` 2% ` 2- @<`T D%> 5> 3> 2  d ~>  c0 ` v> cc q   ?  ?  d "b   LZ  2h`@d "Q p  :`H h@ `  /u/t  '| ' ' ' 'h 2`* *` ' * 2` `*` ' /  +  *  * @ '  +  *  * @ '@' 2 @[ T*  (u DB4  >4  * *`@ *   d> #d`,!>  H ː #4  `l  @ > %4#d` !>    4   ,` `i ?> #d`!>  X `i  > X  ڐ@]eː> 8ؘ `B ;e > e!P@! D`<` `0'`''`@''`<`4 < )> "''D@ @ @ H@ D       //'''''x'L?P////'H /* !   D D` D`8?"`8  & $H 0" > !(㿘> # "  2  @2  2 2  㿘 > `ؤ  H>  ` @  $ "@8`"  "`> "#$ ?"&& > #  @Ȓ " @  @"`@p`? $` > a@0   |> "' 'D>  9!hH@= DА@9 @5 @1        //'''////''x'L?P'  Dۘ D`"& $ D`8 4& $ "`8D& $" > ;!㿘> #  㿘H /` * ! >  ؤ  >  `> > #d`>  > a  H 00e#  H 00Y)> 2 $   "  $ H " $R  4 $ `` ``  ڒ! ݀ ` c @ c ``  @ H @R   @@@$@` aH 0 㿘 "HH /` * !    =  0. .  6   $`& IՐ2 H 00`'>  "`>   "   ?"&& GH 0h  > H 0] ! ` (    (H 0M  | 2 H 0? '> $@ $` $` $`  $` $` $` $` $`  $$`$  "$@kh " $@ $@$` "&   $` ""   % H 0 T   2㿘 | ;  "` T "@"  T"`@& T㿘`"  "` ?"&&  |㿘> # @2  X X2    " 㿘> # 6.  ? ? "( P 2  T 2  " \ `  @" 2 2 \ 2@z 2㿘!> !`H2`@ : @! ! 6]  ` | T y `2&$`T`( `XF> `   ? @" H /` * ! cc $``"`#c$`H 0 `L `@Ð > #d` !> " 7  X 0  `   $ 㿘 P"H`& 8& <@P > #d` !> "p  X 0 א  \ 9H /` * !  `"  "` ? "& &  T "   | 2 ? $ > b0  H 0ʒ |@wx H /` * !     *@`?ɐ "I 8 L 2 L  &L L2  L &L L )` 8&8 <&< D&D @&@ H&H L `P `@ > #d` !> "|X 0 C `:W 26 L[1 L ' L0@Ȕ䦒 > 䀢`2`L> #d`N > c( X 0#\  0 "`8" <@ L2   j `2a  2]    X2U  0͒  N" @"I  ' ' ' '  "  8 :7  < :3 > ? #> # "@ @  c" " 8 @  " <'' <'@$ $ $ c$ $   2"  8 `` ` 8 >+\ &\    \?&\H 0㿘 `#@ `2` 2` @ 2`   X2 ` 02  2 \``2@@Q " \@$ 0?& \㿘 T    -  " H "R  $㿘> #)>     L 6 ܐ  c> # `- "Ac ? ? "  L 6  P    P $ P P "   "  P ?$ P  2 c"c??  "   L 6  P  ?$ P  2 c ?'> %>  ? ? "4  L 60  P  2 P@  d "  Pސ  X x P 2  L 6 @P  d "  Ɛ  X x  2   "*  @"  " @   $ @"  "  .   ? $  2 0   @ ?$  2 >  P'"'> #d` !> #n  X8  > # "  P "  X X2     2|   퀤   `@ `2``> #d`@!> #2  X 0 V  @泦 (  ,/ 0' 4'''`I  ! @朒 D ''@''  U > `" Pc  P & P! #d` @` X> #\#``@ 0#d ``8?"`8b > ᗐ >  P'd"'> #d` !>    X  @;  ؠ  //Д @- / (/  h@# D'l't  d @>  Pd ?`& P > # Bd)> "*  P 2&  2#  X X2   "  > #d`" ] X`0#\  #`0  Հd#d` !> !PG X`0 d` `8 4 "`8d > ! > h X b' `   "x> #d` > # a0Ӑ  @勒 x0  @+   // _ h  @''pt  @?` "ܠX 'ܔ EXh**@`pt* *@ @  ''''`0*'`4*@ '`8*'`<*@@ '  //  8 <''` N"8'T!@ Eq@"X$'ܐ @'ܑH /` * !  H 0 > #d`W!> !j3  b > " 㿘 < 8  > #d`> b0  > & Dc & D 8> & @c & @ `?> "@"@` ?> "`"`㿘  H /` * ! ? ? " `XH 00>.6   bПH 0P 0`"( ` 2$ `@)Ҕ  2  4(2 @b D  4' ' 0 ''    >  ` > *`>  > X  ` X> *`>  >   ǀ  4                                                                                                                            ` Ȍ ȸ  < h ɔ 4 , , ̈́ 4 㿘> # h> "> ' ` `B ':`   2 ?#@    ?#@[@X   //ђ  I> c c@ `l!"{` `v 2u``, `,`0  `,`4 `,`8 `,@(  2_`` ``  ``$ ``( `@(x  2I``Ԁ?#` `B < @ "  `B 2< .沔 \W  &0?l@@]@̐ hsg [j̀ #`[d#`(`B :(m@'̤`㘀@2`l'0?l@@]@̐ hs: [=̀ #`[7#`(`B 3:(m@0#``B : ; `B : ;2@[>   "  "H`(B:`( #   >  PB?:P > ݧ"!㿐`>`C @ ? =?     > " `/>  "x  ? )> 2#\#`  ט  v `?#\#`#   > "'T'X' 'H'L'P @ '`'d R  f'` R `: ]=    7    (Z  2  7H'`@`&``&``d&` ` &`$r$ H H $,X` 2 ` '  1$'`&`&` &` &`H`" p`4 "p`<'dp<*2 2  ```2 .`.`.`.@ v.`*d.` R `:"  Ԁ?`: Ԑ`@ '``( `\ 2  7'` \4@`^ (4@l#\2  ɂd '`R` :> d "> "H `B:`?`>/ *` €d  "H `B:`d "> "H `B:`d "> "H `B:`d "> "H `Bz:`d "w> "H `Bo:`d "l> "H `Bd:`d "a> "H `ȖBY:`d "V> "H `BN:`d "K> "H aBC:ad "@> "H aB8:ad "5> "H `ЖB-:`d "*> "H `ؖB":`d "> "H `B:`d "> "H `薂B :`d " > "H `B:`> "8-   B ;`0`B :0 Y$ӯ?Y `> Ð"㿘):- 00i le 0k   "X 0  ? )M  :   Xh >   @ b '`  '̐JS`G.`>/"8 €`> " ;'̑H /` * ! > > !48o]  '̑H 0 > co  '̑H 0H 0 ?$`,`v    $`ߺ '̒  * ``(* 򀦠  > !!$``` $` `$`($`$  ?6 m`2> > "" 2`x`؀  $`߆Ȁ  >  `T 1 P 1    ?#@B 1    ^ . 1"ऀ ' 1$`, $`0$`4$`8 Q>  ` 1 ^ /``H``,̖ 2 ̀ m 1i'̐$`,$`0$`4 $`8$` $` $`$mG$`(Wn3S   8J'̠А@$   //А` #2  97'̀ " 1'̠''' '''' ` /'̐ؖ'   -'̐}˒ }> ؐ"ȀWi > "؁㿘`    -   > #` ę 8> " @'> `0`@ `  '\ Ԛ  '\ "T   Ő  2 /  1   8  8 $  8 (  8h'`'d'h  'l'p't`'x    H ,\ 2 >\  1'\ zՒ {'\ 2 < 2  < $ 2 < ( 2 <g 9 ,  0W<  `\ 7`? > (2 (c 4`4`4`L4`N p<+2 `2  ```2  ..... H 4 2<.& &   &  (&&&&  &$* `4`<c4`> w"T , l`" ,2 #\ H '\ /'\V[?VT \> "㿘@` +> #Г*`   0@%$ 2@ * $㿘@ 2> #Г*`"  㿘 沔 V  * H /` * ! > c hm  H 0hg  UH 0 7㿘 & ` 2` `@ (  J  2`  Wl` > RcБ* @ ``U㿘  ͔ $ 7 H /f * '    H 0 2  > #"` k > `@ 4 RБ* @ 2  ^ 㿘` > RcБ* @@H /f * '     H 0 " 㿘  *`2`  > #Г:` `' +` 0  z  H /f * ' `H p@㿘> #Д  . `2  . -* *  *  J  *> #Р)>   @   $E 4@ 4 @ $ 0 4?`> #` "$` J$`$` 4 J  >   $# 4> #  "$  J$ $  㿘 > %#0> c"#0@("` ( p D!X!`!l!!x! $ !!!! L ! , ( 㿘  Yn &   㿘  J !>  X>$`$@0 `8$` `8$ X$` 㿘>  X X" @@@ "@ 2@@"@> ``?"``> `d?"`d  J 㿐  ,   *  ",   J:  ð p 5 4`     2 a*@* @  "w `"<> ``00 ̐@\   5,,4$V >  X`` "@`" @`2@  @`2`Y0K X` ` "@`2@ `  @`*  `@`2`S@    5,,4$ / X``  2 @`2@` Y@`2`St>  X``2@` D@`2`S_@̐8 Jh> "'@ھ  "  "  $  $  //  h  //  JH ' &&`T&`Xр  0 ( 2' 7 ( ,' 0' 4' J'7Ґ@ &`D&`Hр  0 X b' 7 X \' `' d' z'7Ґ@ &`X&`Tр  0 , 4' 7 8 <' @' D' L'7Ґ@e &`H&`Dр  0 \ d' 7 h l' p' t' |'7Ғ@F̐ &`P 2@р  "  x  ` " $ 0*` $ *` " $ H*` $*  > :#x㿐  0  @2  P  @2 P  Ԁ@"  P 2   @2    @2   ܀@"    䀒@2 !% "! !$  ?! "!A!  ?!A "!x!@  ?!x "!|R   ?!| "!pR   ?!p "!tR   ?!t "!R   ?! "!R   ?! "!\R   ?!\ "!`   ?!` "!   ?!   ް `! 2! 2H! 22&ʒ J  'ð &&`@&`@Ô    @   Ԁ@  @&`@    @   ܀@  @&` @   䀒@&`@ &`@!$&`@!!@ &`@!@!x &`(@ !| &`,@ !p &`h@ !t &`l@ ! &`p@ ! &`t@ !\ &` @ !` &`$@ !  !!@R! &`|@! &`@*! &`@= @ `h! 2$ h @s@'hds h" ! `  dȒ J  㿘@`! G" ?6>7,(> ܀, 3+*@ ("> ؀! 2 *@ " *@ ">  l*@  " *@ " - x> "'Dp''H'''@ >  X ' `D` 2@`(>  d`E` J  ' @ڒ   4>- -5  0 `8H% 쬒`ʔ 'X   "  2   2 UP8@ק J'H@ ߔ 'p ?`Ӗ>7 *` €@׌"(  /B '$@@#\BӐ '  J ' ''t'@  t`   Ȁ    쀢| y vȀ s p m쀢  > #`g   c H /`4 * !        l  2 3`B  `$ wFE`'@  ! ,! 'lt@ @!$@!@!@x@ Ô @  |@  @ @ @` @\ ؐ@& ܐ@" @ @ !#`#\Ē!@ @(@6@P'''' $ F '`Eg$ D3'耢            t @  x@ R @ N | @ J@@@ H 0 t`   Ȁ    쀢o l iȀ f c `쀢  > #`Z   V H /`4 * !        l  2 3`Aؐ   `  E8P'@  ! ,!쀢 '_t@ @ !$@ !@ ސ!@x@  @  |@  @  @ @S @O ؐ@ ܐ@ @  @  !#`#\!@ y@@)@C'''' $ E  ' 'D'CH 0't H /`4 * !        l  2 3`A0  D%H 0Mk` y t耢 u' r't H /`4 * !        l  2 3`@  ' 'H 0<`  @>  `$``" ` @ J ''  2> #Ĕ 8 8' J ' H ` * @$` 2> `#8骔 0 ' Je '  2> #h闔 '' ` >7 h*` €H /`4> * !> "` ` ``2Hϐ`2 `H 0H /` * ! >:ctA H 0D'H'LH /` * ! >:bAߔH'H 0 ؀  7 't H /`4 * !        l  2 3`@  `̀     l  2 3`?  "    `" ` ""`  `"$ ` ""`$ " H 0&  ?    -       X#\#`Ȓ@ (@ӽ 0@ӹ 8蘔 0H `  | *  ' 0 8 ?"8@ 0 2  `0@ 0 2   `    H 0 G'H 0H 0 8> bȀ  !> x "b> c p#\ ؔ  Ę  p  2 H 0z @: ؐ $`$``$`Ē 0  /(/)7*',  0`0  0$` `>7 P*` €",` ,` ,` ,` ,` ,`> x p0GAH 06    ` ,``|ϔ  `|@  ``Ĕ  ``@ܒ         l  2 3` ,`C$`` C$` "- n.V  $`"> xF0 p솒H 0ܐ 7  2@` n2`` "`"``R`r`  + n.)  $`"> xF0 pYH 0 7  2@` n2`` "`"``R`E` R @[ D('0'''   8  +'`"``Ȁ``"`"`̒?`"$`$`` "`C$` "> xC> x p H 0d> ""`$``"`Ԑ`""$`> a "a <`,`H 0D&H䀢 :'X " 2 `" ` @2  R 쀤Jm  `2`@  d`$`  $d $`?$d '  G E 7C ,   ""@ & /-     , `  @   ",  `> ax* @   @> "@ @      D Ҙ '耢 "H JHޒ J  'H 0> " > ̗#> \$>  ``"\'dհ @  ?`  ? P hఀ "R    ?ഀ "R    ?฀ "R    ?ༀ "R    ? J h @  'd'h  7 *2*"ࢀ 2* 3 ld +d -`"@'|2 2@ |  `@'2 2@   岒`ఀ 'R   ? 2 3ఠ3  R坒`ഀ 'R   ? 2 3ഠ3  R划`฀ 'R   ? 2 2ภ   ฐ 2А Rk`ༀ 'R   ? 2 2༠  22ؐ RQ`''``  *2 '\5> < >  6` 6`ࢀ 2S l> < > c@   >  ! .`6` Z6`c@  >  ! .`6` M6`c@x  >    c@n  >  @ .`6` 66`cȐ@a  >   (!.`6`(6` c@S  2">   ( .`6`6` > !> ;> c#@A  >   #c@8  2>  .`6`6` >  @, >   ` @#  >  .@6`/6`` @ > –  .@6`"6``  @   > ’! `0 @  > ’!  `@ @  > " .@6`6`> #> +> > c> c > #;= > =`+> b> ==&`&`>`>` >`(>`0>`8>`@``H\ `@ '\dh  औ И d@p dܒ J! 3  26 !  0 l"!P -! J!$  ?` p @ 'd? h@E d 'd'h ,,!> ,\4`d$4 "\'l@ddd'p@ .`2 d *  $`?@ddd'|@<!$dd'@7!!   f @s J` `'T @^ @ Hh@ TP JTP` @ C X@ߒ P  2  /Y7\@/X/[—  /T@``?&@&` *` 22 ``"*`T@hP TP@` "@ &`&@  P  P`  &`T   J㿐      p a " `  "  } `(  } " `  "   `(  " R `  ?@ R `  ?@2& f  J '^ & a &`@l ` } &`@d |  0@>`0`Ԓ 2@  &`(  R  ? @'R  ? 2 2 @2 `( R`2   " &`,  R  ? @'R  ? 2 2 @2 `, Rْ` 㿘> "   2 А@ Ѐ 2  ` 'Tn @ Wh@ϒ T2P Y`P@ T X@;  `  2/X/[ 3 l    P /[P  2 /Y7\@O  0T@``?&@&` *` 22 ``!*`T@7P TP@` "@ &`&@  P T`P  &`T ْ J㿈  a `2 \ '/'''> 0``H8  &C`ߒ 2=H /` * ! >D`:H 0 "H /` * ! >EaH!H 0"&㿘!>  @"  >7>7>;>E" $" p c " " " 3" 㿘> E"  !4!!!!!!!!!l!l!!!!!!!!,!,!!!4!!,!D!D!!!!,!!@!P㿈> "'@̺  `  & * 2     > 0  `8 2v   `p n  j>  h* `@`(b * @ "   @Ȕ@ ߑ, `۔ @ɼ ?!Ӯ >F!0* €28  84 "2  8.  8*   뀤  2  `` ? 2  `  "(6 `- 2    4` ` 2 @ `@z  }`2 ` w- 2    4` 6` 2԰   (ΰ `\`?: *  2İ  (  8 } (  8 s (  8  4sJ?`.@  ? [(   *  Q(  @  H @j H @ J 8s   8o  `@ * :(c  - 2    ,`2 ? 6& @ 4M ` ۔ `2A @"8 ǀH0À8/ &@* &`Ŧ`2%  >  *`   @2      b `   b `   b > _ P!#t!#|!#!#!#!#!#!#!#!#!#!#!#!#!#!#l!#!#!#!#!#!#!#!#!#!#!#!"!"!"!#$!#,!#4!#4!#4!#4!#4!#4!#4!"!"!#!#4!#4!#4!# !#!#!+!+!+!+!+!,`?"7 ` ` * ` * ` *`" `*!` "`  $" $` "`  $@" $`  $" $`  $" $`  $" $`  $" $ `  $" $ 2`" a*`$ * * al2`` " ` ` * `"#`>H(              * `"`$>H@(            * `$"`$ " `$@"`$ " `$"`$ " `$"`$ " `$" " "㿐`c"N`"`0"`0 &  $  $ ?& $` >  $  $ ?& $` >  $ :` B   & $2 (#  'a (ڐ` $ ?& $` >  $ P& $ $ ?L& $ &  $" $ =& $` >  $! $ >& $` >  $ :` B  & $2 (#  'a X` $ ?& $` >  $$ & $ $ ; & $& `> `> `> ȁ@  &2"  $F@5; @@" $ " $" $ : $" $ : $ "+@'  $ " $" $ : $" $ : $"@  " : : Ȓ :": :@ #@㿘\` ` @ 0@ 02   `@~@z`@v .`.  0.@.   '0iGC 6   .  & `. &  6 `6 6`.`&``&` 6``H6`F.` o   j  6   .  &  &  &  & `& ` & `& `. (& $ 6 *`6 ,6`.`&` &` &`&``&`` &``&` `&`$6`*`6`,.`( "` 06 +  3 *2` `"`"`2!+  3 *2 ``"` " `"`" `*"`" ` "`$"`,2 "㿘`' P `2>H!*` € * *  *  * * **  2*  &' L2  "(*`&' T~ ' Dx ' Xr ' Hl 㿘```  `` 0 Ŕ.㿘@  ? 2 2@`&ܴ@`*@  ?@&㿘`(!!@ n*  ] &@`*`2 22 n & "` n"`R`` 㿘`.!p!t@ n*  1 &@`*`2 "   2@ 2@ n & "` n"`R`M` 㿘`/!|!x@ n*  ?&@`*` 2 022 n & "` n"`R`` 㿘apatR ` `2`2  "  2`&R  R`  ?@&㿘aaR ` `2`2  22`&R Ԑ R`  ?@&㿘a|axR ` `2`2 "2  " 2 22`&R ۦ R`  ?@&` ``0"2 `0" 2 㿘`  ? 2 2`*`2`&a`z```  ? 2 2`*`2`&a\i``  ?@&``2!a 000"㿘`TE`6!㿘a`TE@Ɛ   24@$` &``"!a 0 "㿘`&a`&a `&a` ` &a`&a$` 2a` a`@  `8 j >  ha``@*`U|``>* "@` &`*`(" ` $ a$ a $ a%> ( $ $ $ ``@*`UZ``* "@` &`*`" ` $ a$ a $ a(`  $ $ $ ``@*`U9``>* "` &`*"@ ` @ "``a "`"`"`"` "`V/㿘`&a`&a `c 2 * &a` `@&a`&a$``@*`U``>* "@` &`*`" ` $ a$ a $ a  $ $ $ ``@*`T``* "@` &`*`" ` $ a$ a $ a`  $ $ $ a> !,`a  , $@```@ >T``>*`" ``&`*"  " " " " " " U㿘`&a&a &a  &a&a$``@*`T``>* "@` &`*`"   $ a$ a $ ,a  $ $ $ a> !( a  , $@`!(``@ >T[``>*`" ``&`*"  " " " " " " !(a *  , &aUJ0  r$'*`  , `*` ,@$@$` " H zL@ /u `@?L /2? @ ''', 'z2' _ /5, @ '''''z# P''l'h''zh C t 8 kx /@ `@`$ `'@ $@=  ' ? ' ` x0x    @ 2  *@  22" =#` = 8 "`@ 'd'\'`° `(4  > 0` h @8@*   `  >`0''''''`\''耢`? 3 '\`ؖd`\ o%@`k \R` N 4I`@D`$@`;'``7  42`2@뀤`0+2=    D  "!  ` ` ? '` D$@` ` `@̀ ` d "x  ">@\ "> > 0   㿀"!'?''' 'r ̔  0> #|8" > L "㿈` ''@#\  , p` ֣  @?# @"?`"` + -0% -0"4`, -07!? -0 ``2`  ''''#\' ܘ 8 s` ` `` ?'#\  `  '#\ ܘ  V` '#\ ܘ  J%> @’ `>  @ P `P& > a$@@^@·  `& $> a$@@S@¬ $ `$> $@a@G@  `$` `' ܀8'ܐ  ܀ ````?  &`` 㿘ܒ @> "#L 㿈ϒ   ` '@#\ M 㿐@(  *`0  '#' @0* @` '#'`ձ 㿀`գ    : :`?@?+H/ / ?"@  " H  H/ / ?"@" H  㿐 (! '!(` `'`  @  O  !  $!$!$$! !( @$!(㿈@` (` `2`C  .,`  '@ $ $  !* 2$ ! "!  $ ! " 0  $  0 "   $  * `$   2`  "  `$  㿘`` @:  (> " t'@ ݔ )c@ "N   b@ "9  @"> O?@ "" lJ?@ .!>  |@ ??@ :? ` @` @5 `@"  )`@&`}@*&? `@y`u@"? IJ D ?" . 8 ?" .`.`@ .6  ' ' ' ' ' ' ' ' ' N'䀢'耢> !(* 'N4 '耢> !(* '/@/V?c?  & x@@  @     . . . . . . ** * * . *N  * * * **** . . . . . z. ' ' ' ' ' ' ' ' ' '@n'  ~@ "8  }@ @ ?# *` * * *& x@9 `"@B: &> "`0> !p~ , $ " '`& `b &    2 b 8&? b > !㿘` @ ````  "  @ ! 2  $2 "   " `x # ` 2@@` 2 `2, @ @  @(0(0>  b > !֒ x@``` ` `" ? `"  l" `@ @** ߀` * , :`$ >! `@"    * * @?  @#  @" <" @ "`"@"`"`  x@`` ` " "*@*" " @2 wh @@` (0*   `  @`*  `` ` @@"`"@"`"` 㿀> "'Q `    " `7   " > !㿀> "'W$ `  2 `7   " > b!㿀> "'V `ѻ  2 `7Ѹ   " > :!p` ` `'''@''Ԙ'''T 㿘`  "` T@8` |  7#3 (`*` {j ` @'*a `@Tp'쀢`   ``P }  p`` ` ''@''Ԙ''''S.؁8` &  (#$ (`*` { *  ` '@S'|Ò  2@ "` 2` 2`  2`  2` 2` 8? <"`"` "` ("`  0"`( H"`0 D"`4 L"`8 P"`<㾠@ D'(''$'',rÐ {  2'ؠH`з @㾠@ '(''$'',r s{b  2'ؠH`Џ @`W=@ 2 0%  $ 0 ` 0 ,?`$ 0 0 Z 2'ؠHe`` @㿈`@: '?g㿈`@: '?#x``@: '?'K&㿈`&@''' N8`   >@ ` 2`(v 4 r `` ''`''''''p ?P`( 'ؐ = =: `%@8؄????'''  yǐ'    : Ȕ$  *   ذ{k Y  ` Ϡ `"@& 0" 0`, `0> ( "x`> " `J `@'` ''''`  '`   '` ! '` ( '``: '?؁㿘 '>     &&@"  @ @.$> "?٤!> "?0Р @> € > > "0Ő" . > 0  p㿘> 0p#|c@gc@I* *,"@ **`@# + " *`" & 4$p#$p㿘@*  @ ` @  J(8  J  J  (8 " J   & 4 & 4 * 8 * 8"  `  ?2  " @ ` ?  2  2J  J@ `2J   $*0 ` + +    "* 2"*J@   J@J`  㿘  `"@ J@  "@ 2N@@q  @ *@`N &*@   (+  2 2 " 2+J " ?2J@ "J`  2J@  @(*`  *02 @@@ @  "`"     " + @ @ ` ``z  @Z( 2 "" 2 @ 㿘`>   "0 㿘> "` ``?@``H> > "`l "p> "@0>[> >[>[>\>\>\>\!> #> %>\'> >\&`H`\P#`$ᨐ"ؠ#0c( `4 ` ` ` ` ` ` ` ` `$ `( `, `0 40@WԔ &`0> ’bP@I &`D>"`"&`D`D> !> !(" h> ’bh@Hr`0&`4@ 2 *@&`8 <.''  @#\#` ?,%  > `$[@ > "x 8 &`@%>  8P` a( @>a  a(à    Ңa(@`@* @ `8@* ? 5 >#?`@`0$a(đ:  0$ Є$`@ :`@>a à  ?&`8&`< H `0" `0@* ?  "@`0 "`0" H 0 `0> @"`82`4 `23 > b&`4  > b( 2'4 ''@Gϐ %> #>Y@G@D\ 'bH @G > (> h> 2@ l* <a(#@0 @("@ 0 p > l`> (< "0@("0 4@㿈#\@Wv `?"`0 "   "`  "`  \"㿀> !(@   +  > ޶ ! `H/ /`   ` `#`#d #\H p@\'@"㿀> !(`,`@U #\ " DH >"l`2`,>"€`,*@ *``0" `,`4* * "`,`8*` * "`, `&`, $ >   1> "쀢 "@'`' 㿘&`(&`, @Y㿘&`( &`,  ~ " @:㿘> #㿈> !(&`,#\( "&&&`0&`8&`4 1>  28#("@? &`(&`, 㿘`,`0 '> !(  @ H/ / p H p@ > #PR?ߦ&`,&`(㿘> !(!(`> ֱ#x D@? > .`$ 2&` '` `" 9> 5> 2`8֔#P@ @`& 㿘> !,@"> ~#.@g> $@ 㿘> n#Н㿘> "   ``?㿘  > Ð & " 4>  ܐ ( 4> ؐ 8> b  > ͐ H 㿘`>  Đ ( P> "`` 4> > ״ >_U t@" ` > > ע 0ן 4  > c 2'4 '''> Ð@E9ਠ @Ȓ &`8 s  &`4> Ð @D@EQ>  TN`% T)> Ð@Aɒ  cԐ@AҐ  @( >\'( N 4'> )> Ð@D `TS 2@A > ÐCa 2 $@ >\'( @D Ґ㿘` > > "`2>  >  ` > >  0 1>  x  >_$ s & x> ^!>_ @(㿘` > > "`2>  >  ` > > ̐ 0ɐ 1>  x  >_$ rߔ & x> -!0>_[ @P> "`` $`> ֤ 0P0`4 @S &`0`@< @S &`45> Ð@D@ $`0@ϒ &`< r  &`8> Ð!X@D`0> > "t!xv `a4  > ` 2'a4 ''> Ð #>\'c 'Ɛ> Ò`'c' 㿘 < 2`4> Խ!? ? -   =" @ <  8@  &`0  * * @ 2 &`0P` > ℀  g>"` < 2q  '''℀  >  $#T. '䀢  ?@> !(@R  ` '`'?'` '8` !'> `  8> `  2'8> גc 2'8 ''@'   "'耢`">\@'>\4( 㿘u 㿘m 㿘e 㿘> #h. > b* 8@S6  > >  t`4 א! > > ^!  `B <  x*` `" 0@  @ 0 2㿘>  x`?> ӫ!2. > Ӧ"@ "@> ݓ.`1>_0> ݀ .`1>_00 20"0P  >_  02 8 q+ 2 > y"8" "@M 㿘> "`4> a(@. >b  +` <*@   $  ( ?3 (#? ҃@ @ 2 @ ( @QԔ 㿘> !(?@>  @dO 㿘>  `P> !`)Ho o > "`> ?8` **H 0 02> ?8`** > ?8`** Ho o > "`> ?8` **H 0 > a> `ِ(2 >   㿘> "   6   0> e"P`?> ^"`   > W"h  㿘> "`!> > "pb  25> > ="` > >   | 2/> Ð ,  @Q( '&5>  #> ?8 , @Q b`?8 > `  > `*&> >` `p > !`"> < > "x㿘>  `> S"H > * **@H 0 >  > |> " H  * *H 㿘> "` >b? > c   W 8@ 㿘 > "#Ԓ   @P0> !x > *`* @ *#`@ @ > "#L  > "  *   *   2#  ऀ`* `> À`"`> "> Ô"@L 0 ` > Ð`&B"㿘> "` V` >b? > `(F    8@ 㿘> #  0@P-%> > "`" 㿘> "`2>b? > `P "   ž 8@ > "`?㿘> "`> #> @@c > Ò#(> Ðc8  , @O!> #> "ؒ`  "ؒ&` @ , @OҖ(> b>     >"> `x> >  "` " >  *  *`  *  > ##L"`㿘> "`>b? > "   A 8@ >  #@`" > Ð#P`?㿐!> "   ?* *   @Ok ?   @Of0? ?> > " "" `"   ?0 @OT ?` ` > > "`" '> Ð $ '$@ d@`> Й#X> :` @ d@  p㿘H/` /  > b4    "b4 > b4?"b4`?H 0 `> !(> >  "ؒ >    > > ℀g> x `* `*  `*  `*  `*  `* 㿘> #Ԁ`!!> #``d> Ɛ# d> "bВ d$#`@U"@!> > "cd  **   *`   i*`%> `"@@#  > ÒѠ# d$`@3> "cd#> b b`$bb@  > щ# d$bb> ""@> 3  cБ:  d@!>  :`@4:`""  > #d> `>  * "+ "@"  c> #d?`*`  "* " c> : "#"`" Ů 㿐H/` /> cԀ  >   'ţŕ 0> ">  @'? 'H 0F 㿐> #Ԁ`> > } b  >  > ` ' ">   ""  "`0#" ? 'Ho> #а>  " @ >  * ""  * ?"`  㿐> Y`?!`  >  0 ư!@ > #Ԁ`@G>   ' `@,' '2 '*@ *`@ / '2 '*@ *`@ / '2 '*@ *`@ / '2 '*@ *`@ / '2 '*@ *`@ / '2 '*@ *`  7 ' `,'^5> "bb  > "b$ `@-! b, `""b6> >   Ta@ > ĒH > àb؀ > Đ @> = 㿐> #Ԁ` >  g>  `c@vx> b [>  `Wb5  g  ,g@W , @ ,g@M , @ ,g@C , @ܒ ,g@9 , @Ғ ,g@/ , @Ȓ ,g@% , @ ,g @p8P* xP@Q ,g g `,g㿈@*/g////4c7㿈4/// P///@&/> अH> ख  *  @( `  (H > अH> ख  * *@ `  (H 㿘> #Ԁ`0=H > ""& & H 0 > "8  "8   > 4> 88 & "? & ?/a `&& 8 8 "㿘> "` >  : %"@8@r /1>   ! %k `   ,     @  l @^㿘>   5 , >  ` ! !> @N* :   .@> c`@@ 2`  Ȕ"@N* :  ڴ`  | 㿘>  ` #>  %> $` ! $`  2$` % 㿘> >  `" " 㿘> "`  > t   㿘  0@Kc > "`>  > *H 㿘> J ` >  В`"@* 㿘  > E `? `<  > "`  㿘>f&`0b`<> "` > 80 @K &`4> !> "`@> !㿘 E  8@ѐ > a & 8& 8H/` /> b`4 8`>  8>  ?c 4 2 8>  ?8*@0 8 ֪@@H 0 a  > a> `*(2  <2 㿘``?> "' &a> Ēa@;^  &ađX:   @2a &aa  > 0>"> " " >   00 ! > !(> Đ!0> "a@ua> Ā`!8b`@@`> !t`aa (@bb@7_`a> Ĕ@ dv> ĒA!X> > > `  i> J` `> Đ!h/ > ,!pb`"a@;a &`0>|"b bH/ /b@[H 0b > !x㾐'pp:   &">  "at㿘> Ģa> Ġ" ! `   > Ē!> ِ! $ >  ,!Е: > Ģa <->  D!ŕ: %> Ā  "`&c>  :` ̸!> Ā`&c l :` > "P> Ĕ"X   s h>  ̡" > Ģa T>  \"`: ̖`> ̑"x㿘> !"!!!""""`l0= . 08"">&"`"`"` "`"` """"""""+""̄ "`l""  "` "`"`"` "("`l""  "` "`"`"` "("`""""`l""  "` "`"`"` "("`㿘!> !x !x  "" 6y # !?00 $}0+!@  d !&"&"&"&!!&!ܐ!0  "_^ @ !,! &"&"&"&!&!Ԓb@ !$ @! &!&"&"&!&!&!&"㿘@6J> "` !> Ēb@9&!&!> ĒbД @9&!> Đb@9 &"㿘`?"> Đb@@9$`&"> Ēc@9 > Ēc@9 > Ēc  $`@9$` `  * & * "@> ##0 * $`l$`$`> $`cH@9j " &"㿘"  > b @i\ > > Đ cX (㿘` "> Ēc@9Ґ& > Ēc@9C  2&  & !> & @9’# > Ħ @9c {>  v#@9( & 4> Ēc @9"& , `> !> %>  )> ŀ`   * `2 * `"& 0> Đ#ɱ& 0 @8c 4& 8 8& $㨐@8 & L  @8& D`  `   *@ `2 * `"& H> Ő Ɂ& H @8Β0& P Lyw P 0& < H 8  ,&  D@ 8  $& 5 > Œ`H@8 & > Œ`X @8&  `>  )> ŀ`   * `2 * `"& > Đ#0=&  @8`h 53&@9  3 @8z & d> Œ` @8t& \ ` > ŀ`   * `2 * `"& `> Ő & ` @8S`& h d h& T > ʁ ؁㿘@ Ā Ģ㿘@@㿘 ւ> "  @ &!&"> S! !̐ &">  `&"&"!̀   &"㿘 >à  #@2 > 3!@, 㿘 &"  Ң @|㿘! H: ! @&"&!&!&"&"&"&"&"&"&"&"&"&"@Z&"Ё&ƀƠ㿘! @> šH` > ŒbX@7?`4 ` > Œbp@7?> <  > "` ` > Œb@7?`4 ` > Ŕ?b@7)> < % ?"?bX@7s?> >!bp@7i?> >!b@7_?> Ŕ?b@7Y)> >  ,"@2  ?2  ?2  ?2   ?2 &!&!&!&! `! 2! &!!Ԁ 2"  &!" 2" &"" 2   &" ` €`""" 2"" #> Đb@6 &"@3b@6 &"" 2"  &"" 2"  &"" 2"  &"" 2"  &"" 2"  $&"" 2"  (&""Ā 2"  ,&""Ȁ 2"  0&""̀ 2"  4&""Ѐ 2"  8&""Ԁ 2"  <&""؀ 2"  @&""܀ 2"  D&""쀢   H&"㿘> "̖`"`2``?2`` 2` `@ 2`> Œxې㿘> `  "`Ho o>   H `  "` H 0 > " 㿘> "`2    `> Ő#`?㿘> "` > ! 2"> ѐ#`2 >  0 @Eh > "!> O#㿘 > #> Œ#> > Ŗ>#> > ƒ 0H7> a`> > @ h-> Ɲ 㿘> & > > Ɩ > > Ɛ!(@`> ƀƃ!h㿐>"€` `> !2`> `>  Đ " > ?"#`# 㿘 + #`!> א!> `Ȁ "`> Ɛ!̒> Ȁ + > ` ""`Ђ$ Т@  㿐>"€ ''|㿘 4 > !. @  `@4A$ ` " 㿘`` "$ > b?  > > "` >  > ƒb8@5/?V`  `?!(   & 48@ 㿈`> ,!@`@3$@ 2 !0@ @"!0> Ŷ"@`> >"P0 > Ɛ"p7 `4>  `d`T,> Ɛb '耤  > Ɛ"'2> > Ɛ"'> > '',&&&& n& d&`  > @ؐ& &> `Д  &.G.J.H .K @G >nK 2   @ H /k * , @, H 0 \`\ \ > b@ 2>  > > "@> "Da( @>ǖ` >nbD">n> "a@@ &`0Ho o>  @  @ H 0> "`>  b@4F  >o!>oax`4 " T" P" X? \㿘`" > j" > d" 㿘>     ,`@ @ 2L L ܀ @? 0 `@ 㿘H o*@ f@ H 0㿘@j @f   * 2 :@ 㿘`2  > z".`@ 4 @: 2 <`. =. <  H( @ *I@*G *I *G@@   *H*J*K@  *H*K*J *J*H*KH  㿘*3> b? ( b @? ( x  㿘*3> b? (j *@b? a 㿘> " `( T  㿘> *b? F 㿘>  " `( 9  㿘 > *b? + 㿘 X !> !`    !` $!`& X 㿘 X  > a`& X "a`  n 㿘> !%>  @?    > #P`@m@3㿘H/` /#> b?  ڐ  b ? А H 0㿘H/` /#> b?    b.  H 0> > ? ׄ @( `(  " " 㿘> a㿘> aƒ`> ᰄ ᰄ " " 㿐> ",` Ho o   b,    b,H 0% H/` /1> "`> "`$ *b,`P"`> "`$*H 0 " 㿐`/Ho o> ",  `   0 T@H 0> b> ", '> ``!`@.{'> Ơ €8 ??`>  #H-%> Ƥp 8@ " > `@ 2 > ƒ#x%> > ƒb€ >   c@1> b Op%> '> 7> ǒ %> '> 7> ǒ`J@ 2`J@ :J` ` z$?@.' € > ϐ#HK@p @ " > @ 2%> > Ɛ#÷0ݒ@1j> Ȓc > ""& @1^> 缒b ?Op `J@ 2`J@ :?J` ` z$ ? @`L'> `H7> JJ@@`> #耥`  `$ > ǒt @23   > > "a d ᨑ-`d8 ,`> [ H,  > ! " > "ᜟ@&aa @ >  `㿘` 5 % ` % `. 5. % % 㿘 o  p  0`` 㿘 0  0Ӕ  S 0&  4 <& $ 8& ,& (  X T  P  K   F  B  >   9  5 1 - )  % F C       㿘`4  8  ' 8   @  `€   @ `  8   @  `€ "  @ 㿘 4  N L " ? . L `@? \ * L * L * L㿘    !!!!!P!!!!(!d!P!!!P!! "   "     2> >   0@ "    Β ?  㿘`>   㿘@.  22?@ 2-? " d@  2#?@ 2? _@ 2?@  2? P  @ 2?@Ր ? 㿈 2&`080 @>ϔ &`0`P&`L &`P&`l&`p&`D`D&`H> ǒ  Ȓ``> "!> a&` @:< `>  0``ɢ >w`L@; `0&`Ȑ&`h&``&`d    7 *`h @ " 27*`P &`P`0&`h`&`d&`` X&`\r > ǐ!i0j`P "> ǐ@ @h "> > Y! > Ǔ4 U!@8 7'> "`> >   ^ *>v  " #cX 04    >v  <@ >v@  >v'>vcX`>v`c> !'5>r'p ``' @) 㿘$ PN   *@ h* &   & @ @ c 4 # ` @ Ѐ 2a"@  2  @ϐ 2  |    |  `? P   h*@ Ē 㿘>ubha>u aȒb " > >  0!P  ?!p?&` 4&`&`,`" @  @ @` &`X&`L`02&>   ~`&`㿘 D> ܐ `:  6O ܑ* @I  D `  * <@ɨ   3`+ +` @z< @  0@* g! &#:`  :` @ $ C *@@* :  2 @ (   $*@ @*   C& @*  ;& 4& < ē2* @   * w*  :@& @H /d * % |< 2$@*0  L > ߐ!@H 00 0(& 0H /d * % EH 0㿘 $  D&!<&  H &  H"# H@ 㿘 ` $   & &  "` ? "& & `X   &  H&  H"@$ H&!< А&`@& `XEB&!X!’ $ L㿘 P " ` h *@ ` *@E  `* P`  h*@㿘 P "  4 D    h  4 *` " ` 䀊 + * ``*`*0` 0 *` ` 䀊  `*` O 㿘H /d * %   $ & H 0㿘 $H /d * %  ?& D L @ H 0㿘a |" '>  ` `Ѐ``$   ? d ,  2 `> ǐ aȐ?$ ?㿘a"? ` @  d *0  ??㿘>   :  6M ܑ* @  p2``  ` *` *  > * a  2 /  "  Ā " & ?  $ $ 耢$  @  `  *@"     $  $     $ > ܅2 @  ( "䀢"" ऄ( "ऄ( "ऐ ࠄ"ਝ㿘>t>ג!4ᔘ_㿘>t>ג!4ᔘ_Ɣ 㿘 L > #!0@㿈 D   > ǒ p>  L! ">   > %#(> !#(> "0>  }" |00 >  | }>  ~>  >  "p#\#`#d#h0"0㿘H /d4 D* % D   >  L#H pʒ  & L!X "& L L & L@EH 0㿘H o*@ e@0 H 0㿘 p !   >  L#0>  L#H /d * % @ H 0㿘 p    L    & L& p& l D`2aX& Ls $````"`& H`?`"$`$`$a<0@2H L`J>r!*` €& T$`< `$` ( 3`+ +` @+8<`Ȑa`䀊   & L7 # 4` * @ " ` 䀊 "`! ?$ ``$` P `& L` ?$`a$  P " `0@2`@8$`@@4?$` & L& `p`0B<`p А%   `     ܐ & l   ` `@8(  $``Ĭ  `Ȗ@<  -  `@H$8> a( @>8$`<` - $`@-%@ ``ȕ:` `̀"H> `~#H`Ԙ 0 & t @ `ܖ & x /`0 `*@& L& lJ&  А # M f, `@ ` ^  X  R { L   o @, `@ `g 8 `a 2 \ -` `V ' P ! J  D    P `& L   `0    | ` ( }d@@+$`  & l& L &  d9 0> ǐc0q 0< @`0" 0f <@`00"    } 2   | % 2  \ @2  T  }  \ `4  X` ? ` & \& X X  & X .& L T  ` `@&* > > ǐ `#?> "& T X?? & X \  ? ` & \u& X``Ȓ ;  B`<``܀`И " $` $`Ѐ  `  @O; T$@ D d  & l& L & !ŐO ֐ @   & L& l& s d  5 `^ /4   P ` & L> c` @ #  >? |  " $`@ D`䀊 " P > Ȑ`  @ & L㿘 D!X& X 쀊 9  T   6!  " - " ) 쀢 2 P |6  2 P> Ȑ 0̒ 1    2& L0& L    |? > Ȑ H  !& L     @B* > > Ȓ`? ?X> "> Ȓ`h`0$`4($`0 T & T?? 㿘> bܑ4  bA@ ʔ!"@@"` `p@`s@: 0e e@ "N` r ">@ 0@< 0 !@"qV  q@   m@@ 0  h@1 0 )"=@"a  e`g@`f@ 0.  VR! @`!X u @ n  !i ` &`*`` &] [ *` S e g@O? 2  @?`4# @ `* * `>t@- a4: 7 @3 2/ n, @+'`İ &&& & &&&& & $&$(&(,&,0 &0 & $` 㿘> "ܓ6  `  Ē UÔ * 7 $,$D$0@` ``Ė  @* &!; ` ; <*$H$<>Wa 㿘@! 6`Đ  * &(``&8`@&,`` &4``&0` $ ;` 6p&<> Ȓ`۔ > Ȓ` ֐  aW6r&&/? 2`  ?6   .  *6 >ta4@+㿘> "   $ =   8 0   P  ? h*@  h *@ `p2```   *` ( > ( 㿘`>    > @&`ȒJ@ >  3> c @& !<: c> ې !@> !<֐  㿘> "`2 2 ` 8 2   & 8 `?P`   > !0{`%> Ȑ@&m?  &`0@"_^@&d@&`0@"`0> (> Ȓa8@&X ?&`< 2 a4 < &`8 @&`4)& 8  > ܙ` 2'a4 ''#> Ȑ@&"aH @ &`8 T  &`4> Ȑ!PגaH@%@&9 (5> %> #>{p@& > "`dx @"  @ 'b @& ߒp㿘 8 2B`0> !( ` `4*  #: &a< ` * *  ? @X&a@> b? (`0> !&a@&a<#@  *@`@   &`4 A&`0  `<#@ *@@ ""` 0. `4&a<` (&a@`0* *  8   `4  4@  @ ` @  #@  4@ `# `ޑ*㿘> Ȕ `@%} a<: 2` > ! 㿘>~ b`  H >}"p>}",& 4> h & l㿐 /@Β @w @H /e4 L* & L   P   T`2  L@'H 00 > #`Ӑ@#貒 $  & P& L 0  TϒH 0㿐H /e * &  0 /& P & LH 0  "@"  "@"㿘  - &  8> " l' p p L p ' > Ȩ"( @l 4`hh    ,@ ,@l `,@ x** 2@H /e * &  l@>H 0&& t !"H /e * &  l 4h` ll@h2@H 0 > C!㿘 # @ " c@" Hc @(?#@ #@?    @y Y&   0  ` `?& p 㿘 @  ` & H(. @`   `0  `. @  . @ ` @     . @> Ȑ!! 0& <㿘H /e * &  l x@ tH 0 [ d㿐 < `    / 0  㿐.` & 8` `2``2` 0 // !!!!!㿐> ΐ#x  & 0& L> X?b-ސ P> ''# & p @? " 㿘 L"@ $d "!C P t€ & 0& L X)& 4㿈 p x 0 t 2! <* P T"'" 'Вb@ ??  Ð!?@W ?& 0& < < 6 <` L& < <`4>~#x*` €`  & 8`& @ & @`` @ & @2 < @ & @ < X`& < d < D.` <: ` & D H.` <: `& H& < < 8@ X?& < p  @ #\ D@ H& D& HH4?(?" c   ` @@  " 㿘> * * " *  4cL& & &`xH /k * ,  @ *  4  1  . 1a. 4H 0>#> &`tc㿘 xH /k * , 1 `*1H 0㿘 xH /k4 * , 1 `r*1H 0 㿘    !  `p  0 0  *  `@,5  2 | $ |$  . L㿘̒ ( 1 `3. 1㿘  `2 F`` 0 ` 4  $ 4 |$ 0 $ | . L`2 F D@ F  . D E  . E |`$ |. L㿘 H /e * & H /k* ,|$|H 0 `" D H 0`,  2  ``I, `> ͒c `$. EH 0㿘 xH /k  * , @#  L헐c &  & H 0` 8`? `> "` >'aȐ`8> ,* "* ` 4c& & &`4 > &``?&`\ א# ,` @ *  @> ͐#_ `\  > ͖#耊`  >  "  a`" `"a" `\  > #` >  a "` a"   2>    > (#> <` > 6` 2> >  (>  0y !> #\>>>c(&&&&p  * O&`0#\&`p`p*&`l &`|&`t&`x&`d&`h P 2`\ & X`\ 8 @ # ' ''ȑH /k * ,  1 . 1H 0&@WH /k * , @ H 0  @ H /k * ,  @ H 0 > H 8㿘> |   &|> #Г.  0㿘 4 0H /k * ,  `. @h* . `@`t" @ > #`> y  \ 2  T 1 ` , 1, !짒  T`  X >  H@ 4H 0`> #| > b  ' \ #|*@20U`4`t $ $ \. G H /e4`t* &`t  $`pP`"'@ "'H 0> ΐ h# ''`  @'` @ '`  'ȑH /k * , 1 ,1,H 0$`@I\`2 $` # %$`$`$`$`$`떐`t  ?$`tH /k * , x> $p\p$l$te  `,@H 0 `t   H 0 ,M`  LM`  `LMs "$`t ' LM 2$`H /k * , @  H p@ 2`t` "``t $`t` @2LM`t > LM G> `!s  LM  M  ) "& M`t  H /k * , @d H 0`t }$`t 2,M`t =$`t`2`t` @`t "H 0   `l> c@* @ 2`t Q > } 㿘> #| . @ 0 t % 4 l> c@* `@H /e * & .MHH 0 t  㿘> #| . @> 0@ l*` 㿘> #| . @> 0@ l *` 㿘> #| . > `0c@ l`* @`4@ lޫ d H /k * ,  ]@ "4```y@8`x@6@ `z@`{@7  `\@ " j@(+ `m@&`k@*$ Ԓ 0В 0&Z! $``@^ 0 @[ 0 @t0@& H 0㿘 p> c|*  4H /e4 t* & t!5 1鍐 H + H P H o4$ *@ l$ $  t  & t, `1 2   ,`1,`!   F    $ $ H 0`p> |(H4`t(`t " " `t"`tH 㿘 p> c|* `( 4``$`@" `  `   \  @,@  Ā " ; 2V H /k * , @x 3 c 5 ? !   " #" ` 4`@`@ ` 4,3 `d,5  @"`@2`,4& & & @ @   $ $ $@@@> $ d $ h   , , ,L    `, @> #`cd$ d$ h@^ H 0@@  , ڐ@  4 `G `H*`F " `F `I*`F `F `? "߆ *`?㿘 4 J`` 5 * *5@     & & "@x 㿘 4 ?2  l@ " 58 m k@" 5 @@" 5@* } *5@     & & "@G  4 5 `` `  D`2 @` 2 㿘 p> c|* 4 K 4 H /k`* ,`    `*@P    ***L   `*@ H 0 㿘 4 K  58 %  @ % @ *5*% %K 㿘 `p`|`t ( m p Y 0,,  :`xC ?$`p$`t `  ,`. L `  `d ``,`   ``,` 1   . 1. !㿘 @  ꍐ& @ $ $    1    $ $  1  . 1. !  ,  , . L㿘 `0 `\  > !Ȁ``2`2 F D D ` `  鈘  F@. D E  `@ . E$`$` ,`. L㿐H /k4 P* , P& X T& P& TH 0  >  > Θ `2> >   #\> Β`א 㿘> \  l> `l#@ t*` "  4 |    T X `& T`& X 89 <`t  , \* $ ;  `p  ` `@ P X `& P`& X 8 <`@@`?2  , \* $    .  : x2 6& lH /k * ,  t& & t t h     `. `1  -`1-`!   `. H 0㿘`t `&`t &`t `H`PҒ" > `l#@ *` €㿘 4H /k4 E* , E D, EH 0  G > `l#@*`  €  H  . > `l#@ *` €0. 㿘  0H /e * &  .  .  . H 0㿘`㿘>  `Ѐ   ` @@  " 㿈>"` &`0>}a`TW>`xaRahih&ip&il&ih&a\> ,`* "* ` 4c& & &a > &a<?&a8 א# ,   *   > ΐ  a8 "!>   >  > !> "b!""! " !> #  G* #&aLaL*&aH &aX&aP&aT&a@&aD P 2a8 & Xa8  @ N#0` @ H /k * , ǒ H 0@  1`. 1 !嶒 H /k * , @ H 0> H /k * , @ђ H 00K"`&`D> c> @ڒ`  > 6a 2`D &`D`D`H`  '> !`H> #0`<> !(`<`> `H!@`H> #(`a '> ͐!*` 2"> c> '!P'􀤠> #@9㿘!$ʐ >  !X c > ΐ!x̰ 0H o+*@l@B `4 `3 ` `5`@ ``,`3,`5 ,`4)u  !`&!d&!`$`@畐)t&!@ &!D)t  .)t.)y,`L)t   )t `.)t@K@ْ H 0)w .)w@@ɐH/` / ?& H& 8@_ #>#? @ `  @  7#?'#? @ `  @  "! < 2& H@* # #? @ `  H? ?> !H 0㿘H/` /! @ @  *@H 0㿘H /k4!`* ,!`( ? &!`@ )p*)p)l`@&)p)h&)p*@ H 0 @ 㿘!H /e * & )w 3!` /H /k * ,  .)u 1 2 !\ , 1, ! !\5 !`!\)l  &!`&!\)h&!\H 0H 0! `G `H*`F )z" `F `I*`F `F `? "߆ *`?㿘! J`` 5 * *5@  )u  !`&!d&!`"@8 㿘! K)t  58 %  @ % @ *5*% %㎒ 㿘 aLaXaP k 㰐 p 㜒 0,,  :aT㆐ ?$aL$aP it  ,iy. L it  a@ it`,it   it`,it 1   . 1I. !㿘 @  А& @!d$!d$!`!` !\t !`!\)l  $!`$!\)h$!\ 1  . 1. !  )u ,)u ,)v. L㿘 '1 `2 F D F@ . D E  `@ . E$a`$ad ,ix. L㿐H /k4!,* ,!,&!4!0&!,&!0H 0  > !> Θ!؀`2> > !А!#\> Βa+ P> "'!H> !P!"@!X  !0!4 `&!0`&!4!~ < /  `p  ` `@!,!4 `&!,`&!4!~y <`@@`,$ @2! @:!T?2 $ 7&!HH /k * , !P&@ &!P!P!D )t  )t `.)t 1  -1R-!)t )t `.)tH 0 > !!H( `E `D*`EH  `H  *)w0*)w㿘 H /e * & )y .)y:)x .)xǐ)v .)vH 0`> ᰄ ᰝ㿘H/` /! @ @  @H p@  @㿀 ?> ϐ!  ` @&`$ &` R'`$䀢 `48 " 028  8?@4@1?2- `4 ' `4` > `@ ''>Ė'' " `$ "0`$0"`4&`$`$"4"H`( &`(  '㿘" > g" , $ (? 0" 0 8@2" 0 H2 0`" 4 4"`4 4 0"@& 4& 0b  ݀㿘`"  >  : *` @ "@2  > "h 㿘`  "@ @`㿘 $ & 0 & , P@  " 0 2 P 㿘 $   P@  0 2 P㿘 $ & 0  & , P@  0 2 P㿘 $   P@  0 2 P㿘 T` 2`  8 4 $  X$=@= 09` (*`> "> Δp * @ > @#`@ T 8  $ 8 T 8  $ 8 X @ T 8  8 $㿘 X R`   `  `   @!`2 T* 82 $  8. T \?" : ! `2d `@2 T* 82 $  8 X @" T `2` "@  T  8 8 $ T 8 $  8`  T  4 8 $ 2* l# !$ T"  X`> #``& X> Δ(: Xs @?`2?` l& X>a z{̒!?㿘 ( "H /f * '  X  ? T& X`4 $ 8 P@  TH 0㿘 T \`/ 2, 4 8  $ T`4  $ 8 2  h 2 d & h d h  & d P& d @" ?? ?㿘 X !!< T  8 $  8% Ր!`cѐ#``c   T 4 8 $ L   X $ T 8  8 $㿘 X  ?& X{q l㿘 P@㿘 T `0@ ` `,@`!@!`<@ $`0 & `,& H /f * ' H 0㿘 T,   0@    0 `k ,`k `x2<`x`|<`x 㿘 X   T L*``" ι  \( L*``# ί  \'  L* `#  ΢  \) L*``& Η  \#  L* `&  Ί  \%  L*``(   `<@F@   X L *`& h& X`+ m  ` X L + *`@& h& X \  `  X @& X& ha$ L *``0J  `  X`@& X& h!$ L0*`@  6  \  L*``  , 㿘 L T 㿘 X zf l `"   (8 : @2` `2`  `2@ 㿘 X!/  T 4 8 $ T`4  8 $ X` $, *  $ 1$ ( ,, 2,` 1  (1" 1"  (""4# # & 0&  0 ! A !㿘 T  $`,$`0 T `4 $ 8` T`4  $ 8 " T`, $`, T  4 8 $"`0$`,| `0 $`0q 2 T`0m   4 8 $ T`4  $ 8  X @  `@  T 4 8 $ T`4  $ 8  "`0% !`0 `0 `0  `00 @`0 `0 @$`0`0 $`0`0@ ``0@$`0`0 `  a$`0$`0㿘> ΐcD   㿘> ΐْcD >  x  (> &`L8&`P&`8&`T &`X&`h€`T  4`8`$? b &`\㿘 ( `S "`"6`0C<0>` L2  9 0= L2    T 4  8 $ T$`8  8 $0*` \`   T 4 8 $ T%b`8  $ 80 L2   ? 0 K QV 㿘 T  $`,$`0 T `4 $ 8` T`4  $ 8 " T`, $`, T  4 8 $"`0$`,Y `0 $`0N 2 T`0J   4 8 $ 0  T 4 8 $ T`4  8 $ !`0 "`0   `00 @`0 "`0`0 @$`0  T  4 8 $ @`0  $`0`0 $`0㿘 T  4 8 $ T`4  8 $?b  T: 8 8  $㿘> ΐc   㿘> ΐc >  j  (> &`L&`8&`P&`T&`X@`T  4`8`$? b &`\א㿘 ( `G "`"*`07002` L2  - 01 L2    T 4  8 $ T$`8  8 $0` \`ʐ0 L2   Đ? 0 ' -2 㿘 T  $`,$`0 T `4 $ 8` T`4  8 $ T  4 8 $ " T`, $`, T  4 8 $"`0$`," `0 $`0  `0 `0   $`0`0 `0 $`0㿘 4 ?c !2  4  @2 0 @`  㿘 >  ` @ (> &`L0&`P&`8&`T &`X&`h€`T  4`8`$? a ! &`\`T  4`8`$&```\?"@<``@ސ㿘`"+ 08103  L2  . 02  L2    T 4  8 $ T$`8  8 $0` \`֐0 L2   А? 0 3 9> 㿘 T  $`,$`0 T `4 $ 8` T`4  $ 8 " T`, $`, T  4 8 $"`0$`,) `0 $`0 `0   $`0 T`4 $ 8 ` @  `0@ @$`0$`0"W"W"W"W"W"W"W"W"W"W"W"W"W"W"W"W"W"W"W"W"W̝㿘> ϐӒ`|   㿘> ϐǒ`| >    (> &`Lp&`8&`P&`T&`X@`T  4`8`$? b &`\㿘 ( `G "`"*`07002` L2  - 01 L2    T 4  8 $ T$`8  8 $0` \`0 L2   ? 0 G MR 㿘 T  $`,$`0 T `4 $ 8` T`4  $ 8 " T`, $`, T  4 8 $"`0$`,B `0 $`07 2 T`03   4 8 $ T`4  8 $ ?`*`># €`0 `0  `0  `0 `0 @$`0`0 $`0㿘 T  8  8 $㿘> ϐג`   㿘 : *  2> ϐ &`P * :  $ > ϐ > ϐ &`P` >  8r  (&`L&`T&`8`P&`X@`T  4`8`$? b &`\㿘 ( `G "`"*`07002` L2  - 01 L2    T 4  8 $ T$`8  8 $0` \`Ԑ0 L2   ΐ? 0 1 7< 㿘 T  $`,$`0 T `4` $ 8" T`, $`, T  4 8 $"`0$`,1 `0 $`0&  T 4 8 $ T`4  8 $ `0 `0  $`0`0 `0  $`0㿘 T  8 4 $ ? 8  8 $㿘> ϐӒa\   㿘> ϐǒa\ >    (> &`LP&`8&`P&`T`&`X€`T  4`8`$? b &`\㿘`" 0)#0$  L2  0"  L2  ` \`0 L2  ?0 Z0af 㿘> ϐda   㿘> ϐXa >    (> &`L&`8&`P&`T`&`X€`T  4`8`$? b &`\㿘 ( `G "`"*`07002` L2  - 01 L2    T 4  8 $ T$`8  8 $0` \`z0 L2   t? 0 א ݐ 㿘 T  $`,$`0 T `4 $ 8` T`4  $ 8 " T`, $`, T  4 8 $"`0$`,) `0 $`0 2 T`0   4 8 $d`0  h$`0`0 `0 $`0 㿘 >  `Q" >  : *`@ 2G"@ (> &`L&`8&`P&`T`&`X€`T  4`8`$ ! &`\`T  4`8`$&```\?"@ <``@> ϐ"``0㿘 ( `G "`"*`07002` L2  - 01 L2    T 4  8 $ T$`8  8 $0` \`0 L2   ? 0   㿘> ϐb   㿘> ϐb >    > ϒ c:`&`@ (&`L &`P&`8&`T&`h&`X@`T  4`8`$? b &`\㿘 ( `G "`"*`07002` L2  - 01 L2    T 4  8 $ T$`8  8 $0` \` 0 L2   ? 0 f lq 㿘 T  $`,$`0 T `4 $ 8` T`4  $ 8 " T`, $`, T  4 8 $"`0$`,- `0 $`0" 2 T`0   4 8 $``0  ` $`0F`0@ @$`0`0 $`0㿘А @ =  T 4 8 $ T `8* 2  $  8 T  4 8 $ T `8* 2  $  8 T  4 8 $ T `8* 2  $  8 T  4 8 $*  T2 8  8  $"H"P"""|"h"P""|"h""""""8"t""8"4"4""8""P""P"P"؝㿐> bH  !> "bH> Ϛc#\   !h |![ !> > ϐ" c#\  [ "N 㿘> "   " " >  sf   㿘> "{  " " " >t  sO   㿘`> `"?@ А ?@ ْ@ D㿘`> `"k` @ L @ \@ 㿘@~@``@ @&@㿘@r@ `?@&@㿘&& & &  & &  @Y 㿈''''@T  "> ?`"`& """"  > """@'# 2@r ?`"`'"""€ 2㿘>  " " " " 㿘 @  ` `&  &  "@$ & > ڐ 8@2 @H㿘 @  ``2> ` "`$  ?"&& &  `@ 㿘@ǐ  ` "`$  ?"&& & @ 㿘 @  @@ 㿘  !  0€  @  Ð 2 € 㿘@z   !> А  gH  `@㿘@e &  h& @h %''''€' `2 Ȣ> :=Ð㿘ђ㿘 €㿘`>(& & 㿘    @   2  & &  "@$  &  @M @F㿘  @   " 3 > - ` "`$  ?"&"& `"  "` "` ?"&&   ?` 4 *  2 &  hA &  &  @  㿘  ?  G  @   0   @:,  |'? `6 `"`& "@""  "  "@ " "      @:  |2ߐ` @Ɛ  "     " 㿘 @  2 >  H0@` % `'''' 'Рؤ>TG'@ 2``2 %0@@ `@ 2̀ @”㿘㿈 ''''@  |"> T?`"`& """"  > """@'  |2 3 >>#(`T> И? 2ːa`"`$ "@""" ?6 """@'ؔ   !> А  !0e  `@?`"`'"""€ 2㿘  @   @: `6   @ʐ 㿘 @   ?` 6 *  2  f  @ 㿘  > !̰   *ِ0 #  G& & & & & & x㿘` > `x!`㿘'@~`   2ʒ  h Β 4  "    $ $ $$ $  %*@ѐʐ ` * *`  *       *  *` *  '@4X  >> c  @ 2u`m    2y  b~    $ $ $$ $  *@*`*` ` *`*`*`@{"4# C   . +` (      5`-    5- @  -`4,-,      `    *  *` *  '@3 ` 2``F `2'@  㿘   # &&&*@0 㿘 ' $ *`*@*` (&&& &$@t6 :`  `  `   `$  @0 㿘@t $(( ?  #'    ' ' ' ' $ 6 *@*`*`*`*`@0 㿘 &@   &# && **@0 㿘~    &`&!0 #& * *@x㿘h_ \  '`'`'` @s'`$` *@*` *` *`@^W㿘h> \  '`'`'` @s'`$`?# Z***7 **@92     ( (     㿐\&` dh'`  ?@`2$@ 2$ $" <  " #\  y   i&$ " #\  "Y*   Q  $& *  A 2@  <   '`    *  *`  $@`(   *  *  '`    *  *`  $@` * *   *   ?@ 㿘 a   &&& &$ *@*`*`.@ha0 㿘*    @  &&& &$ U4 *@*`*`*`..@E>0 㿘(#  ' ' ' @rk' $ 6 * **  66* * * @"0 㿘 " , $  " (" * F0@㿘 ` t€& 㿈 p%'쀢`''> *!8 t " > #!` "> & > & t& p@* p  !> А !a  p`@^@?"㿘 p > А!@   & pcv @D㿘 `  +  ,` *`> P €  (@@  ?@ >  ,N!   ?`$ 㿘    .`  "   "@*`" * * ? !> 1> А \!!aA  ?㿘44 ?      > x( €($@" ( @    *  d  @}@y#`$d_dqdn0W  *     ` V]bZ bW`$?# @3`$O U K V G  C VC!G  *  c > 3   *  ! 4`$!`$`?# @3`$ `$  :  ?    *  b   V  @㿘 8 ,` $`> В">  ! L㿘 4 4  ``q> >    > @  6 ``  |  > *`* @ @ # 0p@q>   `` > ! ` > !   ,  @> !0 ,  "> > !@> !h   * *`  *  "  "> > !!> !p  ,   * *`  *  > ϐ! @@py > !Ē `> !ؒ @ @ph > !㿘> "P@p&  ` *     ``bP0"O bP> !X* bP bP bP M  p @> #> #> ^> Y > 8T > А#  `    @ `D`` > p EbP A "@bP`;> *` € @> " > "(*> 3 bPa # !bP > "@ 8T bP*> H2bPK bP h  bP*> `2bP< bP㿘@ *3 ` ( "`> %> @P` K> @, *> @`? `*  `*`  *   9`m!k`` *  *  *   9``*\&``` *  *  *   9`** *`  A&` /`+`(   -   5` 5- @@ @ -`4,-@, @ @   @ 9` ` *  *`  *  &@Ր"x"""4"4"$","㿘`   ` @@| r 2 u `4``$ `   ,X $ \ ` $ $@   ($ @ " ` "  `D 2F   $  ` $ `$ Q$ .`[ F.`Z ,`$>!T*` € $ (" &`$.`[ .`Y 4`(W  > # .`Y 4`(L     .`[` "  @ " `  - 㿘`@@   2 x  +`` @  + +  + +   + + + ` + `+ `+ ` + ` 2 + ` `+ `+ $ `   + $ = `$ $@   ($ @ " `"  `  2'   $  $  $  .` ,    .` .``"  @ " ` |  -5 㿘 !@*! @" $' 00!@0!@">  0 *  &&  & & P& " `00E  ` @<: !@  !@> ,#0!@&>  $#  $?# @3 $ 3 $ $ 3 $ $ @3 $   $ 3 $#C""""""""""""""""""""""""""""""""㿘`> #  㿘> #X`> "!&8`.&`0" 2`0 6"`0"6`8 `2`8 * `8> #`0`8` @> } `0@> @" > >  k> h 8>`l&`4M >  @[`@㿘?@?㿘 @   @4@ 㿘 8 @ @  2 8 㿘 0 @  @  2 0  ` 㿘@Ք 0 , 0'& 0Ho  ?"`m1 0m0 Ho  "`m5  㿘M8@ " 4    > > >  ``p!$㿘`  @2 `  "@ @"@ `㿘0a@a@"8 ?2 ?2@0,") @5!@?2 ?2@ 2  @ @ 㿘 0 `" @ `"   㿘 0@k d @  2 $\  * M  >> c  @E( )D  >> ! !c ( * /   * *`  *   2 @   2`   @@@Ւ`@*Ғ    @@ 2` 㿘 0`"@6  @&    @ߐ㿘0 `" @  2`" 㿘 0`  `"@6! ` @2 `   @b  @  2 `  㿘 0` "@6B  @ &<  68 @8 1 `$ ) `,j "`$@" 0w``*/  0 `"`x@`x "@@*   4 "  2  2   4"@" 4 4 @ " 4 2?""@9 @ " "  " "` @ " " """    􀠠"A @  \    @"*   @2 @  *   *  \_ \* @ 00* @ 800* @ 0*  @Ò`*> " < <  ` `'@2  `  > >  >  > >  ">  #> ؐ#֐#H> "cx3 `.>#-` €> (#> %#> "#> #> #> #> #> #> #>  #>  #>  >  >  HȐ #   h   >   P $b" >  p >  >  x>  >  >  b > d 㿘`>  ^ @> "'  .   &  2 0% } >b$ (4 4 $ | |$  < 0`0 ` @ "  2 & $ &Ȕ  $  >> $ 4 $ & 4 &)> ! !  "ʦ  $ `@" $```` 0 $  " $@= /`->  $(*` x`"`<`x "`< "> @2>  `2> $`  > `<  : > y > ` ! @ > # ` ( &  ? &# @4 &  ? &# @4 &   ? &# @4 &!4 &  & 4 & &  4    $ 4 $> '#'f   >  * x $(    ! 4  4 ! >g^  x " $@6 $@" 0 '  0 0` `@'  > cY 㿘 2 '5 `@2-`2)@h:`` d 2` @h/ `  Y 2`@h$@` N  @@'в@h> " x ' 2b >> c  @)> !Ȑ $ !bˑ*` *`     ``" * b@ b > bؐ 㿀'> ¨ u i  *    %(b T  +$ G@ @    ` $ @ ///:/ 0   4뀢  & ////@ 뀤ט"  "    "     6 @% x  & 㿘+X㿘` $    , ,, , {  (㿘 ? . &j "d"P""""t"P"""""("ְ"D"ؤ"("("""("L"" "4"H"\"p㿐> a  㿘>&`` $`(`$`, 4``&`L (``$b> > c  @2> ` &`> 4!`>>`ta] &`Xoh 0㿘`" `    !0 `@&  㿘 >   "h*` )> > >#ctbh`'D bh "̠  0 > >#bl"̐`', "̠ 08o 㿘? 2  @ 2` `?> sא!ؠ 2   @ 0h6  o z  `$ >I`  4`$!!    7! "K .   ! 2B `$ 4`$!!@ ?`$# @4`$/  @  `6" ,@ `"      *@$  *@$    $ `$`4`$   Ô!`$?# @4`$og㿘?2  @> !ؓ2`s>  2 I  @ 0gB o\ g09"      **@$  **@$    $  Ē }!` #?$c 2$ `$!     Ēb$ 2$]v!c o'g\ 㿘 D? @2  `@> !r2` 2 % @"   $`2   <(@g 2 ` @ l  >  g'0& 4 0(& 0 <& @H /d * %  LH 0 g㿘 , @$  R 0( 2 敖0j`(4  @b^ D *<@@f@$0 @ ?,@2  ` 2    *4`*4`*`*`*   * (+4`+  4`4`*`*`*`3`+ +  &  h@& !0& H>& <"& t& $& 0& pm 08 ! > % ؐ n 㿘  , p` 6 ,> ܓ*` € ( <`0 0"@ m۔ `$`aa$`[b 0?@ P  ?$ 4 ($ @   ?2&  ??& 0% 0  <($ 4$ 0$ @ < (`0 0" m H /d * %  gH 0ߐ㿘 D? @2  `@> !q2`  "    ( <*`" 4& < `0€f㿘>>#|P'㿘>>#|P' P> b?  2  @> '!ؓ2`qr    ` @"`eА `$ _ ! @"R $c@"L  !@"F  Fc@Cc @ p@":  c@6c@ 3 0/ #  `q@")  !@"#  # # @`m @0 @"  !@ $0!@2@2$  $   @8Qc@()c@c @!@Z m c @c@ d c@"B$ c@@c@ V c@"!`c@"` 6c@c@ C c@"` `p@`s@q 3  #@2 #@ "# e e@ "r` r @  @a #@  @ "# @s   `m@a`q@ِ   e`g@`f@Q  h@"E` #@y 逢  !@ • 0#@"v 0#@0#@ р 0 @2@Ð ǀ   C!@Җ `wx!@ǖ 0w!0 &`*`` &`0 lE `$``i ` $`l<0@ @m@ #\@|@ v@1q? ,C@Ӛ cÑ*   8uېW   @ M` &d ?# @ `*`2 @7 v 07#$  #!n * `@  '   "@` !?#?*`  $ ``&$   * 2` 2`*`` &d ?# @ `*`2 @4?8ud> ܰ   O#$   @b @ ,``&$ ?#   * 2` 2` &d ?# @ `*`2 @4  ` 8`&  0 @@S @|     @     @ {    @ r    @ j    @ a@ ]@ X V S`Ē P M`Ē J GV  "$? $!;2$  6`Ē  0 ` @ ( 0%2$$?#ϒ @2$@y@p@@   `Ēbې > \!㿘@`Œ!  e#$`Ȓ d &(&8&0&,`Д @^1 d`&4``$"> a  > a  6> aȐ `В 6p&<  !W&&&&6rb6@m  "   "   @  ` `2 ?2  @?6 `# @ `* * >c|@㿀'    2`5  #`#h#\#d    "  * *` * *`  `Ė"  퉔 `Ė"  d 㿀'    2 #  #` #d#\#h 쯚  " `  .@ .` .` .`Y  x'    2`_  #`#\#d#h N 쀚 쀢 "  I  /  / / `Ė/#`#h#\#d a 쀢 "  *@ * ` @* ` * ` @*耢  `Ė"   `Ė"  ˔ 㿘 &  $  a@$  ***/(0 㿀` $b'C     2`:  #`#h#\#d    "  # ` *`  * `   `Ė"  싔 `Ė"  f 㿘    $ a@$  E*6`*6`* 6`* * 6**麐0 㿐A @>   #$@Ȕ  0  4 @ &.  `  `  J  ? `  ;  .` #\ `@ 㿘 X  $   \$  G* * * * * * *\U0 㿘 :  $  '$  K**E>0 㿘 #"  '$ 4-0 㿘 (  #$   $ $ $ $ B`*  * @7`***** 㿘 )  # $ $ $ @^1$ $  C`*@ ` *`7 *`*` *`*`㿘   Ԛ 2`` "   +   š 㿘 b Ġ(> & &(   Ȁ> Ѐ" &  Ѐ   Ԁ c b> Ё ?? x> "' { ' !0 $ $   @]$ @`  >!*` €  + ++   ($ $ $ng bߑ2 .`  ++ ` *  +  $ $h$ UN b`ri b  ++ ` *  +  $ $h$ :3 b`+ܐ +` 2`+ *2`2`** + ` *  +  $ $h$  bܒ`2 2  2  .` .` .`r$ b  ++ ` *  +  $ $h$  bߐ .`  + +` *  + /ِ`q   $ $$ Րΐ jb f.@  + +` *  + /ِ`qܔ   $ $$ 궐篐   G.@E.@ +`*``?+ 2$   + + +  ($ $ $ꖐ珐 +bܐ ݓ2 ޒ ` 2 .`.@.`.`.`   + ++ ` // $ $$ pibe b > Wؐ!؁8> "' @( i a0  T$`  T$` $`@\$`$` *@** *`<*5`M` @\k ?**  * +`*`+ @ 4 +(( ` @4 2 2`  4@5` `   .........& &&. > " > WZ!㿈> "' ( " a0  $`  $` $`@\$`$` *@** *`*涐 .`.` > W#"㿘(  2 - 冒(  A # $  (a0$ $$ $  *@ *`*`* * *z ``p( > "' S( ) a00  $`  $` $`@[$`$` *@@*` *`Q*`J 01*  &` `p\4 > V"㿘(  2 3 (  ̒ ) $  (a0$ $$ $  *@ ** *  @ `*&``p`  㿘@` >!4*` €9 k 㿘  4 $ ` 4  ?   @"  *  $  `& 0 Z㿐> b,  Ø㿘>&`0bX > "(2"`|Q",@㿈?> 2 `  6C . @ 2 0; `$ 7  2`$ 0 H! 2) 0 H  @ "@ `> !@p 2 0 @  8   @$ 4 ? $c 2 $? 0>  * @?0`$ 2`$㿘?2 > ° . @#F@ #D #H@ X  cC@. #F@": 8#D@"& 80B #E@"$ H0< #A@ cH@/ 01 #B@ 0+@/ +@ '@ # 4" "?@$ 8  # 4 4" " H" L" P"  T "@< 3 0㿘@ 4Q `4M +  H`?@4E * ` ?@ X<  @ :  85    `` 0r  % a$  b $ $  ( 4,,`2 2`2 22`((((((`   ( d]㿘@`4q `4m ` 4i +` H`?@4a *` ?@4Z + `?@ \Q  @ : "L  @ :  8E  `` ``@ 0  1 a$  b $ $  + 4,,,`2 2`22 3 2`2++++++++ `    + `   + 㿘@ * 4  H `  +  : ` 0    a$  b $ $  ++ 4,`2`22`+ + + + `   + 泐㬐 J@ @ "**4 *J@ @ "*** `" `#(2 "㿘` .ݒ` @*ؒ`0㿘* `H   `Z   O$`8 $@O A *  o    4@5 '  *   , *     `@? Pl˒ `ƒ 㿘 0( a# "  $ $  $ $ $ $ 6`++ 67 + + + +  7 * `*   + 㿀  ǔ  20r  #`#\#d#h  Ú  "  ?    *  $8  *$H  *  $<  +`@$L  ($@ * $P  ($D  (0$T#`#d#\#h`  : 0X@Wƒ \@W’     ,@ , $ 0$ 2$ 㿐> ’b& d   `& d㿘  4 $ 4`    `  @"  *  $  `& 徒 """h"h"H"$""h"h"㿐> bl  G㿐> !`>! &`$(`$,a&`L`첒 $" " C&!4& C 2$& 4&$"> > c  @2> ` &`> x"a$>>`ta N` $h2$ A$  ` ⧔  `@*$  `>  xy"  > #8 @X @T_ >   #x^0> xZ#(0vʒxU"  ?`u@ >  2 >   '`v@א> >  6, &a> #hx0_q 0㿘`" ``"  0 䀊 @%    ⽔!0!$`@ߕ&  㿘 >   "h*` )> > >#ctbh`E bh "̠   0> >#bl"̐`- "̠ 0!`> 5 3_ 㿘? 2  @ 2` `?> cҐ"@ 2   @ X1 `  0`$  0X& _ } "  `$ >I]  $h2 `$!!- `$  4`$ ! ᑔ! "A ' `$, 4`$@  2  `$?# @4`$- @h ɀ `6 ,@ `" "      *@$  *@$    $    $` ᱔!`$?# @4`$_mW㿘?2  @> "@2`c,  2 S  @ 0WL _J W0C"      **@$  **@$    '$  䀊 @  `$   a!` #?$c 2$ `$!   s  b$ 2$MZ! G!$_ W@ 㿘 D? @2  `@> "@bɓ2` 2 ( `@%   $ 2 <    " < @Wv( 2  `  @ \Ő   !$W0& 4 0(& 0 <& @H /d * % -H 0 V``  +@ 0+``0* * +`  ``` * (+@ 0+``* 00* * 3 +`+`  ```  +@ 0+``0* 0* * 3 +``3 (3 ((  `㿘``  (@-55-5-5(``55(((((((1 (` ` 1 (1 (( %`㿘 ,`䀊 @$ `Ð`0ꙮ 2`0 (4`   @Qϔ  D *    B@  &  <!|& t& $& 0& p]L`0 ` %`ጐ`䀊  ? %`, a$㿘  , p` 6 ,>"*` € ( <`0 0"@ ]/ `x`a `$`J 0?@Ȑ  ?$ 4 ($ @   ?2&  ??& C0% 0  <($ 4$ 0$ @ < (`0 0" \ H /d * % H 03㿘 D? @2  `@> "@a2`  䀊 "    ( <*`" 4& < `0€UW㿘>>#c㿘>>#X 㿘? 2  @> "@2``ʠ    `䀊 @U( ``$ )  !@"  p@ !   q@ "  m@  $0!@2$   $ ڰ ذ   m@ "8"  u@ `p@`s@0 0e e@ "B` rP t@ 0@1 0v@ "  q@uh@. 0 !@"tV  e`g@`f@ 0&  O!@7 `g!  0@* 0|g !0x` &`*`` p&]`0\Q i`$``Y 2` e g@2`? 2  @?`4# @ `* * >`@c` \,$`0?">  8$` 5$` `W@ - "$( $ !"2$`w @ @F  "` ]T"h> "'@R!@ `D猔  `@`L燔  ``\炔  Ȕ $  > au "acǔ " > M## 㿀`$('k -   b  s  !> Z !`  #`#d#h#\  k F ?  `  ` v2` @ ` u@1&.&  %  +`  ` ` *`  ! "    "  ޿ P> "'@Qh!`&(`&0`&,`hX&4 &8 d&8 6` `<  2 > > c[ `cАU ``D@V ` @P`L>  r @Q^f a 6p&<  !W&&6r&&&XS? 2`  ?6  +  *6 >c@9 > L4#㿘 䀊 @~ I! !$㿘  4 $ ,` 4 ?       8 C0 *  $$  !   ? 0*㿘? @2  `@> "@^H6` 2 ?<? @6?`  *@2   P '?  $`.`  ࠀ`"??( 2 @  B @NQ    ږ ??Rq㿘> "ج`? 2`>   "@2  %؀ = "@*@`7` (@R U @R4, @ , @M= ,  @ C B  >D42 2 @+ ) ' D$"%`ٻ    & & & f& $ .ݼڵ  %ذ  _(*``  @*h '''''ڝ>`   m       #`#h#d #\  d 2    2  耢`2    "  `$ 2`$? $c 2 $ `$(  ` 4 2 <`  <   2K$ #\#` #d#h  %  䀢 ?  ``@# ` 2` `*   `0( *` 4,( @ `,   >`耢 r   *`@ k'@  #\#` #d#h  ؚ 2"  " ? 2    *`*  @ @ f =f`@L 5  #\#`#d#h ܘ ۨ ' ܀# ?   *     *  '``@ eϐe͒ >` ; ``@$ 2&` 耢 ""&` ` @"`d"`b h@"` @@@"`1 `  `e@?c ! &@&`  &@ &@`&` ?&`2 &``e{@`@K &``  ` &`&@&`㿘 &!  5`*@` ab&`&`&`   ?& #T#T#T################T##<##(######p##L##(#####"#&#&#&#'0#',#'\#'t#)P#'#(#'#(#'#(#((#(#58#58#4#58#7#7#7#7#58#7#7#7#7#58㿐> `l  㿘>&`D $ ,$ (@> o `>ǒܐ>`D`H V`?&`l&`h $?# @4 $㿘``  0`@& 0 㿘8  ?> ֐ 2  bh  @ 4 #'> > >Ũ#ctbh       bh`@̢ @# > >Ũ#bl̐l  g  b  ] ̢`@0i 㿐> c  $^  `& P`& p`@& 4㿘 P t@Mb  .   p@` $`  .  ,`  . 㿘? 2  @> "hO(2` 2`09  @`D2 ` $ , )  4 $ Ŕ! $` @ؔ  2  $`0(`@` ` $?# @4 $ `0 $`0O 㿘?2  > "hN6   <  0 @ !3   D @  `"`$ ``" `$ @ `$  2 `$ @ `$ @~ `$?# @ D4`$Ɛ N㿘?2  > “6 N"h  _  0 @(W U D p t  $ 4@, J 0  4`"`$@R @`$"@ 5@ 0 " g |, < 0   $ 0 x  $ 8`$ 0@D @2  >  mے 0 `!@ 0h$ 0`$ 4`$NR㿐 0? D& lh& h @ @ @ @ ?!@` @ @ 0? 7& 0 $ @ 4 $D$" H0`"0"" <L2 <0"82>Ą|(0`"0""8""8`"04 `20`0"0`"80"8"0 < 4 0&000"0 㿘 D? @2  `@> "hM2`   0`@" <*& 4 *`"  H@N 8 >  8 m'   &>  L`  >  L m ؒ  & 4ᨐ z M0 0(& 0 <& @H /d * % H 0 Ms㿘 `,0 @؀(`$ ?# 2`$Ḑ0᎐ 0 i G `0@$  @ ":0`0 `<($`0$`@$`4H /d * % lH 00`0$`4`< 7$`@$`00 $0H /d * % OH 00 "! `0 `<h$`@$`4$`00 ?$0H /d * % .H 00  @J`0@   ,0 ~`$0  , (& 0 "`<  , 8@K`<2 ,  2 * * 2, 2** l0   *` *   $l#  & & `H>& `<"& t& $& 0?& p0@*@ $0K0ې q㿘  , p` / ,>Đ#ȓ*` €ැ`/`0 $`0`Al 07@X  ?$ 4 ($ @  ؝ ?2&  ??& 0 0  <($ 4$ 0$ @H /d * % yH 0㿘 D? @2  `@> "hL 2`   D`0€L!㿘?2  @> “2`K"h " `0 @ >>ɒ! L  㿘?2  @> “2`Kא"h " `0 @ >>ɒ!  K  㿐?2  > “6 K"h    0 @ ! 8@ < a@a@* D0 !@"0V D@? ͐@I  6 8& <& x& |& D`$ " 0 6 0(" > 6 >6 @6 h& l& 4 >4 @`v>Đ#*` €@   @ &@ /   @Ӗ #  @ y   0s @ߔ m @ٔ h @ `  @ Z*1$ 0-$ 0@ L`2 H `@  L @ >  L@:$ 0 0$ 8 $ 0`( , <.  DC'@Ӓ >  j} , <`$ 8 0 $ 0 0 ?$ 0V  " 0  8 $ x < , |, J㿘2 D6 ~ / # $   $ $ $ $$  . 0`6 . 8`@IА: 2.2*`.6*`*`f_㿐 D$ ( h@   !0 `&`&` &`$&` *F? * *` *  $ L$ HpD '    ` 3  #\#`#d#h ఒ  0 " ` ` " $ $ 4 $?# @4 $ Ő 0-` € @ ` ` *  $`$*  @ !$` ` *  *`  *  $( 0 " ( 8\Đ$( 8@F($ 8$( `$( 0 " ` 8@FҐ 8@Fΐ ` " ` h? & h& l 0 M & 0 ` @" ` 0 @ & 0 ` 0 0 2 @ $R  2N > ! gF  "  0 2 0> !(f  0 4 ` & 0 $ 2 0 8>& 8 0 ($@ `  ` ` 4   $  8> & 8& 0$ $(Ӳ㿘$ ٔ  6 Ò '$$`8(`82`0`0    ?$`0 7  Д s 0 2`8l    㿘 &`0> 2`"`,fr!`?> „ 0  6 * 20  $ 0$ ? 0>  ␐* @?0`$ 2`$㿘?2  > b. 0#B#C#C#D #DhP> b 'X     > c  @ Q  N > c  @2G"  `2B"   5< :8 :> #X`2 h &   & & & & $& 4  + ++   ???????7    >   ap @? " > ?s!x㿘`&`0`4"`,> e!&`@&`D&`@z  > !e0@`D $>ВaD  &`> e!`H&`&`Dv ``D@ `L `HQ@`D`@P`Ȁ  >ђa$Ȑ > !em`&`Ȣ``"`@@0L &`@㿘 4 Ȁ $ D$ D  Lh    D6  H  H@ D `P H$  @   P> #X> ` '   0Kh Ŕ ` @0  $` $`$`$`$$` ` < *`*`*@*`*`IB       & < & @    @ @ * * & D  & H @Œ & D& @}   T'  @  H %> $ H @ @$ L$ 8 d`@  P @  '> $ H @ @@$ L$ 8 d۔`@  P @  & ̀`& Ȑ $ H @ $ L$ 8>  b   P  $ H @ $ L$ 8>  b0є  P`   2 & & @ &  $ H @$ L$ 8`@ P  @ &  > > "8 㿘 4> #X`   0n( " $` @$`  <0` $`$$`$`  <  *** >*`2`2`*h*a " Dא0 @6 đ,` H* @ D H ?`|$ D>ΐ" *` € L       D` ]  D   E  L "   "  P DC L DI!"  DD D 8  <$ <2  D     L    * D" D& D      $ D< 0$ < L    D     $ << 0 L @@ < 0 D`@y,` Ģ * @      :` " <" < `@P,㿘0"$@@ 㿘`  2^    4 Ƞ  ` @    @2   Ȁ <  @Y  `.@`.`> #X`.` `  0P      @!0  $ $ $ $$ $  ; ****LE 2  㿘  @0(@(b2*@ *@ b 2`* @ *`B2*@ *` ? ?@0( ( @ @>̖  3`0 @#Q#Q#Q#Q#Q#Q#Q#UT#U`#Up#U#U#U#U#U#U#U #U #U #U#U#U#U` @   `>      `> `  h> "&`0`4'"`,``0Ȓ`D~ > bX; ! 2&`< &`<> bu"`@ϐ > "hbm`mb`P 5>ԒaD !&`> `b\"`P`"'`H?`P P` T"`T&`T T P"$ T$ P1 `P 2`P`H`P  `X  P А`H "&`P>Ԓbx! > `b&"`H`"`P?`H`"`&`L"""  `H 2`H`P  b`H `@ &`@b > ;"㿘 4 H " P!Z H " P? H`"`& L""" Ò  H 2 H P # 4 X  P " @? P  P` T"`T& T T P"$ T$ P  P 2 P @  _ 㿘(    g > #X`2  0ɼ( 2`X ( +$`$$`$`$`$` `    *`*@*`*`*`͹ʲ = 9  * @h2         *`` & D j  & @@? '  #  @   㿘> #X`   0Rh   $` @ $`  D+`$`$`$`$   *** F*`2`2`*N*G@  㿘ѐ 2  ` O & P P& T& H H& L @ W` @ ` 6L   "@  @ ">     5  > /   4"" L" L"@ & L" > " #  X Ք  @, H$ 8$ L  $ P T P$ T T"& T  &`5  H " P? H`"`& L""" n  H 2 H P " ? P P` T"`T& T T P"$ T$ PU  P 2 P 㿘 4-  0@ P 5 L @ ?`>ѐ#*` €    $ < H "     @  P@ P@ڒ P P 2 L֐> #` 㿘0"$@@4 㿘> #X`  `  0(  $` @ $`  D+`$`$`$`$   ** F*`2`2`*%*@  㿘 4n ? H.  `@ $  @ 2 *@  * ` <*````"0  `  *` ` *`X  O K `L 2 :`0 <"`L00`L+>ф( "   5A j>ф(      5A ja :`0㿘`L G?7`/ /`f6..`0((F6..70 @>`0㿘`"!@>  _##8!@> _#H 㿘``/  > )#X "   > !( `Q&`48B@ P "8, 2  80 @ &  > &`8 c0 2#> > c`@̓> cp > cx 2 `8`8* "`8 "T" > b   < " > c@w??&`D&`D`D &`D> ^#`8<@ @ %&`@ `> @"> ,> (@ > $@"> !> ,@"> > ^#> ^#> > ^z#> ^v#> ^r# > ^n#> `@^i#> ^f#@O B> 8 > rcX  > 8lc( 8g0 2'8 ''@! %> #>Ւ@@Ȯ   'b(; @ 0> ;c(  > `@1#耢 &`0"% > >>>؄>لP"\"h>>>>׆h!a"p"`"d"l㿘 8@$"! 8@耊d! ?S  8d ?   >  8@#> `]Ք!W> ]Ґ 8 8 |` " 8 @!,@2 8"@ 8"S  8  "S 8  @@ `2 @ @(@" D@" D 8,@2 8 D` *`2  8 `   8," @@ 2& < 8" & t& <㿘~ 㿘`` 2 @ 㿘i  8  8 㿘 8@#> $ %> @耊d! ?S  8d ?   >  8@#> `]/!> [ 8 8 |` "& T& XbԀ  >  @@@ ]  T?@@*" 8 & P'bԀ >  P] X @,@  t 8 "@ t 8" 8"  2 T P`  T @l& L & H> [X x 8"  @ T 8"` @@2 8 T> , P @" 8* 8"  8  @,@""  8  " <㿘`8`0> "Ԁ` > >   `\B> > `!H\`8? ="`8@  ``< 2`8> Z!`@$"!`@@耊d! ?RL `8d ?   > `8@#> `\g"<> Zא 8`@,@ @`2`8`8@ @@ "@`8`  耊` ! ?R `8`  ?   `8> > #`\3"<> Z! ="`P`($`<bԀ "%>   € ؠ@€  ؐ * @  € آ @€  \   ؐ@€  bԀ > ![ 퀊 2,`P ؒ € ؠ@€   * `@  ؐ@€  * 2 `P`P@@2`P 倊 @" `P,bԀ  >  @! € ؤ @€   倊 @ @€   [>`T"> "`2 `X`H "`X`L@`P`X ""`T@"@㿘 8 > }" 8> ` " !H[k  \@ 㿘`"!@>  [^"(!@> [Z"8 㿘``k 2 @ P "8, 2  80 @N &  &`<8&`@ < " > bH@??&`8&`8`8`@ `&`8c> :` ["X&`48  ''@ %> #>ْh@@|  Ғ 'a<8d @ސ h㿘`"!@>  Z"x!@> Z" 㿘``~ 2 @ P 0 @ &`0D&`<4&`P4 2&`@&`4@e < " > b@}?&`D> Z"0Q > Z"0J> b@i??&`8&`8`8`< `&`8c`D :` > #> #> `DZ"&`48 "' '> Z# @@Y #> !>ْc(@,@  @X '#7Ζ @H c(㿘 4#> @c0 t  & L> #8 ZM05 @:& H Lc0 4@ʖ H (`8 * *    L`4  @2 `   " `4 L@ ` "   H&`8㿘 0"!<.` L(   P &@("!@ 0.`( H @` 4   L   & L @` @ޅ.`㿘`0 $`  O ?   2`D> #XYÒ`0@9W`<$  `D$`T`<@9P*`$ `D *``<@9I$`X$ $ `8 @ 2  < $㿘 ` ` `L@`㿐   2$ B  0=$   Ē  ( `2( ? $ '􀦠(  [        ( `2(8  L$ $@&@ܢ㿘`}X`?㿘4``h> Y4#x0> c@?&c(>ݐc\.c0  @5 4&c <  @/#`&c H @) &c$&c 0@+&c> c@Д??&c,&c,> c@ǔ??&c0 8&c0 8>c0`x `&c0&`0`0&`4 @b@pb>>@┐% @ ?@}h #   ! #   #&b@ ! #   #&b@ &  ! &   &&b@ ! &   &&b @ (   (&b`    &bb`K >>>?&`h!``l<" $$$4\$ $M_Ȑ_> c(#Xn8 > cp| `@"&㿘cL $ \@/ \ $@ @icT#cL!܀ !"   ! !!̟€ ! E!܀ !"  ! !!̟€ ! "  D  &!&!$ !?&! D " D  c<* @ jcD8  ," c  ""  2! \$6 \ c $c8"`cL 6 Z$cL$cT㿘#p 6 .w#\#"" #b " # M #" `?"# #c   M ## `?㿘H /f * ' ː@~H 0㿘>   V]c!B  >  > >  (WJ >  `WF㿘 @  >  >  > >  W0 p>  W, `n#L h"#P#D*`#`` `@a:  *`#D#`` "$2Z#L  ##P##L\2\#L?# ##8 #㿘 h 㿘#X#D, @ # % @@  #D*  "@!`  #D@ &#X 㿘 h#H /f * ' @DH L`@ C 8`#@#D#H#LJH 0#\,ے 㿘 H /f * '  ! "# \! :0!5.0 !6*/ \ 6 \ ` @:& h$`4@  2 \x \ ?6 \  @m@  `4 ߔ"Yz h`4  \ @ @ H 0㿘# h# #H /f4#D* '#D  #D @ &#H#<   #< @ &#@ #\@ #D* #@ + @" #D ("    #@ #D*`   + " #D"  "   $#@&#L&#T&#P@g&#X@"("*  $c""* $c""*`@ $c $c @HK  $b  $bP $@#H$ #H($ TK-#,$ $ $>$  $_X? $ , , $ ($a$ $ $ $ $b,$ 0b  $b c `$c \ @ ;4\H 0+В 4#$    ?#d ?#d#㿐#$#(`>  ؒ Up0# $   '$   'K6   ?$'0  ?$'0>  UM 㿘#4      > U>!(M1? @ @ @ݒ @ڒ ` < `@Ԑ?< >@ `@̐?>@#4 @W@U @R *?@@K@I@G@@ @ *?@@ @@㿐c4 c$ $   '$   'J  6  >  $   '$   'J  6 !(TĒ` 㿐c4 c$ $   'J  $   '6  >  $   'Js  $   '6 !(T`㿘#4     > !(T 00@. @+ @( @% `. <@ `@?<@ >@ `@?>@@ @  6 > `@?>4 `$*``$*`` $`#d $#d#㿘%  h> !@T3  B< #<`*`   2  `B <  D`B <  @ Y& 㿘 a !"  0 2  & & #&`  `   ?&`㿘" X  F B  # I ?    >  ;!hu ` ``*  #b " b ="b ?*   Ih ? G $ >   !S 㿐# h \!c  @$c 0Sc ?$c  \b?#$c@$cD$cH$cL0F?c$c@$cD$cH$cL \="7777"& w6  ?;n #       @2?2 $ 22*  * @0  2  ؐ$c@$cD$cH$cL \ =6 \㿘`w7`?㿘 @`h> S!0n> a@Ҕ?&c 0  @ 8&c<  @ &c&b 0@&b> a@?&c 8>#`&c&`0`0&`4@ b`F@ >>&`h Ha>?c4"`"$$>>$4\P}<  } # #}3 $ $GZYՐ> c !R8 > avŐ `@"&㿘 \ $@ @\,!܀ !o  ! !!̟€ ! "F$,!܀ !Z ! !!̟€ ! "  D  &!&!$ !?&! D " `>`  `*   8 ' ,`"  `"a" $  $$ \$6 \$,㿘# #,   H ?    $@@`  G ? @ 㿘ڐ@2㿘> b P̔ !`B >!H /f * ' H 0㿘"# *`2 2# `#߀@r?"  @  " @> 㿐#$ h %#(#*( ' 2#$  `B ;  #$?  &#$#*( ' " #$ "3 Z#(  &#( \$ ;3 \  㿘#0 #,`@ 2� #  @ @G` #* `"@a   #@� 㿘`h@   > " Qf`  B< @  `B < @ > "@QQ`  B<  @ > "`QD`  B<  @@ > "Q7`  B<   @> "Q*` @> "Q"` @    BaB < < @> "Q `  @ > "Q`  B<  @ > #P`  B<  @@ > # P`  B<  @ h   BaB < < hd  aB < db  aB < b > #@P`  B< a> `P#X   B`B < < ``@  aB < `@`  aB < ` > #pP`  B< ` > #P`  B<  ` > #P`  B<  ` > #Pt`  B<  ` > #Ph`  B<   >  PZ`> `PT (8?㿘 H /f * '  ! "# \! :0!5.0 !6*/ \ 6 \ ` @: ? h$`4@  2 \Ӑ \ ?6 \  @Ȑ@  `4 z#4S/ h`4  \ @ @  H 0㿘# h#"H /f * ' # 2 ## @W &# #   @# @M &#  #* #,  @ "   # # #*`   , " 4 #"   $## $`# ($` &#$&#,&#(�$`$`$`$`$`0$`4 TD#$`$`$ `$` `$ \ X  $`,`, "$`(` , ,,,, , ,@ ,    dE< ? $"  ",",",",",",@B,\ `@  {a4\ , H 0㿘%  h>  @O6  B< #`*`   2  `B <  D`B <  ; T) 㿐# h \" , `  dDՐ `    ,0R \"6 \7777"   -  r  ;n # ? `   @2?2 `$ 22*  * @5   ڐ , `  dD `$   @`,`$ @ #"` @ ` "` "`8   㿘> r h`?㿘0  &@4@" > 8`p" &c&c4 4> Nd p0O` > N] 0H&c880 @i &c(  2> D< @\ &c$  > N? 0*b> `@  4c|Lc`c(C dcc(` @" c>#Dc&@ &@ @  @.`ː㿘> r& Ѐ`?㿘<#cx&@ @@ "`>  pD"`&b&b4 4> M 0S`4D> M 0L< @ &b  "8> Mސ!0<0 @   > MА!,b>!c@&@ cD&@ @  @ږ`b`6  $  ?$ b@ $$ 8@ݟ .by b@ݕD㿘``q > q!0  > q!@  ˒@ 㿘4``> M{!P0`> Ms!p08  @ʀ0&cXD  @z<&c\P  @tH&c`\  @nT&cdh  @h`&ch> &`ha@? &cp &cpcp  `!&ct> a@??&cl <&cl <cl @ @&cl> &`0&`4``0 @< c@> a@  {3T2cp> M!>>!x` >`l#`&`&`>>&`8&`wB<??? `   " w< w[ "wW  0@C >>>? 0b"  $!$!$!4 \$!<$!$! $!BT8>`@>>  $pؐ > apҐ > a0p̐ >&>b\"&`㿘 \ $@ @G#!܀ !s ! !!̟€ ! "/$  &!&!$ !?&! "#$ D 8w @ x8  ,`" \ `"` "   $ \$6 \$㿘 "  \4 Z ;4 \ l#X "@#X    B #X`   > !L8 㿘H /f * ' ΐ@ΐH 0㿘H /f * '  lH 0 "F 㿘>   Jb!`B "K $!$ % , @ % ` %@@@"> "0J $c @@ b  $$b #t`2"$@b  l`$b c $c @ ! \ @ ;5\㿘#t  #h?#"`` Ȕ "`#t @&#t㿘#d $b0@ ? b  > "PJ 㿘#d $c0@r ? c  > "hJ 㿘>  J" 㿐#d "H"L"D "@ `B<`#"H#"L#"D#"@# `\`B 4`\ <` #?&##  , #x(@=  6`&## "4`Z 㿈 k f6 a6 `<`\`WT?`P`  `0H` E 8 @@<8 ?`.0 6? "7/` /` ('`0'. 6?668($3$㿐# @`B <@#x, ! '=#   " #x, @= `ݕ2 &# 㿘@!P`B >!P.@  @ !``B >!`.@ ?"@ > > "I _ 㿘cX?a" Ԓ @@㿘.`* * #* @   `2 <2 㿘%  > #hI?  B#< #.`     $ 2  `B < B<  D 5 N- 㿈#d  \ =6 \ w''''6 \*`@"  ?c6 \'h'''h"   " P 2 *2  ,@ $   $L$H$D$@$ #h ` #h  #h 㿘#h"> ``#h  a2#h#h  b   &@ 㿘#t  ##h*? .`c   $` ` @@ >f ` ?  3> #H 0. $`       >@ `>@ > `> > `>$`㿘#t #h % *`@ .` $` ` @@ > ` ?  >  H4#B ` 1?#=  $` W ?R O L I  >@ `D?>@ > `<?>$`? ;*? 30-㿘 \  㿘t l &` &` #db "b !$b "b !$2!$㿘 > kڐ# > kԐ#Ѐ 2`  ``k 2  > "` > !(  :^$ 48@  㿘4`"> G#0p>  &eG#&e [ > `@C &e@e> `@=?&e<" &e@&e<e< 6`$ 0&e<e<@&b@&e< 2S > kv# 2L `> GU 06 x o `> GJ H0+ k`&e80 @R $`8> G9 h0<> " $`@$`0 < " > `@??$`D$`D`D $`DD< @+ *&e> G 0 2&e80 @ &e !>   k 2`&e& 0`@  &e" 0`> F > E`  2 > > j#Ѐ 2> >   \&`eC  `ؒ .`.`.`   `ؐ@€ _ "`8&eD .``  `.`   `ؐ .``  `ؐ@€  `.``ؐ @.``  `ؐ &eD@€  P2e< &eDe<#@&"eD`&eL`` >b` >b@&eP &eL@&eP@&$&eL@&eP>be&eX&e\eX@{  !8 3> `jr 2.eD <@   2"eD `@2eD @4 eD > `jS 2eD ?2 eD `@2eD @ eD > eH &eH<`H @ %*` %*`( % %( 㿘% d@㿘% \@㿘% h@㿘% l@㿘% p@%8"%<#P#\#\#h#t### # #,#8#@#„###\#ä##`#Ą#Ĩ#̝㿘> "`> iԐ#(`? 㿘!0`> #0E0E >  #PE   N 0 @°  N .`d.`g &`.`f.`i@..`h> >cؔ&`@$ 2 >> `"c\``1` >!`&`&`` @`>a@ߐ &`> Ð!E@L !* *  E** *  C*  *  02   " 0" " 4" l" p" t" x"  㿘@@& 0  @""""" " 㿘@  > ch`i~   &`&` &`$&`&`   f> (@82 h(@2& g(((0 > (a2$2"(@> 2"2$ i -*-H( i+ , c+ + ! f+   d0+ + ' e+ & j0+ + #+ "0+ + %+ $0+ + -+ H  `4 @ ` !* *  #`4@ #`#`t#`x#` `4 @ ` !* *  #`4@ #`#`l#`p#`   !*@ *`" 4   !*@ *`" 4 㿘> Ð`7n 0 @``& `" @>h( ` *f ` *g ` *h`    `  ` *i @`` ` @>( f *` g *` h*` "` i"`  㿘@` >#*` €  ?&`&`> cp &`$&` h\` > &`<`(cx  ?&`&`> c &`$&` hJ` > &`<`(ycx  ?&`&`> c &`$&` h8` > &`<`(gcx  ?&`&`> c &` &`$h&` > &`<`(Ucx? &`&`$&`  > c&``h > &`(cp`,h G&`@? &`&`$&`  > c&``h  > c&`(`,g > &`@c`Dg ,&`X? > &`&` &`$`c? > &`&` &`$`c? > &`&` &`$` c? > &`&` &`$`c&`g˔    㿘    8  *  & @ P     ,   & @  P?㿘 H /l * -   @(  l " H 0  l@ pH /l * -    t  H 0  t@ x0H 0 㿘 @ /J >a $ $    @ ####<#X#x#И#д##ф#ќ###҄#Ѵ##,#X###,#֐# #0## #ؐ#ظ###0#X#ـ##X#d##`#ۈ##P#ܘ#ܼ###(#L#p#ݸ##l#޸# ##P#ߜ###$#4#D#T####P#t##☝㿘``f > f#Ȁ   㿘4`> B#0; > #B028  @0&`h> &`l` @F??&`p <&`p <>`pa &`0&`p&`4`0 @`> Bk 0> ÒB!p   .`.`.`.`.`.`ǁ h( h( h( h㿘`h@  $ >  @B@`  " " 2 $    ,    ϔ  ˔   Ŕ   ,  $ `x` ` `` "` ` 8    "` $ 8$ <@ €`   `` ` `` "` ` (    "` $ ($ ,@ €`  #" >  @44?  p8      ?"?   &" 4*`@  #`#`   @㿘 t  hB  & t& & & & x& |& $`7Y  $`7U` ` $`7O`W ?$` @` 7E ? @  2 >  XAe   @  @      㿘    @  ǐ 2``?   Ȑ 2``? N    ` "N     `N 2  N 2 ` 2 ࿐ `        "       @   ͖ `0 Γ2`2  0  `  ~ 㿘 h@@w ,  , & t㿘@`S >#*` €> `x`e  A > ``e : > ``d  3 > ``d + > ``d  $ > ` d`  > ` dސ` > `Ȕ dא`   &`&`&`$> `ؐ`d˔   &`&`&`$ `      &` &`㿘? `  >#$*` € o A  i ;    "5^  Z ,     N >0!  퀢 C >0!@  • 8 >0!l  /  ? 8) 9 "&!'      &        ' ' &$ $$$؁` ?㿘 ܀  h  ב*  ` H /l * -  o @,@ I,@ ,` H,@,` `W `c5 ? @   \>  ?  \,@,` `W `c5m ? @  > !? ,@ @W` #5Y ? @   > ! ?y  ,@ `W`  #5B ? `  > !@?c H 0& ܁ h?`"` *@ ` *@*`"h?ۄ"` *@ ` *`"㿘> Ðb2* 0 㿘@` >#P*` €`2`   h *(` 2 h*@`  h * h*@` ` 2`   h *` 2ڰ h *`   h `*  h*`  h *`ɠ ` ư` " 0` 2`   h *`   h `* 2 h *`   h `*  h *`  h *`` 2` 2 h *`   h*`* ` 2`  ` . ` 2|` . ` ^. ` 2s`? (` l Q. ` 2e` @ ^. ` 2[` @ T. ` 2Q` @ J. ` 2G` @ @. ` 2=` @ 6. ` 23` @ . ` 2)`  ` . ` 2` . ` . ΐ ` 2`    2` . ݠ   >(  h *h9* h(h* h(h **  h *h*  h(h  * h(h  *   h (h *  h(h   * h(h y* uq h(h 0i* e * \ * * SJ M@ JJ D@ AJ ;@ 8J 2@ /J )@ &J  @  {*  * t*     " 㿘@`; >#ȓ*` €  ? &`&`> ap &`$&` at` > &`<`(ax  ? &`&`> a &`$&` aa` > &`<`( ax  ? &`&`> a &`$&` aN` > &`<`(ax  ? &`&`> a &`$&` a;` > &`<`(ax  ? &`&`> a &`$&` a(` > &`<`(Ӓax  ? &`> a&`&`$&` a` > &`<`(ax  ?&`&`$&` &`  ?&`&`&` &`$              ?&`&`&`$&` > a``  &`(> a`,` > a&`@`D`ڔ  &`X  ? &`&`> a &`$&` `ʐ` > &`<`(uax  ?&`&`$ > &` &``a`  &`(> `,ap`  &`@> a`D`  &`X> a`\` > a&`p`t`  N&`  ?&`&`> &`$&` `a`  &`(> aА`,`  &`@> a ``D &`X> aؐ`\`x  *&`p? > &`&` &`$`a? > &`&` &`$`a? > &`&` &`$` a? > &`&` &`$`a&``O 0 㿘   @u $ ` $ $$`Ȓ 㿘 䀤   2 @  @ $@ٳ0 @ 2 > !;  㿘 x  h> ;"=  "& x" 䀦   2 & > ;"@) ""@""   "8"<  ?# @"D " * * ** * * * 㿘   >  ;i"hU  $ & $  ` 2@`& >  ;W"C $ $ @$ $ ` h" ( h"`, h `D ! `@@"   ޒ    ֒  h $"    `  $   (    $  h" ( h"`, ########################D#0#<###P㿘> #d> c`  㿐```m>  4> " e & 0& 4X& 8`2V 0>  L`1  P'2  E" 2  E" 2  E2  ` 2  ``1>"*` €$'#$&@"%"! " 0J `>"*` €$#$&@ %%& 4 & 0"!%$& 0& 4 0/ 8 & : 2& <> @7b& 8> @1b& 0> @+b 0& 4 8@@/ 8/ 8 & : > b@& < 0/ 8 &  <: @&& < 4/ <& @J   J* (J А 㿘> b ^{!,!   &!D &!P&!@&!< `D"`H `H $ 㿈 T `$`( $`( 8>  <& T$` 0 $` 4`$` !> #> @b "#> @b P" >    " Q P "" P P" >`<@耢   ''쀢 /4 4"@ 4'耤  /( 0"@ ''쀢 2``( `$`(`  2`( 0# `( P`( @$`(@.`(`@2 8.``@@$`.`L`. `: @$`$``$`d 8 ?$`h$``$`㿐> "` T D@ʒ H " H& D& H H " ($ $ ( `& H& D `6 $  D " @$ ?$   @ $  $ D $ $ Ԁ 2   H > D >"`$  ̀    Đ  @0 Đ  @`$!,` @㿘 8 6`4>   @ ` `@  `>  "Р @ ` `@  `   @    @    @    @ 㿀2` `> > "cd"``  !,>>> H`Д&`&` &`!, !\&!\&!T&!X!T>''''' 㿘!` T  &'&`̀   `Ē  @ !``Ē  @ !`  $!`!`"!` @#``#dd"@@d`?"@0 d0E" Ed0 # P`#dd2 #㾸> > " b,'` `  @((> > H Ȗ$8e 8> ' '$@$`  "3 @ "/  2&) @&@&&b,` `  @>  Ȗ89 '@]' "&  &  > #؁㿐 4  >`> #p`  #\`    "&    %&` &@@% &` `#\`\   &`&`&s &  & `Փ Ր  㿐  "3 s,  ` z w 㿘@` `> > >  `85!Y"`N@  `  `, @ [ݒ  @&` 㿘>  P 7Z> @7S `.` < >   h7J㿀` R .` < L  8 2 0E   4耢 "8#\#`4 2 & 0  € 40#H /e4 p* & p    0    ` 4$ l$ pH 0@ 㿘@ 6 @ p "@ l&@@` *`  <  `[^ `  [X 0 㿘` > l#@*`   € > "̖    <> "l>c  "l  0 2  @  *@ 2 (> 5 @    㿘` .`L  <  D > #p@">  6 H /e4 p* & p & p@ $H 0 "` 0 € 42 >   6> `       㿐`  #\@f  '> !> ÒbԀ !> "̖ `> "l>c  "l  0 2?c.`  * "`㿘@㿘" `$   <, @`R` 2  ,  k t"`"  `\   @#  㿘`> 5 ȁ 㿐\ @ :>  @" ؠ > 4 &"> !5?&"`<&"> #l` %> > > >  `3" " #\> > >  `03"#`     a& <> p>  !X5p$"@ΐ " <> !x5f` <& l& p > 5_! \`2& 0@#C& 0& 4`& 8> "7>  t9> 5> À@   "`@&@ ސ`* @*`" * &  : & #&   & @     > >     &㿘#> cl "  > > >  `3l#`4  > > >  `3a#  > > >  `3V# > > >  `3L#&  > > >  `3B#> cp"cp> $ $ @""$  @> Òb>  $ "$cl㿘?> ×2 "`26b "*@  V * < 2M  F>  t> 2 hc`$ $ Ԣ` $ pެ " t5 h  a# %$ $ $ $ $ $ @ nd t> l $ t@*`  `"   `4  `4    $ 㿐 ?> ðb6 ^ *`< 2 V  "(   " H /e * & @ H 0 > l#@*`  ^Ő  ?&   $€> #h`   $    '@  ?& b "b@pbb ?$b㿘 ?> ðb6  * <     >  lc@* `@ 㿘 ?> ðb6  * <     >  lc@* ` @ 㿘 ?> ðb6 > 2 "* <   㿘 ?> ðb6  @̘2 / *`< 2 '  > lc@* `@@ 6a 6 @? 㿘 0 4 @ 㿘# #2b 8` `?&`@t` @ n&   0`@ b cV"  cEcL cV #Q #P   E cV"#R"` cEcDcK"(` '`0cL",`00#^   #Q #PS`00 #U0 #]"`8`0` ` =& :&8&  ` ?&`  `` &` @ @   $€` "`@` "`0 *`t `0` `@@ `0`4@ǰ  `&8`0@ `4  @  $0``?&` `0 2`4 -``?$`> *`" `*  @* &`*" *  @ؑ* &` &?    $`` "Ő`t> c` ' @e#`  $`$`` 2`@\> c` ' @N#` Q$`$`` L@ 0HD@ ?: &`8*   Vq `8`*  &`8 @ &`8` & `8 @  &$@  2 @ VM   `0`4@㿘 `@ ca@"  #V@NcT@@ 0cb@X@$ 0 cO@   #S@ cM@": 000#N@"k0 #U@# 00A#c@u 0@{% s 0nind@ ^ `Z  V(&$&@K  ]8#] "&8 0< 0   4  00*" *  $ <0& #* "@*` `$ < ?2 " 2"@O&" 2 0  ` @ 㿘 > ?6 @ + `< `?`  `0 `4?㿘> ?" 2`   * < "    c0 㿘> ? "2`   * < "     cZ㿘> Ð  p * @H /e4 t* & t  H 00 H 2 s  s<* @2 H 00|  & tH 00q& tH 0 H g ` P@< p2 0 @ @ w   @ @    P   @ vH /e * &  t H ?`& t> #`& t 쒒&`:` piH 0H4 t( t" tH `$ `( ` झ㿘  ` `  v 㿐 pL HF?> #c@@=* 2  o< 8@> 2 l`  2 l *   €`* 2`   `?> #T lJ*@ ' ?4@㿘 p``  > #T l*@ `㿐H /e * & ` `p@ H 0! @  'H 0 0  c  @ "$H 0㿘" <* @`" ?&"` N 㿘 > ."(4  , > "P-U< ` > "x.ْ  "$l ?> .ΐ" $$p$$@  $pv 㿘" > ."@ " ? $"$ p03*> "-   < ` > #.   """ ?$"@  0> #` > #  4@ #} 㿘 ` .`  <@ H /e4"* &"? !#> "cHj "!"  pH 0h` l@`2 "2 "H 0T   H 0I &"&"H 0 p 2 l?&"4 &" `2 .` < ` 2 @ 2  .` < ` " @@  .` < ` @9㿘 p``` 0 @   $0 ` *`   <2  (p?l㿘' H /e4 p* & p  3> !cX  p`!H 04 ` .` <  `) H /e4 p* & p@ ` >  &` X!u @@  ` ?&` H 0 㿘` &  &   㿘 p  㿘!> # " & \"@0 #& \& \㿐> #l`/> #  >  < p  > p     㿘> #> ` "#`0 $> `4€> #€> Ä>  ㈁ > > Ԇ>  "#㿘> #``<`  `0  @ `4`㿘> Ôb   , @ "`@ ` 㿘; <,@ `   @  , @ " "  2    • H /e4&"* &&"H 0 ǒ㿘> Ôb   , @ "`@ ` 㿘"?H /e * & "?&""H 0 㿘 p `2 ` `  0   p 4㿘 @` 0 `  `" y t 2& 㿘 0 ' 4  H /e4 * &     t V&   &  `?& H 0㿘㿈 #X @'''*'?    ? p @ ? p   @+  @'   @Y ?㿘``0`  0 @ 0 @ 0@1㿘`",``0.)0+ ?&   0  0@ː0 @(0@L0@@0  @0@E㿘`  `  0A` 0="$" ?8$" $""5>  (`@ " + 0' 0 `# @א" < ?$"$" .`@ "`  p2 @:`& & 0& & & $& (& ,``.` 㿘 `@ ’@ @?@`  `?   = &  0 @P0 @  0  @0& 0㿀` @ @ 0`4` @ $   ''쀊 2 䀢 `@耢 '@ @ O`@㿘  @`@㿐  $`@ ($?@`  `4@ x0@ `  倥` ? ?㿐@ ` ` @ `%  ? @``4@ C0@ ݐ`  倥 2?㿐  ` @ ’$ @@ @ `0``4> *`p   p* @@ ` ` 4@ 0@ `  2?㿐  ` @ z &@@ א@ q`0``4> *`p   cp* @@   ` 4@ 0@ J`  2?㿐 ` @ @ 0`0``4 2" > p *`  @ {@ `0``4  * @ @ 㿘 "`"" 0" 0@e 0 2  c & & $& & (& ,   0 & 0 0 & ?>& 0㿐 0  @B 0 "  @ & $&  ` @ &@ 0`4     $ *w $ "  &   & & $& (R& , 0 F ?N& 0㿘  @  0  @ 0 "    &  ?` & & ( & $&& , 0 ?& 0㿘 0 ` & 0 $  @" $ǐ $ & 㿘 0  @@ 0 @" 0@{ 0 @㿘 0 2K  &   (@   & & $& ( 0 ( & (& & $ 0 ?& 0  ( :  $ *  @q (& $&   ( :  0  *  0@b (& $&  0 & 0  (*  $   & $ ?  & 㿘 0 2'  $  @" /  ( :   $  ,n` ,& $  ,@(    (@ ` (&   (@*'  $@   ̐   %& $S`   $ A& $7 0 $  @@.& $` @    ?" & ( 0 +    &  0   "@&   0   & 㿘 0 & $  @"   ( :   $  ,` ,& $  ,@(    (@ ڔ (&   (@*   $ @"&    @m @i $?@& $  @V@R @&  0? 0   H& 㿘 0 - & 0@,   "@ #  $ @ "" @  & (& & (&  0  @y 0 @" 0 0 d@ 㿘 0    0 ?& 0㿘 0  ?& 0 H $ 0 ?& 0㿐 `   $ 8?@5` 4@0@h`  b*` ` `  @Q?   "*@@* "*@㿘 "`"  @  > #T l*L@ `?2 l㿘`  0 㿘 8" H /e * & "     ` "@"  #  &"> #p%  &"H 0㿘 0 8)㿐" F > "h`A3  * > ֔ *bl@ > !쀢 bh? 2  @"@bh ` l"*` * > c " ?" @2  `@ bh  . @  #\    @ h 㿘" "&"㿘 > %#0 &  &  & 㿘 > %y#0` & 㿘` f (H /e * & @`@ %> ;$`!x ;@`@󀎠`@ !`" H 0` 4 4@.` * \@@ ``$#$@  `0H 0 #H 00 4` 5.$@㿘 H /e`A* &`A   @ 8. H 0$Z$Z$Z$Z$Z$Z$Z$Z$Z$Z$Z$Z$[$[$[$[$[$[$[$[$[$[$[$[$[$[$[$[$[$[$[$[$[$Z$Z$Z$Z$Z$[,$[,$[,$[h$[h$[h$\$\$],$]H$]$\$]d$]$^$$]$]$]$^$$^$$^$$^$$^$$^$$^$$^$$^$$^$$]`  " 㿘`> $# `       㿘> Ð#@` &`|&`0  `? >  $p > " &`l   $&`l"@> `Ւc`l " ?&`p ``l&`t&`&`x&`@ >`Ȁ "`l> " > $`> &`$#4&`&`&` &`#4&``&``&` )> > "` > > > >  (`8X"!b䀢 " > > > >  (`8p"u!"b$ `\`"> >  $`> $  @@ >  #`㿘#> b  !> > > >  (`8"H!$""?> > > !$ $ b@ $b㿘!> "  > > > >  (`8X"(!""""`"`$"㿘H /e4 * &   H 00 Ā "   \ "   l` @  ` H 0`"* ؁ 㿘 ` " @ " |&    | > b䀢" "b> > >  (`8!ɔ"7 X F>   B> ܑH /e * &  Ԑ? +&   $  `8$ 6   " $   >   4f > #`> *`" *P  > !#% H 0> "̖  > "l> a  "l  0 2  U  㿘 " &   Ā *`2  l \ " l  l@% + \< l c€    l \$` `& & 0@`  ` & & &  㿘 X`3` > "!80+`,    ?@$ 2" > aX ![ 0`#``$`5` "`$``  `4ٷ 㿘 \ 㿘 \ D` x  ? x p € t& x㿘 \ "  " p&   p€ t㿘 ؀    X 2 @>㿘?> Ð2 `  6- . @ 2 %  `   2 ` " X@ X  4 &`@  "& X㿘& X&  㿘?> Ñ2  . @X   "Đ  "Xh 㿘 & Đ& X~  㿘?2 > ð . @ ؀   X 2 > !Đ!x  $ M 4 Ԓ`$  㿘?2  > b. @㿘 Ԓ & Ԕ@  Ԑ? & 㿘 "}@ 8"~"|@02@!  v@0* X  @ (" X $   4  @ " `8   X 2  `4 @ @? 㿐 c@  #@"# #@ #c @"   c@ c@   K  #@"$@ "  #@E#@"  p#@ v # @">  p@"|>  p #@ "/# #@ "p  #  #@" p@"|  p@ "V #@1  p0# @" p p  c t "  &  &   & & p`  tc@Ѱ " &  " &  "   &&    & & &&  ʘ > ۰#$#$ "`"` "` "@"` ` &`&& w > #4#4@@C*` *   ll  @  ̔0 Д  l $ А 0a Ȁ 8&*  ̕*QU R&?# a2 l А !G ? ߀" l@ @ ̔ '@' 5 l`$ /  @ t ' #@# H /e * &  l? # @"   o$ H 0㿘?2 > ð . @ X  > Ä 6?* @" \ * ?㿘> "䀤 $ \@  㿘 | 2) ` \  !   @ & \ & \& \`> ! o` > ! h  㿘  > Ð  6 . @`2``     `X @ `㿐> "` > "䀢 %>  Ā '> = '> #> X?`'$Xbܐ * =* 2  o$b< 8@"X>  ?#` X  * 6   @;$X$b܁㿘> "`> "䀢 >  Ā  㿘> "` > " `  㿘 ` @ b2 d2 h2   xp €t " x`     ( " x \0'QcY @'䀦  '܀ 60"''0 \7cZ㿘.2 <!@ " l4!! @"  l@@" l@ @  @@ @@ 2 .2 =`,`- l  l `"  \ z  v  `"   \ n  j 2= 2a =2 @2 \ | > !Ȁ` @ &@M  I"@ `+F> #<*` €2? \  :  \  \ 1 01=2 $ ? % `? =2 ' ? ( `? =2 * ? + `? ) 0 㿈 `'H "    O$  ?Ð" @y& &߰  Ȁ6۰ . ̑* @@  =!H?Ð"@`a> #*` €H ϖ k H Ȗ d H  ] H  V H  O H  H H  @A H  : H !3 H  , H "% "H (  h  H H`` 2P `  "I  H "$ $  $ H π`  !@ 0" `* 2  o< 8@> @ 2 $# b    `?   @@~ @ .@=* 2  o<< 8@7>  24.`$#  -.`, 2 Ҁ">HӐр .` 2 .`2 >H     ?  .`>H    ° .`2  o4!< 8@ >  `?# > > <c"24 >ab(.`)=``!.`, 2 a .`  $ &   2   $ & 6 .`=2`!@2 ii # 2  @2  .@@ 2&    "@*` 2  ? & @R   a$A}* 2  o;<@ 8@6>@ 2  ?#@` 2,6  0* 2  :.`2 ` `2`  * 2  `8" " 6    6 6  `6  $f@$f\$f$f$fĝ㿐> d=> ú\ .(@77 7.. (.`0@2&`7   @`6``6`6` ((7@00 ""d> ø\    68(( @ @ @ @@ 6868261=!-(0 @#* =(0o< 8>   * ? 2 ** 0>  *2 㿘`0> #.` €4a666$666666 6666 6 6  66 6 6 6㿘4a66666   2  +@@ ?#8>@}* 2  o <  8 `8`8`* >2` @s+<    +d`+`@* 2  o<  2@ =@"6@<    26` * @@ ) ?# 381> (@ }* 2  o< @  @ 28 @`8`8`* 2    > "@0 `@*n@`2S㿘 . @ . * & J &@ 4! @ 2@ @ 2 @@ 2`@ 2 @@ 2` p ? >   `  2  2  i" * "  ` T *@  *  G?# 8>}* 2  o <   8 `8`8`* >2` @2  <   < <    * 2  * *`X Г*   * ?#'8%>}* 2  o< @  @ 28 @`8`8`* >2`@"> # < @  @  o " `  * 2  o<   2 =@*< a   aa **@ * 2@ *   * @ )@?# 85>,` }* 2  o< @  @ 28 @`8`8`* 2   ``@ > # f* ’ ,` * @ *g Vа @"` 㿘`> ΐ#P  㿘&`l> Đ"` &`p&`0 @> @@@͒ "> > #`> #x> #`"*  㿘 ` " X@ X F>   B> ܑH /e * &  ? +&   $  `8$ +Ӑ   " $ ː  >   4Ϝ > #`> *`" *憒  > #[ H 0> "̖  > "l> c  "l  0 2    㿘@@\@Uu  X`[`  > %#0R& t |& |  &  &  & ``` .` x @@  3```` ?&@ "@ $ 0 ` `  &   | ```` ?&@ "@  |$  ` `   & |`"  2``` ?&@ΐ $$  ` `  &   ``` ?&@ $ $ ߐ ` `   & "  2``` ?&@ $$ Ð ` `  &   ``` ?&@ $ $  ` `   & "  "2 t``` ?&@b $$  ` `  &   " t``` ?&@I $ $ s ` `   &  t- 9> ;> +> ``` ?&@"6 ?`$ #ؒc`u! *   $G ` `  ۖ  ``` ?&@  $$ + `4  `& x$`*:` "`$`2`  `4 㿘?> Đh2 `  6' h. @ 2   `  2 X  4 &`@' "& X"㿘?2 > İ h. @``  X    l" X@ p0 㿘# l& & & & & X@ p㿘?2 > İ h. @   X 2 > ]  `$  `$ 槐 㿘?2  > bh. @㿘  & @  ? & 怐㿘  W  |@ }@  v@  F  "}@ " X8"~"|@" X1 l@   v@" X( l  @ ("`% ` 4  @ " `8  2  `4  @  @ p? 㿘?2 > İ h. @ X  㿘 X * 㿘`l"`X  €`p㿘  > Đh  6 h. @`2``     `X @㿘> " )+> Đbđ*    `>  @f* "*"@6 %"*``@ $%"`%bĐ7 bġ,  >  h@> 2b> > pb"㿘? 2  `  2 ` " X@ X 2   4$ & |@ 㿘 X >      ` > @    㿘 p p& X%> #>  X " ` d` d 0`€ d p2 X㿘?2  > İbı.  X @ & XH 㿘@& X 㿘 p p%>  ` d 0@$ X d2 `㿘?2 > İ bİ.  X #> !( 㿘?2  > bİ. @㿘 cb@ ca@  #@    v #`@   v@" X b|@" X #@" Xb}@b~@"   X #b@ "{ p#a@"\ X #`@0A#c@" p X X  H /e * &   .    ?&  H 0ΰ 4 # "" 0"  $ 'T  " $ L    4 H 0 "  " "  <n@ pJ 0@ 2 d @Q d 2 0w  p   0"  "  d$ 0&)& | X   @ V$  S   4  @ "K `8F D 2 ? `4 8@  X 2  p \ 2 p. @*  p  )>  `!@[ d 0` @ "  d2 ` #@ & x㿘?2 > İ bİ.  X )> (!` 㿘 2``   `X `     `  @ 㿘  "  p$ t$ p>  x (> Ēb$ $ 0$ x 㿘 2``[  > !T &`` p&`d t&`h p@& p t" d& t \`$ `0 "  X€ " 2 X`0%   | @  x` `0  x @  X` `0 € "&```d@`h& t"`h`h@`d& p"`d?&`d&`h㿘 ` 2 \> ! 0) "  X 0  €   d " d 0@ d p@ h$ t h"`h h@  d$ p"`d?& d& h& `㿘 #@$`|`p`p? )>  `!B d 0 ` @ "  d2 `2 㿘` \      @㿘`  p p& \ & )>  `! d 0 ` `\€ 2  d 0  c  | @  d2 `2 㿘 > L >  "Ȱ"`6C  2  2 > Ą$H$H$H$H$H$H$H$$$$$$x$$H$H$H$H$H$H$H$H$H$H$H$H$H$$|$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ $$$$$$l$$H$$$$$$$$$$$$$$$$$$$$$$$$$$$$l$$$$$$$ $$$P$`$p$`" "`$" `" `" (" $" ," 0" "  0  " D" L" \" 4" H" T" X㿘#> cޚ $  c`   @ P `   @ P 2$ P $ `$ ѐ㿘 > # ``"& > > > "8bHpR А d    \  & `& 㿘``t > "#̓*` €  0j , g?e& ,c& , ,  $"" @ 8 `V  ?&    ( P L@   & : ,6& ,  ?&        L   & & ,& ( ( ?& (> r"0  & 4 (  @"& (@ D㿘  ?$  `  ( , P H`@   $  , $  $ , (  @2 $ ( D@ "$ , ,?$ ,$ , 㿘``[2& 4 8& @@  & 4㿐``3Z > # *` € @ ?  *` 8  & *   , $#8@   ?&      # @ (2$  & 2  2?   @ ?  *` 8  & *   (  "& (& , @ ?  *` 8  & *   ( "@ 8 & ( @ ?  *` 8  & *   , $"@ 8 & , @ ?  *` 8  & *   ,  "& , @ ?  *` 8  & *   8  @?`& (  *  8`  &  *   $ 8 ?h& , (      ? & "   L 2S  & 2N  Ő?  , $ ǖ"  @ ?  *` 8  & *   ( "8@    ? &  "  2  & 2  ?   L @ ?  *` 8  & *   ( "8@@    ? & "  2Ӱ  & 2ΰ  E?  @  "@ LG @ ?  *` 8  & *   , $# 8@   ?&    #  @ (2  & 2  ?&     $ " (@ L2w  r&  @  T X4 \* 8  `/%> # <*` €?L   ``` * 8@  ?• * 8@ؠ?ؖ  @K 2/& \& H& L& T&& X       @ ?, *` 8   8  & D 0 & \& L& H& T& X 㿘` 0 9 ;" @ @ @   8 <  & @&` @*@ *` * ?А&@  & @ @  & @ & @`t "& 4& @ 㿘    ` 2 >  "     (  ,   ` & & _      4   (  @   D @d`  & $ @ =& $  (?& (& "`@`P  4   >  4   U |"`  &  `"` &  $ $   (  ,  & 2& & `,8 / @ "  `$ "  `$2 `$:      2`    ` @? ΄ 㿘  `  @` `; `  `  `` `   `  ```  "`"  2  `  @  }(0o < @ 8> @ 2- @2 -`2-> (  -(0 * ?,(0 * ? -o(0 * ?Æo0> Đ"Ѕ( ",v(0  * ?Äv2`> Ć* 2i"<➑2`\> &㄄♀a> ⛄▀^> ╀R> ☀U 0\"F> A> ✀8> ❀1 0N<> ㇄぀(> や⟀< 0>%> ダ# 06,>  ㈄ㅀ > ㆀ 0( > ㉀ 0 >   > > "  > > " > " 㿘 (> &@ ,c &e 㿘`"`0`"090    L & (& ,@    0  ,  (㿘`  ?$        L   $ <$ (9  @   ?$   "      $   ?$      "@ L   $  (  "$ (㿘  *@ D #    @ h    @ a >  ܐ#(?  @   4& >  А#P ?@  2?@ 㿘H/` / ` ? (>  $#x   ("`  \& $ $   & 4 $  @ & 8& 4 8 4& 8<9> +5> +/> +;> ,3> +7> ,& 4 4  @ & D $@ 8& @ : $@& H& L& <& $&  ے2 & T $֒& X ( $ (` & P ː .A  ( & (  (`@%& \  <: "  :  ?@ 8&   ":  \ " @& & d  \ @몐"@* & `& d& ` ( +  \   " <  $- 8   8  z \@vr@$- > ,#T!> , p`ct!& & & & & & & & Ѐ&  ( > +> +!   & &     (@ (@א  ( =& (H 0 ?"& (H 0 㿘 2> # @ @    @ &@   &  &       2`>  2 2**` #      (* # 㿘  $ǒ <:`:`  X @ X  @ $  @@ * ?""" " """"    ?" ږ 㿘 Tk Xg `$ `@[ ?> ?@? 㿘 ( "   П@ 2 ( ?& ( & `& $@`"   П@ " ( & ( " h (  h" h ?*``` 0 h *`*`@*`*```"2`2`" " `#㿘> h< @2  (    :  \:     <$:ޣ: Xڐ   H@` "@"`"`"` "`"`"`"`` ""@`@  㿘 $ X   T   " $$@"@:`??C  ?8" ?2 00??-    8*  82?8"  8* 82?2  㿘 TO XK F?   < h@@ B$``??x> ?"?2 0g??c> ?2?2 0R?P ?*?2 0?` "@ `& @&>>??2 ` ` `*2? """" """"  " *22?2  ` "> .> -> .0|0"``  > /> /> /ܐ#l"`"`"`㿘   X <  @  $  l h" h l@ 2 ?     P&r 8 (@ Y- > , `@8  B @ @ &@@9 `2   *  *` * @82 @ @&@@    *`  * *@ 2 @ @&@@ ~ @  * &@@ @v@ >  T* > Г, 88 @  @U @` @ @&@&`@H  `$"?   *  *` * @8`*  @ 2@ &@&`@"    *  * *` @*`  @ 2@ &@&`@ -@  * &@@-@` @ @  &`&@ 㿘 X @ T  @ `$ l h" h l 2  + ,@@%   Pq& 8 (@  @8,@@ @    @,@@ @  * $@* 㿘 XF @ TA  @ `$ l h" h l 2  0 4@@*   P& 8 (@  8,@ 8 ,` @    ,@ ,` @  * $@2 㿘 ` ?  h <@ X > `$  + .> @   ? ?=8 ?  #? 01> `T+ @ > #Е*  >?/ ?/   # ?#?  `   #?2  㿘 `   $ X  < `$  *,>  `ؠ??-@@?  #@?@ 0">  T* `> Г*` ?8 ?8 @@ #@`?@ #@?2  㿐'D  <84D X/ $` XD> < ? ?@@ ? >   ؕ*.>  #Р . @: $``* ?  > @ *  @* @ @ T@@ @ @*@ @+ @`$ ` `@:  `D?`?@Ų@0j> .`T@  '> #Г-   "'  ?@=`? D ` <>    "@ @  ??6;>  **`> `T  ب .D @( : %`*  > @ *   #@* T @`  @ #@#``?   : #`4#@* #@ 9 : %`* ? , @ *  #@* @#@`T @ #@*@#@*`%  #`> #: #`?~D0>` < ?@ @ ? > *> . T خ  - D`@  B :  '`* ? > @@* !#@* @#@ T.@ #@*@#@*`'  #`> #: #``࢕`?   : #`4#@* #@``% : '`?* ? > @@ *   #@* T@` @@ #`#@?vD   "> 2 > 2 > 1"> 3> 1hh" 㿐 XK @ TF?  h?  < @ <@  ` `$` //=  + 2 - ` P&  `(`8 @ ` `*  ` @*`*   @ 2*+ 2 `   * 񀦿$,  㿘>` h<>`<7> ;> &P/ ./ c  "&&c c@.&@c@./ &@ 㿘> #T` "#T$cTTP> #P " X X @ T  $* > $$     Pv&8 (@> # 2  < $ *  <  $   >  cL* $$$ cT ?$cT㿘> #T` "#T$cTW> #P " XR X3 @ T. @  $0 > &@&`&` @ %   P& 8  (@> # 2  < &@ *  < &` 2  <  &` @  >  cL* &@&@&`&`cT ?$cT㿘> #T` "#T$cT\> #P " X Xː @ TƐ @  $4 > c&@&` &`&`*   P& 8  (@> # 2  < &@ *  < &` 2  < &` *  <  &`  @  >  cL* &@&@&` &`&`cT ?$cT㿘 8 u (s $  >  ,  * 㿘 (  $ 8\ ? ( ?   , ,  &  ( 㿘H/` /> c\     $ ( 2 H 0> cX> Ґ0  "cX>  #\  "@   `##\> \"  22 㿘H/` /> c\ .`  $@2#`  @2   (@2  $q 2 H 0   ׀H 0?㿘H/` /  $ (   H 0:? F > l> 4`c\  "l$@`4` 4`$` $`4`  / <$` < | $z ( ! `"`8` 884`$\H 0 㿘Ho oT 9 `,  H 0-?ʐ  " ,"  `0"   H 0?ǐ  " 0   * 4 &@2`?H 0㿘Ho o &@ &H 0 ?㿘Ho o  ? ?> !ؓ* 2 2`H 0 @@(> ә(:` 6 `62?" (+?&'?6"? "`0 `0   **` ? ?㿘@``!"  . ,:) *`   @  `@+  ` @#  `@  ܦ`   㿘@``!"  , *:' *`   @  `  `   `ݔ  ަ`     23`2(+`@ #@( ` ("@ @"`("`("`("``0 "@ @"``㿘*@ * \ *@  * Ŗ 㿘> "b`?㿘> b@l> \> 0b&ad4&ah8> &al`?b @l: >ap> 80@lat @{Q&d|> bHB@k @{F&ax> b` @k&`8> bp$@k&`0> #b@k&`4`8`0@ݱ`8`8 & `4: &`<&`@`0> `8"d|&`X&`p> 7a@`Ē?> Ӑb0$㿘#A@". 4c_@"4 <c@@ cD@#FE@ cB@"& 8 #E@<?0; #J@"7?2cC@"  80? $,&& 0& 8& 8 @? a & & 2 !|@T   2 @n!| 2  @! ? > ,  8  &?`@8 2?@ (?> at ah ad( ad ?㿘!|* "|#|* * @N 㿘@ `!"@(` s 2!` k 2 "`c  㿘@ `!"@(` H 2!`  @ 2 "` 8  @ax(""ax0@ ( a|b|@c| `ax(  ax*  ax( @ 㿘``  2'  "#   ?"  ">    "`2 G  E"  4 ?   㿘> "> b   ℒ 0 @y #&`P?"&`P`L &`L℀ 0`L   0 @y &ad &ax   6 `0`0℀ > `L  > " &ax > b@j` L@ > "Y℀ 2>  `L`*  J`@`ℨ ℀ "0> b`?0&ah4 &al8 &ap@&at# D$`0> `4&"> a,`@  ax@y0* &`X&`p  ®?> Ӑb@A@"' 4_@"( <@@D@F@ C@ B@ E@?0 J@  "" 0" 8" ""? > ,  8  &?`@8 2?@ (?> ax al ah( ah ?㿘> "`!t  L >0*`Њ@@ Ъ@@0#Њ@@ ?Ъ@@0H/` /`!d `  `!d ` *`!d ` *`H 0 㿘``~ 2 > "`2  2    ?"   E`?㿘`L  &`L 0@xW > b  &`P>  " J  0 0  ?@xA&ap0&ad4 &ah8 &alap " s" " " # ,$!> &`p!(`@   *@x&at`@  * @x &`X@ `0> `4"?> Ӑb㼘`!p> !,  @!t ɔ*  ///  * * *``> !,  @!t *   * * * `` ! 㿘 E@"> #F@ "8? c@@!cD@.?0-#H@'#A@" 4$? cC@ cB@L@"? #J@ "& & 0&&&  ? > ,  8`  %&#?`@(((8 ?@ > ah ad(@ ad@ ?㿘``I 2 > "`2  2    ?"   @`?㿘> "`L `&`L 0@w > b  &`P>  " J  20 0&ad4 &ah8 &alap"""?" $# > !, `@0 * @v&`X`0> `4&`pҐ#Ò> ;a a?> Ӑc 㿘#A@". 4c_@"0 <c@@ cD@#F<@ cB@"!t #E@3?02 #J@".?)cC@!t'? !#&!& 0& 8& &&c   2 !p  ? > ,  8  &?`@8 ?@ > ah ad(@ ad@ ?㿐!p #\ !t㿘``C 2 ` >  0@  > "`    㿘> #  8?#4> #0@044> #` 0`> #0> c@fJ@ "> > #> "  8 0`?@u  <    "0&e&e&ex&e|&e&e&e&e > 2&eD :` #<&ad@&ahD &al$ʖ#`@<D*` `?&e &e @u &`X`0> `4#> =c&ee `@p&e &`8@אeap  @ "@ ` @ u&`p> =c`t` ?> > =  f> Ӑcp㿘#A@"/ 4cD@"s c@@!?0lc\@.c_@"1%d? #L@ "M#E@Y?0X cB@'cC@"0%O? K&& 0&%   &% @? !<& % 6 @6&  <* 0&.&% 2+ !p@ % # 2  !p@˒ 2@ 2%@>   @7  ? > ,  8 " ?e`@* :  2? (?> ah ad( ad ?㿘 8#`2 X% %x @ A*@> =c`& 8@! @% %x p q*@%!*(%"& 8&%t㿘 8 ђ > !> "a% A @`%x ( (㿘@``!"  + )% *`     `@鄔  2` @|  2`@t  ߠ `   㿘@``!"  , *& *`     `F  ` ?  `8   .`   %t2%p"%p "%t@  * @8 "%t"%p%x(%*`ap  @%` 㿘*`!s* !r* !q* !p*  㿘%x  "    *%x `*%p%t  `%x ``"  `㿘`  " > c؀ 2#   > "`2 !> !(  ,@s?@@ ?"  `  㿘> o#00&ad4 &ah8&al @sv&ap   @sp&at  *@sj&ax @sd&a| @s^ &a  " L@`L>  &`Lc > `@cL@ >  .> b  >  `L   `" J` ℤ ℀ "at> b`?at> ?@"&dd`&d < @n @ @ $# > !, `@0 * @s &`X`0> `4&`p ֒> ?bLՐ > ?#> @> A> @> Aa,Ę!&a&a&a&a &a$@a?> Ӑc㿘#A@". 4c_@"0 <c@@ cD@#F9@ cB@"! #E@0?0/ #J@"+?&cC@!$?  &!& 0& 8& &&c   2 @d ? x?? `"" "  t`@"p" " > ,  8  &?`@8 ?@ >  ah ad(@ ad@ ?㿐!p #\ !H!x`!x H 㿘!x `0 02 ?#ߒ @`"!p! !<  !|`?""`㿘 [!|` @ @ 4"@  4"@F `$*&"$`$`$`$`$`$` *`3$` ̔$`$a `$` d($` 4 `@$` d?$` `$` d$` 4 `@$` d?$`` `  㿘 k!|`h @@d D  4"@  4"@ P ` Ē鼒`$鸐$$$$$$ *`3$ ̔$$ `$ d(@$ `?$  d`$ ?$ `@$ d$ `?$  d`$ ?$   㿐 `U!| @@Q D  4"@F ` `\`$X Ȓ@ $$$$$$ *`??$ $$ h* ($ d$ `@$  d $@@ $ `?$   㿐 `!|  @@ 4"O Ȕ@ $`$`$`$`$`$` *`??$` $`$a h* $a @2  ( "  $i$i ?$i $i($ d@$i `$i  d$Ԡ?$i 4 ` ?$i(` `  㿘  !| $   $$$$$$$ *`$ U$$ d($ `@$  d$@@ $  ` @@ $   !xh( "h㿘`` >  (   `?㿘>  0!>  (   ( > `@@`` > J@ > ֐ H> " @ 0`? @odx`&ap> C%> +> -> B*/> ` 2'0 > Ԇ `  > @`" p   a  +@  $  (0 ` 0$&ad4&ah8&al&dx&d|@j  @ ap " s" " "$# (  `@ * @o &`X`0&`p`4g`PXxX ?㿘#A@". 4c_@"0 <c@@ cD@#F9@ cB@"!t #E@0?0/ #J@"+?&cC@!t$?  &!& 0& 8& &&  - 2 @x ? > ,  8  &?`@8 ?@ >  ah ad(@ ad@ ?㿐!p #\Q!tH`!p `!p(!p(H 㿘!p  "    !t `*!p !  !p(㿘``?㿘> `p@_6> {h> `x@_.J@ "> > o > k > "00 &ad4 &ah8!&al`? ! @nl&ap "!@nf&at# $@n`&ax$ #^`0 &`8:`4 &`<`0&`@e `?&a`8> !( `8   @n4a&a|`0 !( `8   @n"&a&`8@~ a|&`p&`X" `0?> > D  `0> `4` > `@^J@ >  `> Ԑ`㿘#A@". 4cD@"C c@@ ?0<c\@%c_@"% <4? #L@ "!#E@)?0( cC@!cB@  0 && & 0&&&  @&* & @    @   ? 㿘 8`?!' !t."`\!t " X!p "`p!p?"T!p"`X! !|Z !' !t."`\!t " X!p "`p!p"T!p "X@!x?#"c !x"#(!x]& 8' !t."`\!t " X!p "`p!p?"T!p "`X!@ά!|!' !t."`\!t " X!p!"`p!p"T!p" X!`2!|@Γ !% !t*"`\!t %"`X!p?"p!p#"`T!p" X!`2! @Q  **!x "*& 8> , 8 (&&?`@(8 ?@ > ahad(a @   0@  ?㿘 8 & > !> "a!x ` !x2` `"㿘``  > "` > !( 0@l?@H 8@ 㿘> "`  >  " J  20 0 &ad40&ah8 &al&ad $ @lx&ap  ( @lr&at&  @@ll&axat<2@ @  $#b > !, `@ad * @lS&`X`0> `4&`p9 А*> Fc)`Ȓ?> Ԑ`Z㿘#A@". 4c_@"0 <c@@ cD@#F1@ cB@" #E@(?0' #J@"#?cC@? &!& 0& 8& &&@T @ 0? > ,  8  &?`@8 ?@ > ah ad(@ ad@ ?H`!p!p(H 㼐> @ `b!x'!" *!pO * `Q !p `2   !p ` *` b*@  b  *@  d  *@  !p `*t` 2` m  `f  " >  㼐> @ ``b!x'!" Q ` = 2J`  5 2B` - "!p8,`Ґ !p `2   !p ` *` b @ 2 b   @ 2 d   @ 2 !p `  *` > ~ 㿘!p㑐 !p `2  .`!p  *!x2@ !x 2"!x 2!p ` *`㿘> a   > a   㿘> a @[C> 툐!> b`?> > !(`z 0l!(` @j &dp l@j$&dt@c!,2` $@2&dt @ؔ  #o$> aP@[ " `@ $> !XF`08(&adad&ah &al `@ @jJ* &`X`0> `4&`p0!!ap@˥#> Ha,2` $> !`@R`?> Ԑa(@` ` `* " 㿘#A@") 4#D@ "@ 8#_#@@?08@"! <4? #B@ "!p#C #E@'?0&@!p"? '&!& 0& 8& &&@x  @ 2 @T  > ,  8 &?`@8 2?@ (?> ah ad( ad ?㿘$p #$pu#ŀ`  ߔ $p s#Ł㿘*`!p * * * @ 㿘$p#]`.`!p.@  #$pQ 2 㿘@ `!", % # @`@a   ` @Y   `@Q   `@*` 㿘@ `!", % # @`*   ` "   `   `@*` 㿘 # $tؒ! 2?㿘 #!Ӕ ?  $tĒ! *$t㿘 $@V֐ Q  L 8  6 0@?0&$x 0$"$x%"# "$x01"$x&@$" $x0)"$x0&$x @ @ &$x> I> Ia$(> I> J> J ,ah$t&!&! 0 &! &!p&!$$t Gl 㿘   ْՒ `А$̐x d` @ `@ mt FB tB @.`t= Pt9 T  X $ *t1C㿘  $  dx`@ @  1t F t @ `.` t P `. t T 4. t X 㿐  Ȕdx @ h* @  'M   H `  $B d`   dt F  `dtdt @.`dt T  X $dt*㿐  Ȕdx @ h* ` ' dt F  `dtdt @ @2  ( " dt  T  X *dtx 0`$ d T  `.`dtg  4. dta Xs 㿘` ``  $`d `$ ``x`   jt F? 3t? @,t P9t5 T` X $ *t- ?㿘> 9!؀ 2 >  "@ `?㿘> !4> > ! 0s ` "dx 0&dxdx 2`> "0^0&add &ahh &al@f8&atD< @f &ap> "  `?"! > `@ !, * ad@fޔ at&`X&`p> &d"8`0 ``4at > L&d"  &dd&d `@aȐ> Kc`  `@@ @ 5?> Ԑaxǔ㿘 cL@"E##F@"?#D@ " 8#_#@@0?0{@"C <w?#A@"4 4mcE@l?0k #J@"g?  #B@ "-!x\#C@/!xZ?0#Z@ "EP#Y@.?0N (K& 2I   `"D @ݐ@ !& 0& 8& 7&5& 1 /G 2*@j$   ? &@&& &@& &   ?@   @  ? > ,  8 &?`@8 2?@ (?> ah ad( ad ?㿘*` !x* !y!z* * @  $x (* az@ $x ( $x( @$x`(* 㿘H/` /ta`"a8" ߖ !t"a8@3H 0㿘!t `   !!t "` !t " p 0 p2 㿘 :> L> L> M> M> M!p"@cĖИ#&!&! &!&!&!$b &$#b !p "!p""!p"b!p"  0 4? /!p o*  "$!p@&$"a!p"!!p"a 0 4? /*  o!p "㿘 `   ݐ?݌ `݇`$݃ d p3 $"p $o*  "  $ o@?p /*`@ X" p @ * $ #@  $ @? /p, "@ p_$㿘  $ @?< d7Jp3 $"p@ o$ `  /*  #@  4@ ` @ op*`@  X"p @$ ` /*  #@  4 `  ? /p*  " p` $㿐``Ȕ @`  ` ``` $ސ`d p?#$"p""p@ o*`$@#@ `$ /@ /p, "@ p$㿐  Ȑ@ ap?#$d"ap""ap $d @ 2  (  #   /*  o `$܈܄ d ` oapo*`@"  4@ ` o /* ap " ap` $d㿘` ` $_` `d  Z`$`` lp!$"`hp#""p /@ *`$@##@ ` $  /p,  " p`H$!t "$ 㿘>  Ȑ"X`?㿘8  @c0&`0*`0  > *`0"` 㿘>  "`?㿘> `T"懒`쀢 > " 00&dԒad&dАՔ $`4 @c &a`@ <@c &aa> ` "`&d` `?# t"X`0 `4&d&d@ d d&d`0&d܀&d`8"> dԐ &d> !, `L`D *  &a@cJ $$d> d /"a > P&d" !&d&dd @^8` "> R@Ր> R@ސ#X > Oc`  ``0# @ @  ?> > S  > Ԑa#㿘 cL@"F##F@"ǰ?#D@ " 8#_#@@1?0@"p$?#A@"Q$cE@?0 #J@"?  #B@ "c!#C@e!?0#Z@ "#Y@"d? &`&$`4 $Ԁ }$@$y $Ԁ $@ה > Oc  ` 0# 2e @ja "$$&$&$&$ @? aP&  &$!& &H& " <$$ғ2`?&=&: 9 7m 22@,  '? &@& & &&$Ԁ "& @ &  ?@   $Ԁ   @  ? > , 8 2J?$Ѐ'B? !d`8 ,?@ (> ??B !p`8 ?@ > ??B !|! 4 > 2? > ?> ` @( @ 㿘*` !* !!* * @ !*`#$"!!#$!#$*`*  !b#$ ("b!!#$!#$! `("$"!"$"$2` `*`"!a"$a"$b2 ! `("$"!!"$!"$2` `*`#"!"$"$*"!a"$a"$㿘H/` /a`"a8" ߒ` !"!8$Ԁ`@H 0㿘! `   }!! "` ! "  0 2 㿘 H> P> Q> Q> Q> R!#`,` &!&! &!&!&!$b &$#b !?"!""!"b!"  0 4? /! o*  "$!b&$"b 0 4? /! o*  "!@&$"a!"!!"a 0 4? /*  o! "㿘 `   4?0 `+`$' d  b$"b o$*` @" $ o@? /*`@ X"  @ * $ #@  $ @? /, "@ R$㿘  $ ? dܐ= b$"bo $ `@ /* #  4  `X@ o*`@ " $ ` /*  #  4 `  ? /* " ` $㿐``Ȕ @`h* @ `'؊ ` ؅``` $`d ߐ b$"b#** * "b o*`$@#" `$ /@ /, "@ $㿐  Ȓ@  h* @'a $d"c*`*`@ *`a "a $d @ 2  (  c"   /*  o `$ d ` oao*`@"  4@ ` o /* a " a` _$d㿘` ` $` `d  `$`` L Zb$"b`h#** * "b / *`$@#" ` $  /,  " `#$㾰> b>  ",'` W T`  @Q$(#\> ؐ Ȗ _ D'$'' @P' ;8$`5`"3 "/*,@: #4"!> Ԡ"@$ $ $@$ (@O$ 8Ồ >    q#H$` h   $$` > #X㿘H/` /` B  ?U $  8  K $Ԑ ?&$ԑH 0㿘 c d$ c " d >  T ' b > > #'<> #' G > >  '>  ,' #> Ԣ"Ho o! ?&$"!&$&$"!&$&$  > cp-> Acp`  "0  " @) @ s2% @`b"       2      2       Ƣ`!!` &$"`!+&$"8!"a@!2 }&$"ސ+!a&$`" ! !"@  2!#a &$"a! s&$" \ o s$耦@ $Ԓ @&$$$Ԑ `@x&$$Ԑ `H 0㿘$Ԁ $Ѐ $  > Oc  ` 0# ! "$ 㿘N> N , 2 N  ` 2 > `@ 㿀> J@ , 2`J@ `y`> >  q`0m"#> `Д `?@N`" `> ` ($#''' 7@Mۖ > P!0  @]]&d  @]W&d0 &ad4&ah8&al&`8 &`0&`4&`<զ &`@`0> `4,!> a,`@  * @]6&`X&`p@? a@#> Ua ? @ > Ԑb6㿘#A@") 4#D@ "@ 8#_#@@?08@"! <4? #B@ "!#C #E@'?0&@!"? )&!& 0& 8& &&@e  @ 2 @  > ,  8  &?`@8 ?@ > ah ad(@ ad@ ?` $@ @$ @" @0 @ @$@ @㿘!* "#* * @j 㿘@ `!"@(` с 2!` y 2 "`q  㼐> @ ``b'!") `Q 2"` I 2`A sa nb i " > !(d:`(dabc*@@@ d ( d( @d`(2 㿘`!d @[  2/` ? @ ? @ *`+` 2 3` @ * @ +`@ 3 @ 3`@` ? +@?@ ` 2$*@  @` $"@ ̈́2`㿘> aX`?㿘> ތ!h> b`? > > !x~ 0a@L1J@ > s!0&ad4 &ah8 &al< &ap@&atD@[u&ax&a| @?  @[j*&a$#h > !, `@0 * @[Y &a> @La 2 a`@h* @&ad&aa   `0> `4,!@@  @Ӓ a&`X&`p> Wc@> W#@&d&dd @V#`` ?> > W \ > Ԑb-㿘#A@"/ 4cD@"o c@@!?0hc\@*c_@"-!`? #L@ "I#E@U?0T cB@#cC@",!K? #G&& 0& 8&! @? !<& ! 6 @6&  <1&* .&! 2+ !ވ % # 2  !޷ 2@K 2!@   @   ? 㿘!??#"h!|" " 8@"& 8! @`2& 8> WcX& 8㿘 8 ے > !> "aH!`(! H > , 8 26?&3? 8 @8 @  " ? @(8 2?@ (? ((> ah ad( ad 㿐!| #\ j!㿘!h  ?   "h!|! !) ! "(` T! $ @Ġ$І?(*  Ը@ 0Ġ㿘 > a@Jg &$А &$$Ѐ4!&$А * `&$  *` *  8 @@ *  4 &$ > a@JD !   *` *  8 @@*  4&$ȁ㿘$Ȁ  T> Y> Y!`&! &!`> @Ja耢 > Y"T&!$  `> Y"&!$̀  > X!> Xb!&!&!&$ԁ㿘 6  Ԑ@) ` џћї`$ђ d0ю ` @ @G0? 㿘  $ tpl      d0YU ` @  4@ 0$&@@2 4 $Г*`$̄?   (  ĺD"* @ ?㿘/    0  $Ȳ&@* ?2@  #, +@  @  к# " ?㿐  Ȕ @*`   `k'    ` @$ې  d`$`    㿐  Ȑ@ *  @ k  ' (      `$Ы `Ц d 4@ u   㿘  ` Ў $ ``$  Ј d      X ?` 㿀   Ȗ@ h**  `'' _ `@$Z d @$   쀢 ! ?`0 P<&  "@8&0' 1ȑ* $@ j7  *'  ""@-`''   @@: (`@ " * +       Ի .   Ի. 3   Ի 6   Ի  +    .  Ի    Ի?  ! 㿘> Xb( > Rb8   㿘> bP@G> *H> bX@GݐJ@ > "h ?4  &4&8> " 0`? $@W&ax> bx@GJ  g?Ϡ$$  > + ">   > b@G> @Gb$# &`8&`0&`4$&`<K &`@`0> `4ѐ"0!> &ad4!(&ah8 &al `@ @VԖ* &ap`@ * *  @Vʐ&at @ ap&`X&`p> [c>?> Ԑc$Д㿘#A@"4 4c\@5 @c@@&cD@#F@"<?7c_@"& <5? cC@cB@, #L@ "$#E@#?0" #J@ %& & 0&&& &* & @I   @E  ? > ,  8 !&?`@(8 ?@ > ah ad(@ ad@ ?`15!x 㿘` @ > [c!x     !x2` `   㿘> " > " > "   㿘> "ǒ4> "В`ؾ 0`> b@FpL "> ذ#> b @> `?c&exPH @U &apD< @U &atT> ]&adXc0&ah\&al&ee`&e@P  @ $# > !, `@T * @U &`X`0> `4&`po#`> \c\_?> Ԑct㿘#A@"- 4c_@"/ <c@@ cD@#F:@ cB@"!%x #E@1?00 #J@",?'cC@"%x%?"&!& 0& 8& &&@\!x  !x@ 2 @< ? > ,  8 &?`@8 2?@ (?> ah ad( ad ?㿘%x  !{.`* !z*@ !y* .`* !z*@ !y* !x* @ 㿘@`!"P ! ; ,   `@Ԕ  2?`@̔    `  / ,   `@ɵ  2 `@ɭ    ` , @` @ɛ  ״   㿘@`!"Q   9 ,   `r  `k    ` 1 ,   `T  `M    ` , @ ` :  ״,`   *`%x!x!t!t$  `"!p!p 0  㿘!p` " `  "` ϔ! !p  㿘> c0`?㿘00`T&ad4 &ah8&al $@Sː&dp .@SŐ&dx P.@S&d|  @S&dt  @S&d> c@@DRJ@ "> ֓#H> b &`8> `?cP$@DL&`0> #cX@DF`0&`<* > &`@&`4 v#`> a, `@  * @S$ $ \ 4  * "@ $ H $ <$ L *" 8: \   +`" $ T$ Ñ:   \ " @$ $ d  \ @" &> `> `> `> `> `> `8c4`d"0c!$ $ `$ $ $ $  $  > > a  ?&d@  @` > ԐcC㿘#A@". 4cD@"; c@@ ?04c\@%c_@"% <,? #L@ " #E@!?0  cC@cB@  0 2& & 0&& &  @ &&@< ? > ,  8  &?`@8 ?@ >  ah ad(@ ad@ ?!p( "p( #p* 㿘$@y`$x\$p  @"  @ 0  @    0@}$|?n?"n$.#$.$. 4? 0*`? $.$.  $. P$.$.  4  0?*`  $`$` $` !p"p#p$` @>   @+@` @`+` @ *`> _.`d@Y&$ $.?$. c?$.#$. 4 0?*`  $`$` @  $`#$.&$㿘dt$ ` #ߐ ?    > #p`㿘$t`& ` ` @"?&& `& &  㿘$t$Ð  #p!p$"p  * @@ * @$ `  $  $ $t `" 㿐 $x$p  Ȑ@   `  $  d    ?$?  h\$n/ *  *`. $n @  $ $ 㿘  $x$p \ߒ `$ْ dԐВ̒?Ȓ?  .` . / @   P@ %@ %` %`%`㿐`P#\ $     㿐 `P#\t  㿈 @% ( ! xp  ȟ@ h@   P& *` * &   ?*`  &`&` 0   P#\  D@  㿐#\ D l  㿐 #\`  㿀  Ȓ@ h*`*  ''0` `$,*  ,  '  P#\  쀢 Y`$*    P$ *`$ ?* $$` " * $< $x$p` P&`8`(@   P$ *`$ ?* $$` " * $` `$` * $  쀢` * $  쀢 ??$ 㿘$  > !> "a㿘#8 > Ր "`w 0>  `     ?# 8@ vِ> #2 23f##0㿘 #%# 8@"# 8@?2#㿘?# %## 8 @"ȵ# 8@?2#㿘" `  `1  " >  > (  > # "`2 -# " - "`2 -#    -"`2  # "  #> # 2  %8 # %"`㿘> "`!#``8 `\@ #?#8 "` # `@# 8@ @" "7㿘> "`# "  `` ` 0 `Z0A0>㿘#  8@ "  > #. =0  > #" 㿘``0 " "`͒ 8M@ 㿘 >  ` ``?> ` ``?> `4`? ">  0> ߐ @&b&c0  @N &c`  b7>9> a;> bbcH$`b7>9> a;> bbcH`> –#X @  X    X*@`X`D X   <&c  @> &c&c# D`H@?` &6c > b   c    c  @w?* @ @* >  `&c&c 6c&c& 4&c 8 &> #   <@    ` > #k ` @& b> >ٚc>> a#"paH&b&b&b&b&b&b&b&b> b!&b> b`&b> a> b#p`Xi `  # k  #0$>  c   #Z  % U   P o 0  % G f %r> ">ؐĀ` &cHc "> a!&cH&cL@H X㿘`` 2 4 6  2  È ? 0 ?  㿘 t 4(@ƈ d4(@ th@?Ȅ2h@h@(2h@ th@2h@㿘 t d,m , t ( ( t(㿐`x􀠠"r> c> > d> d> d>( P`xD>  @&c&c &c&c &c&c&`p0 @My `p&`t!?'>  > "#> Ȑ  `p 練 &`l> ν #> a(`p  @n 2 a(`l  @ "`p> ά &`hc`l> "&c0 &c, 2 > Θ > 8 "  @ ?&c(a(b`l &c4a(`p" K&c8> d> d> k#`4> k0!d@&c&c &c&c  &c&`p&c(H@M &`th@?4  @ * " `p@L &`h&`lhD?! 4hDb* 4@ * 4gc`l€`p`l`p$|# &c(&c0&c4&c8&c,ǐ!0Xސ@ `> ϼ!0M0 > f#> j> e?c$ "$$$4\$ֿc> Ւ`,*@ > !0Ϛ  > e!\&`0&`4`0@G 8 4 8> e!\&`0&`4`0? 8  > ` ` @"$ 㿘>   $aP!B@ (D (F!hJ (Da4(D#0 ` @ @ `P``@``@` > !. !B@>!#0 ``ߔ ` 㿘  #0",@`#<,` @ ? > `d`B > 0 `d  2 +  2 (  2`(@**2 +22*`2` *  2 ! @  B >!4  $4  4  4  `d@ @ n'" *#<*2 3 #>  n #@+`3 +` 4 @㿘 @ Ԕ {6 6 җ*    > Μ!  4 !! B`C >!>! 2 ! 2 ! 2! !`B  >!" # !!`B B>!>!#     @  ,* @&#  @ 8` 2`@ ?"@& 4& & @ x㿀#<.`! ''2   2?*`  2b, @ &`@ &@  !`B  >!䀢 !> #` "%$#`   8  $#` x㿘  ? b0 '+> *@`@aА ̩ @0  `2 * @2@@X &*`@  2@M  &㿐 \`@% 8 9$d6 \4 @ༀ`,$*  2*` @ *2g * <# 2*` 2 $* h "@ ',  < M   $$$  ?$ A *  e    @  *  2  %(  > "T$[,2  ; <"@@Ő <,* 2,2`2`@ ?"@$$% 8`i4 e@ༀ`,$*  2*` @ *2ٖ * <# 2*` 2 $* h "@ ' +  ( ( +  3`+  3`+  3@( n#+ + 3`@ 0+  n#@+`3 +`0 0@  $4ҁ㿐H /f * ' #( #€#, #€#0 #€, h$@' ,  * *,@ n`$ , 2 , 4` h l"@ ' `,` `* `*#@# €T d @ #0  @W `H 0  H 0 㿘H /f * '  > V" Ԣ x ;6 '  @c` @& > "(A ` @ > "H5 Ԑ`6 Ԓ@D H 0 "x#0`' 4 !# @> hb<> c` @*  0@   㿘<%6`6`6@ n&@ *#0*2`@ 26`  23@@ 2`3@#0   ``!@@> "hƒ 0`@` ?> @ "`> @ "˳ 0> " ˭㿐#4# #8#€b,#8 3@4#< &>  #!,!,& *@ b0 &  #<', "    ", 6  , "    ? ", 6 ,  @ސ*   n" *2 * 4` ,  ", *`@ $  2 , "     "0 6  , "    ? "0 6 ,  @*   n" *2 * 4` ,  "0 *` ,  2 , "    "0 `8 & `@`<& `4 & & !  2` h $' `* `* `*    n"0#>","  #0`&`?&*` &*`2&  3 n'"@ *`2 *`#< 2㿘6@#6`<#! 6`"( *` # D`** ** 2`@ 6` n &@ **2#0 3 c > @ 2 >  y#  㿘#4< n#$ *`#0*`2  4`4"4 4 #$ ,  ,  @,  ., ,  `, ,  , @ , , ,  ,  * >  2 n>  @#P0J!$ *`*`2  4`44 4 #"     >  >   #p0*,#0   `k n#> Ԗ" * @*#02 6 3`  #0 `۔ #`@ 㿘  ͖ 㿘 H /f * '  a a, \ 6 \ `  U x!`4 \@ #$#$ \ @ @2 \Ɛ \ ?6 \  @7`4ܒ x`4  \ @ @  H 0㿘 "(& "   *  D  4  Ԑ \  "   "6 Ԓa x  *@ *`@ ǔ  `&  2 &# ` * ( 22$  *@ `   `" *`0*@2@  `  *@㿐 `   "0 *@@@> + @  2*` @| `  ?aА ǰ? a* @  $"" #!"0"@ &`є  @ @  @  @   @  @  @   "& & @ @  @  @   @      "  2 &q "(  6q < D   @  @  @  @   @  @   "  2A&E ה?    "& &`2  @ @  @  @   @  @       &   @ &  ?B?< &@   ??0x &`&` &`'  ƒ   &`   (``(8&` `  2 &` > '# @ 8&` ` &`&` ` $&Ѡ  U ! b0,`@  2 *` ` !"" `@@@& 1 @`@& `@@@& `2@ `2@  $*` ?c 2@ΐ $,` % %|%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%4%|%|%%%%%%%%%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%%% %,%8%D%P%\%h%t%%%%%%%%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%%%%%x%x%x%x%x%x%x%x%x%x%x%x%%%%(%4%@%x%x%L%X%d%p%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%|%%%%%x%x%x%x%x%x%x%x%x%x%x%%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%x%%x%%%% %%$%x%x%x%x%x%x%x%0%<%H%T%x%`%l%x%x%x%x%x%x%x%x%㿘 <""> > ĉ#cd"p H 0"& 0㿘!@"$`(a6"@ apa$`8a  @H 4`p$`<$`8?*   * >  "d> nb\@8 $a6"@a4> А#`J> `6# *24`6 4`J4 `3, `/,`:4ҁ㿘`` 2# 2   h` ?  .` ` Ѐ` "@m ? $  `    x  0@B & &`h> #h*` &`|>  z&` `x"??`  @j# &`&`&L a &`> Ԑ a@ ` = `+ ` "@ ( `  `4 *` @ *``` * $` .a~&`.a.a.a.a.a&`&` 0#\#`    @  2`> ) 00̓,  S,, * `* @` " > @ W>  X>  `a ` .a^aa~`.a~ `, `" a~`Pa~0>  a ` .a@aa~, .a~ , * `* @"`a~ 2#`-a~#`#\    @!  2a ? `.aa, @*``@*`a~ .a~ , ` " a~``a~` `@ >  Ġ0C> u &`0&`4`0 V`  "@j 8 0 ?耦'?2 '`@2' @-m 'a ݖ ``'@j" @-Y > {`Đޔ> #`*ݒ@ `    㿐`0@ƒ `&`L ` 6`6`&` l&` * "`2$`ȑH /d4`Ɛ* %`ƀ  !> `ƒ  G `ƀ ``>  ``Ȑ 6`#\#`   @^   ! !? `.!S!, @*` @*`!~ .!~!@ +   " !~``B<!~`B`> ސ!6`" @ > !Ӓ6`> ΐ!0`Ȑ#\#`   @  2!  ? `.!!, @*` @*`!~ .!~!@ +   " !~``!~``@ ݐ> !H`Ȑ#\#`   @  ,    2!  ? `.!Ӑ!, @*` @*`!~ .!~!@ +   " !~``!~``@ > !p 6`6`6`.`.`Ր<#6`Ζ``  }2 2 ? `Ȑ#\#`   @  2!  ? `.!!, @*` @*`!~ .!~!@ +   " !~``t!~``@ Y> 8! #``Ȕ #\ @^  2!  ? `.!T!, @*` @*`!~ .!~!@ +   " !~``=!~` `@ "> !ܒ6`Ɛ`0.`Ȑ  `> `И Ȑ!``8`Ԓ5 &`̒"`> `Օ: #\´"`Ȑ#\#`   @  2!  ? `.!!, @*` @*`!~ .!~!@ +   " !~``ސ!~`"`@ Ð> I"@ `Ր`Β` ?`Ș#\#`  @  2!  ? `.!!, @*` @*`!~ .!~!@ +   " !~``!~`" @ {> "p5K6`?#`    2 " `̀@ ~`ԑ2  `Հ  ~  } ~> " H 00&`]"  @*  > #  26`` @"$ 6`  ;`ƑH 0? 0 > Ֆ 2 * " ` `` ( ("` ( ("`` `"`㿘?2 > Ր  ` 2    *  > "`a 㿘? @2 > Ր `` 2   ऑ* @   h@"H e r@ "=  e@7 0  m@? 0  n@"  e`g@`f@ |0>0 e@k 0ut H /d4 * %  "H 0]  !W `& *`` &L  "  Đ 4 ?# @4 2 ; Ŕ 5 ƀ  e 4  e g@*? @2  `@?`4`# @  `*  * > t a@4$   @$ k @> 㿀?2 > Ր  ` 2  6M  * @"G ƀ  Ȣ'  @fW" ?'x@fu"ƀ  )  `6! . @ ` "   *@$ *@$  $㿘> t>ג!ᔘb#㿘> t>ג!ᔘb 㿘?2 > Ր ` 2  65?ऑ* @`.  `*@2 ` t 2!?`, @ `?    `(@ 2  B @  `  f ??< 㿀 D? @2 > Ւ `@ 2`  *@   &   (@ <  t& 4ƀ  Ȣ'  @e" ?'@e"ƀ  "  < D  " < N& 4 N  $H b >"` .` 0t.` 0r 02 .`  .`  `Ր?.``.` .`  `А?6`   `Ԑ?.` 0Y 02 .`  .` .` .`  .`  .` "6` .` .`0B` .`  ``0   ` `  .` &6`   2 6` .` ` .`  (@.`  @ @.`  @ Դ6`  (@`  &` $@`*   = .`㿘` \ 02p !~ ; @o  2e !~ / `!~  ` 2!!> !~ " 2P !~ !~! (!~!> ! " 2? ! !!~  `ِ ` ` > Ԑ".!~ `!@J , *  * @@. l     #`#` #`$#`(#`#` #`#`,#`#`#`#`0@㿘!~ 2?> #.!~!@ J@  ,`*  * @@ 耦2X> # \"\& \?"D l 2`  2 * D  `( @ @H @ct< 2#<>  #0!~,`.!~ - *  * @"`!~  0!~ &X\X&\\ "@%"\&:   $ $ $$ $ $ ($ $ $ $ $ $ ,$ 00@   A`0@  㿘.` h*   * `0P2!i !_* ! @ !.!`  .!0<> 0M> 0 `@2O #>  cP  @ @ B #X * h2 *` h2 * h2 *` h =*  h * !  .!0> 0P>   `@2 #>  cPf  @ @   @ #p㿘! @ h B B  a ?  B   `  ? @ ? ``?  @ 2!- @! 8!" @R ! ! .`*  * @`!~ "  耢   "!~x  &  @@   @@  *@  =  `ː ` *  h*  h2`* h2`*  h2`* h*  h*`   hs ? $   h `  @ "$ h `@Р > # h *`  h ` "@Q ?  h ` 4 > # *`  Ȕ 㿘!~` > #_  h *`  h ` "@& ` h `` ? v   ` ``0` `2m !?.!"Y!&` /   + 2`*`  +    `` ;`0`"`0J "5!F  "`4`00("0`$`0*` " @`0`,<@bYH @`0`0 0< @# A`0!~!@`.!~ `*  " !~`2 9!~ 5! .!` `@ &` ?  .!!_*@ ! .!   4@( `2 !!~ "!!~!!!~@!@ @ ` > #В   > (> >   >  0㿘`)! % h ` #> !!_J@ @ !.!.!۔ P "`@ !  h `"!㿘 h ` @ `  @> `Pa ? >  pU> Ő `  *`       ǐ @ĕ-  @ !?.! 2  ` `$ $  @ "   "    @  N2M  H  $  (`"$ $ ($ <$ $,`$ $  @ ,@ @ @*` `  ,@ &$ 4`  @ 4`   @  @d ,`  ` a >"@,`  (@$`! ?  `.!!_*@!.!/ M   ` "9 ?`0`A 9 ?=   0`0 ($`4$`0 $*` $`@$`@ ,`H@a`< `< 0`@`0"  !~!@`.!~ `*  " !~`!~@K  @$ !`.!  @$ !`.! 4 2`4 㿘     > m  0  D>  ` c`a@  @  @  2> >  В ` > `  ` I@D`"  @ > ;  >  2> >  2!> /! 㿘` ``?` ?`@&`! .!`?&`!?.!? X` V `$ + ` `("  @ &`$&` &`(``   @ զ@@r Ԡ@n@/?- ` &`  `.2 *  `@.2  .6```̐ ?6 ` Ԡ" @`. `@A . ! 0?. `  `` < `&`@2( ``4$ `&` .2`*`  .2  .&`! ? .! !_* !`.!  (> b ' H /d4 * % !!_!!~ !!@Ĕ H 0@ ZВ #\>  O!(@ƒ > H!h`!7> ?)>   =!p - ?> 4!x`)>   @,!p @- @ ? >  !   %>   2  ,  @@ @2   3 #\0#`  `40 !7> >   H /d * %     `  @" ?` ?"`  @ ` " ?4` >  А!Ȑ ? d H 0`*?@ " > o!㿈 ` {'> m"4*` €     Q Ѱ  ͑* R  ư     `ְ 6?`!?> m!*` € ` @D `Հ   * @ %6   @* `Հ 2   0 ~ @ `Հ x  2r   @] ``  E @]ϔ0X `H /d * %  #``ȐW#\`,`0 *  * @ `.  . !? `,!@! !~!@`,!~ `*  "  !~`21!~   H 0 @]w > m\* > !> "> " > "@> "X> "p> "> "> "> "> "> "> #> |#(> y#@> v#`> s#> p#> m#> j#> g > d > a 8> ^ P> [ `> X x> U > R > O > L > I > F > C!> @!> =!(> :!@> 7!X> 4!p> 1!> .!> +!> (!> %!> ""> "0> "`> "> "> "> #>  #>  #8> #H> #p> #㿘\ `& & 0& & & & & $& (& & & & ,&'&'&(<&'&'(&'4&'@&'L&(<&(<&'X&(<&(<&'d&'p&(<&(<&(<&'|&'&'&'&'&'&'&'&'&'&'&(<&(&( &(&($&(<&(<&(<&(0&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&(<&&&&㿘 <""> > l#ch"S H 0"& 0㿘!@e"$`(a6"@ aSa$`8a  @+ 4`p$`<$`8?*   * >  "h> ~bД@(w "6a"@a4> #`J> `6#ؖ *24`64`J4 `3, `/,`:4ց㿘``ٰ 2 2   M ? А@[b@ @  p  0@2 & &`h> #h*` &`t>  m&`x&` `p"??ܔ  H@Z #?ܒ H @  'ؒܔ  @Zݐ H H@[ؐ H  @>  D`0@ H&`&`  QW &`|>  8 `  +  ` `|@ " ``4  * ` @  *@ `  * `@ ` *``  @*`@ `  *`ڑ+ `|&```h 0&`&` 0 #\#`   @ۚ ` ``2  ` " ?` ` > @ > ݐ H> ڐ P0i> ֐ x``"> > ϐ > ̐ `" `h`@ Ɛ>  0P ` > > ` >  > !0A &`0&`4`0 i` " @Z- 8''쀦'?2 '`@2' @ '`  ``'@Z3" @m > c> #`*@ `    㿐`0@ڒ `&`L` a8&a<6`6`&`&a&a8* *  | * @&` l&` * "`# H /d4`Ɛ* %`ƀ  !> `ƒ !@O >`ƀ ``> !P``Ȣ 6`#\#`   @    " a  > !`86`"@> ;!x> !<#aa6`6`6`6`.`.`ِ  }2 2  &`̐ &``̀  `#` #\ @  2`  " # 2`̀ " `̐@à`> !6`> !А`0.`Đ  `> `Ԩ !```ؒ &`ْ"`> `ؕ: #\">  +``Ԁ``ـ"``̀@2` ـ 8Ԁ@8 ؀ 8 `s> "```$ݑ+` ې??,`2ԐҒ`Ȧ#\#`  @;   "  "`@G> -"x `ِ`Ғ` `Ș#\#`  @   "` w` " @> "K6`?#`    2 "``Ѐ@`~`ؑ2  `ـ `~``}`~> "H 00&a>"  @˒  > # 26`` @"$ 6`  `ƑH 0? 0 > Ֆ 2 * " ` `` ( ("` ( ("`` `"`㿘?2 > Ր  ` 2    *  > "`a 㿘? @2 > Ր `` 2   * @   h@"H e r@ "=  e@7 0  m@? 0  n@"  e`g@`f@ |0>0 e@k 0ut H /d4 * % !"H 0]  !W `& *`` &L  "  Đ 4 ?# @4 2 ;  5 ƀ  e 4  e g@*? @2  `@?`4`# @  `*  * >  bt@%$   @$ [ @I 㿀?2 > Ր  ` 2  6M  * @"G ƀ  Ȣ'  @W8" ?'E@WV"ƀ  )  `6! . @ ` "   *@$ *@$  $㿘> >ג"tᔘS㿘> >ג"tᔘR 㿘?2 > Ր ` 2  65?* @`.  `*@2 ` t 2!?`, @ `?    `(@ 2  B @}  `  f ??< 㿀 D? @2 > Ւ `@ 2`  *@   &   (@ <  J& 4ƀ  Ȣ'  @Vu" ?'@V"ƀ  "  < D  " < $& 4 $  $  ~/ ` *  Ґ"@> #$  . l   $ $ $ $ $$ ($ $ ,$ $ $ $ W$ 0@G 㿘`܀> F#0D  `( @ H @UD< 2<>  #H! &:   $ $ $$ $ $ $ ($ $ $ $ $ ,$ 00@   {`0 㿘 h  4P t " @0S> 0%> 0" `2e`1>  #h} @ `  X` А Bb@ > > ې#p#e Ԑ#@E 2  h#P"; > Ɛ#@* h2 *` h2 * h2 *@ h * "@0> 0P>  `2`1>  #h}P @ `   `@d#㿘 @ ` |x 0 ` 3`"h`"  & @ ` *`>@ @w &   ?, *@ |*`  !  *  ,` "@ `  *" @@ ` *2    ` @F Ѡ` @㿘@ `4  hBa     ? @ '   ?  @ 2@ @@ ` 2@@@ `" h`@ 㿀  ؔ   @ *  2`  *   `*` ߐ * ` *`   * `   `@*  h *` h2 * h2 *` h2 * h*`  h ? $   h `  ` " h `@0 > + h b@ 2 >  ( *` x 㿘` >  8  h ߒb@  ?      |` ``0` `2M4"H4&`   *  2`  *` `` 0`0`"`004"*`,4 "`4`00("0`$`0*` " @`0`,<@TH`0`X`"!8 |@`0`0 0< @# 3m`0&`~` ? @&`4`? 4@ 㿘`  l, @" 8"   `2    ,  P㿘 h `  > t H ? X >  `h> ؐ x ` @ @*` `  *`  ``  @" @  "   2`  $`$` @ " ` " `` @ `B2A` < `$` `(`"$` $`($`0$`$, $`$`  ,    `*`  , `&$`4 ` @` 4 ` @` `@u , ` ` a >"@, `(2 `4 4 < ` ` ". ?`0`0 + ?,  `0 0 ($ 4$ 0`$*` $ @$ @`, H@S  <` X"a8` < 0 @ 0"  $`2s   @$`}  @$`  - @`2S` 㿘     >   0  D>  ` `a`  `  `  2> >   `> ` `t@ro`"  @j > f  >  2> >  ] > Z 㿘`@``` ?`@&`` ?0&` R` P  `$ + ` `("  @ &`$&` &`(`` ! @ ٦@@ ؠ@@!M?' ` &`  `. 2  `@. .6 ```А ?6` ؠ" @.`@q .0'`  ``` F ``&``@ `` `&` .2 `@ . .&`㿘 H /d * %     | `  @" ` ?"`  |@ ` " 4  >  ! ?  H 0> #`* @ 㿈  ' 6  0z&  u q  i  0c a  ]*  Y  S   @Pږ `  k @P0= H /d * %  #`#\ 2    . . " {o   ;H 0@P [> }Ї* > U!(> R!@> O!P> L!h> I!> F!> C!> @!> =!> :!> 7"> 4" > 1"H> ."h> +"> ("> %"> ""> "> "> #> #> #(> #8>  #H>  #h> #x> #> # "F   "A   "< 4: @ 4 5   &/ . ", 04* " 0%"$ @ ! " `    " ` %   "  @ $   @ 0 㿘\ `& & 0& & & & & $& (& & & & ,㿘``Y 2E > "`2@  ?2 &   24 > Ac 2- >"`2 & > 3c 2 >"`2   ϐ ?2` > c 2    (?  㿐`     &f(   (@&0> >R>Sf(! c         6`P&``6`>&`&`&`&`&`&`&`&`&`䀌&`d &`> > > #a x&`&`&```(> f(&> > > "Hb&`&`&`> > "b(f(  > > > "lb&`&`&`> > "0bT&a&a#f( &a &af(   a &a &a&e!@&f E  &f > #`0  f " &e> "&f&e&e  " ```e @!p` `e` ` `!@&f`> I @d: a4 @Q  ?  `@ @ @ >'  @ 㿘 <8 4& <KŐ㿘& %؀  `` ">    > @  0` #!  &!! # 㿘&`%؀`2" ܐ 4  4  4 4 4 4 4 &4 4  ܐ $ $ $  $   $  㿘! > $ H&( ;! `7!$ 4 4& >  p   @  `>   &  $ $ $ /@   &   @N  $  >  w &$ 㿘!` 2!> ܐ ؀ "> ֐ " $`   @N $$ $` 㿘!! %0#cP'>  d&    ` 9 `$㿘@%  4 %? 0%?`#2``#2``2`` 2`2`2` 2` 2`2` 2`㿘!` ` %> !Hq !$? &&$  @3   3 @`    3   3 2 ?#ߒ @3 23 3 :3 3 3 3 @   *@  *@  *  ̐ *  @*  * *@  3 !`&!㿘!!` ~%ؐ ?&! ?# @4  "! > !h@ ",!`&!! V `&$  & "4!$E&! $! > !"@  &!$&!  7  2   '?   @0 ? 2 * *  2 * ?c 2 * * ?# @2`*4 4 4 4 4 4  `* *㿘@ %  $ % %   㿘!`  `%> y!H!$ ?&&$ ` ` ?$`<@ `"$`#$` `  * > !ݒ  ܖ  @ *  *  ̐ *@ 5 > !Ȗ   *@  * *@` $`!`&!㿘!!` `r%ؒ &!  ?$  @ "! > !@ ",!`&!! P "@ 4 !$> "!`C&!$! > !" @ &!$&!  5 `   "> )a|&>  ?2 +@  2( > Ւ @ 2`(p "p > Փ2`+@  2 (t` "t > Ց2 +@ x`"xa| "a|$ $  `* *㿘`` F &> d@"p  > d:" > d4" > d." > d(" > d"" ` `2  > !(  & 48@  㿘4` > d"0)> d"> &c&c&c&c &c&c&c&c&c &c$&c(&c 2&c80 @"֔ &c> d&c @b ! А@Jb@6c> dc@q &a|8 *> d <@%> d @@ > d> d#ɱ " > d"ɪ " > d# ɣ "  > d"ɜ 2> d > dɔ"p " &c> dɍ" 2a&ca @cbx &a&aĐ .a @&a "$6c6c6c6c6c> dp" > dj" ,> a>  * a &a&a.a 8 A` &a> d#(:`0y!!!6c6c6c6c6cD  @"?<! 2!!2!> cc&cHcH `@4&cLa? 0 &a` c  &aĐߌ&aax`U&axb2   'a  a` 0 _ a` 0a   b2   `Ot0 > d#3  @ Ð b2   `9` @  Y㿐V#> d#` ?` 7  H7  !  ` `7 7`  &@*` 6#* #: * 6 㿐V#?# ? @ `2 *`@ 7   2*  7> dƔH!  ` `7 7`  &@*`6#?* #: *  @ `*`2@ 6 2` #R ` #2` #P ` # 0 2` #R ` #@?#(2 2` ?#R  `  #*0 ?0 㿘"p 2u ! , " @* !&"d , @ !&#Đ ` !@ 8! @  &"h> d N#`@IY &"p> d D#! ` ! 8! ?  &"l> d /#@I: &"t> d %#! #!  ?Ȑ!#`0" ! > d #@I !`4"@ ! `2  > e   0 㿘"$`$* `"h ` k6> b   `  @H  &`,m e` I#đ* @"`> e @Ӓ  $ ! "h*  @  #&> e G h"` ` @I`$ &`,; f#đ* "@`(   @`6   @6&$@&  ,`,@`$ `$` `$`,`,`,@,``$ &$& 6..  g. ...` @㿘`(>"`$`(` " Ґ#đ* @> e \ Ɛ#đ* @#đ* "@> "``$@I1` 㿐!B!  *` €> ei <`2> > eԐ " > Ւb0*'@  Y(`` % > e > e !  8> e a 8> e!(' ? YN&`> e!H0 > e!X @B'> > ը"b0,``@2`> e2` ??̀ > e!h'@- " `  > e0> e0 ?*  ' YD `'  Y; `a!x``@Ǒ,`&`㿈@> e6` a! `J6`6` 8 ? ` <` &  `4& >  ,` €, ,  , * ,%  %  @@ِ @ ,@ @ ,@ 0`& 0@i @ ,@ݔ@\ @Ք ,@Д@vO @Ȕ ,@Ö@   @ ,@@      p. % W "S% O  @@ ,@ 6` 6` 6`  @ `@i  >  `  > Ր!J p. @ %  *% , %*   %* %*`%  㿘  ,@,``2   @@_ ` 2    z&   v&  r "L   L$`$` 6  $`  @" $`  $`  @2    $`  @$`   $`  B #@$` @n``9$`?  @    @  b #   `?$`$@  @> e` `" ِ!$`@ @ @ b@ #$`$`$`$`@` ` `,`,` #`< 2"7 2 - ) &`` b`     `   `( #`㿘  `,, `,@80`2  @@p   $ ,  " 2  " "        @`    " $     ?" $  @ @@`&1  @1  $  @ @@`&1  @1  $  @ @@`&1  @1  $  @ @@`&1  @1     $ $ 㿘`   &  & & & @z&  㿘?.@6`2 `*  ?  & & & & @c&  `2  2&  & & &  ?& & & & &  㿘?.@*26`6.g<  & & & & @2&  g 2&  & & &  ?|& & & & &  㿘?#@#@66/ *6`..7  @ ?#  & & & & & @ @ ?2&  & & &  ? @ & & & & &  㿘.2`&`&` > e0 > e0=Ks  !2 &@` 2&@  &`& ?&@㿘/ /` (`67`7 @20`0+#" "   &  &2&  @@@&&&& &&&&  0    `?㿘@ ` "`` 4` r"@@ڐ "`` $``  2 0`1 ? #$`㿘@`* @ [N E2`M`4 Y Z"@@Z  `@2 9   @& `,@`@2> e!8 @`@"` ` & u "11 #`,`1?*@㿘@`* @Z >M'@2`&J  ="@@E  `@2 @ 5&  @& ! @* <ܒ `@"' ` &  ?1@&1 & 4@`, &`1?@*㿘@`*  @Qc@2`&<#@  "@@ @`@2 %@   @& $ } `@" # ` &  1@&& &?1 &4@& &`?&`, &`& `@ 㿘 > e> e& &&x& !㿐   ,@ ,   @ 2`@`  " 2` $`  ` ` ` `'``  (`) , 30`1  @ 4 @D    (`) , 30`1  @ 4 @D `  (`) , 30`1  @ 4 @D   (`) , 30`1  @ 4 @D( # (`) , 30`1  @  4 @ $`$`$` $`$`$`$`㿘 `   `@Q       B : "! 1 B  (" @ B 0!    b`    B @ b`(  @@ B 0@!    b`  ` B  b`(  @ B 0!    b B `&    b`(  @ B 0  ! ! 㿘`  &> e!`r   > e~!# ####1 `_      `?    `$`   ` "(+@+(03@3  @ 0##### 㿘` ?    ?`8#  ?@ 7`@  6`@  .//@67@/`@ .`@  670@./@(@!#####?   LL        9F (fɀ  ( 4("@8> >  "'b> e' p@ b? > > ""%b"b *>!> #@x!> "#(> $ H,",$ L$ T\$ `$ X$ $ P`$ d$ l$! $ $ tऀ`> А!`"@>@x~"!> $!  !!@$!@B6;b ub> e@""  !> e@8@Ւ" 2> eT"(@R" 2> eJ"`  > eD"$?> e?"Ƞ )> e'> e#?P,  p҂@` ` -@`? @ ,  p҂@` ` `> e#H@p?p" ?p "> e@А#  @@# 2> e#@# 2> e#> ?* > " "`b`4>  P`=@: ?P ?P* > fs 㿘!> !@wڒ!> ",` !`@ @", @ L -}#> [ `AL @` '>  L` @ / 2*@*@L @%? `L , : `L :  L?$`L  /   L  /2  $`  $ ",@L / ,@", @ ` (L - #>  L c"b  d  a b   sb   $b $$b @@ L $b x> "N`' ('''ؒN`J@ ,> `FܒJ@ ,> `>> "`N@ x>@N` d2> f> f``  >  ?& & & `"   N`> f( ֔ ؒ? & & &  $ N`> fN@ 0  &  & & $  i l'`sN` e#`s> f `8!> " ?& & &  $" N`> fN@ 0 x " & & `& $" 2"N` d t r2">" "> f  >F"& A>> f` q !> " ?& & &   $" > f#`@> f`8` !> " ?& & &   $" > f`H> f`8O !> " ?& & &   $" > f`PA " & ؒ`& & $"  "> fR X> "`LJ 1ܤ :  : N`> fN@0   & & & ~  f@N` d`l> f` > " ؐ & & & h#" `l!`sN` e`s> f` !> " ?& & &   $" > f` " & ؒ`& & F$" 2E"N` d t r="> f`̔ !> " ?& & &   $" > f`P " & ؒ`& & $" N` r  > f  N@> f 0ܐ  & &  & $ " > fp 㿘> f5 N`> f%> f#> f!> f 2  & `! ``a ذ N 2 > f > 怢 p p㿘> "`,> ",`'> c@ "> f@u  > f  `"?@` &` &@L *?Ѐ &@ $L 0` &@㿘#> b !> > f!#t $b#t. @@\ > " d> Y> ")> f`+> L-> > # `.>  !> > $  R #Єȑ*`: * @*` " R   ` 2 2 > f!(' > a(' p'> "a> fא!H? @> f@ax> fma > f! @ > b,> x#"@!'s' 2> f!    H o@H/ /c\@t#0@4H 0%X㿘> Ӑ!> " `> *` @ ` `` @㿘> fc!؝㿘@u#@u#1> '> f #@w\#耢 "##@t##@ "@ .,@#㿘`> f Ő! 4  0 "> f> f"" > f 4" 㿘> #Ȁ 2 &#@ 2&#> f"(㿘 " !> f"@@Q @x "@ 㾐> "'@s!> fbX@!?#> f@Òax  ax@'> fb` " @vF  > f> f"pH]   > f> f"HQ & &@u &  ,> fbȐ @Ȗ ? &   > f> f"ДH2 <  & (> f c@ @?" 9 %> f@ʒ 0 17  +@4  > "> > ՒbІ"  *@ 4 " * @" # , 2ؒ    > f> f#H <  &!0> f>  , " 2? " ? @ c@Ȕ " > fnw#p㿘``?P> "` >"!> > gА"ג  > g> f@Wb@!> "Ŕ > g "℀ 7 @s !D> f!'#> c q@r!D> > f!`8'''cq  > g > f#x #x''q͖  2'0" > f       #> g X> g ℀ )@  9> +> 1> f87> > f!)> f'> !x@L  @r!D''''q @  !xb,? 9> +> 1> f7> @r!D> f!> ''''qq b, LJ`> HJ`> g> ""`@ > "b@ʐK# &> gX!!'L &+> g)> 8 aҒC'@  #q- 22L P℀ > f!x@  @a> fa 9> fb@@W  2 '  > ga8> ga@ > b "bb  > H 0+> 'p֖ @P ℀ @qݒ!D> f#> ''p `> "`& "<  "<@ > g"8> g '''!H> !( ' '6耢 "":" 3> gu@"` > f}`8 > g!h@#> ga@Ԕ? > fbȐ@ ( @\a@ > g !g㿘> g^!> "`2> 瀤 `$$ > "`> "`$ X ",  "  > g !02  ?  : $$ $   / > g!@> fc > g!> f> g""X@A@rӒ .`@*  > g"( > g"H㿘> "`> g"hq > ",` €> g 0"X 㿘> ",`€㿘!> #˖ ?" #.㿀!> "'  " > gk"㿘> ",`€㿘> ",@€㿘` > fax> f"`  ސ > f> go"Ȣ"@'> f%> g  #> f!x@; `   ǒ 2 ے 㿘!> ",` > gĐ" `@ ",@ 㿘> ",`€8@ 㿘> ",  8 |@pM |€0@(> b>  ",'` `  @ > g d > gP d&@&  @ b b > gk#㿘> "`> , x"@, t@㿘> "`> , x"@,`d€> g#㿘> ",`l€㿘 & D> g `#E  > f ` = 4> " $```N  s℀ ?    @ `℠  ℐ? 8 @N  s2@*@` ` "$`p> b>  p' > f @o@o > gG#  " ```ے 2` > hjo 㿘> "<x> ""4@>" "$>  "b0 Т@ Њ@@ Ъ@@ >"> h @㿘!>"P@p"<"h@p"T*> !,* > ""4> "0 Ԃ Ң  Ң Ң> `> h"" @^"X㿘!>"P@o"<"h@o"T*> !,* > ""4> "0 ւ   Ң  Ԣ   Ң  Ԣ Ң>̐ "`"Xl  pК@ `к@>␒  "p"> h @㿘>" "$@> !,?*@ > > > ""4"0"a!#> h @   ֢A@ ֢AЂA   @M :>"`!$ >b  "b> hT P  ݐ`@㿘!>"P@om"<"h@oi"T*> !,* > ""4> "0 ԂԢ>b<bD > h @ 6>ТA@ @ >"T"\ @   آA@ آAЂA    >"b@㿘>> !,?*@ > > > ""4"0"a Ԃ  > h$  Ң >"`" Ԣ >"bo`@㿘%><P@nT@nh*> !,* > ""4> "0 ԂD !> h @ 6>ТA@ @>"T"\ @   ֢A@ ֢AЂA    Ģ&҂@@" > h'  >"b" @> 8 >   > a(: a( Т0 (8 $ Т> b8`> "`* * :`>(8 $ Ģ@@ > 8> ℄"* *`* *`:> > a(: a( Т0 (8 $ Т> 8>  8` Ģ0 > ((:? $ Ƣ?㿘%> <)> !(> 8@`4 "@n!(  .? #!( Ҧ?0(" ,? $ Ҧ?0#@4  6 6 | `?0:> >"8(  $:@  "  Ģ` > b8`> "`* * :`>(8 $ ĢB@@ > 8> ℄"* *`* *`:>(8 $ Ģ  > (> >b(8:b$? "8 Ģ? 㿘㿘> a(>  8 %> a(@ @mw"46(.$,? "$ ԢB?@0#@4  ?6 6  `?0#@4  x6 0a  Ơ  Ơ Р㿘P[>$>(8   > Ѐ2> g Є o ??  Ģ> Ї2`  ? @0 `( > Ї2`  ? @0 ` `?> ӑ*  㿘nC X X> c|@ &Xع Jb E (+$ D  < ( $ 0$ <@ " H- 46"@2p @X"@ < @ C  nK  pt  u   >  0 $ 0Ԑ>  "`㿘I( H$ D@Q    < ( $ 0$ <@J  >  0 $ 0>  "`㿘" @`@ *    !W &`&`X&@"&` &` &`  &`(&`$!&`,!&`0!&`4!!`p `< @ B  &`8! <@hה 6`p&`< 6`r!&`@!  &`D!> ݪ &`H6`&`&`  !`ߒ 4 $    4 *0  @ B $ , @ ,  , 4 ``ݠ a 2 " 2 "*   gG#ꀢ@  Ȓ  @  @`@  > gG#뀣@2T !  @  @`@  2F > ݪ Т   a 4 $    4 *0  @ B $ , ` @ `,  , 4 ``ܠ  gG#뀢@2K6`  Ȣ  ؖ` ,`* * @ `2`96` 5 " ,`,`` `*@      "``  ` ``6* ` `" *  * "* * * * 2`ް?6`l`p6` `< @ C  lӖ 㿘 ("2  , "  0  @i"  &@ &` &` $&`  J 6 6a 66a J6a 26a .*`6a @* &a D2 &a ѓ2` a%@%`   B   * 5   @ >B@i@5  @B@i%@%` ת`6"6a !`%@%`   B   * 5   @ >B@i{@5  @B@ig%@%` ת`  a`b`Ț`ؘ` -( +@ 3  gG#&`@  @`@ &` @6a@`@ 6a **`@ @   }4??(@  ?㿘@2  ?`" ` @j=&&` <* & 2` 㿈|  2 2  2z |2   ' 4`H*   '* ?@ | ^ 2` *`: '2` `  '쀢 4`H*   '* ?@ |n   `5 2  ?`; *> €& # w쒒  2   * *  " `H  |> `    `? @   "@ 3     + `??'  $(,048< ?ݔ@         3  + ` `2j `? 3 + ?# 3  3  x> "'`    ?'/?7 ` ' `'  €   €€     &  (  ?# `"@   & 6    `  .   ``? `?'             $  ( ,  0 4  8 <  `?ݘ @``             ``       ` `     ``  `6 `  ` .  2h ?#6  . ?c6   6    > hb& 㿘 > h > h  b`> > Ԑ"  > cؐ   "c> hŐ  > ""؁㿐!>"''€ 2 !> h > h!Đ!863 !  ?p> h> h!`,> h!㿘> ݐ   :" > hatN > ݐ! > h:"  btD ""0020""`0㿘  00 2020> h@"b`""0㿈> h"@Q*> h"hK &``&` `t` H/` /> cܑ: > #.   @  > h"(   > > "`5> b. ℐ!`>"!d>"!" ?.)  :  @? (R@> ?).   (R#\#`#d > h" > ݓ. !P@bH 0x> b. !6` cH/` /> cܑ:  > ݐ!P.  `> "L ` > H 0U "`2>">"!d!"# )@  ;  @?(R@ q8?).   (R#\#`#d> h#>  # .   " '''#  N@@&` cܒ *@ $cܑH 0 㿈> b> . !`>"!d>"!" ; ?).   (R?'H/` /> cܑ:   H 00  . L@&  `cܒ *@* > #%c"H 0㿘 @> *`"L@$ 㿘> "`         H " ,/ & <&& & & @H/` /> cܑ: > #,  "> h @ > h#HȒ> "L, @AH 0㿘H/` / 8`> "  & 8  <z 0z b > "ax> ">  >!> !(@>!(?H!( @˔@ ℀`?H?Lw0> #\> > "aѐ!h> > h#*@ ɕ2`> `$ 0'#\ T b> "a??> ""?0> "b > h##\  r > "b> h#> h#ؓ*@ 2`p㿘_!(!$ "!$`@fh " ?   ?    $`!,  #>by$b#T *&!,@c P$a$= ?c$$$,$ 8 `$$$H&㿘`(  >    -0 -03> aHa a } > 5`0">  H> 0 ((!(!`H`@'@@ !*@  ! !$#!( @@'X'\'`'H'L` 'd`* 'h@?P'l`'p`0't!@  ? 0'L'DxAĘDw ?@'d Hw  ?@v  ?  `$`H$`$`$`xw@'D ? @vٔ "+ !($ < @ * ## # # # 0# H؀  (a( a( ?"a(?" @& ?㿘> #X`", +> I>  "" > ᰀ > 0`>  "&"ᰀ(> h(_#ȕH/` /!> @n>  B~ ` "> i> iD @C> i @> i: P> i7 p> i2   > X s*`  @X d*@  -*XX*@ *XːX㿘> !?(3  `*`> Ր#t"  *  `> a(` ?,@"> `b,  * $ $> > "a">   `㿘> vb@> a?> !`%>  > !? 2 2 > i `Ő <> a> Օ2  *t"@ `*` > i  ?> > i 0a`2` `*`" * > i : @"@"n> a(`?* :  > iD  > c> ? K DI`  > !(=`  =` D> ir ?@ 0 #1> 7> i"@ 8> a( @ \5`@ `@B >  `a@ `>  @@ 4 D@@ آ> "- €> i1!0> i-!0> i)!(0 > i%!80 > i!!H0> i!X㿈t> i!h> i!`'> %> i 0 <  $ ( ,#\ 4#` 8#d 8#h 8 ( 4@ 4 @ " 0㿘>  \ 2 ?x# \ ` > (`8@ &> ( 8   \& @?@# \ > i8!2(> i2! > b @. . !>  P` (&@㿈> 0 `"> i> i`8"!> " !> !( > i "0#\ #> i   t> i"p > i , "|(  * @> i 0b <  $ ( ,#\ 4#` 8#d 8f#h 8 2(> i_"؁㿘N@  t> i0``> i0> i"> iH#0 E#0 0?#(㿘H/` />`0``> #\a$` t$` H p@㿘*` *  D`   1  > !(\ """" """$""(", 㿘 㿘> if#@㿘> ib#h㿘> i^#㿐> !, `@ .@     `   (2 $$ #\#` ?  V  \' ' ''  " 㿘`> i%#Ӣ` `  㿘> !,@"> i#> .`$.㿘> i #&8&&&l&l&l&l&l&l&l&l&&? 0        㿘? @2  `@, > `h  #> j h h`$ h!`O  h  h!> " `$h> `$> ($"" 2`> j  ` `   ?` ?&@ &`> j  @2 ` >  |*` €` @ > !(#> `, >   " !> b @ ` ( `"@ @8b >,b( @@ d`` ?G#@> !(?H@ @   8 %>  @ `>  4@  2   "@ @8  @ 8  @?  B %` ; &`8 > "` ` #> b '> ( Ĕ $b (@8b=ǔ `  "T@? @2  !>  h  hPܐ $ h? -*`" "" 㿘 `"H &    > j> j H~Ӕ` >&`0at "at㿘 `"H &    > j> j H~p >&`0at "at 㿘 > j> j ~> 0!t"!t  & H 0 >    㿘> ", `"  @ " @  㿘#    &r , ?㿐#@2> # &`> `l@ > #@ > H/` /H p@  $l> ",0`''@İ   #@P@ 0c@c@p 0؀` Ho o €H 0 @` &   'Ho o  H 0Wp`r\  U |Ho o  H 0 @2b aC`E/ 2VHo o €H 0@] @ $&  q)4"> Ho o €H 0> 瀎`& " Ho o €H 0> " l& "   &ڤ&ڤ&ڄ&d&ڐ&p&x&X㿘> "Ԑ@㿘{ޔ >"` @> a( @Y 㿘>"` @M {ɒ㿘 `#҂@   ? . %$Ң` ` `? 1?` `?1?** ` `> j?.   |  2( (@2  ?(:  㿘>  0 Ҧ`z>   > +              " "  " "   㿘#>   ?$`D#  * @> *`"Ԡ &> `D ">  !0 2  #b> > "ā"@㿘> #Ԥ 4> !( >  D> >@" `` @*  2 4  ښ >  \*   4@2 Ț cԤӦ > > D`* ` `  㿘> "  > %?> /?"`" 4 > %?> /?"`" 4J>  1> 4*`  * b`Д`> a ⌀`@&>!Ԡ?  +> )> ",a? 4",b䀤@2 4  ,  2" @ *`"? > !(Є Ф? *4&'㿘!Ђ* >a  à    ҢЂ ```> j0 > j0>!> j"@{l > j{i!@>{c!Ha à  㿘?. # , ` * @҆ ` (  .  )> j? @ ` `*@*    * ` `+` {?  ?*  @   {!x Ǒ, 㿘?.  @,  ҆ `   #  > j ? @ ` `*   `+  z?  @    z! ?$@㿘?>  .  > j> jֆ    + `@  .`z`4 #`4zz  ? 㿈> "ܔ"'L ='P ` "`" ?"@# # #  "@& # ` # `"&`> #,>  <",0 "04 "4L *``  * P *@ 2`L# 3 3 > # #> jzo"8  2> > jzh"X 2> jza"x` "`" ?"@$ $ $  "@>  < & > # 4 0`" 0" 4 * @ *` `2 > jz8"* @'@# > jz."@@  ">m Ь@@>" € > "`  . *  . * > > m Ь@@> "`  Ҳ`  Ҫ` > "> "LcP??** c''/> +>  # @  @ @£?  * "**  * @`@<` @" @$( ۦ > b    * *`:  bԲ`bb  *`*   *`* :`@Ԫ@`b 2 ` "` %  ? "$ $  @$ `$ `"@&`` L *  @ 2`P$ L4 4 㿐> .`0"* @`*  * `> "``** @** <`@> "`` Ҳ`  Ҫ` > "> c"'> +> 5> @#  ( ?  * "**  * @`@<  @" (ޢ@``` "` & ` ?`"&`&` 2> > jy ""` *`>   2`@`"``"`> " @`?@"&@&`c0?"0@`"``"`> "#`?@"&@&`c4?"4&`&@&`"@"c`, "`,㿘 0 6`+   * @6`` ?*@@> > "䀢  `6 І@ "1?0/?@H /f * ' >  ې# > "`Զ@`> Ԯ@`> > !(bЦ@`@ H 0 㿘> "` , 0H /f>* '>`   @#@ "+<`@Ԁ@"??""`> "">aa,` "b @ `   `,&`04#@& F&  @>"П@> "    >  " ?> `   в`  Ъ``? 2 > ,,: $*` *  ӰH 00 !>"؟@ (,`!:   z"@>"П@ "Ң`H 0㿘2> > jw#"`&"#>b؟ "bky"bП "Ң` Ԣ># @@'>℀   "k`@@П Ҭ@@ >>kT Ь@@>a$"a㿘kIH /f4 * '    H 00 @  +>  2> jwY# 4 *` * 4   `?> jwL#@*` > "`@  2b> jw>#` 4< <  | *W$ 2 ?#?#(H Ҫ@>"ğ@` @b > `е`b`Э`b> `!0<  < ?,`6@ <` @& @,@ b 4< <  | "@    $ " ?$ 2{ @H 0㿘jH /f4* '   H 0b  @ S> ??!(c  4`*`  * 4` `?> jv#*  > b䀢"3 Э@@@@>"ğ@@@> b  Դ`Ԭ`℀ <`  `<` `?,@ @ 6<   @2%  @H 0㿘  > jvK#- *> c   "> & " &   & &    p& *  "&  " &  ?@& !> > #`  "` > jv# 2  2 "o      > "4    2 #`"`  & c㿘 ` ` > c` "` & & D& A& >  c` "` #> "  ! ## `& 0 b> b4 #b "!bn[  2> ju#""" " " &㿘iQH /f4 * '    H 00E" :"` `> juc#  " Ԣ>bğ€ Ң`  :> k uI @& *|``  $` "@` ?$` @`2`"H 0㿘hH /f4* '   H 0B " 3 3> kF 2v`( " Т@ pꢀ`  2 `<    @>"ğ@ p` ?|2% "H 0㿘  > jtƐ#- *> c   "> & " &   & &    n& *  "&  " &  ?@& !> > #`  "` > jt# 2  2 "nf      > "4    2 #`"`  & ֔ 㿘 ` ` > c` "` & & D& A& > "m  2> > kt: X# `"  ` 2" `  ## `&   > b4 #" 2 $$ $  $ $ &㿘gͰ @H /f4 * ' * > b  "" @"' %>  b ХЬ@ğ@  2 b  "0@H 0㿐> "!> $!(!(>  #T> :@ > "" ''8> "  @+0@S㿈>> 'D'H'L'P؂> !( ?+ > "*@ " #b 4 P> >"`>  "bP> ݐ"a> ѐ 3> &`> !> ΒaT!5> > &(" P#> %> ɢ`<> > "b" 8'> )> Pt#|> > "c""> > > > > +> -> 1>  "̚`|c@7> 9> ;> > > > > >  &'"'b `T!""`""""'P" "> H> ` > . ` k5> )> +> 1> "  , ,@ *`  ?2 , LPP!>D* "*&0@ @S $!%@"" %"ܐc" %c> `<" "`<> ( "@ > ,@ "> a($@ &"> @"`\@"?> "b> "$!Ԑ   $!$!Ԥ &> ",$>?""c@ ?'@ > Ⅎ@`6`<`  <`  ? > " > #>k   Ҕ@`>  @@`0,"> `ԑ* '@?H4`H `     'H> $`<$ "@"$ $ "@&> `0 "`04 $ 4 ? %4 @* @ 2`> "@ *  4@ # 4 `  -` @> a( 1> "* P  @ > !("  Ҥ@@H "> "> ?b#! @@ ֲ`֪`   H  >> > "ܘc>  ",`0"@*` 4 " $ "@" ,P  # ,>!Ԥ  / > "̠ + @@ > > b "<`   #8   ?д@`@ Ь@`@  怠 ٔ  Ԫ@> b> (> }"#>@ * 1> ;!(# Є@ Ф@@ @ @  > +!(cЄ@ Ф@@ @ > "@  > ;!(cЄ@ Ф@@ @ 㿘!>'D  > Ѡ$3> > &`(a> " > ˖> > "b+> #%c> Œbh> " > > > > > %> '> )> 1> ǘ pblHܞ<> > > Цx!<!d5> 7> ;> /> -> > > 9> &Д&'`T""'" b! P%%8"⤒ #> `"" "(k"$@Q7 `!>  @Q3k ` ;> 3> +> -> 5> /> 7> * * * @#$@a ?"?6*a( '>D>  . $* "&@Q >  > ԰ . $& &b , ?@Rg$e^#<%c$&@P ?%(&@Pް ?&X @Pג& > c." & > " \%; $$$(z> `$ b(("@ $* #@  (@ +2cz@ (  +` (  X+`""2   z`"@ `?b> `a(&⸠"`!> "b?> ""> >$@Ԕ  "``$@Ԕ &`$@>?!>"aB"a> > }> "`(4 *` * 4  a >  ` , <  |< > b>$b2   b  >  > "   {@  *4(` 4!>" b"@v㿘 "Ң"   $Ң`!2  ?!Т@ $Ԣ`㿘> "`  >  >+ +dӔ$ 2   #  dʔ! 2   @ d! 2  ,"@  &!&!㿐> > k" `#\  gA > "`!> ݠ!> > k `$$  g1#\> > k#\!P`Ȓ!! g' 㿘> "`> " Ԃ@`>"`  >  > 0"@ 2@ @ 㿘> @ !(#> `P@@ 㿘  "  <@Ox <  " ++c& > " & &  & & >  h e& $ $ & (   z@`>!c @z` & 0㿘   ? & @ "㿘H /f * ' > b    "> ko ؀    > ko !GH 0  "bt "b   >   > kn!*>  $hА & (& $  " 㿘 V>  >  b> "> b  "0 @H /f@* '@' "6` ?`6` * ** :`* @ **  * @ ` @@ "H 0"  "0@㿘> "> ` "0 @H /f* ') "6  ?`6  * ** :`* @`@**  * @ ` >  @ "H 0"  "0@㿐. * @@ / ` `  Ԫ@>  a(`&2  >"Ȫ €@>b @ @O> #b@ D!(2:` 2 >"ğ@ ?  * "**  * @`@<  @" H /f * '  xH 0 Ц@ 4& 4!(@@ `',> "`../ / >`@>!Ԕ > "> b Ԫ@@ж@`Ю@` ?, 㿐. * @@ / `j ` f "Ԣ>  a(`&2  >b   bȐ€@b @ @I> " >`  ?@* `(8@<2'? >"ğ@6 ?  * "**@  * @`@ > @"  `?p` ?@*z 4?& 4(@ @ >` ,`㿐. *  ? / > km!  3 > > kl!8b䀥@2^> "`4>` >`  | @A> #b@ 4> 2+$@ ?  * "** @ * @`@ "$@H  *  kH 0$@ 4?& 4> !(@ @ Ǣ`-  "% ? -   "%   Ҫ@> (`&2  >"Ȯ €#>b @  Ԫ@> b   `>  `> "(` >`  `>` `?,@ @[> b@ Q> 2< 2>"ğ@c ?  * "**@  * @`@<  @" H /f * '  ՔH 0 Ф@> b 4<` <`  | " 4?& 4> a(@@ @7-> "`/ ../ >`@  " > bж@`bЮ@` a "%q ? -  U "%"   ,@"& , 0"& 0㿐. *   / > kk!  ` 2> kk!8 " Т@>℀ > !0&2@ ` Ȑ€@  @I> " >`  ?*  `9> <2'` >"ğ@4 ??  * "**@  * @`@ <  @"   p` ?* z 4% 4> !(@ @ >` `2-> "`/ /  ". ! Ң`/   z!> e!P% ? ,  " Ң` $.@z@  "!Pe$㿈` @^` 0H /f4'* '' `  H 0 0Ԋ@' ?'9>   4-` * @ 4` ?> kjܐ!P@*   2?> kjҐ!p> ,䀢@  " <  |< " 0 "$ ? - @ ' "%@@   `Ԫ@>bğ€0 Ҫ@" >  в`b Ъ`b> `!0< `< `?.@ֆ@> k`!j: @' Ԧ@`T" 4>` >`  | @J">  @2@>!Ԕ > "> b Ԫ@@д`Ь`ؒ ?)-  " bж@`Ю@`  "$ ? -   "%" 4 `4`,@"$`,`0"$`0`4?$`4> "d 2, && & Ҫ@H 0 㿐  0] Ҋ@'H /f@* '@ 9> +>  -/6`+ @  *`b6`  ?`+ + `:`* @ > kiʐ!8 "o+` ` 2`f> b䀢 b  >`  |>` @U>  "(@ @J@ "  Ҫ@@A@> #ب'%@`$ @ $`$`(>bĐ $`(€Ц@!(@@퀦@0%@b`+`2 е`> 2 Э`> ba( `>`  `>` `?@ *@ > !(Ђ@ Т@@ @@ @ t6`H 0 Ҫ@㿘]> !( > ` .@  !!`  @6`6` `?H /f * ' +   *  `2  > k!j H 00 > > k"j H 00x +` " > b   > "` >`  |>` @ @Q*@F&@@@   Ъ@@@ @=ؐ 2+>"ğ@%Ъ@@> b    Ҳ`(  Ҫ`(` >` `>` `?.@@ @ذ.@ @H 00  `" H 0㿐` @\Q`  0H /f4'* ''   "H 0 0҂'x    6`- *  ` 6`` ?> khO"8-  ` 2?> khE"X,`` " Ԣ>bğ€p`>`   ` ":`> kh-"x  @z 4?$ 4 `0>  + - - !``-  z#> aaP$ ` ? -`  " $"` $-@z@o "&`aܐaP> "aՒ 2 ` ?& &&"ҢH 0 㿘> 0 > `` `[@"H /f@* '@g > #> 6`b+   * 6`@ ?+ + :`* @> kg!8 ` *@ `2: " Ң> a(`@$&:@ %$*+> > #ب >`  ?@*  @ a(( $(` <2p>"ğ@p` ?@*  za(@@ޑ>` @ > H 0"㿘[.> !,> `>  .@  > ` "`H /f * ' j " Ң<  2p>"ğ@p Ң`"⢀  ?` "`|H 0㿐> "̀`>`  L ,` @@ !> !(`6? * > "@+ *`  * @ !> !( ?6 *@ @ @ @@>   @ @@  > kf"@㿐6`, * @6`@ ?6, H /f * ' > `"䀢 D@ 6A `#@   H 0&0n2( 4?,)? * > "@*`+   * @ 2  4  Ԫ@>bğ€ 4?& 4 ` ,` @ Y@b` (> r < >4` >  -  b?Ԫ@``ж@`Ю@`> !(?> "@  Ң @ 4 & 4H 0 㿐YǷ66`+   * 6`@ ?H /f * ' > b   , 0" 2  :  & & 0    & , 2" "q   "H 0 Z2/> %-  ?4, @@> " "*M   H 0Ѱ Z$@ , />  - > "䀢   b 4>` >`  | &    Ҫ@@>b @   Ъ@@b2 ֲ`> ֪`> b`!0>`  >` ?* 6G #@  H 0 8 ?s& 82' 4?,? * > "@*`+   * @ ˔` 2 4>"ğ@ 4? & 4 , 8 & 8 @ #@䀢!b   Ҫ@0  Ъ@@b2 ֲ`> ֪`> b`!0>` `>` `?.@@b 4>` >`  | $ 4 & 4H 0 㿐`,(!> !(`v6@? * > "@+ *`  * @ !> !(?6@*  ! @>   @㿐@?x*  `@`<@!> !(`>6? * > "@*`+   * @ > a( > > 6 *` @ . "@@  @$ @   > kd9"    $ "  $ "㿐=6#@> k"d6`* @ *` 6` !H /f * ' >`  ?@*  `2< ` ?@<H 00G2% 42`? * > "@*`+   * @   "Ԣ>bğ€ 4?& 4 ,`  7` d/@p Т` ?@*`@z@ 4 & 4H 0 㿐Wq6`,  6* 6`@ ?H /f4* '  " "5   H 0ʰ W"$, $ 2"> !P\3   , H 0 $   ? z@`j  $2   z@- @)@> !P\  2 $@H 0  , -  , >`    ? z@`? 2   z@T >` ?*` `C ?@<H 0˖ 8 ?T& 82% 42`ǒ? * > "@*`+   * @ !  >"ğ@ 4? & 4  , 8 & 8  7` x/@ " Ңp Т` `?*`@z@ 4 & 4H 0 㿐`x* `  ``> a06@* @ e? * > "@+ *`  * @">  a "@>   㿘 c6`* @ *` 6`Z ?*  > " @ 5# @@   V+ Ь@@؆@" > V" Ь@@> b    Ҳ`  Ҫ`> `!0>`  `>` `?*@؂@ @  > "`4>` >`  | @  > !( ? + + @ @ &     3 ((  3 ;  >  0> ℓ2*@?+ /@" 㿘 @ & `㿘 @     㿘 @ & `㿘 @    㿘 @쐐 & `㿘 @  삐  㿘 @x & `㿘 @  j  㿘 8> !0?4 , <> b@> !(U Ф@㿘)>" 8 `8k> !(`#4 "(\`> 4 < Ф@a(U>"ğ@ Ф Ҥ@㿘>  t 8` %> > ">   x$p$t!>" > ,> !( "4@ *  p 0Ԣ`tz@!>  pU!( p 0Ԣ`> `t z㿘>  x 8)> `8`-> +> !> "#> % "<` &x` 6%`%|#>b > > !( 4 b,   ސ b4*`   0Ԣ`xz@` 0Ԣ`|z@>  !> (U6 >"ğ@   0Ԣ`> `x z> ` 0Ԣ`> `| z㿐> "`L " Ң B> ">  ޒ@  "4 > k`#(T?  * "**  * @`@      " ?  0Ԣ`|@<2> >"ğ@> !(ð "0H@@ Ъ@@ A#> ;b## & > k`J#P ?  * "**  * @`@   讔  2> >"ğ@> !(ɰ  @> ̔ : 88> 0"㿀> "̀` 0@* 48'   " #`#\#d ??㿘> "  >/ 0 >Ң㿘 $H /f * ' #>`0  S 2b@0 > b  "Ң0 Ҫ@H 0㿘> #> b * > b> V * > !0<x> "`  "Ң"  Ҫ@"#ʠ'> a(`> * > b?$ Զ ' # # > "` Ԡ * # # >  #)> @$  `!@" D`4@  ?)> ' @$  `!@" D`4@  ?2'Ԩ ,> 5>  >  D  ?   ? @$  `@" aD`4@Ԩ ۮ > b E> " 5> b  `> `> "9> І' @$  `!'ܒ@" +ܦD`4@> a(? b> > b b Ҳ` Ҫ` > a  @"㿘H /f * ' > !,>.  > b  " @℀  "Ң Ҫ@℀ >  ᢒ   H 00/ 0Ң`{. 0Ң`{℀ 4>ք H 00Ф.֤>" €℀  "0@H 0㿘!(S P 㿘!,> ݀ !>" 2!,S !,R! 㿘!(<`` *  R P@<!( "  `   2 !( !( 㿘!, !>! * &!,!>"2!,S!,$"!,R! !$ 㿐>  a(``@ 3"`  U @4   U 2 > #X`"`&&> l> l#c8_ > ݐ".  > k#h]%>0  2!$>  !$ *.$!(  "' r 0,   0& "  $ 0  > l "   0   0 '> m ?#? > !`> l> l#^c8'    8> l! ^#H' 0>  @ "! 0Ho 8 "` b " > "0`" 9_   2'`&&     !,  >  * !> ݒaQ]!$!,> !t`2 '     #>b Ru!,R(aL$b "aL &@Ɛ   ` > l` > l\#xH` PO @  ` "$`> l\#P]@  H` P8 @  `X``P/ @  ` ?> l\r#`$`' = > l\f#R!,$!,' . > l]j#'  & '    `'&& PL> l]O#G]K# `'&&  > m]>  `'&&  ]2  `'&&    쀢`  0( @   !  ,!*`H >"@ *&㿘!$` ` 2 x  xO @ 2??  @$` 㿘O!$" 㿐> !(>`0`  ">  "> "̀`>  f @ @   @.1 2!$H/` /> m> m (](H> m[ ">  >'"@C> #X`2@!$=# > `$q 1!$$!(  $@  @⧒ &!Hqϔ `   ʖ "   @∔ , !$   ``H/` /> m> m \Ř H> m[5 '`4'`@'    􀤠'  쀢`  0( @   !  ,!*`H@ >"@ *'@㿐> !(> 0``" >   +  `` ` @ @`  `@  ` `  h @ !(> a_ @"a$Ђ`  X#Ђy `@.  @`  @2Ia$* 2> H/` /> m> m \!> mZ #X`2-a$=# > `$p ia$$a(`$ pޖ   ɥ "  ("'a$   ``H/` /> m> m! [ژ > mZJ &0&  􀤠'``쀢` `0(`@ א  a `,a*`H >"@ *&p> (>`" 0 @ @"> > lZ "!$ "> mY!H#@"!> mY!`$!(, `0 3   0`0`4  > "0   `8   . !*` * +* T2؀$`H> mYĐ!x"-`@  \Mo*  ؐ  @`2P!TI!*N   @`2`4Tn`4'' 0@Ф 02!Ѐ&`0 &`4  `    @*@`&@&`&`! `,@`@@&@&`&`0&`* 쀢`  0( @   !  ,!*H ؒ` 2@Вc@>"@*&@㿘!(" 0* "" 4 쀢`  0( @  !  .!*H ؒ`   0   B % 㿘> `$@G 㿘> !(` .   >  h`2&@`6 ) &@> 6`$ @% ;  㿘> !(`@ .@ @>  h``6@    㿀> !`'> (#!(   8  : H/` / !> ?b@!#\ #`#`@0#d?!> b?b@!#\ #`#`#d@ HH 0`8 *%> #> 9> 7> m (XA > ℔* `' `P !( '޲@ >b 2b€㿘> !,.  > " . 0鈒H/` /> bI > mY!H 0>b b€㿐 0@2 ,> mWݐ!> `$ H!(> & L 8 $@ $@  yZ@`#& H+> )> 1> m!> b >W!"`" '"  @ ( @ @ 㿘 0@2> > mW!!, H8 $@ >  豔@> `$x- L>& H& L℀   @ <"@ 㿘> 0 !$ a$K:H $`>  " > mWb"" LI!,>"  *M  * !&a,!,L6!%&a,% @ &a(K P& H $"  &   `& & 0& 4& P$  " >'! $ $ $$ 㿘!,  #>b2Lʐ$b *J"!G 8 !\&66&(!( PK~!$!,`'>" 2!,L !,Km!@6!"(H ''   '#\#`#d#h#l  !\ #\ #`#d#l#h   &`   * 㿘`=> }#b :N.   㿘> #P` > " `@> mX#H@?㿘? #> > !Ā` 3 > ݐ"* > mW#h> c #> > m@Ր#x#> a< PJِ`H`P `JԐ!> #P `t$#PP t #P`H$#PJ” `J P 㿘Ɔ㿘> @n#T㿐N `?#> ! @ <=#: 86> m#+> m OpO  "'c #> m %> m)> m.``c`.` O#Ȓ  <=# 8є'z'xl'x|'x'x'z`'z`'y'z'zt'{'{'{'{'{'{'{'z'z'z'{'{ '{ '{8'{H'{'{'{'{'{'{'{'{p'{'{'{'{'{'{'{'{'{'{'{'{'{'{'{'{'{'{'{'x'x'{'{'{'x'x'{'y'y,'y\'y'y'z'z'y|'y'y4㿘> ߢ!, < @ > pW#Xc ` , 0~#0p70~@2 8   2  2 @  @ 2 @ 2 ? 42 @ @  2` @" ` ` 2@2`> p-#`> pVʐ#p`L .L@ ,2&`!/-> p+)> p'> pL a p "Vx V#V㈤*LL@ ؀ ,> pV#L` Б* : `Eܓ*`> ݐ!( €> ޕ4 #t> ޔ #t*> ޕ4 #t4 > p#4 > p#Vp `¤?> p#Vi, > p#Vc '?4 , > p@ VY#??,* >4Np , >4Nh > pV@#4 > p#4 > p#V5 `> ސ t* 4 | > pV(#L`72x4 > p#V `q> ޑ4 t |?> p#V, L`82c> qV  ^> qV Y4  ` > q U P> ߕ4  - > ߕ4 ! | > qU A> ޕ4 #> 4 > q U, 4> p#Uܒ .> p#U֒ ?(> ޕ4 #> ߕ4  t | > pUȐ#> qUÐ 0> qU 8> qU @ > qU H> qU PL > qU `L  > q hU㿘!?΀@.`  && "@*`" * *   K 2 @K@5Ґ ,`h H( h(  *H 㿘> q p`" y{  @ `> "'> r bؖ '" > q,  p` y[@ 2`@`yU 2`@` 2> r"U2> > rb@3ڠ`'`'Ā  > r%> r,7> 9> ;> L  -`*` :`*  L?Ѐ  U `U&``&`0`4 &`4 ` &`t` &`x`  &`|`6J`4 @ K ~`$+  + 4 &@ @ $ @   `@$ @ *@@    @  `@  *"@ *`" *  *  &!: !@4R#,` " ``4 2` * $ ``$`4 `8`+   "`4 1 "Đ 1 a&`&`?̝> ! &`> " > r./"Ё㿘0    4 g dt %3 *` *  4@ `??P `? b?*`?"@" 2@  8"*` *  4@ @@  b?@ ? `$  *@ `b* " 2 ?"  " `  "$ @ `*@  ! | 2`*` *  4@` `m    "@" " @ `*@  `x `(2`* *  4`  c@ *@ "`b"  ]@@ *   T"* *  4@ 8@  @ c* @ *    ?#     c@* @ *   ?#  , 4 , c (   # ,`# (@*@* , $ ( , "@  " @@    *   ? # @ `*@ `㿘 s 0 o> #\,*  4 `t \  $@)> #T)> r     @    $ @   "Qؖ `l*`@ €  $@2 Ho o ?$ H 0   `l*`@ €  > rb Q `H (`PO" `t `l $`t* @0,# 04  "0Ho o ?$ H 0  "0#0 P>     `? 㿘 &   - > > !0cؠ`4 4$ `" $  " " $ $   $ $`$ `` ?@"  ݠ 0&`0> r > r#(> r#Rh㿘? 2  > `2  ଑*@` `0-  *  4@ t b$ p"$ t#  c$ $ $   $  @  $    $  !%$ $ $ $$$ H /e * &  h - @`*  @ܒ   @ْ @ *@@9ߐ@  *  `2 t  t %$ t ?"$ t$ J H /e `H 0 t =9$ t* & ``   t " #> r$ t !c0   t "H 0 l> #@*` 㿘>    *6 .  *  4@ >  l#@*`  H /e * &  @ t  @. H 0| 㿘  >  6 . *@ *`@`<> l@*` 㿘  >  6 . *@ *`@`<> l@*`   > 2 * *` (<㿘>    *6 .  @*  4 > `l#@*`  @ hP ` ]@ P `y@3`x@0O `z@!`{@" F  k@ "+  j@*\@07 l@m@".    $ 4 0$    @ 0@{ 0@w 0 @r &  & "  $ p> 0*`( (4H4t(t 2 "t " H 㿘 p> ` `2`**`  *  4H /e4 t* & t!   H   ` H$ , P$ ( t & t H 0 H(  h(";`"' 0TDQ l2 m2`@2` 2` "a`@6 "2`@00@22` m*2` l(0! @ ` m *` l *0` @ ` m(` l(H  㿈 p> `2 * *@ *``4`(       2 `$   耢  H /e * & `(    S`(`  v r* * `$   | x* * @D   @A `@ @ @ @ "`$2 #!"  " "" *@`@  " *@  * @    @ N *@ *`@@2  "`` *@ * ! * H 0 > Ā    `? 㿘 &   ! `l`T `4-> +>   4$ $$W|$Sb   P P` P &`0> r > r#(> r#8NÒ㿘?2  > `2 _ ԑ*@`"Z `06V . *  4@H /e4 * &    H 0;  & H 0$& @>?& @;  && H /e * &  h*@@C   @@   * H 0 &   > Ԓ 2 * *` ( < 㿘@h㿘@b㿘>   Ԓ *`6 .  * ` 4@ #  @&=   @28 #83  &/ $$ + @$ @$$  &@ &@ &H /e * &  h@* @ o&H 0 㿘a㿘?2  @>  ԰ 2`.  `*``*   4   @ 8   ې  `$ $ #1  S @@` 2   Ô PK  G  $$`H /e * &   8 "$ > rH! H 0 "` 2 `% ` @8`  y   2`H /e4 * &   #ΐ   ?$   #Ő 8  ?$ H 0`  %` &` 㿘  g& 㿘  _& 㿘& & H /e * & 3> r h*@ r * @Ò   @   * cX!  h*@ *@   @ @   @ H 0 &㿐& & H /e * & /3> r h*@ a" | x*   * *@ @c   @` H@Y   @V   * ch!  h*@ *@>   @; H 0 &㿘  . "* > `@+* 㿘  1> A#`@+Ԓ#耢 #`@+ϐ#㿘@   `@  ( 㿘``p4 > rp.#   㿐4`> rL #0􀢠> r#K 0~80   &`> r&` c &``> rc &` 2%&%"%&``  &`&` k &`*@`@(``h```0 h@  hk  *p` *hq` *(a` *hb`*(c`*h@`*(A`*hB`*(C`` `#\> sK > `ؔ ) > b$ ) > b&`h&`l?ç> "&`0&`4Þ?> c &`> ؀ `?㿘  @!& > > "b`4, 0  $*ɐ " " $$ $ $ x   $ $$  `@  4`&`0> s P> s X> s @KC㿘? 2  > $`2  > `  6 $*` @ 0+   *  *  4 t W$ p"$ tw#  c$ $ $ `$  $ `$ @  $ `$   $  !%$ $ $ ` $`$`H /e * & ༒ ` *d@( `  ༐*d@༐ P*`$`2 t`(  t $$ t ?!$ t$Ӓ I H /e `H 0 t =8$ t* & `   t " #> s$ t !``ט   t "H 0 l> #@*` 㿘  , > a$* 6 . *  4@@ l> #@*`  `H /e * &  @  t   @ *hd*(H 0tא 㿘  * > a$* 6 .  *  4@@ `l> #@*`   @ lxa d ]@ T `y@7`x@4S `z@!`{@" ,J  k@ "+  j@*\@4; l@m@"$2   , $ , *(d  *0$  @ 0@ 0 @ &@ 0  $ &Ò "  $ $ H(ༀ (d"5``0O?LK 0  (2a@2`@ 2` 29`07  + 0 ( `+ 0༐  (`#("`+ 0 (`@ (` + 0 (`(((H  㿐 p> ` `* $* 2`*`  *  4`(    @ٖ 2 `$   @ϖ  H /e * & `(    X   *hd`@ @ @ @ "`$2 #!"  "  ""  B*( @(`@@  "  D*( @ؐ(  *h  H@ѐ(  *(   *h   *(   G*h   @* *( *h *(`(` *h9 *:`$ "   *h1 *2  @( h( @$ (H 0 㿘  *@ > !$*`6 . @ *``4 > l@*` 㿘  *@ > !$*`6 . @ *``4 > l@*`   (> a$(2 * (4@p> * a$(0((4@H4t(t 2`,"t`, "`,H 㿘 p> ` `* $* 2`*`  *  4 H /e4 t* & t!  H   H$  P$  t & t *(d  *H 0 A0(( ( z4* x*" 2   ",",  ("@" ` A0(((`46`*`zx*" 2  ",",` ( "@"   (A0(( (4, .  *({  *({, ",,  ({ ({,",? `" " ({ ({ $ " , "     (*(,߆",#@  ( A0(( (4 @ , " ,"@༐ ((㿐'   ,w ```P@2?@?<   lv  2?o@?   lu  2?@?<   㿘   0> #\,* *  4`t` l  @!> #T    @ $  $  @  `l *` €  @2 Ho o , $ ,H 0 H /e * &  *(d (H 0  `@$ ( `l* €> s`h E `H `P" `t `l $`t* @ 0,㿘.`@&. 2?#@2..  > $ Ā`?㿘  @& Ē`&`0> s P> s X> sF     㿘@ 㿘@ 㿘Y, 㿘a"  ``> sEܐ . 㿘> si``?㿘8 0ݒ &`@@ `@< @ @ (@> s0 > sE 0> sE 0E @2㿐 @'  ;p  @`@'   > s E !` @ ";V @@ ?"@ @ ( @ *`㿘?> t2 `  6 t. @ 2N <  2  Ɛ$& 4 . <& 0 㿘?2 >  t. @ 0 @Ɛ; d ;  d 4" , <㿘 0 "B   @ `  ` :#   @ ` 2-  ` " 8'   & 8*` @ ` *` @ `2  @:Ր#  $ @ @ ` "  `` *`2 0? & 0㿘?2 >  t. @ H $ 8 "$ 0 ` 0@&` $ 0`$8$ 2 4  㿘> shҐ! 2 @ P> sa `> sD(> sa8X> shaH 0> sD!P0   &`D<   &`HH   &`LT   &`P`   &`Tl   &`Xx   &`\  | &``  v &`d  p &`h  j &`l  d &`p  ^ &`ta4 " '> sh[a 2'8 '> s?a`@`D* `&`4&`0 "`0@`D`8*  "9 d@> sD!!p7!D8 `'` ''> !v 㿘 4#> sax !  & @> s! C05 @$7& < @ax 4w < (`8 * *    @`4  @2 `   " `4 @@ ` "   <&`8㿘`> s C! 㿘> sg͐"`?㿘4`> sC"0 > s#C08  0&`0> sC#8> > s"cHg&`t 2`0`t &`t`0.`  `# `8``  * > `0  > "&`8&`<?> b4@`p>> s>  !  cX -> s)`@!@@! P`CF` `2 > sC>#h@! X> sC5#p@!@!> s@#x6Ԥ`> sC##` @  @ `p @"`0@`0 D*@@&`x㿘  0 ` *`   ? 0 ? @  *@    t " |  R @/  | "  > t? 1> t: > s S  0 #B͒  0> s & ?& &   @ & |& x #B > s #B & & x& |  *@   & & |& x  |B  0 | 2 t x  t t `  & t& x "   0 `"* 0   :r 0 n & @  2 | ` & | .  0 @ *@V 0 2S 0  . M& |㿘> t8@  > t@@ h#> b C '//ɒː/5   ''@0b > t Hh> "   /'''@ݑ,  `  @W > t XB      ܀@> t pA @.   ܀@ p  > t > t > tA @   @  @@} @b p  > t > t > tA̐  "b p € `b > tt h!> "   /'''@ݓ*`@& p" > tX!h!> " #  /'''//ʐ@Ȁ`& & " > t9! h!> " $  /'''//ʐ@nȀ`. . " > t!0h> " p ' @ t @ `? !   ///'؀` '쀤   my a7"@8 t`  ba7"  mf b > tݐ!Hh!> >`>  `"   //˒'/''/@ /" > t!X㿘 x6ѐ  x H/` / t`& t`4K  & x`$`& `& & & א |` & x 44 0`$@MH 0 0 c 0" 0(㿘 0a b   6   0 `  * h> > "  `' "   /''ؐ " > t>!h㿘>  ` ` `  > ""2 㿘>  ``  ``p @*` > ""2 @ 㿘>  ` p `""㿘>  ` *`  ࡐ   `` *ࡐ @?h>  > b ' ?2 #@ @ 7 6` /'/'/$ d ."@  d  ; 6  0  ///''ɒ  > tz!>  ?"  0  2 `" ܀   "܄ `" "܁> bb`?  0    ``܄"`ܐ h>  > b ' `   a@"za@ta @!@"0`pa@h k !@2e "b "`"`W " ` 0*@O$`0*  0* @ E$`D /  Ȕ /'' ܀   . z  /''ܒ `8. .`  .`?`e?. ..?&`p` .. -  > t!㿘 ܀ >  b    "b ??*c* @  }  <؀  ` 2``?"`"` ""  >    R`  > "`8"`<"` ؐ 㿘> tb!`? 4 0 #> ta@ 4> t!>^ 0^ aߖ x`0`?   ? " > #&`0&`4\?> t>A!> t >=!> "<&`p%> "P&`h ,`"*  t@ ,`,``* ,@*`&  ` 0&` 4 & & & (,   "@    & &0&&@`ϑ,`㿀> ta' h> ''''X & @g0# ? ?(? c ?ߐ c 2 (2 `   0   @]& 40 & 4㿘 > t0="  #  # # # #  #   # #@  "> , @*@" """ # ` *`  # # \#@   ?`((2` 0㿘   23C" , u2`3:   ?Ϡ 2  @ 2@3/ 2@3*"  a0(2 %` 3 d `   ` > t `" 0=7`00 @  )  2 2@㿘`> > t"H`lǘ > t"P;㿘%> tHo o p 2  *@ , H 0x  p  0& pH 0*" *  tؠ  `   4 ϔ  0$ 4@l 0 4 Ĕ ? 0$ 4 @ 0㿐 H/` /  t @ "  2@8  t `" @$  8H 0㿘H  p *@& pH 0   p㿘  ( 4`  0ߐ 0!  0 p* @2 ,> t" t"> t"㿘> & $& (a\ & , 㿘 > t <" 㿘 @ *` `? c *2`  > t `<"> b& 4>  & <  @$ $@`` @㿀& $& (& ,& & @ @ @ > tc' 4''> D''6 Q&    *  2  *`` 2   ??@*    2 ?? *`  `2  c *  @  0  2   *` ` ? c *2`    &   `@ & 㿘`> > t!8`8 > t#9ܒ㿘?#%> tHo o < 0T H 0 < @ p 0 * ,& t :4#P @ " @  *` `   2 *@ 3@  @?< H 0㿘`c deZ4%Z@#/w!@|"@ @"@ @"@&`d  &㿐!,ؖ* *` @ #` `"   @ .`  *    ?# 2 + @ 2   *`@  `!2  0""" ""  0`# ` 4*` # # # \#@   0# < # #  0# < #  #@㿘   *`& `2 @" !   @*   "82 @"  @*    '2  *` `  ? c *2`    ` *`  ` ?# 2 *@ 3 /    *` `  ? c *2`     ? *      * 2`  3@@"  ?#c  *` `  @ `*`2@     >  `.!`4 `$4   *` `  ? c *2`    @ 2 ? ?  ?& & &   *`  ` ?# 2 , @2   ?& 㿘  *` `  ? c *2`       *` ` ?# 2 *@ 3@  $*` `2 @(#㿘> & $& (b & , 㿘 , "& (& ,& (& $`> t#> t#x㿐> #`-ː@b@> #X`'> t.0i 㿘> t\U#`?㿘0 &`4`&`8&`0&`4 &`8&`&`&`X&`0&`&`@&``44> t8#0N` > t8#0H> u8 0D `̨?`p0``     `ꀤ``&`\&`4%@$&`p&`` ` > #&a&a`a?> u7ސ 0> a &`&``ؖ?> u7ѐ 8 0 D 0 2`@8 (D0 (㿘`[`?㿘> u7 H&`0&`4 &ah&a`&al㿘`"!X(`&!X "  "   $ "   2 0   "   $ "   2  㿈 0&!X ,@ 4@= 0 0@ 4@ =!T > K "耢`"!X@!X 2!X d m 2 > u5 P?$ `$ $$  $ $ !\ "&!\!X   $ $ $$ ($ T$ X  2$ !X  8)> '> !P#'!Rh77'耢 $ $`  2!P`?㿘!X #> u  "  $ "    $`h6  $ $  2 㿘!X   "   $ " E  2 㿘`   "@ @`㿘 ` -> uV 8!@  > u )> u'> u` ਑,``6`,````> u6 ?#@*`%`"> u> u6 > u6 @"2> u> u ؔ > u6 ?#@"> u> u6w > u6t `> u6o > u 6k 6g`  > u  %> u!> u`!6T``  ``> u6G  !X" 2 `  (  㿘 ` "& (> u4!㿐 ( 2 > u4!Had  "ad `0,€`4 `   & ,0& 0@& @D  " & DH& H2 ` !X` " D "@  @@(,2`2$   ,0 4 2g   H 0 #\  4 D  "   0 4P  (aX ?`@ "    `` T 2`   (  @? ` ֒  Ҕ  !X " `   Oƒ  N’  M  L  P L "  `#`+E& `  ad? "ad `00€`4 㿘 ( 2 `> u3ϐ!H 6  ?'& ` & `aX` " D"@ @ *@`@8 `0`4  H  , 0€ 4 ad? "ad `00€`4㿘 0 4 " > !X ":   "6   "2    P  & L L*& L P@( O& P O-  N)  M%  L!  P L "     㿘` !X`"` `  `T  2`\`\ 4``2`T+@ ` !``> u3#!H /e * & ` $`T$`X$`\ 0>   4d` "a`H 0H` 1` !``> u2!H /e * & ` 0 $`4` $`T$`X$`\ 0>   4d` "a`H 0` H /e * & $`T$`X$`\H 0` !` x  z  q s 0 `  0  4㿘 !Xy "v   @"``T  2`\`\4``@2 \ !``2 0> u2r!$€ 4/ ?1  & T& XK"!`/ !``> u2Y"H /e * &  0 $`4 >  0  4d  "a`& X& TH 00H /e * & & X& TH 00 0 $4㿘 0 (4㿘!X "  T "   Ò  "  T@ X  "  ?   2 T(( l( l( @( l( l( l( l( l( l( l( l( l( <((( l( 4(\(p((((((((($(8(L  *0(*2(22(((( 83!  ??<" 8# 3!?????????????'#!#! #!#!3!#! !X#!$'> c@ ?a 2a㽰'D 0 4$'H'L 'D> u "@$#\Ԑ  $ €D> u"p2԰?0  $€' ?'''     'ȑ*@# '` 'Ԑ 'Ԁ  LH€ Ԑ 'ԐH` `'> !*` € F' Ā BԀ `?.`Ԥ`)Ԣ`$Ԡ` ` ,` , * !  Ā Ԑ `Ԡ` ԑ*  `Ԣ` * Ԣ `@` , ԡ< #       D> u"2'Ā ڐ?@  ԐĒ` * Đ @2Դ"6L, Ԑ`@  `?$Ԑ`@Ԣ`@Ԥ`@Ԡ`@ `, @, @* @$Ө LH  €$ $#\   ̐ `?'Ժ J' ``". `  $#\$Ԁ`ԑ2 'Ԑ`?'Ⱥ  , VS* (@ ,* "@   $#\$@`2ԑ2 '@ ' `?' 'Ԑ` 'Ԑ ` C2 Ԑ` I2 Ԑ` S2{ Đ  '€㿘> u  816" 8`  > u1+"  > u1$" $> u> u1# 1# > u 1#8 @ 5> u '> u%> u`"1H1P``  `0X> u#`0 `",@> u0#`` H> !H*` €> u0ې#C> v> u0֐#>> v> u0ѐ#9> v> u0̐#4> v> u0ǐ#/> v> u0#*> v> v0 %> v> v0  > v> v0 > v> v0 @> v> v0 P> v> v0 h > v> v0 x> v> v 0 > v`  0`` "`> v@ 0   " > v > v> v0   40{! 40w! 4> v0s!( `!-> v > v0k!8  @ 6 8> v!P '> v%> v  `h` 0T @   8 "1 T> v0I!p 8 @ 6) T> v!'> v <   > v!`h D   ?> v!h@0$ 8`@    T`> v0!0 `> v0!  > v0 !  > v0!  > v/!  > v/!  > v/!  @> v/"  > v/" !> v/"  "> v/ڐ"0 $> v/Ԑ"@ (> v/ΐ"P/̐X X 2;> v``2@> v"X/㿐 "'  "1  + 0 " 0 !"w  "R 0y w` s`h! " `h |  2 `h"! `ha "a$&@ &`^&`l\&` Y )``h "@ "``h "`   ` *  `h ,`!"  ` `7  4 `@ `2`h0* ( ` ` * `h 2a ` ` `h *  2a `l  ?2&`l`l 2   d=  &`l> v-"@?" &@""""`h!$"@`l`h "a$ ``l "` Ր ` <4 `2 @  @ `l 2    d  &`l> v-P"@?" &@""""`h!$"@`l`h "a$`l" r``l "``l " ` `d@`l,  * @  " `l " ` `O@`l,  * @ " `> c! \j&`d g 7``d ? @`\ @ \ ʛ  2`d> v,"!f \%`X`l`X`"`l"`` %@ &`d` `!S \&`d  ``  %` %`@ ` %`` %` ` %` %` `@    `'#    `Ғ@   4  ` `Œ@  `4 *  `@     2   2 Հ` ː `@` Ϩ  %` %`@ ` %` %` `@    8%`  ` 0 ` "  D 0" >  `a@ %4 `Y@ `@S * %# `H@ `@B `@< `@6 `, @, @* @%  "  @ `D@ " >` `@ %4 `@ `@  * %# `@ `@ `@ `@ `, @, @* @% `@ "@`  e` *@%`%` %``6   `Œ@` ~? %` @%`@ ` %``!%` `@ `@ * 5`4   * 5`4    @ %`8 `@ `@ * , %`< %`@{%`D2*  %`8 `q@ `@k *  , %`<  `@_ `@Y * , %`D%`@Q `L@    %`8`ha m2a  `65 2`8`ha 2a`8 . \ `< `!@ * O$ `@ `@ *  `@ `@ `@ ` ,` * , !$`@ `@ `@ߐ `@ِ `, @, @,`$`<" `ha 2a\ `@ `@ * O$ `@ `@ *  `@ `@ `@ ` ,` * , !$`@ `@~ `@x `@r `, @, @,`$`@" \  `D `[@ * O$   `O@ `@I *  `?@ `@9 `@3 ` ,` * , !$`%@ `@ `@ `@ `, @, @,`$`D"`8ج  * & `@` q  %`"%``$%` `(%`  %`T `ؒ@   㿘9> #    ` !P2!R@2?#@`!P?2!@`O 2!D "O 2|`@#> "耢`!!X> v *"Ȓ!@@ +> v '> v%> v`"*ܐ*ِ``  `*ϐb!X"&!\`" `Xȭ  2`XȦ  2&!\&!X # d \ ˔  3 \$`X`X"$$ ƻ  # d$$ \ Ʈ  ` \{$`X`X"$$!\"&!\ \ > 8   @@  `2   `  㿘! @ 㿘#x, #x aR%b 5 = t  s 㿐 &cx ې "8> v*%#8`" > v*#  `> v*#X%b ahal  2  c`0 4@ 2  > v)#0f  c`0 4@ > v)#c`cd&c &c$     c`ct > v)Ԑ#0B> vch#)cl%b %t%V .c^  > a 2 .c^@ 2 > v(!#>&cX( Ә`cx &`0J@ "> w> v)#> w)  ^㿘 #x  `0`4#t#x#` 0 €4㿘`2 P``" 004 `0/ 2 \0 \ @4 ZŐ 0`"#x2#x#x& 001#x#x>( y & 0 \ 0  0`"#x#x#x& 0 㿘 2     `ג@.@ `ђ@  *`  㿘?# #> w !@`@ `   ""``& "#" "M 2M 2` @2  V  $ 㿐&c  .%> {'> { ``     " (x X( X   `0c `4@   > {(  X 2 2c> {( %?cؐ&c&c&c&c bj > {(!8 cؐ &cc   Zc > {(u!X0   Lc쀢 > {(h!xc> {c!(a  VV ,?c* %> w!@@    "!`"`" "  " LI 2 LB   `  `"``@# W0 @eV $W > {(!xc"` `@  `@  `@V` "c @b 2^c>>>>>>ݐ `Ȗܘ#Ț`t &c&c&c&c&c&c&cc  *c ` P2c ` p2c>`>`>`>`!Pad&c&c&c&ccА? >>>>>>ܐ"bܘ!bl&c&c&c&c&c&cc>] ˘`c &cJ@ > {'!В c `0`4cc `0`4cc 0 €4?&c㿘#?  #  `0`4## `0`4### 0 €4㿘`B 8``0M`%0H##>] a &#NNY09 \ @4 ZNR \ ?4 \#`"###�&##>] ? &#R( \`Nb0 \ @4 ZN, \ ?4 \#`"###&# p` B #   0  4 > {!&ߒ 1#  0 #\   4؟ > {"&ʒ # ؒ @. `# `0`4 # 0 €4#̔      #̄ *@ #  "#А p#  0  4 > {"(&y 0/#   0##\   4؟ > {"P&d # #* # 2 *#` 04 # 0 €4㿘> |"{#> { ! "  `" JN 2  ! "   `" J@ "" * > {"x?# " 2   @ "  @2    㿘@ 㿘% `H&@ȐА  > }%!{` 00@  4 @ @@  > }%ِ!hD@    @  > }%ɐ!X8@<@ > }%!4@$@  @@o&ob&o&o &o&o&o 2 d2o@ `4`ho  ?<#2`> 0˜ &@> }"%@J "> }> }"("0> }%~" > c  ! #H@ L@&@  ` `0D `4@   ` 0c0 @ €4㿘 0! #H#D$   0 €4#0 0 €4,J0 㿘`8 0``# 0=`# 08`\ @2`Z/!  ?&/#H  #H &0"cH>0 1 &cL> (   0 ! #H ʒ #H & 㿘H /f * ' / / #> } b8 /@ / &/ #,@/*&/H 0㿘> }HȐ"@`?㿘0!  &@ 4@ # 8# &`4  8  &`  > > }$"H0'# &@  &@ @ `?> }$"h> a@ > &@ !p &@ > }bp7  &@ @  &@ &`㿘  `  P 㿘  `   P    P  d  B    *@  2@* *@ : : *2@ :  &  4 @    㿘   `  `  @  `   *@  2@* *@  2  *2@ 2 㿐   `  ` @  `?㿘  `  `  @/# @*   & &@&&``"   ` 㿘?#@6 6`ג ` : & $ @$@&@ 2   *  , " 4  "@ ,  4 `@ -` 5``@`   b    88 H 'T> !@L T :8?T2 7耦(7耢 2: , 4`444`4`4`ؑ45 'ē45 5 5  `B'? 8' `@`@`*  @ @`*  @@`*  @T  -`@T :-`-2 ,`- ֓2`    `" ` '``? '8  đ. ?2@ Đ"  * c'Ā@ '.` @ '   @ @?  7 / @   7@', @@* '*2 . 2, @ ( ?#   ?;@#..  ?$$6`6'@  @"6``4@  *. ?  @26`@4@2@ / T$   . " @?* 2@ @2. 4@*  *`@ T:@̑* Τ Г*`@  +    ?( 0 2 + ( 2"@ @b  *  @    㿘  㿐  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2* J " ?* /> =%/> ᴬ%/>  @`E < @   7A2Y    @2 $ a$ 4@  , ,2 @$ $ +> b`-?8 -0-?8 - ?$ (` --00 @-a""  Ѐ2 @ , ?$ ( @-a"  Ѐ 2 @`  ,` @$ ( $  h %8+> b`+?P `-`0+-?P%/> @̀/> %/> ᴬ%/> \(D=(  ,%P %`8+> b`+?P `-`0+-?P%  ,% P %`8+> b`+?P `-`0+-?P%/> @̀'D'H'L'P'T'X@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  irqfunctionsocketcontrollerdrivevectmuxconsoleoffsetslotluntargetphychannelleveladdrwsmuxhotplugbiovlanvethertuntrunkspppslpppoepppmpeloopgregifcarpbridgebpfiltersystraceksymsccdvndendrunmstsnmeaptyencpflowpfsyncpflogpfOpenBSD4.9GENERIC#92 @(#)OpenBSD 4.9 (GENERIC) #92: Thu Mar 3 03:19:09 MST 2011 OpenBSD 4.9 (GENERIC) #92: Thu Mar 3 03:19:09 MST 2011 deraadt@sparc.openbsd.org:/usr/src/sys/arch/sparc/compile/GENERIC PortDB[%d] changed: current =(0x%x@0x%06x 0x%08x%08x 0x%08x%08x) database=(0x%x@0x%06x 0x%08x%08x 0x%08x%08x)Not RESPONSE in RESPONSE Queue (type 0x%x) @ idx %d (next %d) nlooked %dHBA attempted queued transaction with disconnect not set for %d.%d.%dHBA attempted queued transaction to target routine %d on target %d bus %dHBA attempted queued cmd for %d.%d.%d when queueing disabledSCSI phase skipped for target %d.%d.%dHBA PortID 0x%06x N-Port Handle %d, Connection Topology '%s'HBA WWNN 0x%08x%08x HBA WWPN 0x%08x%08x%d.%d.%d: FIN dl%d resid %d STS 0x%x SKEY %c XS_ERR=0x%x%s CHAN %d FTHRSH %d IID %d RESETD %d RETRYC %d RETRYD %d ASD 0x%x%s RAAN 0x%x DLAN 0x%x DDMAB 0x%x CDMAB 0x%x SELTIME %d MQD %d%s CHAN %d TGT %d FLAGS 0x%x 0x%x/0x%xGeneratedNVRAMbad underrun for %d.%d (count %d, resid %d, status %s)????Downloaded RISC Code Checksum FailureCannot setup DMA21002200230023122322242212401016012160bus %d is in %s Mode12801080LVDDifferentialSingle-Endedunknown mode on bus %d (0x%x)Unknown Chip Type 0x%x10201020A10401040A1040B1040CDifferential ModeUltra Mode CapableDMA Failed to Stop on ResetFailed to come out of resetchip reset timed outreset didn't clearMBOX_BUSY never cleared on resetRegister Test Failed (0x%x 0x%x 0x%x 0x%x 0x%x)load 0x%x words of code at load address 0x%xF/W Risc Ram Load FailedF/W download failed at word %dskipping f/w downloadf/w didn't *really* startboard type %s rev 0x%x, %s firmware rev %d.%d.%dloadedresidentFirmware Attributes = 0x%x2K Logins SupportedLast F/W revision was %d.%d.%d%d max I/O command limit setline %d: markportdbfailed to set active negation state (%d,%d), (%d,%d)failed to set tag age limit (%d,%d)Enabled FW features (0x%x)Initiator ID is %d on Channel %dInitial Settings bus%d tgt%d flags 0x%x off 0x%x per 0x%xbad frame length (%d) from NVRAM- using %dbad maximum allocation (%d)- using 16bad execution throttle of %d- using 16Setting ICB Node 0x%08x%08x Port 0x%08x%08xSetting ICB Port 0x%08x%08xNo valid WWNs to usebad request queue lengthbad result queue lengthisp_fibre_init: fwopt 0x%x xfwopt 0x%x zfwopt 0x%xFC scratch area busy (line %d)!INIT F/W from %p (%08x%08x)isp_fibre_initisp_fibre_initbad value %x in fwopt2 timer fieldbad request queue length %dbad result queue length %disp_fibre_init_2400: fwopt1 0x%x fwopt2 0x%x fwopt3 0x%xisp_fibre_init_2400: rqst %04x%04x%04x%04x rsp %04x%04x%04x%04xisp_fibre_init_2400INIT F/W from %04x%04x%04x%04xisp_fibre_init_2400IOCB LOGXIOCB LOGX responsestatus 0x%x on port login IOCBPLOGX failed- no linkPLOGX failed- no IOCB bufferPLOGX failed- no Exchange Control BlockPLOGX(0x%x) of Port 0x%06x failed: reason 0x%x (last LOGIN state 0x%x)PLOGX failed- no fabricPLOGX failed- f/w not readyPLOGX failed- not logged in (last LOGIN state 0x%x)PLOGX failed: LS_RJT = 0x%xPLOGX failed- no PCB allocatedPLOGX failed: invalid parameter at offset 0x%xportid 0x%x already logged in with N-port handle 0x%xN-port handle 0x%x already used for portid 0x%xPLOGX failed- no handle allocatedPLOGX failed- no FLOGI_ACCstatus %x from %xisp_plogxisp_plogi_old: portid 0x%06x already logged in as %uisp_plogi_old: handle %u in use for port id 0x%02xXXXXisp_plogi_old: error 0x%x in PLOGI to port 0x%06xisp_plogi_old: all IDs used for fabric loginisp_plogi_old: error 0x%x on port login of 0x%06x@0x%0xisp_getpdbF Port (no FLOGI_ACC response)F PortN-Port to N-PortFL PortPrivate LoopFC Link Test EntryFirmware State <%s->%s>usec%d: 0x%lx->0x%lx enano 0x%x%08xisp_fclink_test: not at FW_READY stateisp_fclink_test: register fc4 type failed4Gb link speed/s2Gb link speed/sFC Link Test Completeisp_fclink_testConfig WaitWaiting for AL_PAWait LoginReadyLoss Of SyncErrorRe-InitNonparticipating?????isp_pdb_sync: bad loopstate %disp_pdb_sync: isp_scan_loop failedisp_pdb_sync: isp_scan_fabric failedSynchronizing PDBsportdb idx %d already validisp_scan_loop: state %d for idx %dno loop topology to scanFC scan loop 0..%dgiving up on synchronizing the port databasebad pdb (%1d%1d%1d) @ handle 0x%x[%d] not probational/zombie (0x%x)Loop Port 0x%02x@0x%x Pending ValidLoop Port 0x%02x@0x%x changedout of portdb entriesLoop Port 0x%02x@0x%x is New Entryisp_scan_loopscanning fabric (GID_FT) via SNSisp_gid_ft_snsscanning fabric (GID_FT) via CTct IOCBCT HDR + payload after putIOCB responseCT Passthrough returned 0x%xCT responseisp_gid_ft_ct_passthruFC Scan FabricFC Scan Fabric Done (no fabric)Fabric Nameserver rejected GID_FT (Reason=0x%x Expl=0x%x)fabric too big for scratch area: increase ISP2100_SCRLENgot %d ports back from name serverremoving duplicate PortID 0x%x entry from listskipping null PortID at idx %dskip ourselves @ PortID 0x%06xChecking Fabric Port 0x%06xFabric Port 0x%06x considered deadchanged WWN after reloginFabric Port 0x%06x changedFabric Port 0x%06x Now Pending ValidPortID 0x%06x already at %d handle %d state %dport database too small to login PortID 0x%06x- increase MAX_FC_TARGFabric Port 0x%06x is New EntryPortID 0x%x 0x%08x%08x/0x%08x%08x %ld already at idx %d, state 0x%xZombie Fabric Port 0x%06x Now ChangedZombie Fabric Port 0x%06x Now Pending ValidFC Scan Fabric Doneisp_scan_fabricPLOGI 0x%06x failednew device 0x%06x@0x%x disappearednew device 0x%06x@0x%x changed (0x%06x@0x%0x)isp_register_fc4_typeRegister FC4 Type rejectedRegister FC4 Type acceptedRegister FC4 Type: 0x%xisp_register_fc4_type_24xxAdapter not at RUNSTATEunsupported cdb length (%d, CDB[0]=0x%x)XS_TGT(xs)=%d- hdlidx value %dRequest Queue Overflowout of xflist pointersSTART cmd for %d.%d.%d cmd 0x%x datalen %ldisp_startUnknown Control Opcode 0x%xRESET BUS NOT IMPLEMENTEDdriver initiated bus reset of bus %dRESET DEV NOT IMPLEMENTEDTarget %d on Bus %d Reset Succeededcannot find handle for command to abortABORT CMD NOT IMPLEMENTEDmailbox cmd (0x%x) with no waitersinterrupt (ISR=%x SEMA=%x) when not readyisp_intr: hard optr=%x, soft optr %xResponse Queue Out Pointer Unstable (%x, %x)bogus intr- isr %x (%x) iptr %x optr %xResponse Queue EntryRequest Queue Entrycontinuation segmentinternal queues fullbad header flagbad request packetbad request handle %d (type 0x%x)cannot find handle 0x%x (type 0x%x)cannot find handle 0x%x (status 0x%x)%d.%d.%d FCP RESPONSE: 0x%xasked for %ld got raw resid %ld settled for %ldRequest Queue Entry bounced backBounced RequestUnhandled Response Typeisp_intrAsync Mbox 0x%xRequest Queue Transfer ErrorResponse Queue Transfer Errortimeout initiated SCSI bus reset of bus %ddevice reset on bus %dextended message underrunSCAM interruptstalled SCSI Bus after DATA OverrunSCSI Bus reset after DATA OverrunTransition to LVD modeTransition to Differential modeTransition to Single Ended modeTransition to Unknown Mode 0x%xFast Posting CTIO doneLIP destroyed %d active commandsPoint-to-Point modePoint-to-Point -> Loop modeLoop -> Point-to-Point modePoint-to-Point -> Loop mode (BAD LIP)FATAL CONNECTION ERRORLooped Back in Point-to-Point modeUnknown connection mode (0x%x)LS_RJT sentQFULL sentUnknown Async Code 0x%xfast post completion of %uIgnored Continuation ResponseMarker Responseunstable type in response queueUnhandled Response Type 0x%xSelection Timeout for %d.%d.%dcommand incomplete for %d.%d.%d, state 0x%xDMA error for command on %d.%d.%dstates=>%s GOT_BUS%s GOT_TGT%s SENT_CDB%s XFRD_DATA%s GOT_STS%s GOT_SNS%s XFR_CMPLT%s status=>%s Disconnect%s Sync_xfr%s Parity%s Bus_Reset%s Device_Reset%s Aborted%s Timeout%s Negotiation%stransport error for %d.%d.%d: %sbus reset destroyed command for %d.%d.%dcommand aborted for %d.%d.%dcommand timed out for %d.%d.%ddata overrun for command on %d.%d.%dcommand overrun for command on %d.%d.%dstatus overrun for command on %d.%d.%dmsg not COMMAND COMPLETE after status %d.%d.%dNo MESSAGE OUT phase after selection on %d.%d.%dEXTENDED IDENTIFY failed %d.%d.%dINITIATOR DETECTED ERROR rejected by %d.%d.%dABORT OPERATION rejected by %d.%d.%dMESSAGE REJECT rejected by %d.%d.%dNOP rejected by %d.%d.%dMESSAGE PARITY ERROR rejected by %d.%d.%dBUS DEVICE RESET rejected by %d.%d.%dIDENTIFY rejected by %d.%d.%d%d.%d.%d had an unexpected bus freemarkednot markedInvalid IOCB entry type detectedinternal queues full for %d.%d.%d status 0x%xAuto Request Sense failed for %d.%d.%dWide Negotiation failed for %d.%d.%dSDTR Message failed for target %d.%d.%dBad LVD condition while talking to %d.%d.%dunavailablelogoutport %s for target %dport changed for target %dport busy for target %dUnknown Completion Status 0x%xisp_parse_statustransport error for %d.%d.%ddata reassembly error for target %dtarget %d sent ABTS%d.%d.%d data underrun (%d) for command 0x%xf/w resource unavailable for target %dcommand for target %d overlapped task managementCommand for fast post handle 0x%x not found?????OOOO?GET NOST DATASET HOST DATAGET DATA OVERRUN RECOVERY MODESET DATA OVERRUN RECOVERY MODEGET TARGET MODE STATEENABLE TARGET MODEEXECUTE IOCB A64INITIALIZE RESPONSE QUEUE A64INITIALIZE REQUEST QUEUE A64DUMP RAM A64LOAD RAM A64GET FIRMWARE FEATURESSET FIRMWARE FEATURESSET SCAM CONFIGURATIONGET SCAM CONFIGURATIONGET SYSTEM PARAMETERSET SYSTEM PARAMETEREXEC BIOS IOCBWRITE FOUR RAM WORDSRETURN BIOS BLOCK ADDRSET RESET DELAY PARAMSSET DEV QUEUE PARAMSSET TARGET PARAMSSET PCI CONTROL PARAMSSET ASYNC DATA SETUP TIMESET ACT NEG STATESET CLOCK RATESET TAG AGE LIMITSET RETRY COUNTSET SELECT TIMEOUTSET INIT SCSI IDGET RESET DELAY PARAMSGET DEV QUEUE PARAMSGET TARGET PARAMSGET PCI PARAMSGET ASYNC DATA SETUP TIMEGET ACT NEG STATEGET CLOCK RATEGET TAG AGE LIMITGET RETRY COUNTGET SELECT TIMEOUTGET INIT SCSI IDGET FIRMWARE STATUSGET DEV QUEUE STATUSABORT QUEUESINGLE STEP QUEUESTART QUEUESTOP QUEUEBUS RESETABORT TARGETABORT DEVICEABORTSTOP FIRMWAREWAKE UPEXECUTE IOCBINIT RESULT QUEUEINIT REQUEST QUEUECHECK FIRMWAREABOUT FIRMWAREVERIFY CHECKSUMMAILBOX REG TESTREAD RAM WORDWRITE RAM WORDDUMP RAMEXEC FIRMWARELOAD RAMNO-OPO/!OOOOLun RESETSEND LFAGet ID ListINITIALIZE IP MAILBOXSET VENDOR IDGET PORT/NODE NAME LISTLOGIN LOOP PORTINIT LIP LOGINFABRIC LOGOUTSEND CHANGE REQUESTFABRIC LOGINSEND SNSINIT LIP RESETGET LINK STATUSGET PORT NAMEGET FW STATEABORT TASK SETCLEAR TASK SETTARGET RESETCLEAR ACAGET PORT DATABASEGET FC-AL POSITION MAPINIT LIPINIT FIRMWAREGET/SET DATA RATEDRIVER HEARTBEATGET PORT DATABASE ENHANCEDREQUEST NON PARTICIPATING MODEGET RESOURCE COUNTLOOP PORT ENABLELOOP PORT BYPASSSET PORT QUEUE PARAMSSET FIRMWARE OPTIONSGET PORT QUEUE PARAMSGET FIRMWARE OPTIONSGET LOOP IDREAD RAM WORD EXTENDEDWRITE RAM WORD EXTENDEDUnknown Command 0x%xno parameters for 0x%xIN mbox %d = 0x%04xOUT mbox %d = 0x%04xopcode %xINVALID COMMANDHOST INTERFACE ERRORTEST FAILEDCOMMAND ERRORCOMMAND PARAMETER ERRORLOOP ID ALREADY IN USEPORT ID ALREADY IN USEALL LOOP IDS IN USEREGISTERS BUSYTIMEOUTerror 0x%xMailbox Command '%s' failed (%s)isp_mboxcmdskipping target %d bus %d updatebus %d set tgt %d flags 0x%x off 0x%x period 0x%xUsing Node WWN 0x%08x%08xbad WWNN- using defaultUsing Port WWN 0x%08x%08xbad WWPN- using defaultisp_reinit cannot reset cardisp_reinit cannot restart cardinvalid NVRAM header%x %x %xinvalid NVRAM checksumversion %d NVRAM not understoodisp_read_nvraminvalid NVRAM header (%x %x %x)NVRAM Port WWN 0x%08x%08xNVRAM Node WWN 0x%08x%08xNVRAM 0x%08x%08x 0x%08x%08x maxalloc %d maxframelen %dexecthrottle %d fwoptions 0x%x hardloop %d tov %dxfwoptions 0x%x zfw options 0x%xNVRAM 0x%08x%08x 0x%08x%08x exchg_cnt %d maxframelen %dNVRAM execthr %d loopid %d fwopt1 0x%x fwopt2 0x%x fwopt3 0x%xispTarget/InitiatorInitiatorTarget(none)PortID 0x%06x Departed from Target %u because of %sadded to blocked queueActive Hiwater Mark=%dblocking queueretrying later for %d.%dfinished command on borrowed timerestarting blocked queuewatchdog found done cmd (handle 0x%x)recursive watchdog (handle 0x%x)watchdog cleanup for handle 0x%xwatchdog timeout on handle %xpossible command timeout on handle %xwatchdog with no commandisp_wdogtarget %d has arrivedtarget %d has departedrestarted command for %d.%dblocked cmd again%s for %d.%dCMD_EAGAINCMD_RQLATERrequeued %d commandsPortID 0x%06x handle 0x%x role %s %s WWNN 0x%08x%08x WWPN 0x%08x%08xPortID 0x%06x handle 0x%x role %s %s tgt %u WWNN 0x%08x%08x WWPN 0x%08x%08x, 16 bit wide, Tagged Queueing Enabled, 16 bit wide, Tagged Queueing Enabled Bus %d Target %d at %dMHz Max Offset %d%sBus %d Target %d Async Mode%sSCSI bus %d reset detectedLoop DOWNLoop UPout of target idsarrived atarrivedchange is badchanged and departedchanged atchangedstayed atstayedgone zombie atdepartedPort Database ChangedName Server Database ChangedOther Change NotifyInternal Firmware Error on bus %d @ RISC Address 0x%x%s: ispmbx_sleep%s Mailbox Command (0x%x) Timeout (%uus)InterruptingPolled%s index %d=> %s %02xisp_print_qentry%s:0x%08x:%sisp_print_bytesisp_fc_runstate: linktest failedisp_fc_runstate: f/w not readyisp_fc_runstate: scan loop failsisp_fc_runstate: scan fabric failsisp_fc_runstate: pdb_sync failsisp_fc_runstate: f/w not ready againNIL PROBDEADCHGDNEW PVLDZOMBVLD UNK TGT INITINI%3d---%d: hdl 0x%x %s al%d tgt %s %s 0x%06x =>%s 0x%06x; WWNN 0x%08x%08x WWPN 0x%08x%08xespFAS366/HMEAM53C974FAS216FAS408ESP406NCR53C96NCR53C94ESP200ESP100AESP100out of memory %s: unknown variant %d, devices not attached : %s, %dMHz %s: unknown revision code, assuming ESP100 %s: resetting SCSI bus [NCR_INIT(%d) %d] ncr53c9x_ecbregs[intr=%02x,stat=%02x,step=%02x,stat2=%02x] [ncr53c9x_select(t%d,l%d,cmd:%x,tag%x,%x)] SELATNS [ncr53c9x_scsi_cmd] [0x%x, %d]->%d [ncr53c9x_poll] [ncr53c9x_poll: rescheduling] [ncr53c9x_sched] ncr53c9x_sched: not IDLE (state=%d)ncr53c9x_sched: tag alloc failure%d:%d busy requesting sense [ncr53c9x_done(error:%x)] %s: QFULL -- throttling to %d commands resid=%lu sense=0x%02x error=%d ncr53c9x_dequeue: lun %qx for ecb %p does not existncr53c9x_dequeue: slot %d for lun %qx has %p instead of ecb %p[flushfifo] ncr53c9x_rdfifo: bad flag [rdfifo %s (%d):startcont %02x] [wrfifo(%d):%s: reselect with invalid selid %02x; sending DEVICE RESET %s: reselect from target %d lun %d tag %x:%x with no nexus; sending ABORT ncr53c9x_sched_msgout %x %d [ncr53c9x_msgin(curmsglen:%ld)] %s: msgin: no msg byte available %s: phase change, dropping message, prev %d, state %d gotmsg(%x) state %dcmdcomplete got %ld extra bytes msg reject (msgout=%x) %s: tagged queuing rejected: target %d (rejected sent tag)%s: sync transfer rejected: target %d %s: wide transfer rejected: target %d noop TAG %x:%xdisconnect save datapointer restore datapointer extended(%x) SDTR period %d, offset %d async mode max sync rate %d.%02dMB/s %s: wide mode %d unrecognized MESSAGE EXTENDED; sending REJECT ident unrecognized MESSAGE; sending REJECT %s: TAG reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: unexpected MESSAGE IN; sending DEVICE RESET [ncr53c9x_msgout(priq:%x, prevphase:%x)]%s at line %d: unexpected MESSAGE OUT phase %s at line %d: no nexus [ncr53c9x_intr: state %d] %s: SCSI bus reset %s: nexus in reset state%s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: DMA error; resetting %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: SCSI bus parity error sync nego not completed! %s: unexpected disconnect; resetting sending REQUEST SENSE %s: waiting for SCSI Bus Reset to happen %s: target didn't identify <>%s: target didn't send tag: %d bytes in fifo [%d] backoff selector %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] selid=%2x %s: identify failed, state %d, intr %02x ncr53c9x: no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] %s: stray interrupt %s: ICCS: : [intr %x, stat %x, step %x] %s: can't get status, only %d bytes %s: STATUS_PHASE: msg %d %s: invalid state: %d ncr53c9x no nexusMESSAGE_OUT_PHASE MESSAGE_IN_PHASE %s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] COMMAND_PHASE 0x%02x (%d) DATA_OUT_PHASE [%ld] DATA_IN_PHASE STATUS_PHASE %s: unexpected bus phase; resetting DMA activetimed out [ecb %p (flags 0x%x, dleft %x, stat %x)], AGAIN sync negotiation disabled (8# (0%( ($(& ('@@(&((100-T4mii100-FX100-TXbncreservedauiutp#%$&'&(ep address %s , wrote %x to TX_AVAIL_THRESH, read back %x. Interface disabled warning: unknown chipset, possibly 3c515? /%s (default %s) (unknown/impossible media) default %s%s/autoselect%s: media_status on unknown chipset 0x%x epstart: no header mbufepgetep_get: packet does not fit in MCLBYTES%s: device timeout %s: eeprom failed to come ready %s: erase pencil mark, or disable PnP mode! wi(((((((p(X(H(( ( ( ( ( ((((((((((((((p(p(p(p(( (!(X"(X#(X$(X%(H&(H'(HPRISM3 (USB)PRISM3 ISL37300P(PCI)PRISM3 ISL37300PPRISM2.5 ISL3874A(PCI-bridge)PRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 USBPRISM2.5 ISL3873PRISM2 HFA3842(EVAL)PRISM2 HWB3163(EVB2) SST-flashPRISM2 HWB3163 SST-flashPRISM1 HWB1153PRISM2 HFA3842(EVB3)PRISM2 HWB3163 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3763 rev.BPRISM2 HFA3841(EVB2)Lucent Embedded WaveLAN/IEEESony WaveLAN/IEEELucent WaveLAN/IEEE: unable to read station address address %sWaveLAN/IEEE nodeIBSS wlanwi_attach%s: received packet of unknown type on port 7 %s: received packet on invalid port (wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: Error decrypting incoming packet. %s: wi_cmd failed with %d %s: wi_cmd_io: busy bit won't clear %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: init failed %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: unsupported crypto algorithm %d wiiocwiscan%s: wi_scan_timeout: %d tries %s: tx buffer allocation failed %s: mgmt. buffer allocation failed wi_do_hostencrypt%s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x wi_do_hostdecrypt%s: wi_start: dropping unassoc dst %s %s: host encrypt not implemented for 802.3 %s: wi_start: xmit failed %s: wi_mgmt_xmit: xmit failed %s: device timeout Unknown PRISM2 chip%s: Firmware %d.%02d variant %d, %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), Symbol %s: %u (%d dBm) put_rateswihap_init: sc=%p whi=%p Sending disassoc to sta %s Sending deauth to sta %s wihap_shutdown: sc=%p whi=%p wihap_shutdown: free(sta=%p) wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s wihap_auth_req: station %s short request wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_auth_req: new station challenge: 0x%x 0x%x ... wihap_auth_req: algorithm unsupported: 0x%x wihap_auth_req: returns status=0x%x wihap_assoc_req: from station %s wihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: rates mismatch. wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: returns status=0x%x wihap_assoc_reqwihap_deauth_req: unknown station: %s wihap_disassoc_req: unknown station: %s wihap_mgmt_input: len=%d MGMT: assoc req: assoc resp: reassoc req: reassoc resp: probe req: probe resp: beacon: ann traf ind disassociation: auth: deauth: unknown (stype=0x%x) ftype=0x%x (ctl=0x%x) wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_ioctl: i shouldn't get other ioctls! wihap_ioctlleam7990_config: weird memory size %lu: address %s %s: %d receive buffers, %d transmit buffers %s: controller failed to initialize %s: overflow %s: receive buffer error %s: dropping chained buffer %s: transmit buffer error %s: underflow %s: excessive collisions, tdr %d %s: memory error %s: receiver disabled %s: transmitter disabled %s: device timeout missing buffer, no_td = %d, last_td = %d ne: where did the card go? : setup failed ne2000_attachne2000_detectne2000_write_mbuf: negative lenne2000_write_mbuf: data != lim%s: remote transmit DMA failed to complete rs@rs@ tugem %s: unable to allocate control data, error = %d %s: unable to map control data, error = %d %s: unable to create control data DMA map, error = %d %s: unable to load control data DMA map, error = %d %s: unable to create rx DMA map %d, error = %d %s: unable to create tx DMA map %d, error = %d , address %s %s: cannot reset device %s: cannot disable rx dma %s: cannot reset receiver %s: cannot disable tx dma %s: cannot reset transmitter gem: invalid Receive Descriptor ring size %d %s: can't load rx DMA map %d, error = %d gem_add_rxbuf%s: status=%b INTMETXEMPTYTXDONERXDONERXNOBUFRX_TAG_ERRPCSTXMACRXMACMACCONTROLMIFBERR%s: device timeout %s: mii_read timeout %s: mii_write timeout ti%s: failed to send write command, status: %x %s: failed to send address, status: %x %s: failed to send read command, status: %x tigon1tigon2%s: can't load firmware: unknown hardware rev %s: firmware revision mismatch; want %d.%d.%d, got %d.%d.%d %s: unknown link state code %d %s: invalid command %s: unknown command %s: bad config data %s: unknown event: %d ti_handle_events%s: can't alloc rx buffers %s: can't map dma buffers (%d bytes) %s: can't create dma map %s: can't load dma map %s: no memory for jumbo buffer queue ti_jfree: can't find softc pointer!ti_jfree: asked to free buffer that we don't manage!ti_jfree: buffer already free!ti_jfree: buffer not in use!%s: can't create recv map %s: overwritten!!!%s: unknown hwrev ti_iff%s: board self-diagnostics failed! %s: unsupported chip revision: %x %s: bios thinks we're in a 64 bit slot, but we aren't%s: chip initialization failed %s: failed to read station address , address %s %s: jumbo buffer allocation failed %s: couldn't get mbuf%s: initialization failure not enough mbufs for rx ring%s: watchdog timeout -- resetting comcomprmcomstart%s: %d silo overflow%s, %d ibuf overflow%s s: unknown uart : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : st16c654, 64 byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: can't establish soft interrupt%s: probed fifo depth: %d bytes vscsi vscsiioc%s: POLL && NOSLEEP for 0x%02x vscsipollvscsiccbdiagnostic ../../../../dev/vscsi.csc->sc_state == VSCSI_S_RUNNINGvscsirefsoftraid%s: could not allocate memory for metadata %s: could not allocate memory for foreign metadata %s:, sr_meta_probe: can't allocate vnode sr_meta_probe%s%d%c%s: sr_rw: failed to allocate vnode %s: I/O error %d on dev 0x%x at block %llu %s: sr_meta_rw: invalid metadata pointer %s: sr_meta_clear can not clear foreign metadata %s: chunk sizes are not equal; up to %llu blocks wasted per chunk sr_meta_chunks_createunknown optional metadata type%s: save metadata failed %s: no in memory copy of metadata %s: could not allocate metadata scratch area %s: could not write metadata to %s %s: invalid foreign metadata %s: not valid softraid metadata %s: invalid metadata checksum %03d%s: %s can not read metadata version %u, expected %u sr_meta_validate%s:, sr_meta_native_bootprobe: can't allocate vnode %s: not enough memory for metadata buffer %s: not enough memory for fake discipline %s:, sr_meta_native_bootprobe: can't allocate vnode for partition %s: native bootprobe could not read native metadata sr_meta_native_bootprobesdwd%s: failed to allocate boot volume! %s: failed to allocate device array %s: failed to allocate ondisk array %s: failed to allocate hotspare %s: found duplicate chunk %u for volume %u on device %s %s: not all chunks were provided; attempting to bring volume %d online sr_boot_assemblysr_meta_native_probe%s: could not read native metadata %s: not part of the same volume %s: not all chunks are of the native metadata format src_dev_mm == NODEVsr_meta_native_attachsr_locksr_hs_lock%s: controller registration failed %s: sr_wu_putnegative wu sleeperssr_wu_get%s: sr_scsi_cmd NULL discipline %s: %s device is being deleted, failing io %s: chunk not part of array %s: could not save metadata to %s %s: unsupported state request %d %s: %s is already a hotspare %s: %s is already in use %s:, sr_hotspare: can't allocate vnode %s: %s partition not of type RAID (%d) OPENBSDSR %sHOTSPAREsr_hotspare%s: no offline chunk found on %s! %s: %s volume degraded, will attempt to rebuild on hotspare %s %s: sr_hotspare_rebuildsr_hotspare%s: pending I/O failed to complete on failed chunk %s, hotspare rebuild aborted... %s: discipline does not support rebuild %s: rebuild already in progress %s: %s not degraded %s: no offline chunks available for rebuild %s:, sr_rebuild_init: can't allocate vnode %s: partition too small, at least %llu B required %s: partition too large, wasting %llu B %s: rebuild of %s started on %s sr_rebuild_init%s: roaming device %s -> %s srdis%s: could not create workq %s: could not initialize discipline %s: chunk %s already in use %s: invalid metadata format %s: can't attach metadata type %d %s: disk is currently in use; can't force create %s: failed to clear metadata %s: %s was not shutdown properly already assembled %s: one of the chunks has corrupt metadata; aborting assembly already assembled; will not partial assemble it %s: trying to bring up %s degraded %s: volume level does not match metadata level! %s: %s offline, will not be brought online %s: volume %s is roaming, it used to be %s, updating metadata %s: unable to create sensor for %s sr_ioctl_createraid%s: insufficient boot storage! %s: failed to write boot block %s: failed to write boot loader sr_downsr_raid_inquirysr_raid_read_capsr_sync%s: sr_startwu_callbacksr_raid_startwu%02xsr_checksum%02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02xsr_shutdowninvalid data offset%s: %s: illegal block count for %s %s: %s: illegal cmdlen for %s sr_check_io_collision%s: unable to start backgound operation %s: bogus rebuild restart offset, starting from 0 %s: resuming rebuild on %s at %llu%% %s: rebuild exhausted wu_r%s: rebuild exhausted wu_w%s: could not create read io %s: could not create write io sr_rebuildsr_yieldsr_rebuild_threadRAID 0%s: %s: %s: invalid chunk state transition %d -> %d %s: %s: %s: invalid chunk state%s: %s: invalid volume state transition %d -> %d sr_raid0_rw%s: %s: too many ccbs queued %s: i/o error on block %lld target: %d b_error: %d %s: invalid target on wu: %p%s: wu: %p not on pending queue RAID 1%s: %s: %s: invalid chunk state transition %d -> %d %s: %s: %s: invalid chunk stateinvalid volume state%s: %s: invalid volume state transition %d -> %d sr_raid1_rw%s: %s: too many ccbs queued %s: is offline, can't read %s: sr_raid1_rw%s: invalid target on wu: %p%s: retrying read on block %lld %s: sr_raid1_intr_cb%s: permanently fail write on block %lld %s: wu: %p not on pending queue %s: sr_raid1_recreate_wucould not requeue ioRAID 4RAID 5%s: %s: %s: invalid chunk state transition %d -> %d%s: %s: %s: invalid chunk stateinvalid volume state%s: %s: invalid volume state transition %d -> %dsr_raidp_rw%s: can't get wu_wDisk %llx offline, regenerating buffer %s: is offline, can't read io error: disk %x %s: invalid target on wu: %p%s: retrying read on block %lld %s: permanently fail write on block %lld %s: wu: %p not on pending queue could not requeue io%.2x %c CRYPTOsr_crypto_calculate_check_hmac_sha1sr_crypto_decrypt_keysr_crypto_change_maskkey%s: %s is already in use %s:, sr_create_key_disk: can't allocate vnode %s: %s partition not of type RAID (%d) OPENBSDSR %sKEYDISK%03d%s: could not save metadata to %s sr_crypto_create_key_disk%s: native bootprobe could not read native metadata %s: %s is not a key disk sr_crypto_read_key_disksr_uioplsr_iovplsr_crypto_alloc_resourcessr_crypto_ioctlsr_crypto_rw: no crypto opsr_crypto_rw2%s: %s: too many ccbs queued %s: sr_crypto_rw2%s: i/o error on block %lld %s: invalid target on wu: %p%s: wu: %p not on pending queue sr_crypto_intr: no crypto opsr_crypto_finish_io%s: sr_crypto_finish_ioRAID 6%s: %s: %s: invalid chunk state transition %d -> %d%s: %s: %s: invalid chunk stateold_state = %d, %d = %d, invalid new_state%s: %s: invalid volume state transition %d -> %dsr_raid6_rw%s: can't get wu_wDisk %llx offline, regenerating Dx+P Disk %llx & %llx offline, regenerating Dx+Dy Disk %llx offline, regenerating Dx%s +Q singleio error: disk %x %s: invalid target on wu: %p%s: retrying read on block %lld %s: permanently fail write on block %lld %s: wu: %p not on pending queue could not requeue io/dev/ksyms: Symbol table not valid. ELFfailed to allocate memory for /dev/ksyms pf: pf_src_connlimit: blocking address , %u states killed pf_src_connlimitpf: src_tree insert failed: pf_insert_src_nodediagnostic ../../../../net/pf.cs->key[idx] == NULLpf: %s key attach failed on %s: wirestack, existing: pf: key setup: pf_state_insertpf: state insert failed: id: %016llx creatorid: %08xpf: state key linking mismatch! dir=%s, if=%s, stored af=%u, a0: OUTIN, a1: , proto=%u, found af=%u, a0: pf: key search, if=%s: pftmstate->timeout != PFTM_UNLINKEDstate->timeout < PFTM_MAXpf_unlink_statepf_free_statecur->timeout == PFTM_UNLINKED%u.%u.%u.%u:%u:%x[%u]IPv4IPv6TCPUDPICMPICMPv6%u in out wire: (%d) stack: (%d) - [lo=%u high=%u win=%u modulator=%u wscale=%u] %u:%u @%dFSRPAUEWinvalid address type: %d pf_change_appf_change_a6pf_change_icmppf_modulate_sackpf_send_tcppf: pf_test_via: kif == NULL, @%d via %spf_step_into_anchor: stack overflow pf_get_wscalepf_get_msspf_calc_msspf_tcp_issdropping packet with ip options in pf_test_rule()pf_normalize_tcp_stateful failed on first pktpf: loose state match: seq=%u (%u) ack=%u len=%u ackskew=%d pkts=%llu:%llu dir=%s,%s inoutfwdrevpf: BAD state: pf: State failure on: %c %c %c %c | %c %c pf: state reuse pf_test_state_tcppf_test_state_udppf: icmp type %d in wrong direction (%d): ICMP error message too short (ip)ICMP error message too short (ip6)ICMPv6 short optICMP error message too short (tcp)pf: BAD ICMP %d:%d -> state: seq=%u pf: OK ICMP %d:%d ICMP error message too short (udp)ICMP error message too short (icmp)ICMP error message too short (icmp6)pf_test_state_icmpnkpdpd->srcpd->dstpf_test_state_otherpf_routablepf_rtlabel_matchpf_route: invalid parameterspf_route: m0->m_len < sizeof(struct ip)pf_route: pf_map_addr() failed.pf_routepf_route6: invalid parameterspf_route6: m0->m_len < sizeof(struct ip6_hdr)pf_route6: pf_map_addr() failed.pf_route6pf_setup_pdesc: no storage for headers providedIPv6 more than one rthdrIPv6 short rthdrIPv6 rthdr0IPv6 short optpf_setup_pdesc called with illegal af %upf_test: kif == NULL, if_xname %snon-M_PKTHDR is passed to pf_testdropping IPv4 packet with ICMPv6 payloaddropping packet with ip options in pf_test()pf_testpf_test6: kif == NULL, if_xname %snon-M_PKTHDR is passed to pf_test6dropping IPv6 packet with ICMPv4 payloaddropping packet with dangerous v6 headerspf_test6pffrentpffragpfstscrpf: expiring %d(%p) trying to free > %d frentsdiagnostic ../../../../net/pf_norm.cfrep != NULL || frea != NULLoverlap -%dadjust overlap %dmissing fragment at %d, next %d, max %d%d < %d?frent != NULLdrop: too big: %dcomplete: %p(%d)IP_DFmff and %dmax packet %dreass frag %d @ %d-%ddropping bad fragmentsrc->scrub == NULLpf_normalize_tcp_initsrc->scrub || dst->scrubpf: %s: multiple TS??pf_normalize_tcp_statefulpf: src idled out of PAWS pf: dst idled out of PAWS Timestamp failed %c%c%c%c tsval: %lu tsecr: %lu +ticks: %lu idle: %lus %lums src->tsval: %lu tsecr: %lu dst->tsval: %lu tsecr: %lu tsval0: %lupf: did not receive expected RFC1323 timestamppf: broken RFC1323 stack did not timestamp data packet. Disabled PAWS security.pf_normalize_tcp_statefulpf_normalize_mss/pf: pf_find_or_create_ruleset: RB_INSERT1 '%s' '%s' collides with '%s' '%s' pf_find_or_create_ruleset: RB_INSERT2 '%s' '%s' collides with '%s' '%s'pf_anchor_setup: .. beyond root/*pf_anchor_setup: ruleset../pf_anchor_copyout: '%s' '%s'*pf_anchor_remove: broken refcountpfcnslkpfruleplpfsrctrplpfsnitemplpfstateplpfstatekeyplpfstateitemplpfruleitemplpfaltqplpfpurgepfpurge thread?pf_setup_pfsync_matchingpf: pf: started pf: stoppedaltq: startedaltq: stoppedpfioctlpfrktablepfrke_plainpfrke_routepfrkcounterspf: pfr_clr_addrs: corruption detected (%d). pfr_add_addrspfr_del_addrspfr_set_addrspfr_tst_addrspfr_get_addrs: corruption detected (%d)pfr_get_astats: corruption detected (%d)pfr_clr_astatspfr_enqueue_addrs: IPv4 walktree failed.pfr_enqueue_addrs: IPv6 walktree failed.pfr_mark_addrs: IPv4 walktree failed.pfr_mark_addrs: IPv6 walktree failed.pfr_lookup_addrunknown pfrke_type %dpfr_insert_kentries: cannot route entry (code=%d).pfr_reset_feedbackpfr_route_kentrypfr_unroute_kentry: delete failed. pfr_unroute_kentrypfr_walktree_pfpfr_add_tablespfr_del_tablespfr_get_tables: corruption detected (%d).pfr_get_tstats: corruption detected (%d).pfr_clr_tstatspfr_set_tflagspfr_ina_definepfr_commit_ktablepfr_update_stats: assertion failed.pfr_attach_tablepfr_detach_table: refcount = %d.pfr_pool_getpf_osfp_fingerprintpf: fingerprinted %s:%d %d:%d:%d:%d:%llx (%d) (TS=%s,M=%s%d,W=%s%d)0*% pf_osfp_fingerprint_hdrosfp no match against %xosfp matched %s %s %s %x==%xfingerprint 0x%x didn't matchpfosfpenpfosfpadding osfp %s %s %s = %s%d:%d:%d:%s%d:0x%llx %d (TS=%s,M=%s%d,W=%s%d) %xTSFound "%s %s %s" instead of "%s %s %s" Couldn't find "%s %s %s" pfiaddrplallpfi_kif_get for pfi_all failedpfi_kif_getpfi_kif_ref with unknown typepf: pfi_kif_unref: rules refcount <= 0 pfi_kif_unref: state refcount <= 0pfi_kif_unref with unknown typepfi_kif_get failedpfi_attach_ifnet: cannot allocate '%s' address hookself:network:broadcast:peer:0/%d_pfpfi_dynaddr_setuppfi_dynaddr_updatepfi_table_update: cannot set %d new addresses into table %s: %dpfi_address_add: address buffer full (%d/%d)pfi_address_add: no memory to grow buffer (%d/%d)pfi_update_statuspf_get_sportpf: pf_map_addr: src tracking (%u) maps to pf: pf_map_addr: selected address pf_map_addrpf: pf: NAT proxy port allocation (%u-%u) failedpf_get_transaddrpflogpflog%dpflog_packetpflog_bpfcopy got no mbufno second mbufbpf_mcopypflog_bpfcopypfsyncpfsync%dcarppfsync destroypfsync: pfsync_state_import: invalid creator id: %08x pfsync_state_import: unknown interface: %spfsync_input: PFSYNC5_ACT_INS: invalid valuepfsync_input: PFSYNC_ACT_UPD: invalid valuepfsync_input: PFSYNC_ACT_UPD_C: invalid valuereceived bulk update startpfsync bulk donereceived valid bulk update endreceived invalid bulk update end: bad timestamppfsync_insert: PFSYNC_ACT_TDB_UPD: invalid valuepfsyncioctlpfsync_insert_statepfsync_deferpfsync_undeferpfsync_deferredpfsync_deferred: unable to find deferred statepfsync_update_statepfsync_update_state: unexpected sync state %dpfsync bulk startrequesting bulk updatepfsync_update_state_req: nonexistant instancepfsync_update_state_req: unexpected sync state %dpfsync_delete_statepfsync_delete_state: unexpected sync state %dpfsync_clear_statespfsync_clear_statesdiagnostic ../../../../net/if_pfsync.cst->sync_state == PFSYNC_S_NONEst->sync_state != PFSYNC_S_NONEreceived bulk update requestpfsync bulk failfailed to receive bulk updatepflowpflow%dexport_pflow_ifbioioctlhotplug_device_attachhotplug_device_detachhotplug: event lost, queue full hotplugclosehtplevhotplugreadpppoepppoe%dpppoe: alien host unique tag, no session found %s: host unique tag found, but it belongs to a connection in state %d %s: wrong interface, not accepting host unique pppoeintrpppoe: packet too short: %d pppoe: could not get PPPoE header pppoe: unknown version/type packet: 0x%x pppoe: packet content does not fit: data available = %d, packet size = %u %s: parse error %s: tag 0x%x len 0x%x is too long TAG HUNIQUE ERRORTAG ACCOOKIE ERRORTAG RELAYSID ERRORSERVICE NAME ERRORAC SYSTEM ERRORGENERIC ERROR%s: %s: %c pppoe: received PADO but could not find request for it %s: received unexpected PADO %s: failed to send PADR, error=%d %s: session 0x%x connected %s: session 0x%x terminated, received PADT %s: unknown code (0x%04x) session = 0x%04x diagnostic ../../../../net/if_pppoe.cm->m_flags & M_PKTHDRpppoe (data): dropping too short packet: %d bytes pppoe (data): could not get PPPoE header pppoe (data): unknown version/type packet: 0x%x %s (%x) state=%d, session=0x%x output -> %s, len=%d pppoe_outputpppoe_send_padi in state %d%s: timeout %s: failed to transmit PADI, error=%d %s: failed to send PADI, error=%d %s: disconnecting %s: could not establish connection pppoe_send_padtaltq assertion "%s" failed: file "%s", line %d altq assertiontbr_set: no cpu clock available! altq_add: no cpu clockinit_machclkinvalid weight value %d for red! use %d cbq_add_queue: no parent class! cbq_add_class: borrow class != parent altq: packet for %s does not have pkthdr rmc_init: root class not allocated _rmc_wrr_dequeue_next_rmc_prr_dequeue_nextrmc_root_overlimitaltq: packet for %s does not have pkthdr hfsc_dequeue:altq: packet for %s does not have pkthdr All breakpoints used. Already set. Too many breakpoints. Not set. No breakpoints set Count Address %5d %-12s? No such command Ambiguous Bad modifier Count missing db_command%s the kernel did not panic nfsnodesnfsreqsbufsvnodesmountspoolscalloutprocswatchesvnodeuvmexpregistersprocpoolpanicpageobjectnfsnodenfsreqmountmbufmapmallocextentsbufbreaksbcstatsallpoweroffreboothaltdumpcrashsyncdmesghangmanhelpbootshowpscalltracematchnextuntilccontinuesstepwatchdwatchbreakddeletewwritesetsearchxexamineprintmachine ddb> %sBad function Too many arguments Argument missing db_fncallELF[ %s symbol table has bad start address %p ] ELFbad magicbad e_machine.strtab.symtabsymtab unalignedsymtab corrupted[ using %lu bytes of %s ELF symbol table ] [ %s ELF symbol table not valid: %s ] : = 0x%lx %-*s%-*lx%-*ld%-*lu%-*lo%c\%03odb_examine%s%*lx%*ld%*lu%*lo db_print_cmdBad modifier bhlAddress missing Value missing Count missing Symbol not found Syntax error Divide by 0 Negative shift amount 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-| () Score: %lu/%lu db_hangman^R Bad character in number Bad escape String too long Bad character --db_more--  -%#*lx-%*lx-%#*lo-%*lo-%#*lu-%*luFaulted in traceback, aborting... Starting stack trace... End of stack trace. %-12s%s %s+%s db_show_regs [after %6d] bsd[ %s symbol table has bad start address %p ] [ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s%s %s Sifting table %s: %s+%s [%s:%d]db_printsymAfter %d instructions Breakpoint at Watchpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! loglinestabstopsmaxwidthmaxoffradixUnknown variable No value ? All watchpoints used. Already set. Too many watchpoints. Not set. No watchpoints set Address Size %8lx %lx Unknown size %s = %s Nothing written. db_write_cmdcdlinemichpspkrrecordinputvolumeinputsmasterdacoutputoutputsmonitoraudio audio: missing method audio: could not allocate play buffer audio: could not allocate record buffer sourceselectaudioattachauddetaudiodetach: %s didn't detach au_portofaudio_attach_mi: NULL oplmpuaudioprint: unknown type %d%s at %saudio_open: 0 precision aud_draudpquiaudrquiaud_qrdaud_hraud_rdaudio_silence_copyoutaud_qwraud_wraud_qioau_get_muteau_set_muteau_set_gainau_get_gainau_set_portau_get_portaudiosetinfoaudiogetinfoaud_qmiwskbd_set_mixervolumeccdattach: count <= 0WARNING: no memory for concatenated disks ccdlockccdbufplccd%dccdinit: device name too long. ccdinitccdintrccdiodone (mirror)%s: error %d on component %d%s ccdiodone: countccdfictitiouscnopen: recursive/etc/firmware/%sMSG_INMSG_OUTUNSPEC2UNSPEC1STATUSCOMMANDDATA_INDATA_OUTncr5380_cmd_timeout: no scsi_xfer %s: cmd timeout, targ=%d, lun=%d %s: polled request aborting %d/%d ncr5380_scsi_cmd: polled request, abort failedncr5380_scsi_cmd: poll didn't finishncr5380_done: state=idlencr5380_done: current=0ncr5380_done: dma free did notncr5380_done: sense asked for sense %s: target %d, bad status=%d ncr5380_done: bad statencr5380_sched: not idlencr5380_sched: current set%s: reselected while polling (abort) %s: select found SCSI bus busy, resetting... %s: ptr but no data in/out flags? ncr5380_reselect: current set%s: reselect, BSY stuck, bus=0x%x %s: selected as target, data=0x%x %s: bad reselect, data=0x%x %s: reselect, SEL stuck, bus=0x%x %s: reselect, no REQ %s: reselect, phase=%d %s: reselect, not identify, msg=%d %s: phantom reselect: target=%d, LUN=%d %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT %s: SEND_IDENTIFY while not connected; sending NOOP %s: unexpected MESSAGE OUT; sending NOOP %s: weird MESSAGE OUT; sending NOOP %s: sense phase error %s: aborting, but phase=%s (reset) %s: data phase error %s: too much data padding ncr5380_status: none? ncr5380_machine: state=idlencr5380_machine: no current cmdncr5380_machine: unexpected disconnect. %s: no REQ while aborting, reset %s: no REQ for next phase, abort ncr5380_machine: Unexpected phase 0x%x %s: parity error! %s: reset SCSI bus for TID=%d LUN=%d %s: %d extra bytes from %d:%d %s: Target %d LUN %d stuck busy, resetting... , address %s %s: device timeout dp8390_initdp8390_xmit: desync, next_tx=%d inuse=%d cnt=%d new=%ddp8390_xmit: no packets to xmitdp8390_start: no header mbuf%s: length does not match next packet pointer %s: len %04x nlen %04x start %02x first %02x curr %02x next %02x stop %02x %s: NIC memory corrupt - invalid packet length %d : failed to clear NIC buffer at offset %x - check configuration %s: device enable failed systrrd%s: attach to %u: %d systracef_ioctlstrprocplstrpolplsystracesystrace_forkdiagnostic ../../../../dev/systrace.cstrp->proc == p%s: %u: policy %d systrace_answer%s: new, ents %d systrace_policy%s: %d -> pid %d %s: %d: code %d -> policy %d %s: %d systrace_getcwd%s: %u: %p(%lu) systrace_io%s: Trying to detach from %d systrace_detach%s: allocating %d -> %lu systrace_newpolicysystrmsg%s: %p: pid %d -> pid %d systrace_msg_child%s: free %d systrace_msg_policyfreevndencryptWARNING: no memory for vnode disks vndlockvndbufplvnd devicefictitiousdiagnostic ../../../../dev/vnd.cbp != NULLvndiodonevnd%dVNDIOCSET: device name too long %svnd%dsVNDIOCSET: disk name too long vndioctlvndioctl: null vp;n vAMaX ֣d° xextract_entropyarc4_initrandomreadcd9660_inactive: pushing activecd9660_reclaim: pushing activeRRIP without PX field? ..RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_1282IEEE_P1282RRIP_1991ASP   `   4  < ݤ cd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] ..cd9660_strategy: spectag VT_ISOFS, isofs vnode udf_disklabelspoof ! ! .t / 0 0( 0l 0t 5 5D !T 5` 5hudftrpludfndpludfdsplCan't read sector %d of VDS Cannot read sector %d for Metadata File Entry Invalid Metadata File FE @ sector %d! (tag.id %d) FSD does not lie within the partition! Cannot read sector %d of FSD Couldn't find the fsd Cannot read sector %d Invalid root file entry! Invalid file entry! unodeUnrecognized file type (%d) found a vnode alias *UDF Virtual Partition*UDF Sparable Partition*UDF Metadata Partitionudf_find_partmapshash entry is NULL, up->u_ino = %dudf_allocv: failed to allocate new vnode udf_transname(): name too long udf_transname(): Unicode translation failed udf: invalid FID fragment udf: invalid FID Invalid FID tag (%d) uiomove returned %d udf_readdirtag VT_UDF, hash id %u udf_lookup: Invalid tag warning: udf_readlblks returned error %d Cannot deal with strategy4096 yet! Unknown strategy type %d SFile offset out of bounds (%d > %d) LFile offset out of bounds (%d > %d) Unsupported allocation descriptor %d elf32_load_fileexec: a VTEXT vnode has writecount != 0OpenBSDELFcoredump: offset %lld != notestart %lldcoredump: offset %lld != secstart %lldcoredump: offset %lld != p_offset[%d] %lldcoredump_elf32coredump_notes_elf32%s@%dcoredump_note_elf32#!exec_script_makecmds: epp already has a fdexec_script: copyinstr couldn't fail/dev/fd/%dvmcmdset_extend: not necessarydiagnostic ../../../../kern/exec_subr.cocnt > 0exec_process_vmcmds: RELATIVE no baseCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2011 OpenBSD. All rights reserved. http://www.OpenBSD.org %s swapperfork initcfpendvscsisoftraidcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedscheduler/sbin/init.bak/sbin/oinit/sbin/init/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initacct_processacctAccounting resumed Accounting suspended acct_thread  8 P h $ < h bufq_init: type %i unknownbufq init failbqinitbqdestbqqueuebqquiesinitclocks: unable to register softclock intrfileplfdescplfd_unused: fd_lastfile inconsistentdup2: fdallocfilefdlockclosef: count < 0closefclosef: count: %d/%dkqueueplknotepl ڄ xkqreaddiagnostic ../../../../kern/kern_event.c(kn->kn_status & KN_QUEUED) == 0kn->kn_status & KN_QUEUEDexecve: argp == NULLexecve: no vmcmdssys_execve: falloc indx != iinit died (signal %d, exit %d)thrdyingthrdeathcpu_exit returnedreaperwaitdiagnostic ../../../../kern/kern_exit.cTAILQ_EMPTY(&pr->ps_threads)procppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qktrsyscallktrsysretktrnameiktremulktrgenioktrpsigktrcswktrace write failed, errno %d, tracing stopped lockmgr: process context requiredlockmgr: using decommissioned locklockmgr: non-release on draining lock: %dlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: locking against myselflockmgr: non-zero exclusive countlockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: release of unlocked lock!lockmgr: draining against myselflockmgr: unknown locktype request %d lock type %s: SHARED (count %d) lock type %s: EXCL (count %d) by pid %d not locked with %d pendinglkmopnlkmlookupDDB symbols added: %ld bytes DRMAGP MemoryBluetooth HIDUDF file idUDF file entryUDF mountbwmeterbluetoothkqueueNTFS vrunNTFS decompNTFS dataNTFS attrNTFS hashNTFS dirNTFS fnodeNTFS nodeNTFS mounttempNDPip6_optionsemuldatapacket tagsIPsec credscrypto datamemdescUSB HCUSB deviceUSBUVM aobjUVM amapRAIDframe dataVM swapindirdepnewblkinodedeppagedepxform_datatdbpfkey datamiscfs mountexecttysMSDOSFS nodeMSDOSFS fatMSDOSFS mountISOFS nodeISOFS mountmrtether_multiin_multiip_moptionsNFS daemonNFS srvsockExport HostMFS nodeVFS clustersubprocprocfile descfileVM pmapACPIdirhashsemVM mapshmUFS mountUFS quotanamecachevnodesNFS mountNFS reqmountiovioctlopssysctlsooptsifaddrfragtblroutetblpcbdebugdevbuffreesysctlklk??malloc - bogus typediagnostic ../../../../kern/kern_malloc.cflags & (M_WAITOK | M_NOWAIT)malloc(): allocation too large, type = %d, size = %lu malloc: allocation too largemalloc: out of space in kmem_map???%s %d of object %p size 0x%lx %s %s (invalid addr %p) Data modified on freelist: wordprevious type%s %d of object %p size 0x%lx %s %s (0x%x != 0x%x) malloc: wrong bucketmalloc: lost datafree: non-malloced addr %p type %sfree: unaligned addr %p, size %ld, type %s, mask %ldmultiply freed item %p free: duplicated freefree: multiple freeskmeminit: minbucket too small/struct freelist too big%d,%s,%15s %5s %6s %7s %6s %9s %8s %8s TypeInUseMemUseHighUseLimitRequestsType LimKern Lim%15s %5ld %6ldK %7ldK %6ldK %9ld %8d %8d  $$rw_enter: %s locking against myselfrw_enter: %s downgrade of non-write lockrw_enter: %s downgrade, not holderrw_enter: unknown op 0x%x%s: lock not held%s: lock not held by this process%s: lock not shared%s: lock heldphysbuftodo < 0; minphys brokentodo > MAXPHYS; minphys brokenphysiodone < 0; strategy brokendone > todo; strategy brokenputphysbufputphysbuf: private buf B_WANTEDprocinit: mallocprocplprocessplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0enterpgrp: setsid into non-empty pgrpenterpgrp: session leader attempted setpgrpenterpgrp: new pgrp and pid != pgidenterpgrp: mksession but not curproc)J)J)J)J)J)J)Jonprocdeadzombiestopsleeprunidle%dPROC (%s) pid=%d stat=%s flags=%b CONTROLTINMEMNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCSSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUEDBIGLOCKTHREADIGNEXITRVSOFTDEPSTOPPEDCPUPEG pri=%u, usrpri=%u, nice=%d forw=%p, list=%p,%p process=%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu mawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %-10s %18s %18s %18s COMMANDSTRUCT PROC *UAREA *VMSPACE/VM_MAP PID %5s %5s %5s S %10s %-12s %-16s PPIDPGRPUIDFLAGSWAIT PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSG%c%5d %-10.10s %18p %18p %18p %5d %5d %5d %d %#10x %-12.12s %-16s %-16s %-8s %18p %s plimitplidle%dfork idlediagnostic ../../../../kern/kern_sched.cci == curcpu()curproc == spc->spc_idleprocsched_idlecpu_switchto returnedsetrunqueueremrunqueuesched_chooseprocpsensordevstunrsensor_task_unregister: unexpected state %dsigaplpausepsignal signal numberProcess (pid %d) got signal %d issignal postsigpostsig action/var/crash/%s%s.corecoredumpcoredump_tradpid %d (%s): %s write of %lu@%p at %lld failed: %d usersystemsigwaitdiagnostic ../../../../kern/kern_sig.cerror != 0p->p_sigwait != 0uiomove: modeuiomove: procureadc: zero residureadc: non-positive iovcnthashinit: bad cntsysctllksysctldlkkern_sysctl%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%s:%s,sysctl_diskinittsleep: no identtsleep: not SONPROCsleep_finishsleep_finish !SONPROCwakeup: p_stat is %dthrsleepdenied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleeptimeout_add: not initializedtimeout_add: to_ticks (%d) < 0?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func syswqwqtasksunexpected %s wq state %dwqdestroy%sunable to create workq thread for "%s" boredsmashed stack in %sdiagnostic ../../../../kern/sched_bsd.cphzupdatepripreempt: cpu_preempt not yet implementedp->p_stat != SONPROCmi_switchp->p_cpu == curcpu()setrunnableresetpriority>>> probing for %s* %d mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe unsupported not configured root device %s not configured %s at root%s at %sconfig_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longconfig_make_softc: %sing dev arrayexpandcreatconfig_make_softc: duplicate %sconfig_detach: bad device fstateconfig_detach: forced detach of %s failed (%d)config_detach: detached device has children%s detached config_detachconfig_defer: can't defer config of a root deviceconfig_defer: deferred twiceconfig_defer: can't allocate defer structureconfig_pending_decr: config_pending == 0config_activate_children: device %s failed %d failing resume cannot be handled resume %s %s%d%c: %s %sing fsbn readwrit%lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)dklkdisk_attach: can't allocate storage for disklabeldisk_attach_callbackdisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 root filesystem has size 0filesystem type %d not known.. assuming ffs dk_mountrootuse one of: exit %s[a-p] %s root device (default %s%c): exitswap device (default %s%s)b%s%d%croot device (%s) not foundnetbootcan't figure root, hope your kernel is right root on %s%c swap on %s%d%c dump on %s%d%csetrootfindblkmajorcannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %d/dev/%s%s%crdisk_map%s: already registeredextent_registerextentpl%s: name == NULLextent_create%s: extent `%s', start 0x%lx, end 0x%lx %s: end < start%s: fixed extent, bad storagesize 0x%lx%s: storage provided for non-fixed%s: NULL extentextent_destroyextent_alloc_region%s: extent `%s', size 0x%lx %s: bad size%s: extent `%s', start 0x%lx, size 0x%lx %s: overflow%s: EX_CONFLICTOK and EX_WAITSPACE are mutually exclusive%s: extent `%s' (0x%lx - 0x%lx) %s: start 0x%lx, end 0x%lx %s: region lies outside extent%s: can't allocate region descriptor extntextent_alloc_subregion%s: NULL result pointer%s: extent `%s', ex_start 0x%lx, ex_end 0x%lx %s: substart 0x%lx, subend 0x%lx %s: bad subregion%s: bad alignment%s: extent `%s', size 0x%lx, boundary 0x%lx %s: bad boundary%s: extent `%s' (0x%lx - 0x%lx), alignment 0x%lx %s: overflow after alignmentextent_free%s: extent `%s', region not within extent%s: region not foundextent_print1extent `%s' (0x%lx - 0x%lx), flags=%b FLWANTEDWANTEDNOCOALESCEFIXED 0x%lx - 0x%lx klogdiagnostic ../../../../kern/subr_pool.cph->ph_page <= (caddr_t)vph->ph_page + ph->ph_pagesize > (caddr_t)vpr_rmpage: nidle inconsistentpr_rmpage: nitems inconsistentpool_init: pool item size (%lu) too largepool_init: too much uptimepp->pr_itemsperpage != 0phpoolpool_destroy: pool busy: still out: %uLIST_EMPTY(&pp->pr_fullpages)LIST_EMPTY(&pp->pr_partpages)flags & (PR_WAITOK | PR_NOWAIT)pool_get: PR_ZERO when ctor setpool_do_get: %s: crossed hard limit%s pool_do_get: %s: curpage NULL, nitems %u pool_do_get: nitems inconsistentpool_do_get: %s: page emptypool_do_get: %s: items on itemlist, nitems %u pool_do_get(%s): free list modified: page %p; item addr %p; offset 0x%x=0x%xpool_do_get: nidle inconsistentpool_do_get: %s: nmissing inconsistentpool_put of NULLpool_do_putpool %s: putting with none out pool_do_put: %s: page header missing((((vaddr_t)pi) + ioff) & (align - 1)) == 0pp->pr_crange->ucr_high >= range->ucr_high && pp->pr_crange->ucr_low <= range->ucr_lowph->ph_nmissing == 0 page %p, nmissing %d item %p, magic 0x%x POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p usage: show all pools [/a] %-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s NameSizeRequestsFailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdle%-10s %18s %18s AddressAllocator%-10s %18p %18p inf%u%-*s %*u %*lu %*d %*s %*lu db_show_all_pools%s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%s): free list modified: page %p; item ordinal %d; addr %p (p %p); offset 0x%x=0x%x pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) dma%dkernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %s%dlogpri%llo%lld%llx0123456789abcdef(null)0123456789ABCDEFbug in kprintf: bad basekprintf?vverbosettimezonesshowquitLlinesllisthhelpffindqexiteenableddisableDddbcchangebbaseaadd--- more --- %d%d0%o0x%x%s*FOUND***UNKNOWN*%3d free slot (for add) %3d %s count %d disable (pseudo device) Unknown devno (max is %d) %3d at root%c ??? %s flags 0x%x %s [] ? Unknown argument change (y/n) ? out of memory. flags changed %3d can't change free slot count%3d %s changed Error unknown state already disabled %3d can't disable free slot %3d %s already enabled %3d can't enable free slot command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devices enter ddbattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know%s Unknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d autoconf verbose %sabled endisUnknown command User Kernel Config UKC> Continuing... assertwaitokassertwaitok: non-zero mutex count: %dselectpollpipelkpiperdExpected pipe buffer wraparound disappearedExpected wraparound badPipe buffer overflowpipewrpipeclpipepldiagnostic ../../../../kern/sys_process.c(p->p_flag & P_SYSTEM) == 0ptrace: impossiblesysvmsgplmsgqrmNULL userbuffermsgwaitfreeing message queue with active referencesmsg NULLSysV message longer than MSGMAXsemaplsemuplsemwaitsemop - can't undo undossemexit - semid not allocatedsemexit - semnum out of rangeshmseg free count inconsistentshmpl@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ /dev/consolettnreadttrstrtttypendttyunblockttckoutqttwritettyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group empty foreground process group cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk iowaitrunnablerunningttyfree: tty_count < 0ptarrlk/dev/XtyXXpqrstuvwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZptydevnameptyptcreadptcwriteptmattach: Can't find pty slave in cdevswnmea%dSignalLatitudeLongitudeGPRMCGPSGPS simulatedGPS estimatedGPS autonomousGPS differentialGPS invalidGPS unknownmsts%dSignalMSTSendrun%dSignalEndRunputc: required clalloc b_to_q: required clalloc WARNING: mclpools limit reached; increase kern.maxclustersmbplmcl%dkm_clget: request for %u byte clusterunknown type of extension bufferm_defrag: no packet hdr or not a chainmbuf prepend length too bigm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLm_copym0 overrunm_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufm_zero: M_READONLYm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufdiagnostic ../../../../kern/uipc_mbuf.cfrom->m_flags & M_PKTHDRmbuf %p m_type: %hi m_flags: %b M_EXTM_PKTHDRM_EORM_CLUSTERM_PROTO1M_VLANTAGM_LOOPM_FILDROP M_BCAST M_MCAST M_CONF M_AUTH M_TUNNELM_AUTH_AHM_LINK0m_next: %p m_nextpkt: %p m_data: %p m_len: %u m_dat: %p m_pktdat: %p m_pkthdr.len: %i m_ptkhdr.rcvif: %p m_ptkhdr.rdomain: %u m_ptkhdr.tags: %p m_pkthdr.tagsset: %hx m_pkthdr.csum_flags: %hx m_pkthdr.ether_vtag: %hu m_pkthdr.pf.flags: %b GENERATEDFRAGCACHETRANSLATE_LOCALHOSTDIVERTEDDIVERTED_PACKETPF_TAG_REROUTEm_pkthdr.pf.hdr: %p m_pkthdr.pf.statekey: %p m_pkthdr.pf.qid: %u m_pkthdr.pf.tag: %hu m_pkthdr.pf.routed: %hhx m_ext.ext_buf: %p m_ext.ext_size: %u m_ext.ext_type: %x m_ext.ext_backend: %i m_ext.ext_ifp: %p m_ext.ext_free: %p m_ext.ext_arg: %p m_ext.ext_nextref: %p m_ext.ext_prevref: %p m == NULL in m_pulldown()unixsockplsofreenetclssoclose: NOFDREFsoabortsoaccept: !NOFDREFreceive 1diagnostic ../../../../kern/uipc_socket.cm == so->so_rcv.sb_mbreceive 1aso->so_rcv.sb_mb == mreceive 3somoveso->so_splicelen < so->so_splicemaxso->so_rcv.sb_mb == so->so_rcv.sb_lastrecordsonewconnsoqinsquenetionetlckdiagnostic ../../../../kern/uipc_socket2.csb->sb_mb == sb->sb_lastrecordsbappendaddrsbappendcontrolsemi-panic: sbcompress(sb->sb_flags & SB_LOCK) == 0sb->sb_cc == 0sb->sb_datacc == 0sb->sb_mb == NULLsb->sb_mbtail == NULLsb->sb_lastrecord == NULLsbdropsbcreatecontrol: message too large %d netconacceptnetcon2uipc 1uipc 2uipc 4piusrrequnp_attachunp_bindunp_connect2unp_disconnectbremfreebremfree: lost tailbuf_putdiagnostic ../../../../kern/vfs_bio.cbp->b_bufsize > 0buf_put: releasing dirty bufferbuf_put: still on the free listbuf_put: still on the vnode listbuf_put: b_dep is not emptybufplneedbufferbp->b_lblkno == blkno + 1bp->b_vp == vpbuf_dirtyTrying to dirty buffer on freelist!buf_undirtyTrying to undirty buffer on freelist!getblkbuf_get: dup lblk vp %p bp %pcleanerClean buffer on BQ_DIRTY!(bp->b_flags & B_ASYNC)biowaitbiodonebiodone alreadyCurrent Buffer Cache status: numbufs %lld, freebufs %lld bufpages %lld, freepages %lld, dirtypages %lld pendingreads %lld, pendingwrites %lld bufinit: can't reserve VM for buffersdiagnostic ../../../../kern/vfs_biomem.c(bp->b_flags & B_BUSY) == 0buf_mapbuf_needvapg != NULLbp->b_flags & B_BUSY(bp->b_data != NULL) || (bp->b_flags & B_NOTMAPPED)bp->b_data != NULLsize == round_page(size)bp->b_pobj == NULLbp->b_data == NULLbuf_page_offset > 0buf_alloc_pages: overlap buf: %p page: %pbuf_alloc_pagesuobj != NULLpg->wire_count == 1cache_lookupcache_revlookup: found entry for .cache_revlookup: found entry for ..wtf? leak?nchplcluster_wbuild: size %ld != filesize %ldvop_generic_revokevop_generic_revokeallnameilockfpllf_findoverlap: defaultnamei: bad cred/procnamei: nameiop contaminated with flagsnamei: flags contaminated with nameiopsleaf should be emptyrelookup: null namerelookup: lookup on dot-dotrelookup: symlink found.vnodesvfslockvnodefree vnodefree vnode isn'tcleaned vnodecleaned vnode isn'tClean vnode has pending I/O'svgetvref used where vget requiredvref on a VNON vnodeUse count is not zero!vnode already on free list: vnode already on free listvput: null vpvput: bad ref countvput: ref cntvput: bad writecountvput: v_writecount != 0vrele: null vpvrele: bad ref countvrele: ref cntvrele: bad writecountvrele: v_writecount != 0vrele: cannot lockvdrop: zero holdcntvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevmissing aliasvgonel: not cleanVBADVFIFOVSOCKVLNKVCHRVBLKVDIRVREGVNON%s: %p, type %s, use %u, write %u, hold %u,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT|VBIOWAIT|VBIOONFREELIST|VBIOONSYNCLIST|VALIASED flags (%s) vprintkinfo: vp changed unmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done softdep %d vwaitforiovwakeupvwakeup: neg numoutputvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvflushbuf: not dirtyvflushbufvflushbuf: dirtybgetvpbgetvp: not freebrelvpbrelvp: NULLbuf_replacevnodereassignbufvfs_register called with vfc_refcount > 0 vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %b AGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERRORINVALNOCACHEPHYSRAWREADWANTEDWRITEINPROGXXXDEFERREDSCANNEDPDAEMON bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} UDFNTFSNNPFSVFSEXT2FSADOSFSISOFSAFSPROCFSPORTALMSDOSFSMFSNFSUFSNONtag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %ld holdcnt %ld numoutput %d clean bufs: bp %p dirty bufs: flags %b vnodecovered %p syncer %p data %p RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSvfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %llu free %llu avail %lld files %llu ffiles %llu favail %lld f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %llu asyncwrites = %llu syncreads %llu asyncreads = %llu fstype "%s" mnton "%s" mntfrom "%s" locked vnodes: %p %p, %pall vnodes: %p, %p,fsync failedmounted on: %s sched_sync: fsync failedsyncersyncer vnode sys_mountmount: lost mountunmount: dangling vnodesys_getfhsys_fhopensys_fhstatsys_fhstatfsvn_lock..getcwd: oops, forgot to null lvpgetcwd: oops, went back too fardead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockfiforfifowfifo_read modefifo_write modetag VT_NON , fifo with %ld readers and %ld writersfifo_badop calledspec_read modespec_read procspec_read typespec_write modespec_write procspec_write typespec_ioctlspec_fsync: not dirtyspec_fsyncspec_fsync: dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calleddos2unixtime(): month value out of range (%ld) !#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~denodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largemsdosfs_reclaim(): pushing activemsdosfs_inactive(): pushing activefatentry(): function code doesn't specify get or set fatentry(): get function with no place to put result extendfile(): attempt to extend root directory extendfile: pcbmapmsdosfs_lookup. .. doscheckpath: source and target on different filesystemsdoscheckpath(): .. not a directory? msdosfs: reducing max cluster to %d from %d due to FAT size RRaArrAaUmsdosfs_sync: rofs mod1D==>T >? @@ @msdosfs_create: no namemsdosfs_createmsdosfs_write(): bad file typemsdosfs_rename: no namemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirrename: lost dir entrymsdosfs_rename: updating .. in root directory?msdosfs_renamemsdosfs_mkdir: no namemsdosfs_mkdir...msdosfs_readdirmsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %d, %d, %s (LOCKED) bpf: ifpromisc failedbpf_detachd: descriptor not in listbpfbpfwritebpf_mcopybpfattachifaddritempltoo many interfacesallif_attach_common: mallocif_startif_clone_listif_downallif_downif_upifioctlifconfif_getgroupif_getgroupmembersegressif_group_egress_buildifpromiscifa_update_broadaddr does not support dynamic length%s on %s ifnewlladdr%s: trying to send packet on wrong domain. if %d vs. mbuf %d, AF %d %s: can't handle af%d d;n &0vAkkQMaXPq< D֣ad°Ԡ x      ;n C&vkkMGP&"/+Ka5 d1͆< 8O!)#%0&L&&&,.L0D2222lcp!)0505L5h555::<<|<=<=tipcpW)x>l>>???DEGGGGGipv6cp#)rrWXtXYZrrZpap#)rrOOPQ0RtrrRchap%s: input packet is too small, %d bytes %s: Failed to align packet! %s: PPP packet in Cisco mode %s: invalid input protocol %s: Cisco packet in PPP mode %s: invalid input packet %s: protocol queue overflow %s: trying to send packet on wrong domain. if %d vs. mbuf %d, AF %d %s: no memory for transmit header %s: cisco invalid packet length: %d bytes %s: cisco input: %d bytes <0x%x 0x%x 0x%x 0x%x 0x%x-0x%x> %s: cisco unknown packet type: 0x%x %s: loopback %s: up %s: cisco output: <0x%lx 0x%lx 0x%lx 0x%x 0x%x-0x%x> %s: %s output <%s id=0x%x len=%d> %s: %s invalid packet length: %d bytes %s: %s input(%s): <%s id=0x%x len=%d%s: %s invalid conf-req length %d %s: %s tlu %s: %s id mismatch 0x%x != 0x%x %s: %s send terminate-ack %s: invalid proto-rej length ?%s: %s: RXJ%c (%s) for proto 0x%x (%s/%s) unknown%s: lcp echo req but lcp closed %s: invalid lcp echo request packet length: %d bytes %s: got lcp echo req, sending echo rep %s: lcp invalid echo reply packet length: %d bytes %s: lcp got echo rep %s: %s send code-rej for 0x%x %s: %s up(%s) %s: %s down(%s) %s: %s open(%s) %s: %s close(%s) %s: %s TO(%s) rst_counter = %d %s: %s %s->%s %s: Up event(incoming call) %s: Down event (carrier loss), taking interface down.%s: Down event (carrier loss) %s: lcp parse opts: %s [invalid] [invalid chap len] [not configured] [rej] send conf-rej %s: lcp parse opt values: 0x%lx [glitch] [empty] [non-empty] %lu [mine %s != his %s] [chap not MD5] max_failure (%d) exceeded, send conf-rej send conf-nak send conf-ack %s: lcp rej opts: [don't insist on auth for callout][access denied] %s: lcp nak opts: magic glitch %d sppp_lcp_scr%s: ipcp parse opts: %s: ipcp parse opt values: %s %s [ack] [addr requested] %s [not agreed] still need hisaddr send conf-ack %s: ipcp rej opts: %s: ipcp nak opts: [wantaddr %s] [agree] %s: ipcp_open(): no IP interface sppp_ipcp_scr%s: ipv6cp_open(): no IPv6 interface sppp_ipv6cp_open%s: ipv6cp parse opts: %s [invalid] [rej]%s: ipv6cp parse opt values: %s [%s] send %s send %s suggest %s sppp_ipv6cp_RCR%s: ipv6cp rej opts:%s: ipv6cp nak opts: [suggestaddr %s] [random] [agree]sppp_ipv6cp_RCN_naksppp_ipv6cp_scr%s: chap invalid packet length: %d bytes %s: chap corrupted challenge <%s id=0x%x len=%d%s: chap input <%s id=0x%x len=%d name= value-size=%d value=%s: chap success: %s: chap failure%s: chap failure %s: chap corrupted response <%s id=0x%x len=%d%s: chap dropping response for old ID (got %d, expected %d) %s: chap response, his name != expected %s: chap input(%s) <%s id=0x%x len=%d name=%s: chap bad hash value length: %d bytes, should be %d Failed...Welcome!%s: chap unknown input(%s) <0x%x id=0x%xh len=%dsppp_chap_input%s: chap TO(%s) rst_counter = %d %s: chap %s, reconfirmedtlunext re-challenge in %d seconds re-challenging suppressed %s: chap tld %s: pap invalid packet length: %d bytes %s: pap corrupted input <%s id=0x%x len=%d%s: pap input(%s) <%s id=0x%x len=%d name= passwd=%s: pap success%s: pap failure%s: pap failure %s: pap corrupted input <0x%x id=0x%x len=%d%s: pap TO(%s) rst_counter = %d %s: pap peer TO %s: pap tld %s: LCP keepalive timeout %s: sppp_set_ip_addrs: in_ifinit failed, error=%d sppp_set_ip_addrssppp_clear_ip_addrssppp_get_ip6_addrssppp_set_ip6_addrsppp_suggest_ip6_addrconf-reqconf-ackconf-nakconf-rejterm-reqterm-ackcode-rejproto-rejecho-reqecho-replydiscard-req0x%xchallengeresponsesuccessfailurereqacknakmruasync-mapauth-protoqual-protomagicproto-compaddr-compaddressescompressionaddressifidinitialstartingclosedstoppedclosingstoppingreq-sentack-rcvdack-sentopenedillegaldeadestablishterminateauthenticatenetwork %02x-%02x\x%x%c%d.%d.%d.%d%s: phase %s lolo%dlooutput: no header mbuf%s: can't handle af%d lo_altqstart: can't handle af%d ifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedifmedia_match: multiple match for 0x%x/0x%x, selected instance %d sl%s%dsl%d: can't allocate buffer %s: af%d not supported %s: trying to send packet on wrong domain. if %d vs. mbuf %d, AF %d slstartslinputppp%s%dpppdealloc%s: comp_alloc failed %s: decomp_alloc failed %s: no compressor for [%x %x %x], %x pppioctl%s: trying to send packet on wrong domain. if %d vs. mbuf %d, AF %d %s: af%d not supported mbuf packet without packet header!%s output: ppp_requeuepppintrif_ppp/ccp: not enough data in mbuf (%p+%x > %p+%x) %s: got %d bytes %s: decompress failed %d %s: VJ uncompress failed on type comp %s: VJ uncompress failed on type uncomp %s: input queue full %s pppdumpmcan't establish softnet handlerpppwritepppasyncstart%s: bad char %x %s: bad fcs %x %s: too short (%d) %s: no input mbufs! %s: garbage received: 0x%x (need 0xFF) %s: missing UI (0x3), got 0x%x %s: bad protocol %x %s: packet too big %s: too few input mbufs! %s input: %s pppdumpbbsd_decomp%d: bad sequence # %d, expected %d bsd_decomp%d: bad CLEAR bsd_decomp%d: bad code 0x%x oldcode=0x%x max_ent=0x%x explen=%d seqno=%d bsd_decomp%d: ran out of mru bsd_decomp%d: peer should have cleared dictionary z_compress: deflate returned %d (%s) z_decompress%d: bad seq # %d, expected %d z_decompress%d: inflate returned %d (%s) z_incomp%d: inflateIncomp returned %d (%s)       /ư)/0))tunknown compression methodinvalid window sizeinvalid reserved bitincorrect header checkincorrect data check??invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeat #+3;CScs !1Aa  0@` oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeinvalid literal/length codeinvalid distance code0.95Pbuffer errorinsufficient memorydata errorstream errorfile errorstream endtun%s%dtunopentunreadtunstartbridge%s%dbridge_ioctlbridge_brlconfbridge_input(): no HDRbridge_broadcastbridge_rtfindbridge_ipsecnot implementedbstp_notify_rtagebstp still activenot a bstp membervlansvlanvlanattach: hashinit%s%d%s: initialized with non-standard mtu %lu (parent %s) %svlan_ioctlvlan_ether_purgemultivlan_ether_resetmultirn_addmask: mask impossibly already in tree Mask for route not entered rn_addroute: t->rn_p is NULLNon-unique normal route on dupedkey, mask not entered Non-unique normal route, mask not entered rn_delete: inconsistent normal annotation rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation rn_delete: couldn't find our annotation %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2next == NULLraw_usrreqrtentplroute_init rtable_addrtfreertfree 2rtfree: %p not freed (neg refs) ifafreertredirectrtflushclone: called with a non-cloning routertflushclone: no rnh_walktreertrequest deletertrequest1 RTM_RESOLVE: wrong ifa (%p) was (%p) rtrequest1rtinit: wrong ifa (%p) was (%p) rtinitrt_timer_init: already initializedrttmrplrt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputroute_outputrt_msg1sysctl_dumpentryroutesl_compress_tcpenc%s%dgre%s%d%s: trying to send packet on wrong domain. if %d vs. mbuf %d, AF %d gre_ioctlgre_send_keepalivetrunkxtɜ|̰%s%d%s: capabilities 0x%08x %s: using proto %u trunk_ioctl%s: failed to remove multicast address on all ports trunk_ether_purgemulti%s: ioctl %lu failed on %s: %d trunk_ether_cmdmultitrunk_enqueuetrunk_hashmbuf%s trunk_media_change%s: port %s at index %d <<%s: ADDMULTI failed on %s lacp_port_createlacp_port_creatediagnostic ../../../../net/trunklacp.c!TAILQ_EMPTY(&la->la_ports)la->la_nports > 0la->la_refcnt >= la->la_nportsla->la_refcnt > la->la_nportsTAILQ_EMPTY(&lsc->lsc_aggregators)lsc->lsc_active_aggregator == NULL(lp->lp_state & LACP_STATE_DISTRIBUTING) != 0best_la == NULL || best_la->la_nports > 0best_la == NULL || !TAILQ_EMPTY(&best_la->la_ports)i == p->pm_countla->la_refcnt > 0la->la_refcnt == 0lsc->lsc_active_aggregator != la!LACP_TIMER_ISARMED(lp, LACP_TIMER_WAIT_WHILE)lp->lp_mux_state == LACP_MUX_DETACHED || la != NULLla->la_pending > 0 || !LACP_TIMER_ISARMED(lp, LACP_TIMER_WAIT_WHILE)%s: unknown statelacp_sm_muxla->la_pending > 0lacp_set_muxlp->lp_timer[i] >= 0mpempe%d%s: trying to send packet on wrong domain. if %d vs. mbuf %d vethervether%darp_rtrequest: bad gateway value arp_rtrequest: malloc failed arprequestarpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arpresolve: unresolved and rt_expire == 0 arpintrarp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s in_arpinputarptfreerevarprequestrevarp[NULL][%d,] ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold_head=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld rtableid %u key= mask= gw= ifp=%p (%s)(NULL) ifa=%p genmask= gwroute=%p llinfo=%p Route tree for AF_INET (not initialized) in_controlin_controlinvalid argument to in_lifaddr_ioctlin_lifaddr_ioctlin_ifinitin_ifinitin_addmultiin_delmultiin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplIPv6 pcb passed into in_pcbconnectin_pcbnotifyallin_pcbhashlookup: faddr=%08x fport=%d laddr=%08x lport=%d rdom=%d in6_pcbhashlookup: faddr= fport=%d laddr= lport=%d in_pcblookup_listen: laddr=%08x lport=%d in6_pcblookup_listen: laddr= lport=%d internetdivert_packetdivert_usrreqicmp_erroricmp lenicmp_reflecticmp_mtudisc_timeout: bad route to timeouticmp_mtudisc_timeouticmp_redirect_timeout: bad route to timeouticmp_do_exthdr: m_getptr failure%d.%d.%d.%dKgpqrstuvwxyzipqeplipqplip_initaeshmac-sha1deflateipintr no HDRsave_rte: olen %d ip_srcroute: nhops %d mlen %d hops %x %x %x forward: src %x dst %x ttl %x redirect (%d) to %x ip_savecontrolip_mrouter_init: so_type = %d, pr_protocol = %d ip_mrouter_init ip_mrouter_done add_vif #%d, lcladdr %x, %s %x, thresh %x rmtaddrmaskadd_vifreset_vifdel_vif %d, numvifs %d add_mfc update o %x g %x p %x add_mfc %s o %x g %x p %x dbx %p multiple kernel entriesadd_mfc o %x g %x p %x dbg %p add_mfc no upcall o %x g %x p %x add_mfcdel_mfc origin %x mcastgrp %x del_mfcip_mforward: src %x, dst %x, ifp %p ip_mforward: received source-routed packet from %x ip_mforward: no rte s %x g %x ip_mforward: ip_mrouter socket queue full expire_upcalls: expiring (%x %x) wrong if: ifp %p vifi %d vififp %p phyint_send on vif %ld err %d bw_upcalls_send: cannot allocate mbuf bw_upcalls_send: ip_mrouter socket queue full bw_upcalls_sendunschedule_bw_meter: bw_meter entry not foundip_output: IPv6 pcb is passedip_output no HDRip_output: tag of length %d (should be %dip_outputmalformed IPv4 option passed to ip_optcopyip_setmoptionsrip_attachrip_detachrip_usrreqm_pulldown malfunctiontcp_input: TCPS_LISTENtcp_inputtcp_dooptionstcp_sack_optiontcp_pulloutofbandsynplsyn_cache_insert: bucketoverflow: impossiblesyn_cache_insert: cacheoverflow: impossibleinvalid sc_tp in syn_cache_cleanupsyn_cache_respondtcp_output: options too longtcphdr too bigtcp_outputtcp_output: template len != hdrlen - optlentcp_outputtcp_output REXMTtcpcbpltcpqeplsackhlpltcp_inittcp_respondassumption failed in tcp6_ctlinputtcp_ctlinputtcp6_mtudisc_callbacktcp_set_iss_tsmtcp_signatureHDtcp_timer_rexmttcp_usrreqtcp_identm_pulldown malfunctionudp_inputudp6_ctlinputIPv6 inpcb to udp_outputudp_usrreqTCP MD5 Signature Option, RFC 2385IPcompIPsec ESPIPsec AHIPv4 Simple Encapsulationgettdbbysrcdstno tdb hash table tdb cnt bucket cnt %d%s %d +%d.%d.%d.%d(unknown address family)ipsp_reffree: illegal reference count %d for object %p (len = %d, malloctype = %d) ipsp_spd_lookupipsec policyipsec acquireipsp_spd_inpipip_input: should never reach hereipe4_input(): should never be called etherip_getgifetherip_output: no space for align fixupipsec_common_inputipsec_common_input_cbipsec_common_ctlinputudpencap_ctlinputah6_input: l went zero or negativeesp6_input: l went zero or negativeipcomp6_input: l went zero or negativeesp_initesp_input_cbah_initah_massage_headersah_input_cbcarpcarp_hmac_prepare_ctxcarp_hmac_generatecarp_hmac_verifycarp_setroute%s: carp: packet received on non-carp interface: %s received ttl %d != %d on %spacket too short %d on %schecksum failed on %sm_pulldown malfunctionpacket size %u too smallchecksum failed, on %sinvalid version %d != %dincorrect hashreplay or network loop detected%s%ddetachip_output failed: %d> snderrors< snderrorsip6_output failed: %d> snd6errors< snd6errorscarp_send_adcarp_update_lsmask: %x%s: master_down event in INIT state carp_join_multicast6carp_ioctlcarp_vhids_ioctlallMASTERBACKUPINITstate transition (vhid %d): %s -> %sstate transition: %s -> %s%s demoted group %s by %d to %d (%s)carpdevcarp_ether_purgemultiipcomp_initcc||ww{{ kkooT`00PggV++}bMvvE@}}YYGG Ag_E#Srr[u=L&&jl66Z~??AOh44\Q4qqsb11S*? RF##e^0(7 / $6=&N''iuu X,,t4.6-nnZZ[RRv;;Ma}R)){>^//qSSh,@ `yȶ[[jjFgr99KJJޘLL԰XXJk*OCCŚMMf33UEEPPx<!KKa pp|>>BqffHHaaj55_WWiX:''8+"3iip3-<" IUUP((xzY  e1BBhhAA)Z--w{˨TTm,:cc||ww{{ kkooTP`00gg}V++bMvvEʝ@ɇ}}YYɎGG Ag_E#Srr[u=jL&&Zl66A~??O\h44Q4qqsSb11?* ReF##^(07 / 6$=&iN''uu tX,,.4-6nnZZ[RRMv;;a}{R))>q^//SSh,`@ y[[jjFgKr99ޔJJԘLLXXJk*OņCCךMMUf33ϊEEPPDx<<%KQQ]@@?!Hp88cwucB!!0 mL 5&/__5̈DD9.WU~~Gz==dd]]+2ss``ўOOfD""~T**; ʌFF)k<(y^^ v;Vd22Nt:: ےII lH$$\\]nCbb917yy2CYn77mmdҜNNIllVV%eezzGoxxoJ%%r\..$8WsQ#|ݜtt!>ݖKKa ppB|>>qffؐHHaa_j55WWiX':'8+3"iipى3-"< IUUxP((zߏY  e1ƄBBhhÂAA)wZ--{TTm:,cc||ww{{ kkooT0P`0gg+}V+b׫MvvEʂ@}}YYGɎG AgԢ_E#Srr[u=&jL&6Zl6?A~?O4\h4Q4qqs1Sb1?* R#eF#^(07 / 6$=&'iN'uu  ,tX,.4-6nnZZ[RR;Mv;aֳ}){R)>/q^/SSh, `@ y[[jjF˾g9Kr9JޔJLԘLXXJk*OCņCMךM3Uf3EϊEPPKݖKa pp>B|>qffHؐHaa5_j5WWiX':'8+3"iipَ3-"< IUU(xP(zߌY  e1BƄBhhAÂA)-wZ-{TTm:,cc||ww{{ kkooT00P`gg++}VbMvvE@}}YYGGɎ Ag_E#Srr[uᓓ=&&jL66Zl??A~O44\hQ4qqs11Sb?* R##eF^(07 / 6$=&''iNuu ,,tX.4-6nnZZ[RR;;Mva})){R>//q^SSh, `@㱱y[[jjFg99KrJJޔLLԘXXJk*ŪOCCņMMך33UfEEϊPP<KKݖa pp>>B|qffHHؐaa55_jWWiX':'8똘+3"iip3-"< IUU((xPzY e1BBƄhhAAÂ)--wZ{TTm:,cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTQP~AeS:'^;kEXK 0UvmvL%O*&5DbޱZI%gE]/uLFk_mzRYԾ-Xt!Ii)Du‰jyxX>k'qݾO f}:cJ1Q3`bSEdwk+pHhXElR{s#rKWfU*(/{70(#j\+yNie4bĦ4.SU2u 9@`^qnQ>!=>MFTq]o`P$ֽ闉@CgٞwB[8yۡ| G|B 2+HplZrN8V=6-9' dh\![T$6.: gWOa ZwKi⓺ *<"C ǭ-WuLݻ`&\rDf;[~4C)v#ܶhc1Bc"@ J$}һ=2)m/Kܲ0 Rw+lpHGd"Ġ?V},"3IN8ʢ 6ϥz(ڷ&?,:Px j_̛T~Fbظ.9^ï]iГ|o-%Ȭ;}cn;{&x nY욷One~!Jo6 )|1*?#1ƥ05ftN7ʦа3JAP/vM֍CM̪MTߞѵLj,FeQ^5]ts A.gZRV3mGa7 zY<Ω'a5zG8$4,£@_r% ('qOf }:cJ1`Q3EbSdwk+XpHhElR{#srKW*fU(/š{70(#j\+yNie4bĦ4.SU2u9 @`^qQn>!=>FM潵Tq]o`P$ֽ̉@CwgٞB8[yG| |B H2+pNlZrV8='6-9d !h\ћ[T:$6. gWҴOŢa iZwK ⓺*C<"  ǹ-WLu`&\rDf;4[~vC)#hc1Bc@" }J$һ=2m)K/ܲ0 Rwl+pH"GdĨ?V},"3LJIN8ʢ6 Ϧ(z&ڷ?,: Pxj_bT~Fظ^.9ï]|iГo-%;Ȭ}nc{; &xnY욷Oen~!ٺJo6 )|11*?#0ƥ5f7tNʰ3JAP/vMMCT̪MѵLj,FeQ^]5st. AZgR3VmGaz7 Y<Ω'5ah,8$4_£@r %(kXq'Of :}Jc13`QEbSwdk+hXpHElR{#srKW*fU(/{70(#j\+ϴyNieھb4ĦS4.U2u9 @`^qQn>!=>FM捵T]qo`P$ֽC̉@wgB苈[8y G||B H2+prNlZ8V=9'6-d !h\Tћ[.:$6g WҴO aKiZw *C<"  ǭ򋨹-WLuݻ`&\r;Df~4[)vC#hc1Bc"@ $}J=һ2m)/K0ܲR wl+pHd"GĨ?,V}"3NLJI8 6ԁϦ(z&ڷ?,: Px̛j_FbT~^.9À]|i-o%;Ȭ}cn蜻{;x &nY욚One~!ٺ6Jo |)1#1*?0ƥf57tNʦа3JAP/֍vMMCMT̪䖵шLj,QFe^5]tsA. ZgRV3Gma z7Y<'Ω5ah4,8$@_£r% I(kq'O f:}Jc1Q3`SEbdwk+HhXpEl{Rs#KrWU*f(/{7(0#j\+yiNe4bѦ.S4U2u9 `@q^nQ!>=>FMT]qoP`$@C̉ٞwgB[8y| GB| +H2pZrNl8V=-9'6d \!h[Tћ6.:$ g WҴO awKiZ *"C< ǭ򶨹-WuLݻ`&r\f;D~4[C)v#hc1cB"@ J$}=2)mǞ/K0܆R wl+pHd"GĨ?},V3"INLJ8ʢ 6Ϧz(&ڭ?:,x P_̛j~FbTظ9^.ï]Г|i-o%Ϭ;}cn;{&x YnOne~!ٺo6J |)1?#1*0Ƣf5N7tʦа3JAP/M֍vMCMT̖ѵjL,eQF^5]ts A.gZRV3Gma z7Y<'a5G$4,8@_r% >>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<QR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqxj ggQRf߫1m-2'Ș!?YǾ =էG %cQo))g np' F/.!8\&&M,mZ*S8 e sTcvj &aц!}}Onxgro c}ŢȘ? q 5G(w#}2ʫ{@$< ɾCgĜ LLԾ>BY)e~*_o:lDJGX˻]b)*6|YZ0p/Y9g3&g 1JhX . dGHOj ggʧ;l٫Ak[~!y1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىy0@ԟ k/?%z!?/M`@ϟIԯ'@Жuncaf"(h;oY#yw_PC@/V|ҽ-4lHam"T/*2Tk"V:Af@ȧ9/M/-ޗ?JRvD7,QYoZ z{hА."TY5Km/PdfI-3";K4]E@1?.Ueձʭ-Էm P"@ nO8O[rVL/ŜSITFiXcE]WSj9=7*T:x}_bvzB j)r'^Pg8Ƶˌ*ZJ'ѓk*҆Vґ׉C`B\u &ql-sJ5&{M 0n٘&fVH%^V c|cp EP(r#Hp -;MyBA &G LGMj| ^\#Y8r۫Sn/#qFVEn9 q+A|ʉiHCyB}B{ZIݏ\e  [i~9?Caz zUrQyNr5Zc60_ }/{Y6 DDY̳A; *{B [%AzzƩX0ދw?Nyi${[P5%a_b1T UKc]h!fY=cs4~\g+!a9b60W;`/d:͜F5-' zyl0%7^oo; jEt'N:4Oi>M5YdE8Cfr%c3N?( 'ᛥզRTUfpdw M&g!CX`T0orSGUb]hVk-n;ۦк=\w 3L9{^+_Soa Cd^xc"g&рI"{^U-%Rr7yҕ LHϢ 0qc/ S!ET(5c)1BƎI# 0(_qȾ`a輨M/".pN40';yaٸHi?(;CZᗘv/܆7ӱÓnƼ>Q7Bh(Re-jw5'K \n.ے^)XXOTi{&g̅`HK8` #l8~ I` 5sܱGLV>#d8^FB kzOdEA^\#>];Cוr~m|llq`9spvE#@%]=G`6KDʐPQHX_0.r| ],*IPڈ'WyoIR}rY}@EE]t>OuVi#A.`' v䶔etyvwvNHam❄/}4 ȖH0b \8D=`nm`T:IW'H+8 $hE%;` E}(/P4b +md+10ZRXAB휤1\2>F63S57 ާ{sJO{dWQC~(zc _5y Cddc$J(_OC@ " 07O-${MQgqL-_d_ !S>^'Ҹ_Bar%΄q=Ko&;~ԄT~DmLl&I߮63P?~w a8rPP.wWOgF3Ti 1M5=\f][̩o꟒oF"/9F}mCOC!N ? (X&Hn>׊ptw|- %y 껁(;#iޭ8t߇b!@7{ @YVOv/@U{ MV3i5W#'ȰVÑke^anu2Uw?[-;%m;$ cf8( 2T2bZg,uzT1w&16o FjHVZyjLRC~/v t,߷t*M . k|AT嶠5!=B,|&aeR1%i &c1\!^ rIyٍ 1p>d >Ӷ È0lrqn/ބkD؋V9ñ/ʴ1x(o}2X~$ŗ{sa0-!!))*\e0,Ъ?\Ԟ, T ͆_wޠ:xV^V!\uㇳQ#wE)/i߯zpIJ[̘v9F څ8/sgD)k)I/•fgni~/%p^QS$jlD!>Yye)CA9y+WMN҂z) Gl ыiWw@~˳PM xQ VA$ VWUnaX $K'{UahwdlkDMfdi~կI/07O,5jsI@v;M(BDHsnL )_}Oao.w+᪐r<}F+YEEYTNmHo |cD_sVjprn] `yE`۩11\"NB\rr,%@N2N/@g#\xnu"xMkXnD O?H{wv#uV_F*+ (=8 6RJf;tQZרխly ueXJh&pSF\l(vk07h)҅6*$gk %huUD,eI40ʸ"W ubIb~U^vSEFmG,lLHg3|hC\2US `ߡWc톹^9283Ia7b^~N#tq܇&3@~C/ ^A (lؑ0~foo䬘s`*4-K6%░#% =HI6oJ8@CzT¼pOWAZ:TUY5|ūZǵޯ:G:S%e=~jT&IQwP[]Dlvȸ!`Xi[)Y;LJ]5UkLD5$bI/T81q(TH9)[u/@3+gf-V*o` ('Md)P,2\K6ޠ_AP! NhÁ\yCMIP8CA<?f϶&`ued$zHܩóf(` ߨ5mw 5k*HiMuN{:_Cg7I3BfΌAT:lG()G%7j+z \D7bB ntgr9X7EXVn0!$Eˆ)^18FXJNFFPx)C_$;,NmdTJOëoxnn<UV6;]޻a<tb3<L(m tyl{nwe\R0+@`>x7T0}ȧm2羾-yy"SuwXkxoZc\]3򎿰€vzҰyBq3j'`CP=Ăm+NvH%6f(NAa =IϺ߶_撮d:枨 +}?pP+ObZjyb.H@@Z,Қ"-E4S֙)nIloIrB~>VofblqTL+*)9ܰX򮞢RVLf.v9Si.Ӡߦi>҅tFL+OuvV]93x2#O=2]K&ǟ/<~~^O?v)f=oEӵ4+4NrgU="Ҩ`g8k0=8}cQXӐTyGawY-WSVXNcF.xe~yU@0ј5?P=@!IXLQ6p΃yǔqoKK0 ڽ5dw$,ϰ/ t*Bv-:7ޚޱ ,p) @$:7ϴNy ]H 1hZfB1?ru3 BQ\}mc@!d SWz13]oCqF8"ΔԸGi[bUfg N[GLoŽĸWrndzx]D`Փl 9_] c~2p PI) *m~SHX~;t.R/G~'ͤ![<z8BOv5`9'5ɯ{6 g{qp-^3TIZd,= p4wB&Ob$ҿF%dN>7`xͥE{_ v"1.{$%r_m LPm=O%#so(%Iy4azn|n6lTAV'JA<șgmB`{u $ž9g;?q0T;2dB̰E}JBp} W[z?Z MΤ(y043w;S7x倳Nhȳ~ 9|*OC/}"6ʢ7ߓ+$W4xgaoHR^^A$e.{@鎠XӐ[HV8Wrs޼[d1~OPa`{ I8,v%ѷ%$K vGX YѤf 0nN&Qd# Ph                              A@@A@@A@@@@A@@@@A@@@@@A@AA@@@@@@@@@@@@A@@@A@A@@@@AA@@A@@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                             libdes v 3.21 - 95/11/21 - eay  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$   $ $$$   $ $            $$   $ $$$   $ $                0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((           """"    " " " "((((((((    """"( ( ( ( ("("("("cryptocryptopcryptodesccryptof_ioctlcrydevcuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_apply: len %d < 0cuio_apply: off %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for len66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\swcr_encdecswcr_authcomputeswcr_combinedSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128Rijndael-128/AESAES-CTRAES-GCMAES-GMACAES-XTSARC4NULLHMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512GMAC-AES-128GMAC-AES-192GMAC-AES-256Keyed MD5Keyed SHA1MD5SHA1DeflateLZSaes_ctr_cryptaes_xts_cryptHMAC_MD5_InitHMAC_MD5_FinalHMAC_SHA1_InitHMAC_SHA1_FinalHMAC_SHA256_InitHMAC_SHA256_FinalAES_GMAC_Final H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*Fmplsintr no HDRmplsmpls_raw_usrreqbind failed krpc_call: sosend: %d RPC timeout for server %s (0x%x) prog %u rpc denied, error=%d rpc denied, status=%d nfs_read modenfsbioreadnfsbioread: type %x unexpectednfs_write modenfs_write procnfsvinvalnfs_bufqProcess killed due to text file modification nfs_doio: type %x unexpectednfs_boot: no suitable interfacenfs_boot: using interface %s, with revarp & bootparams nfs_boot: socreate, error=%dnfs_boot: GIFFLAGS, error=%dnfs_boot: SIFFLAGS, error=%dreverse arp not answered by rarpd(8) or dhcpd(8)nfs_boot: client_addr=%s nfs_boot: set if addr, error=%dnfs_boot: bootparam whoami, error=%dnfs_boot: server_addr=%s hostname=%s nfs_boot_initnfs_boot: bootparam get %s: %d nfs_boot: mountd %s, error=%d nfs_boot: portmap NFS/v2, error=%d nfs_boot_getfhnfs_boot: bootparam_whoami: bad reply nfs_boot: bootparam_getfile: bad reply xid 0x%x flags 0x%x rexmit %i procnum %i proc %p mreq %p mrep %p md %p nfsmount %p vnode %p timer %i rtt %i size %llu flag %i vnode %p accstamp %i pushedlo %llu pushedhi %llu pushlo %llu pushhi %llu commitflags %i nfshshlknfs_commitlkdiagnostic ../../../../nfs/nfs_node.cnp2 == NULLnfs_ngetnfs_inactive: pushing activeNULL v_data (no nfsnode set up?) in vnode %pnfs_reclaim: pushing activenfskqlknfskqpwnfskqdetE`FE`Gnfskqpollnfsrv3_accessnfsrv_getattrnfsrv_setattrnfsrv_lookupnfsrv_readlinknfsrv_read iovnfsrv_readnfsrv_writenfsrv_createnfsrv_mknodnfsrv_removenfsrv_renamenfsrv_linknfsrv_symlinknfsrv_mkdirnfsrv_rmdirnfsrv_readdirnfsrv_readdirplusnfsrv_commitnfsrv_statfsnfsrv_fsinfonfsrv_pathconfnfsconnfscon sotypenfsreconshort receive (%d/%d) from nfs server %s %s (%d) from nfs server %s impossible packet lengthEgad!! receive error %d from nfs server %s nfsreply nilis alive againnfsretrynot respondingnfsndlcknfs sndunlocknfsrcvlknfs rcvunlocknfs_realign_fixup: no memory to pad tonfs server %s: %s nfs getstreamnfsd wakeupnfsrv cachenfsrcdiagnostic ../../../../nfs/nfs_subs.cauth_type == RPCAUTH_UNIXnfs S too bignfsreqplnfsnodeplbuild > MLENnfsd initbad nfs svc reply, siz = %indscplnfsidlnfsionfsdjpmn p [|n`o pp+op(rootnfs_mountroot: root/root on %s nfs_mountroot: getattr for rootnfs_mountroot: can't setup swap vpswap on device 0x%x swap/swapnfs_mountroot: getattr for swap swap on %s WARNING: no swap nfs_mountrootnfsnfs_mount_diskless: vfs_rootmountalloc failednfs_mountroot: mount %s failed: %dnfs_args: retrying connect nfsconnfs_mountopen eacces vtyp=%d nfs: writerpc iovcnt > 1nfs_remove: no namenfs_remove: bad v_usecountnfs_rename: no namenfs readdirrpc bad uioEEK! readdirrpc resid > 0 nfs readdirplusrpc bad uioEEK! readdirplusrpc resid > 0 nfs: sillyrename dir .nfs%08X%08Xnfs physio/asyncnfsfsyncnfs_fsync: not dirtynfs_fsynctag VT_NFS, fileid %ld fsid 0x%lx bwrite: buffer is not busy???dev = 0x%x, bsize = %d, size = %d, fs = %s ffs_alloc: bad sizeffs_alloc: missing credentialuid %u on %s: %s file system full %s: write failed, file system is full dev = 0x%x, bsize = %d, osize = %d, nsize = %d, fs = %s ffs_realloccg: bad sizeffs_realloccg: missing credentialdev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknoffs_realloccg: small bufdev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimffs_realloccg: small buf 2ffs1_reallocblks: unallocated block 1ffs1_reallocblks: non-logical clusterffs1_reallocblks: non-physical cluster %dffs1_reallocblk: start == endffs1_reallocblks: unallocated block 2ffs1_reallocblks: alloc mismatchffs1_reallocblks: unallocated block 3 %lld,ffs2_reallocblks: unallocated block 1ffs2_reallocblks: non-logical clusterffs2_reallocblks: non-physical cluster %dffs2_reallocblk: start == endffs2_reallocblks: unallocated block 2ffs2_reallocblks: alloc mismatchffs2_reallocblks: unallocated block 3mode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free ffs_clusteralloc: map mismatchffs_clusteralloc: allocated out of groupffs_clusteralloc: lost blockcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedfs = %s ffs_nodealloccg: block not in mapdev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodebsize = %d, size = %ld, fs = %s ffs_checkblk: bad sizeffs_checkblk: bad block %lldffs_checkblk: partially free fragmentstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs1_balloc: blk too bigffs1_balloc: ufs_bmaparray returned indirect blockCould not unwind indirect block, error %dffs2_balloc: block too bigffs2_balloc: ufs_bmaparray returned indirect blockffs2_balloc: unwind failedffs_update: bad link cntffs_truncate: partial truncate of symlinkffs_truncate: newspaceffs_truncate1ffs_truncate2ffs_indirtrunc: bad buffer sizeDisk overlap start %lld, end %lld overlap start %llu, end %llu Disk buffer overlap?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@HD ̄x8Hffs_mountroot: can't setup bdevvp's ffsroot_deviceWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_reload: dirty2ffs_reload: dirty1 ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_statfsfs = %s update: rofs modinodeffsinodino1pldino2plffs_read: modeffs_read: short symlinkffs_read: type %dffs_write: modeffs_write: nonsync dir writeffs_write: typeffs_fsync: not dirtyffs_fsyncffs_fsync: dirtynewdirblkdirremmkdirdiraddfreefilefreeblksfreefragallocindirindirdepallocdirectbmsafemapnewblkinodedeppagedepsema_release: not heldsoftdep_free: unknown type %dsoftdep_freequeue_processadd_to_worklist: already on list%s_process_worklist: Unknown type %ssoftdep???softdep_move_dependencies: need merge codesoftflushpagedep_lookupinodedep_lookuppagedepplinodedepplnewblkplbmsafemapplallocdirectplindirdepplallocindirplfreefragplfreeblksplfreefilepldiraddplmkdirpldirremplnewdirblkplsoftdep_setup_inomapdep: found inodesoftdep_setup_blkmapdep: found blockbmsafemap_lookupsoftdep_setup_allocdirect: lost blocksoftdep_setup_allocdirect: Bonk art in the headsoftdep_setup_allocdirect: non-zero indirsoftdep_setup_allocdirect: lost entryallocdirect_mergeallocdirect_merge: old %d != new %d || lbn %ld >= %dallocdirect_merge: extra newdirblknewfreefrag: frag sizesoftdep_setup_allocindir_page: Bonk art in the headsetup_allocindir_phase2: not indir blksetup_allocindir: lost blocksetup_allocindir_phase2: blknosoftdep_setup_freeblocks: non-zero lengthsoftdep_setup_freeblockssoftdep_setup_freeblocks: inode busydeallocate_dependencies: already gonedeallocate_dependencies: not indirdeallocate_dependencies: lost pagedepdeallocate_dependencies: Unexpected type %sdeallocate_dependencies: Unknown type %sfree_allocdirectfree_allocdirect: extra newdirblkfree_newdirblkcheck_inode_unwrittencheck_inode_unwritten: busy inodehandle_workitem_freeblocks: block count handle_workitem_freeblksindir_trunc: lost indirdepindir_trunc: dangling depfree_allocindirsoftdep_setup_directory_add: lost inodedepsoftdep_setup_directory_add: lost entryfree_diraddfree_diradd: unfound refnewdirrem: whiteoutnewdirrem: not ATTACHEDnewdirrem: inum %d should be %dsoftdep_change_linkcnt: bad deltahandle_workitem_remove: vgethandle_workitem_remove: lost inodedephandle_workitem_remove: bad file deltahandle_workitem_remove: bad dir deltahandle_workitem_remove: truncatehandle_workitem_freefilesoftdep_disk_io_initiation: readdisk_io_initiation: indirdep gonehandle_disk_io_initiation: Unexpected type %sinitiate_write_filepage: already started %s: dir inum %d != new %dinitiate_write_filepageinitiate_write_inodeblock: already startedinitiate_write_inodeblock: already doing I/Osoftdep_write_inodeblock: lbn order%s: direct pointer #%ld mismatch %d != %dsoftdep_write_inodeblock%s: indirect pointer #%ld mismatch %d != %dsoftdep_write_inodeblock: Unknown state 0x%xsoftdep_write_inodeblock: lost dep1softdep_write_inodeblock: lost dep2initiate_write_inodeblock_ufs2: already startedinitiate_write_inodeblock_ufs2: I/O underway%s: direct pointer #%ld mismatch %ld != %ld%s: indirect pointer #%ld mismatch %ld != %ldsoftdep_write_inodeblock: lost dep3disk_write_complete: indirdep gonedisk_write_complete: not gonehandle_disk_write_complete: Unknown type %shandle_allocdirect_partdonehandle_allocdirect_partdone: dangling dephandle_allocindir_partdonehandle_allocindir_partdone: dangling dependencyhandle_written_inodeblockhandle_written_inodeblock: not startedhandle_written_inodeblock: new entry%s: %s #%ld mismatch %d != %ddirect pointer%s: %s #%ld allocated as %dindirect pointerhandle_written_inodeblock: bad sizehandle_written_inodeblock: filefreehandle_written_inodeblock: Unknown type %shandle_written_inodeblock: live inodedepdiradd_inode_writtenhandle_written_mkdirhandle_written_mkdir: bad typehandle_written_filepagehandle_written_filepage: not startedhandle_written_filepage: attachedsoftdep_update_inodeblock: bad link countsoftdep_update_inodeblock: bad deltasoftdep_update_inodeblock: bwritesoftdep_update_inodeblock: update failedmerge_inode_listssoftdep_fsync: pending opssoftdep_fsync: Unexpected type %ssoftdep_fsync: dirtysoftdep_fsync_mountdev: vnode not a disksoftdep_fsync_mountdevsoftdep_fsync_mountdev: not dirtysoftdep_sync_metadata: Unknown type %sflush_inodedep_depsflush_pagedep_depsflush_pagedep_deps: MKDIR_PARENTflush_pagedep_deps: MKDIR_BODYflush_pagedep_deps: lost inodeflush_pagedep_deps: flush failedrequest_cleanup: unknown typesoftupdateclear_remove: vgetclear_remove: fsyncclear_inodedeps: vgetclear_inodedeps: fsync1clear_inodedeps: fsync2softdep_check_for_rollback: Unexpected type %sgetdirtybufsdsdtydrain_outputsoftdep_deallocate_dependencies: dangling depssoftdep_deallocate_dependencies: unrecovered I/O error%s: got error %d while accessing filesystem deps: %s%s(%p) state %b %sATTACHEDUNDONECOMPLETEDEPCOMPLETEMKDIR_PARENTMKDIR_BODYRMDIRDIRCHG GOINGAWAY IOSTARTED SPACECOUNTED NEWBLOCKUFS1FMTONWORKLISTmount %p ino %u lbn %lld fs %p ino %u nlinkdelta %u dino %p %s bp %p savsz %lld fs %p newblk %lld state %d bmsafemap %p buf %p lbn %lld newlbk %d oldblk %d newsize %lu olsize %lu %s bp %p inodedep %p freefrag %p savedata %p savebp %p off %d newblk %d oldblk %d freefrag %p %s indirdep %p buf %p vnode %p mp %p blkno %lld fsize %ld ino %u previno %u devvp %p mp %p oldsz %lld newsz %lld %s chkcnt %d uid %d mode %x oldino %u vnode %p mp %p off %ld ino %u da_un %p diradd %p bp %p mp %p ino %u dm_un %p pagedep %p worklist_printceD ̄g8h hmfs_mount: dup devmfsidlmfs_open not VBLKmfs_strategy: bad devmfs_close: dirty buffers mfs_inactive: not inactive (mfs_buflist %p)tag VT_MFS, pid %d, base %p, size %ld mfs_badop calledufs_bmaparray: invalid argumentsufs_bmaparray: indirect block not in cacheufs_getlbns: Invalid indirect block %d specifiedufs_getlbns: indirect block %d not founddiagnostic ../../../../ufs/ufs/ufs_dirhash.c((((ip)->i_ump->um_fstype == 1) ? (ip)->dinode_u.ffs1_din->di_size : (ip)->dinode_u.ffs2_din->di_size) >= (1 << 9))(dh->dh_onlist)ufsdirhash_lookup: bad offset in hash array(dirblock < dh->dh_nblk && dh->dh_blkfree[dirblock] >= (((slotneeded) + (( 4) - 1)) / ( 4)))ufsdirhash_findfree: free mismatch(offset < dh->dh_dirblks * (1 << 9))(oldoff < dh->dh_dirblks * (1 << 9) && newoff < dh->dh_dirblks * (1 << 9))(offset == dh->dh_dirblks * (1 << 9))(offset <= dh->dh_dirblks * (1 << 9))ufsdirhash_dirtrunc: blocks in useufsdirhash_dirtrunc: first free corruptufsdirhash_checkblock: bad offsetufsdirhash_checkblock: bad dirufsdirhash_checkblock: bad dir endufsdirhash_checkblock: bad free countufsdirhash_checkblock: bad first-freeufsdirhash_checkblock: missing first-free entry(block < dh->dh_nblk && block < dh->dh_dirblks)(dh->dh_hused < dh->dh_hlen)ufsdirhash_findslot: '%.*s' not found(dh->dh_hused >= 0)(dh->dh_hash != 0L)dirhash((((&ufsdirhash_list)->tqh_first) == 0L))ufs_inactive: pushing activeufs_reclaim: pushing activemangled entryi_ffs_size too small%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_makedirentry: missing nameufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory undefinedgroupuserchkdqufs_quota_free_blocks2: vnode is not locked %s: write failed, %s disk limit reached %s: warning, %s %s disk quota exceeded %s: write failed, %s %s disk quota exceeded for too longchkiq %s: write failed, %s inode limit reached inode quota exceededinode quota exceeded for too longchkdquot: vnode is not lockedchkdquot: missing dquotmissing dquotquotaon: mount point not busyquotaoff: mount point not busysetquotasetusedquotfree dquot isn'tdqsync: dquotdqsync: filedqsyncchown: lost quotaufs_link: no nameufs_linkufs_rename: no nameufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_renameufs_mkdir: no nameufs_mkdirufs_readdir: lost in spaceufs_strategy: spectag VT_UFS, ino %d, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %lld ufs_makeinode: no nameufs_makeinodeext2fs_alloc: missing credentialfile system full %s: write failed, file system is full mode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocout of inodes %s: create/symlink failed, no inodes free ext2fs_alloccgblk: cg=%d bno=%d fs=%s ext2fs_alloccg: dup alloccg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedfs = %s ext2fs_nodealloccg: block not in mapbad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s blkfree: freeing free blockifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodestart = %d, len = %d, fs = %s ext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapuid %u on %s: %s ext2fs_balloc: ufs_getlbns returned indirect blockCould not unwind indirect block, error %dext2fs_bmaparray: invalid argumentsext2fs_bmaparray: num=%d ext2fs_bmaparray: numext2fs_bmaparry: indirect block not in cacheext2fs_inactive: pushing activeext2fs_truncate: partial truncate of symlinkext2fs_truncate1ext2fs_truncate2ext2fs_truncate3ext2fs_indirtrunc: bad buffer sizeext2fs_readdirmangled entryi_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentrydirenter: missing nameext2fs_direnter: newblkext2fs_direnter: frag sizeext2fs_direnter: compact1ext2fs_direnter: compact2 %u %uext2fs_direnter: compact2ext2fs_direntercheckpath: .. not a directory checkpath%s: modeext2fs_read%s: short symlink%s: type %dext2fs_write%s: nonsync dir write%s: typeDisk overlap start %lld, end %lld overlap start %lld, end %lld Disk buffer overlapj`v ̄xz{|~`,hHTHext2inoplext2dinoplext2fs_mountroot: can't setup bdevvp'sext2fsroot_device%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsfs = %s update: rofs modinodeExt2 fs: unsupported revision number: %x Ext2 fs: bad block size: %d (expected <=2 for ext2 fs) Ext2 fs: unsupported first inode positionExt2 fs: unsupported optional feature ext2fs_link: no nameext2fs_rename: no nameext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: EXDEVrename: same filerename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_mkdir: no nameext2fs_mkdir: blksizeext2fs_makeinode: no nameext2fs_reclaim: pushing active%u/%unnpfs_devclose never opened?nnpfsreadnnpfs_message_rpc: deadlock avoided pid = %u == %u NNPFS PANIC Error: Message to small to receive wakeup, opcode = %d nnpfsNNPFS PANIC Warning nnpfs_dev: Unknown message opcode == %d NNPFS PANIC Error: Could not wakeup requestor with opcode = %d properly, to small receive buffer. NNPFS PANIC WARNING! nnpfs_message_installroot: called again! NNPFS PANIC WARNING! nnpfs_message_installnode: no parent nnpfs_message_installattr: tokens and no data NNPFS PANIC WARNING! nnpfs_message_installdata failed! Reason: lookup failed on cache file '%s', error = %d NNPFS PANIC WARNING! nnpfs_message_installdata failed Reason: No node to install the data into! NNPFS PANIC WARNING! nnpfs_message_updatefid: %d vrele: bad ref countvrele: ref cntnnpfs_node_purgennpfs_lockfailed to allocate syncer node when nnpfs daemon diednnpfs_attr2attr: bad valuennpfs_attr2vattr: bad valueNNPFS PANIC WARNING! nnpfs_dnlc_enter: %s already in cache lookup_nodegetfh_compatnnpfs: remote pioctl: got a negative data size: opcode: %dnnpfs_pioctl_call: got a humongous in packet: opcode: %dnnpfs_fhopennnpfs<ɜɤɼ(L,Dnnpfs_readdir: mail arla-drinkers and tell them to bake burned cookiesnnpfs_lock: lock NULLnnpfs_unlock: lock NULLNNPFS PANIC WARNING! nnpfs_fsync called after reclaiming! nnpfs_uio_end_lengthnnpfs_lookup_commonnnpfs_create_commonnnpfs_remove_commonnnpfs_rename_commonnnpfs_mkdir_commonnnpfs_rmdir_commonnnpfs_link_commonnnpfs_inactive: failed writing back data: %d xnode: fid: %d.%d.%d.%d attr: %svalid in data: %svalid flags: 0x%x offset: %d amappldiagnostic ../../../../uvm/uvm_amap.c(( sz) & (PAGE_SIZE - 1)) == 0(( padsz) & (PAGE_SIZE - 1)) == 0amap->am_ref == 0 && amap->am_nused == 0(amap->am_flags & AMAP_SWAPOFF) == 0(( entry->end - entry->start) & (PAGE_SIZE - 1)) == 0(( addsize) & (PAGE_SIZE - 1)) == 0amap->am_maxslot < slotneed(( (entry->end - entry->start)) & (PAGE_SIZE - 1)) == 0amap->am_ref == 0amap_wipeout: corrupt amapamap_cow_now: non-resident wired page in anon %pcownowcownowpage(( offset) & (PAGE_SIZE - 1)) == 0amap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countLIST_NEXT(&marker_prev, am_list) == &marker_next || LIST_NEXT(LIST_NEXT(&marker_prev, am_list), am_list) == &marker_nextamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing thereanonpldiagnostic ../../../../uvm/uvm_anon.cpg->loan_count > 0uvmexp.swpgonly > 0anon->an_page == NULLanon->an_swslot == 0anon_pagein: uvmfault_anonget -> %duao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectdiagnostic ../../../../uvm/uvm_aobj.cslot == 0uao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduaoeltplaobjpluao_detuao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsuao_getpageuao_getudv_attachdiagnostic ../../../../uvm/uvm_device.cuobj->uo_npages == 0 && RB_EMPTY(&uobj->memt)udv_detachudv_faultfltamapcopyanonget1anonget2flt_noram1diagnostic ../../../../uvm/uvm_fault.cresult != VM_PAGER_PENDuvm_fault: fault on non-pageable map (%p, 0x%lx)uvmadvice[ufi.entry->advice].advice == ufi.entry->advice(pages[lcv]->pg_flags & PG_RELEASED) == 0uvm_fault: uvmfault_anonget -> %dflt_noram2uvmexp.swpgonly <= uvmexp.swpagesflt_noram3flt_pmfail1uobjpage != PGO_DONTCAREfltagain2flt_noram4uvm_fault: want to promote data, but no anonflt_noram5flt_pmfail2(map->flags & VM_MAP_INTRSAFE) == 0start >= vm_map_min(map) && end <= vm_map_max(map)uvm_fault_unwire_locked: address not in mapva >= entry->startentry->next != &map->header && entry->next->start <= entry->enddiagnostic ../../../../uvm/uvm_glue.cerror == 0va == sva + szuvm_init: page size not setuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileddiagnostic ../../../../uvm/uvm_km.cuobj->pgops == &aobj_pagerkm_pgrmuvm_km_pgremove_intrsafe: no pagevm_map_pmap(map) == pmap_kernel()!(flags & UVM_KMF_VALLOC) || !(flags & UVM_KMF_ZERO)TAILQ_EMPTY(&pgl)km_alloc1wvallocwaitkmthreadkmallocpg != NULL && TAILQ_NEXT(pg, pageq) == NULLgetpagelost papg != NULLvmmapbsydiagnostic ../../../../uvm/uvm_map.cnextuvm_rb_insert: duplicate entry?uvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries uvm_mapent_allocuvm_mapent_free# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# back merges skipped# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpluvm_map_pUVM_OBJ_IS_KERN_OBJECT(uobj)(align & (align - 1)) == 0(flags & UVM_FLAG_FIXED) == 0 || align == 0tmp && tmp->space >= lengthuvm_unmap_removevm_map_pmap(map) == pmap_kernel()!VM_MAPENT_ISWIRED(first_entry)uvm_map_replace1tmpent->start=0x%lx, tmpent->end=0x%lx, end=0x%lx uvm_map_replace2uvm_map_replace3uvm_map_replace4uvm_map_replace5(start & PAGE_MASK) == 0 && (len & PAGE_MASK) == 0(flags & UVM_EXTRACT_REMOVE) == 0 || (flags & (UVM_EXTRACT_CONTIG|UVM_EXTRACT_QREF)) == 0map->flags & VM_MAP_PAGEABLEuvm_map_pageable: stale mapuvm_map_pageable_all: stale map(flags & (PGO_FREE|PGO_DEACTIVATE)) != (PGO_FREE|PGO_DEACTIVATE)start >= current->startpg->uobject == NULLpg->uanon == anonuvm_map_clean: weird flagsvmmaplkfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%llx> BUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVEENCRYPTPMAP0PMAP1PMAP2PMAP3PAGE %p: flags=%b, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found in uvm_pmemrange >>> page not found in uvm_pmemrange <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< diagnostic ../../../../uvm/uvm_mmap.c!UVM_ET_ISSUBMAP(entry)start >= entry->start!UVM_OBJ_IS_KERN_OBJECT(entry->object.uvm_obj)diagnostic ../../../../uvm/uvm_object.cpgs[i] != NULL!(pgs[i]->pg_flags & PG_RELEASED)pg != NULL!(pg->pg_flags & PG_RELEASED)diagnostic ../../../../uvm/uvm_page.c(pg->pg_flags & PG_TABLED) == 0pg->pg_flags & PG_TABLEDuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: bad free list %duvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physdump: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM BSEARCH BIGFIRST <>!!!! obj == NULL || anon == NULLoff == trunc_page(off)pg != NULL && TAILQ_NEXT(pg, pageq) == NULL(pg->pg_flags & PG_DEV) == 0saved_loan_count == 0pg->wire_count == 0lcv != -1diagnostic ../../../../uvm/uvm_pager.cpseg->start == 0pseg->use == 0pagersegpseg != &psegs[PSEG_NUMSEGS]id >= 0 && id < MAX_PAGER_SEGSUVM_PSEG_INUSE(pseg, id)size <= MAXBSIZEpppp->pg_flags & PG_BUSYuvm_aio_biodonenpages <= MAXPHYS >> PAGE_SHIFTuvm_aio_aiodoneswap || pg->uobject == uobj!write || (pgs[i]->pg_flags & PG_FAKE) == 0rvpg != NULLpagedaemon: deadlock detected! pgdaemonaiodoneddiagnostic ../../../../uvm/uvm_pdaemon.canon != NULLp->loan_count > 0uobj != NULLanon->an_swslot != 0uvmexp.swpgonly <= uvmexp.swpagesuvmexp.swpginuse <= uvmexp.swpagespagedaemon: pageout returned invalid 'unlock' codep->uanon != NULLdiagnostic ../../../../uvm/uvm_pglist.c(alignment & (alignment - 1)) == 0(boundary & (boundary - 1)) == 0!(flags & UVM_PLA_WAITOK) ^ !(flags & UVM_PLA_NOWAIT)uvm_pglistalloc: Upper boundary 0x%lx not on pagemask. diagnostic ../../../../uvm/uvm_pmemrange.csz >= 1pmr != NULL && pg != NULLpg_prev != NULL && pg_next != NULL!TAILQ_EMPTY(pgl)count > 0 && (start == 0 || end == 0 || start < end) && align >= 1 && powerof2(align) && maxseg > 0 && (boundary == 0 || powerof2(boundary)) && (boundary == 0 || maxseg * boundary >= count) && TAILQ_EMPTY(result)uvm_pmr_getpagesatop(VM_PAGE_TO_PHYS(&pg[i])) == atop(VM_PAGE_TO_PHYS(pg)) + iFlags: 0x%x, will panic now. (pg[i].pg_flags & PQ_FREE) == 0 && VALID_FLAGS(pg[i].pg_flags)pmr != NULL(pg->pg_flags & PQ_FREE) == 0 && VALID_FLAGS(pg->pg_flags)pmr->low < pagenopmr->high > pagenouvm_pmr_split: lost one pmr drain->nsegs == 0prev == NULL || atop(VM_PAGE_TO_PHYS(prev)) < pagenoatop(VM_PAGE_TO_PHYS(prev)) < pagenobefore > 0after > 0sz >= high - lownw != NULLPMR_IS_SUBRANGE_OF(atop(VM_PAGE_TO_PHYS(high_next)), atop(VM_PAGE_TO_PHYS(high_next)) + high_next->fpgsz, start, end)start == 0 || atop(VM_PAGE_TO_PHYS(found)) + found->fpgsz > startRanges, use queue: * [0x%lx-0x%lx] use=%d nsegs=%ld maxsegsz[%d]=0x%lx free=0x%lx #ranges = %d %s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d fpuswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern)=%p swplkuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswapdrum_addminirootswapctl: miniroot copy failedswapctl: copystrsys_swapctlswap0x%04xdisklabel regionswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filediagnostic ../../../../uvm/uvm_swap.cvnx->vx_pending == 0uvmexp.nswapdev >= 1sdp != NULLsdp->swd_npginuse >= nslotswarning: resource shortage: %d pages of swap lost flags & PGO_SYNCIOswapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrswap_decrypt: key not initializedsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attachuvn_termdiagnostic ../../../../uvm/uvm_vnode.cRB_EMPTY(&uobj->memt)uvm_vnp_terminate: io sync wanted bit setuobj->pgops->pgo_mk_pcluster != 0uvn_flshuvn_flush: PGO_SYNCIO return 'try again' error (impossible)uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getpageuvn_getuvn_iosyncgif%s%dgif_output: recursively called too many times NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egress%s: trying to send packet on wrong domain. if %d vs. mbuf %d, AF %d in_gif_outputin6_gif_outputin6_pcbconnectHuh? Thought in6_pcbnotify() never got called with mapped! in6_pcbnotifyin6_ifloop_request: %s operation failed for %s (errno=%d) ADDDELETEin6_ifloop_requestprefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix in6_controlin6_update_ifain6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_update_ifain6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_addmultiin6_delmultiin6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_prefixlen2maskin6_ifawithscope: output interface is not specified divert6_packetdivert6_usrreqget_last_resort_ifid%s: got interface identifier from itself %s: got interface identifier from %s %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) ia == NULL in in6_ifattach_linklocalin6_ifattach_linklocalin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_ifattach_loopbackin6_nigroupin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifattach%s: didn't unlink in6ifaddr from list in6_ifdetachin6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6m_pulldown malfunctionm_pulldown malfunction%s:%d: ip6q already locked ../../../../netinet6/frag6.cip6q_lockfrag6_input%s:%d: ip6q lock not held ip6q lock checkicmp6_mtudisc_callback_registerm_pulldown malfunctionENOBUFS in icmp6_error %d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) icmp6_notify_error: in6_embedscope failed icmp6_notify_erroricmp6_mtudisc_updateni6_inputshould not reach hereicmp6_rip6_inputsanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cassumption failed in icmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d icmp6_reflect(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_redirect_inputicmp6_redirect_outputicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s m_pulldown malfunctionip6_inputip6_savecontrolip6_pullexthdr: invalid nxt=%d ip6_nexthdr: m == NULLip6_nexthdrOpenBSD-currentcannot forward from %s to %s nxt %d received on %s ip6_forward: tag of length %d (should be %dcannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_forward: outgoing interface is loopback. src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_forwardip6_mrouter_doneregister_mifadd_m6ifdel_m6ifadd_m6fc: %s o %s g %s p %x dbx %p multiple kernel entriesdel_m6fccannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full ip6_mforwardip6_mdqregister_sendm_pulldown malfunctionip6_output: IPv4 pcb is passedip6_output: tag of length %d (should be %dassumption failed: hdr not splitip6_outputip6_ctloutputip6_getpcbopt: unexpected optionip6_getpcboptip6_setmoptionsip6_setpktopt: impossible case m_pulldown malfunctionm_pulldown malfunctionnd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_lookup: failed to lookup %s (if = %s) unspecnd6_lookupnd6_freend6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed %s: failed to join %s (errno=%d) nd6_rtrequestdefault router list contains a non-linklocal address(%s) a router(%s) advertises a prefix with non-link local address nd6_ioctlifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) m_pulldown malfunctionnd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_inputnd6_ns_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) nd6_ns_output: insufficient MCLBYTESnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_ns_outputnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_inputnd6_na_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) nd6_na_output: insufficient MCLBYTESnd6_na_output: source can't be determined: dst=%s, error=%d nd6_na_outputnd6_dad_start: called with non-tentative address %s(%s) ???nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_ns_inputnd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_na_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s m_pulldown malfunctionnd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_rs_inputnd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_ra_inputdefrouter_addreqdefrtrlist_del: negative count on %s dr == NULL in defrouter_delreqdefrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_onlinknd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) nd6_prefix_offlinkin6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_ifaddin6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_inputrip6_outputrip6_attachrip6_detachrip6_usrreqrip6_usrrequdp6_outputPF_KEY @@@@@(@(   pfkeyv2_policyipsec policypfkeyv2_sendaesaesctr3desdesblowfishcast128deflatelzshmac-sha1hmac-ripemd160hmac-md5hmac-sha2-256hmac-sha2-384hmac-sha2-512pfkeyv2_parsemessageexec: a VTEXT vnode has writecount != 0K%  `   X,nK22Kn,X `%KCLGET: returning %x ttcompatgetflags: %x compat_43_sys_acceptcompat_43_sys_getpeernamecompat_43_sys_getsockname  %ciommu%s at %s unsupported cache-coherence?page-sizeiommu_attach: can't allocate memory for pagetablesbad iommu range: %d: version 0x%x/0x%x, page-size %d, range %dMB name_bus_dmamap_load_uio: not implementediommu_dmamap_load_raw: size botchwarning: %ld of DVMA space lost iommu_dmamem_map: nsegs = %diommu_dmamem_map: size botchiommu_dmamem_unmap_bus_dmamem_mmap: not implementedobiovmelvmesvme%s at %s addr %p vec 0x%x+ + + x+ hinterruptcountereeprom unsupported rangesobio: PROM ranges too large: %dcould not find %s amongst obio devices namezsvmesattach: can't allocate intrhandvmelattach: can't allocate intrhandvme: PROM ranges too large: %d: version 0x%x vmebus: no rangesvme: spurious interruptvme: spurious interrupt vmeintr_establish: interrupt vector not allocatedvmeintr_establish: uninitialized vecvme_addirqauxregauxiliary-ioauxioauxio2Tadpole no aux registeroclockeepromclocktimer delay constant %d%s [TOO SMALL?] oclock: calibration failing; clamped at %d mk48t02model: %s (eeprom) mk48t08counter-timercounterdelay calibration delay constant %d oclock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz statclock; using 100 Hz oldclk statintrWARNING: preposterous time in file system WARNING: bad date in battery clockWARNING: clock %s %d dayslostgained%s -- CHECK AND RESET THE DATE! power ledleds sun4cpumidsun4csun4esun4mno%s @ %s MHz, %s FPU: %s%s, %s; %s cpu_attach%s: %sphysical %s%dK instruction (%d b/l), %s%dK data (%d b/l)physical %dK combined cache (%d bytes/line)%dK byte write-%s, %d bytes/line, %cw flushthroughback%s%dK external (%d b/l) Unknown CPU type: cpu: impl %d, vers %d; mmu: impl %d, vers %dmmu-npmgmmu-nctxclock-frequencyvac-sizevac_hwflushvac-hwflushvac-linesizebad cache line size %dbuserr-typecache chip bug - trap page uncachedcache-physical?ncachesicache-nlinesdcache-nlinesicache-line-sizebad icache line size %dicache-associativitydcache-line-sizebad dcache line size %ddcache-associativitycache-nlinescache-line-sizecache-associativityecache-nlinesecache-line-sizebad ecache line size %decache-associativitywarning: couldn't identify cache [viking: PCR_TC is off][viking: turn on PCR_TC]UnknownTI_4_4TI_4_3TI_MS2TMS390S10TMS390Z50 v1TMS390Z50 v0 or TMS390Z55RT620/625CY7C611CY7C601/605 (v.f)CY7C601/605 (v.c)CY7C601/605 (v.b)CY7C601/604MB86907MB86904W8601/8701 or MB86903CY7C601L64811MB86900/1A or L64801psr-implementationpsr-versionimplementationversionOut of CPUsB5010 or B5110/20 or B5210RT602 or WTL3171TMS390C602AL64814L64812 or ACT8847L64804on-chipWTL3170/2L64802 or ACT8847MB86911 or WTL1164/5MB86910 or WTL1164/5version 0x%xmemregmemory-errormemregattach %ssync mem err: ser=%b sva=0x%x aWRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGaer=%b ava=0x%x WBINVALTIMEOUTDVMAERRparity error register = %b ERRMULTITESTENABLEBYTE0BYTE1BYTE2BYTE3memory errormemory error:sfsr=%b sfva=0x%xCSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWafsr=%b afva=0x%xSYSERR UNCORR TIMEOUT BUSERRAFOhard memory errorHyperSPARC async cache memory failure at phys 0x%x%x store buffer copy-back failure at 0x%x. Retrying... warning: got data fault with no faulting address. Ignoring. zsslavezsattach: expected 1 interrupt, got %d pri %d, softpri %d serialkeyboardmousebroken zs interrupt schemepwr-on-auxio2%s: channel %dzs_set_speedttydttycttybttyakeyboard/displaystdin-pathconsinit: increase buffer size and recompile consinit: bogus stdin path %s. device_typestdout-pathconsinit: bogus stdout path %s. displaycninit: mismatched PROM output selector cninit: invalid inSource=%d console is %s cninit: zs not mapped. consinitfdc1.2MB/NEC360KB/x720KB1.44MBfdSUNW,fdtwo drive %d pri %d, softpri %d: unable to register fast trap handler %s: no drives attached CFGLOCK: unexpected responsechip 8207%c : %s %d cyl, %d head, %d sec : density unknown fdstrategy: controller inactive fdcresult: overrun fdcresult: timeout fdcstart: not idle %s: %s: state %d (st0 %b cyl %d) invldabnrmlseek_cmpltequ_chckdrive_notrdytop_head (st0 %b st1 %b st2 %b cyl %d head %d sec %d) end_of_cylbad_crcdata_overrunsec_not_fndwrite_protectno_amctrl_mrkbad_crcwrong_cylscn_eqscn_not_fndbad_cylno_dam fdcstatus: weird size: %d %s: timeout but no I/O pending: statu %d, istatus=%d fdc: ierror status: state %d fdc: spurious interrupt: state %d fdcintr: block %d != blkno %lld timeoutsoft errorstray interruptfdcintr: impossible%s: read-only medium %s: no medium? hard errorcontroller statusfloppy diskfictitioussbusslave-only"%s" at %sdevice_type class %s %s slot %d offset 0x%x unsupported clock-frequency: %s MHz burst-sizesrangessbus: PROM ranges too large: %dnamevmrelative sbus addressing not supported%s: dma card found in non-dma sbus slot %d: not supported sunkbd_input%s: reset: invalid keyboard type 0x%02x ;X?@ABC8jgFˋ )v7SrGHIJ !"#$%&'(+KLMRɒE*,-./0123456OPQ:s9tN '&     1!2@ 3#!4$"5%#6^$7&%8*&9('0)(-_)=+*`~+,-=.//*12.345 6q7w8e9r:t;y<u=i>o?p@[{A]}BC D7E8F9G-HIJLM aNsOdPfQgRhSjTkUlV;:W'"X\|Y Z [4\5]6^0_`ab cdzexfcgvhbinjmk,m/?no p1q2r3vwxy z{}+ ]}&12 "3!'4"(5#6$7%!8&9\'0()~)-_#**|6a7z@A`$@M qVmMW%X[{dwj,?k;.l:/m=+w |<> &12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@()])=+}*6a7z@A$M qVmW%X*dwj,?k;.l:/m!|<> ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?)|*'*`@AC LVWXk,;l.:m-_w|<>\ 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}(+?)|**`@AVWX\*`k,;l.:m-_|<>\ ]} 2" 3#6&$7/%8(`&9)''0=|(?\)*#^@;z@A+~LVWX[{dyjmMk,;l.:m-_w|<> 2" 3#6&$7/{%8([&9)]'0=}(?\)*^6qQ@;z@A+~VWX#'`dyjmMk,;l.:m-_|<>| ]}2" 3#6&$7/%8(&9)\'0=|('?`)^*@A+*~LV@W#X[{k,;l.:m-_w|<> 2" 3#6&$7/%8({&9)}'0=('?`)^*\|@[A+*]V@W#X~k,;l.:m-_|<> \|1!2" 3#!4$"5%#6&$7_%8({&9)}'0'`(/?) *<>@A*~NsSV+WX@dzZexXfcCjmMk,;l.:m-=w }][ 1!2" 3#!4$"5%#6&$7_%8({&9)}'0'`(/?\) *@@A*|~NsSV+WX<>^dzZexXfcCjmMk,;l.:m-=}][ ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?)\*'*`@ALVWX|k,;l.:m-_w}<> 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}(+?)\*|@AVWX'*`k,;l.:m-_}<> ]}2"@ 3#!4$#6&$7/%8(&9)\'0=|('?`)*^@*+A~LVWX[{k,;l.:m-_w}<> 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}('?`)*\|@+*AVWXk,;l.:m-_}<> ]}2"@ 3#"5%#6&$7/%8(&9)\'0=|('?`)*>oO@^A+*~LMaAVWX[{k,;l.:m-_w}<> 1!|2"@ 3#!4$^"5%~#6&$7/%8(&9)'0=('?`)*\@[A+*]VW{X}k,;l.:m-_}<> ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?\)*'*`@AC LVWXk,;l.:m-_w|<>|)'`A^~ ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?\)*@AC LVWX'*`k,;l.:m-_w|<>| >}1+!2"@ 3*#!4"5%~#6&$7/|%8(&9)\'0=^('?`)*$;z@AC LVWX<{dyjmMk,;l.:m-_w|][\ 1+|2"@ 3*#!4^"5%~#6&$7/%8(&9)'0=`('?)*$;z@[A!]VW{X$}dyk,;l.:m-_|<>\ >}1+!2"@ 3*#!4"5%~#6&$7/|%8(&9)\'0=^('?`)*$;z@AC LVWX<{dyjmMk,;l.:m-_w|][\ 1+|2"@ 3*#!4^"5%~#6&$7/%8(&9)'0=`('?)*$;z@[A!]VW{X$}dyk,;l.:m-_|<>\1!|!3#(-_C 2" 3*`W'@X#~|\|2"#6&$7'%8(&9)'0(-=)^~*|@@`A[{V;+W:*X]}|\_+" `+$T+'pO+&: V+-`+$M+(j+) L++zP+,b+0pb+1 O+/&  +/+3L+"N+(L+& O+.Z+%C+)N,+3i+* J+,K+-FU+14U+2 O+/  +/+3h        !!(zsms"!"mouse%s: input overrun zstty flags 0x%x input output: console%skeyboardmouse: %s zstty_attachzs_shutdown: not enabled?%s: device enable failed zsopen%s: %d silo overflow%s, %d ibuf flood%s szskbdkeyboard, flags 0x%xkeyboard-click?true: keyboard, type 5, layout 0x%x: keyboard, type %d, layout 0x%x : failed to set baudrate : failed to set modes : no keyboard %s: %d silo overflow%s, %d ibuf flood%s szskbd_rxsoftmii_attach: phyloc and offloc specifiedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %d!A  !@@@@mii_phy_setmediamii_phy_setmedia: MASTER on wrong mediamiiautnsphy"H"JP"L\+;`DP83840 10/100 PHY: %s, rev. %d nsphyter"M"N">+<+;+;DP83847 10/100 PHYDP83843 10/100 PHYDP83815 10/100 PHY: %s, rev. %d gentbi"Q"R">: Generic ten-bit interface, rev. %d qsphy"U$"V`"X`Q+<QS6612 10/100 PHY: %s, rev. %d lxtphy"Y|"Z"\ "Y|"Ep"\ += +=LXT971 10/100 PHYLXT970 10/100 PHY: %s, rev. %d luphy"]("Ep">` +=xLU6612 10/100 PHY: %s, rev. %d tqphy"^"` ">9+=78Q2120 10/100 PHY: %s, rev. %d ukphy"b"Ep">: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present bmtphy"d"e"g@+?+?6+?p!+?X(+?@3+?(+?2+>BCM5222 Dual 10/100 PHYBCM5221 100baseTX PHYBCM5220 10/100 PHYBCM5214 Quad 10/100 PHYBCM5201 10/100 PHYBCM4401 10/100baseTX PHY3C905C internal PHY3C905B internal PHY: %s, rev. %d scxsplscsiplugscsi_iopool_destroy: scsi_iohandler on poolunexpected opening returnedscsi_ioh_add: unexpected state %uscsi_ioh_del: unexpected state %uscsiiomvunexpected xsh state %uscsi_xfer pool exhausted! scsi_link_shutdown: scsi_xshandler on linkscsi_link_shutdown: scsi_xshandler on poolpendxsxs->cookie != NULL in scsi_xs_syncxs->done != NULL in scsi_xs_syncsyncxsscsi_done called twice on xs(%p)unknown error category (0x%x) from scsi driver scbusy%s(%s:%d:%d): probeReservedMiscompare ErrorVolume OverflowEqual ErrorAborted CommandCopy AbortedVendor UniqueBlank CheckWrite ProtectedUnit AttentionIllegal RequestHardware ErrorMedia ErrorNot ReadySoft ErrorNo Additional Sense++++h+@+(+++++h+@+(++++++h+P+8++++++P+++++P+  + + +p +0++++p+H+ ++++ +h +P +8 + + + + + + + +X +0 + + + + +x +X +8 + + + + +X +8 + + + +++`+@+(++++++p+X+8+  + + + + +p+@+ +++++h+@+ ++++++X+8++++++X+0+++++P+ ++++X +(++++x+X+0++++++X+8++++++x+`+@ + + + + +p +` +0 + + + + +`!+8!+ !+"+$+$+$+`$+`$+x$+X$+@$+ %+&+&+&+&+&+X&+@&+ &+&+& +& +& +h& +0& +&+'+B'+'+'+x'+X'+@'+ (+(+)+)+x)+`)+8)+ )+)+)+*+*+*+p*+X*+@*+(*+*+++,+,+`,+0,+,+,+,+,+,+p, +H, +-+.+/+0+0+`0+00+0+~0+~0+~0+~p0+~@0 +~0 +}0+}1+}1+}2+}2+}h3+}P4+}85+}5+|5+|5+|5+|6+|h7+|P8+|08+|8+{8+{9+{:+{:+{p:+{P:+{0:+z;+z;+z;+z;+zH;+z8;+z(;+z;+y;+y; +y; +y; +yx; +yP; +y0;+y;+x;+x;+x;+x;+x;+xh;+x@=+x>+w>+w>+w>+w>+wh?+w8?+w ?+w?+v?+v?+v?+vx?+vX?+v8? +v(? +v? +u? +u? +u?+u?+u?+ux?+uP@+u0A+uB+tC+tD+tE+tF+tpG+tXG+t8G+tG+sG+sG+sG+sXH+s(I+sJ+rK+rK+rK+rK+rK+rxK+r`K+r@L+rN+qP+qP+qP+qQ+qQ+qPR+q@S+q S+qS+pT+pU+pU+pU+phU+pPU+p(U+pU+oW+oX+oY+oZ+oXZ+o0Z+oZ+n[+n[+n[+n[+n\+nx\+n`\+n@]+n]+m]+m]+mx]+m@]+m]+l]+l]+l`]+l(]+k]+k]+k]+kX]+k ]+j]+j] +jx]!+j@]"+j]#+i]$+i]%+i`]&+i(]'+h](+h])+h]*+hH]++h],+g]0+g]1+gP]2+g]3+f]4+f]5+fp]6+f0]7+e]8+e]9+e]:+eP];+e]<+d]@+d]A+dh]B+d0]C+c]D+c]E+c]F+cX]G+c(]H+b]I+b]J+b]K+bh]L+b0]P+a]Q+a]R+a]S+aP]T+a]U+`]V+`]W+`]X+`P]Y+`]Z+_][+_]\+_]`+_H]a+_]b+^]c+^]d+^h]e+^0]f+]]g+]]h+]]i+]`]j+](]k+\]l+\]+\^+\p^+\H^+\ ^+[^+[^A+[^B+[^C+[p^E+[P^G+[(`+[a+[a+Za+Zb+Zc+Zc+Z`d+Z@d+Z(e+Zf+Yf+Yf+Yf+Yhg+YPg+Y g+Yg+Xg+Xg+Xg+Xxg+XXg+X@g +X g +Wh+Wi+Wi+Wi+Wj+W`k+W@k+W k+Wl+Vm+Vn+Vo+V`o+V(o+Uo+Uo+Uo+UHq+Ur+Ur+Tr+Tr+Txr+THr+T s+Ts+Ss+Ss+Ss+Sxs+SXs+S@RMA/PMA Is Almost FullProgram Memory Area Is FullProgram Memory Area Update FailurePower Calibration Area ErrorPower Calibration Area Is FullPower Calibration Area Almost FullCD Control ErrorNo More Track Reservations AllowedEmpty Or Partially Written Reserved TrackSession Fixation Error - Incomplete Track In SessionSession Fixation Error Writing Lead-OutSession Fixation Error Writing Lead-InSession Fixation ErrorDecompression Exception Long Algorithm IDDrive Region Must Be Permanent/Region Reset Count ErrorMedia Region Code Is Mismatched To Logical Unit RegionRead Of Scrambled Sector Without AuthenticationCopy Protection Key Exchange Failure - Key Not EstablishedCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Authentication FailureCommand To Logical Unit FailedRecalculate Failure OccurredRebuild Failure OccurredRedundancy Level Got WorseRedundancy Level Got BetterState Change Has OccurredInformational, Refer To LogParity/Data MismatchMultiple Logical Unit FailuresData Loss On Logical UnitLogical Unit Not ConfiguredSet Target Port Groups Command FailedMultiply Assigned Logical UnitAssign Failure OccurredCreation Of Logical Unit FailedAttachment Of Logical Unit FailedRemove Of Logical Unit FailedExchange Of Logical Unit FailedModification Of Logical Unit FailedAdd Logical Unit FailedConfiguration Of Incapable Logical Units FailedConfiguration FailureDocument Miss Feed Automatic In Document FeederDocument Jam In Automatic Document FeederAutomatic Document Feeder Lift UpAutomatic Document Feeder Cover UpVoltage FaultInvalid Packet SizeIllegal Mode For This TrackPacket Does Not Fit In Available SpaceEnd Of User Area Encountered On This TrackScan Head Positioning ErrorOut Of FocusUnable To Acquire VideoVideo Acquisition ErrorLamp FailurePower State Change To Device ControlPower State Change To SleepPower State Change To StandbyPower State Change To IdlePower State Change To ActiveStandby Condition Activated By CommandIdle Condition Activated By CommandStandby Condition Activated By TimerIdle Condition Activated By TimerLow Power Condition OnFailure Prediction Threshold Exceeded (false)Firmware Impending Failure Drive Calibration Retry CountFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Controller DetectedFirmware Impending Failure Channel ParametricsFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Access Times Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Calibration Retry CountSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Controller DetectedSpindle Impending Failure Channel ParametricsSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Access Times Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure General Hard Drive FailureServo Impending Failure Drive Calibration Retry CountServo Impending Failure Spin-Up Retry CountServo Impending Failure Seek Time PerformanceServo Impending Failure Throughput PerformanceServo Impending Failure Controller DetectedServo Impending Failure Channel ParametricsServo Impending Failure Start Unit Times Too HighServo Impending Failure Access Times Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Seek Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Drive Error Rate Too HighServo Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Calibration Retry CountData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Controller DetectedData Channel Impending Failure Channel ParametricsData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Access Times Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure General Hard Drive FailureController Impending Failure Drive Calibration Retry CountController Impending Failure Spin-Up Retry CountController Impending Failure Seek Time PerformanceController Impending Failure Throughput PerformanceController Impending Failure Controller DetectedController Impending Failure Channel ParametricsController Impending Failure Start Unit Times Too HighController Impending Failure Access Times Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Seek Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Drive Error Rate Too HighController Impending Failure General Hard Drive FailureHardware Impending Failure Drive Calibration Retry CountHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Seek Time PerformanceHardware Impending Failure Throughput PerformanceHardware Impending Failure Controller DetectedHardware Impending Failure Channel ParametricsHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Access Times Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure General Hard Drive FailureSpare Area Exhaustion Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededFailure Prediction Threshold ExceededSpindles Not SynchronizedSpindles SynchronizedRPL Status ChangeLog List Codes ExhaustedLog Counter At MaximumThreshold Condition MetLog ExceptionOperator Selected Write PermitOperator Selected Write ProtectOperator Medium Removal RequestedOperator Request or State Change InputUpdated Block ReadGeneration Does Not ExistUnable To Recover Table-Of-ContentsAuxiliary Memory Out Of SpaceInsufficient Access Control ResourcesInsufficient Registration ResourcesInsufficient ResourcesInsufficient Reservation ResourcesSystem Buffer FullSystem Resource FailureSCSI To Host System Interface FailureMedium Removal PreventedUnload Tape FailureMedia Load or Eject FailedCartridge FaultErase Failure - Incomplete Erase Operation DetectedErase FailurePosition Error Related To TimingWrite Append Position ErrorWrite Append ErrorOverlapped Commands AttemptedLogical Unit Failed Self-ConfigurationInitiator Response TimeoutData Offset ErrorNAK ReceivedACK/NAK TimeoutToo Much Write DataInvalid Target Port Transfer Tag ReceivedData Phase ErrorCommand Phase ErrorInvalid Message ErrorInitiator Detected Error Message ReceivedSome Commands Cleared By iSCSI Protocol EventProtocol Service CRC ErrorAsynchronous Information Protection Error DetectedInformation Unit iuCRC Error DetectedSCSI Parity Error Detected During ST Data PhaseData Phase CRC Error DetectedSCSI Parity ErrorUnsuccessful Soft ResetSelect Or Reselect FailureInternal Target FailureMessage ErrorPower-On or Self-Test FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)RAM FAILURE (Should Use 40 NN)Medium Auxiliary Memory AccessibleMedium LoadableEcho Buffer OverwrittenReported LUNs Data Has ChangedVolume Set ReassignedVolume Set DeassignedVolume Set DeletedVolume Set Created Or ModifiedSpare DeletedSpare Created Or ModifiedRedundancy Group DeletedRedundancy Group Created Or ModifiedDevice Identifier Changedcomponent Device AttachedINQUIRY Data Has ChangedChanged Operating DefinitionMicrocode Has ChangedTarget Operating Conditions Have ChangedLogical Unit Unable To Update Self-Test LogLogical Unit Failed Self-TestTimeout On Logical UnitLogical Unit FailureLogical Unit Has Not Self-Configured YetInvalid Bits In IDENTIFY MessageMechanical Positioning Or Changer ErrorMedium Magazine UnlockedMedium Magazine LockedMedium Magazine InsertedMedium Magazine RemovedMedium Magazine Not AccessibleEnd Of Medium ReachedMedium Source Element EmptyMedium Destination Element FullPosition Past Beginning Of MediumPosition Past End Of MediumRead Past Beginning Of MediumRead Past End Of MediumReposition ErrorFailed To Sense Bottom-Of-FormFailed To Sense Top-Of-FormPaper JamSlew FailureTape or Electronic Vertical Forms Unit Not ReadyTape Position Error At End-of-MediumTape Position Error At Beginning-of-MediumSequential Positioning ErrorMedium Not Present - Medium Auxiliary Memory AccessibleMedium Not Present - LoadableMedium Not Present - Tray OpenMedium Not Present - Tray ClosedMedium Not PresentSaving Parameters Not SupportedESN - Device Busy Class EventESN - Media Class EventESN - Power Management Class EventEvent Status NotificationRounded ParameterRibbon, Ink, or Toner FailureEnclosure Services Transfer RefusedEnclosure Services Transfer FailureEnclosure Services UnavailableUnsupported Enclosure FunctionEnclosure Services FailureEnclosure FailureTape Length ErrorDefect List Update FailureNo Defect Spare Location AvailableFormat Command FailedMedium Format CorruptedMedium Not FormattedCleaning Request RejectedCurrent Session Not Fixated For AppendCannot Write - Application Code MismatchCleaning FailureCannot Format Medium - Incompatible MediumCannot Write Medium - Incompatible FormatCannot Write Medium - Unknown FormatCleaning Cartridge InstalledCannot Read Medium - Incompatible FormatCannot Read Medium - Unknown FormatIncompatible Medium InstalledCommands Cleared By Another InitiatorInsufficient Time For OperationOverwrite Error On Update In PlacePartition Or Collection Contains User ObjectsPrevious Reservation Conflict StatusPrevious Task Set Full StatusPrevious Busy StatusPersistent Prevent ConflictIllegal Power Condition RequestCurrent Program Area Is EmptyCurrent Program Area Is Not EmptyInvalid Combination of Windows SpecifiedToo Many Windows SpecifiedCommand Sequence ErrorCopy Cannot Execute Since Host Cannot DisconnectImplicit Asymmetric Access State Transition FailedAsymmetric Access State ChangedRegistrations PreemptedReservations ReleasedReservations PreemptedLog Parameters ChangedMode Parameters ChangedParameters ChangedI_T Nexus Loss OccurredTransceiver Mode Changed to LVDTransceiver Mode Changed to Single EndedDevice Internal ResetBus Device Reset Function OccurredSCSI Bus Reset OccurredPower On OccurredPower On, Reset, or Bus Device Reset OccurredImport Or Export Element AccessedNot Ready To Ready Transition (Medium May Have Changed)Conditional Write ProtectPermanent Write ProtectPersistent Write ProtectAssociated Write ProtectLogical Unit Software Write ProtectedHardware Write ProtectedInvalid Parameter While Port Is EnabledCopy Segment Granularity ViolationInvalid Operation For Copy Source Or DestinationInline Data Length ExceededUnexpected Inexact SegmentUnsupported Segment Descriptor Type CodeToo Many Segment DescriptorsUnsupported Target Descriptor Type CodeToo Many Target DescriptorsData Decryption ErrorInvalid Release Of Persistent ReservationThreshold Parameters Not SupportedParameter Value InvalidParameter Not SupportedInvalid Field In Parameter ListLogical Unit Not SupportedNonce Timestamp Out Of RangeNonce Not UniqueSecurity Working Key FrozenSecurity Audit Value FrozenCDB Decryption ErrorIllegal Field in CDBIllegal Function (Should 20 00, 24 00, or 26 00)Invalid Address For WriteInvalid Element AddressLogical Block Address Out of RangeAccess Denied - ACL LUN ConflictAccess Denied - Invalid Proxy TokenAccess Denied - Invalid LU IdentifierAccess Denied - Enrollment ConflictIllegal Command While In Implicit Address ModeIllegal Command While In Explicit Address ModeObsoleteIllegal Command While In Write Capable StateAccess Denied - Invalid Mgmt ID KeyAccess Denied - No Access rightsAccess Denied - Initiator Pending-EnrolledInvalid Command Operation CodePartial Defect List TransferRecovered ID with ECCMiscompare During Verify OperationGrown Defect List Not FoundPrimary Defect List Not FoundDefect List Not FoundSynchronous Data Transfer ErrorParameter List Length ErrorDefect List Error in Grown ListDefect List Error in Primary ListDefect List Not AvailableDefect List ErrorRecovered Data With LinkingRecovered Data With ECC - Data RewrittenRecovered Data - Recommend RewriteRecovered Data - Recommend ReassignmentRecovered Data With L-ECRecovered Data With CIRCRecovered Data - Data Auto-ReallocatedRecovered Data With Error Correction & Retries AppliedRecovered Data With Error Correction AppliedRecovered Data Without ECC - Data RewrittenRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Using Previous Sector IDRecovered Data With Retries and/or CIRC AppliedRecovered Data With Negative Head OffsetRecovered Data With Positive Head OffsetRecovered Data With RetriesRecovered Data With No Error Correction AppliedData Sync Error - Recommend ReassignmentData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend RewriteData Sync Error - Data RewrittenData Synchronization Mark ErrorPositioning Error Detected By Read of MediumMechanical Positioning ErrorRandom Positioning ErrorLocate Operation FailureRecord Not Found - Data Auto-ReallocatedRecord Not Found - Recommend ReassignmentBlock Sequence ErrorEnd-Of-Data Not FoundFilemark or Setmark Not FoundRecord Not FoundRecorded Entity Not FoundAddress Mark Not Found for Data FieldAddress Mark Not Found for ID FieldRead Error - Failed Retransmission RequestAuxiliary Memory Read ErrorRead Error - Loss Of StreamingError Reading ISRC NumberError Reading UPC/EAN NumberCannot Decompress Using Declared AlgorithmDe-Compression CRC ErrorUncorrected Read Error - Recommend Rewrite The DataUncorrected Read Error - Recommend ReassignmentMiscorrected ErrorNo Gap FoundIncomplete Block ReadData Resynchronization ErrorCIRC Unrecovered ErrorL-EC Uncorrectable ErrorUnrecovered Read Error - Auto Reallocate FailedMultiple Read ErrorsError Too Long To CorrectRead Retries ExhaustedUnrecovered Read ErrorID CRC Or ECC ErrorInformation Unit Too LongInformation Unit Too ShortInvalid Information UnitCopy Target Device Data OverrunCopy Target Device Data UnderrunIncorrect Copy Target Device TypeCopy Target Device Not ReachableThird Party Device FailureError Detected By Third Party Temporary InitiatorWrite Error - Not Enough Unsolicited DataWrite Error - Unexpected Unsolicited DataAuxiliary Memory Write ErrorWrite Error - Padding Blocks AddedWrite Error - Loss Of StreamingWrite Error - Recovery FailedWrite Error - Recovery NeededBlock Not CompressibleData Expansion Occurred During CompressionCompression Check Miscompare ErrorWrite Error - Recommend ReassignmentWrite Error - Auto Reallocate FailedWrite Error Recovered with Auto ReallocationWrite ErrorWarning - Enclosure DegradedWarning - Specified Temperature ExceededWarningError Log OverflowHead Select FaultSpindle Servo FailureFocus Servo FailureTracking Servo FailureTrack Following ErrorUnreachable Copy TargetLogical Unit Communication CRC Error (ULTRA-DMA/32)Logical Unit Communication Parity ErrorLogical Unit Communication TimeoutLogical Unit Communication FailureMultiple Peripheral Devices SelectedNo Reference Position FoundLogical Unit Does Not Respond To SelectionLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Initialization Command RequiredLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Cause Not ReportableExcessive Write ErrorsNo Write CurrentPeripheral Device Write FaultNo Seek CompleteNo Index/Sector SignalVerify Operation In ProgressSet Capacity Operation In ProgressRewind Operation In ProgressLocate Operation In ProgressErase Operation In ProgressCleaning RequestedOperation In ProgressNo Current Audio Status To ReturnAudio Play Operation Stopped Due to ErrorAudio Play Operation Successfully CompletedAudio Play Operation PausedAudio Play Operation In ProgressI/O Process TerminatedEnd-Of-Data DetectedBeginning-Of-Partition/Medium DetectedSetmark DetectedEnd-Of-Partition/Medium DetectedFilemark DetectedNo Additional Sense InformationDiagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02x%sCheck Condition (error %#x) on opcode 0x%x DEFERRED AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO: 0x%x (VALID flag %s) onoff COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Error in %s, Offset %dCDBParameters, bit %dActual Retry Count: %dProgress Indicator: %dscsi_cmd_rw_decode: bad opcode 0x%02xXS_SHORTSENSE scsi_do_ioctl: impossible cmd (%#lx)scsibusscsibus at %s: %d targets, initiator %d, WWPN %016llx, WWNN %016llx %s: unable to register bio diagnostic ../../../../scsi/scsiconf.cSLIST_EMPTY(&sb->sc_link)+++++++++++h+`+P+H++8+0++(+ ++8+++8+++++++++++++++++++++(+++p+X+P+@+(+ +@+++@+++++++++++++++x++p+x++h+P++H+8++p+(++p++++++++++++ 1.14UJDCD87301.25CD-ROM CDR-N161.70CD-ROM CDR-S11.08SANYO CRD-S54PSANYO CRD-254PSANYO CRD-256P1.0gMemorex CRW-26421.061.02MATSHITA CR-5741.00GCD-R580Bq01FX320SAC101CREATIVECD3630E1.07CR-2801TE02.2Model 3200 01.7Model 2600 02.4Model 1300 WangDAT 3.SDT-5000 SONY DCASC3725SHP0002ST150176LWSEAGATE4421-07MICROPjaz 1GBiomegaELS85S QUANTUM DFRSS2FKZ-CH3171-S20664IBM0663HIBM 0662SIBMRAID A00MD21/S2 ESDIEMULEX RZ55 (C) DECDEC 1588-15MBSUN0669MICROP 1.01CD-ROM PX-40TSPLEXTOR offlinescsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUvendor-uniquedirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEunknown targ %d lun %d: <%s, %s, %s> ATAPISCSI%d %d/%s %s%sremovablefixedscsibus_printlink%s not configured scsi_probedevscsi_devidcd+++++++++++++h++NEC CD-ROM DRIVE:260 cdioctlATAPI CD-ROMSCSI CD-ROMfictitiousdvd_authdvd_read_physicaldvd_read_copyrightdvd_read_bcach+@+@+@02009000SPECTRA sd++++++++++++++++++ %s: %lldMB, %lu bytes/sec, %lld sec totaldrive offlinesdattach: unknown result (%#x) from get_parms%s: WARNING: unable to establish shutdown hook (unknown)sd_ioctl_inquirySCSI opticalSCSI disk%s %ssdgetdisklabel+X+@+8+(+++(++++++++++x+++`+++H++8+(++8+++8+++++++++++E+8+h+`+P+8+MT-2ST/N50 TEAC ????5150ES SCSI FA1501 AT4000s HP 263HEXB-8200 EXABYTE Model 1300 WangDAT 5525ES SCSI REV75150ES SCSI5099ES SCSIWANGTEK VIPER 150 21531VIPER 150 21247DMT780 ANRITSU CP525 SANKYO VIPER 2525 25462ARCHIVE TDC 3800 TDC 3600 TANDBERG st+++ %s: cannot set selected mode %s: bad request, must be multiple of %d %s: bad request, must be between %d and %d %s: bad residual %d out of %d %s: block wrong size, %d blocks residual uk safteSAF-TEsafte_match %s: unable to read enclosure configuration %s: unable to register update task %s: unable to register ioctl with bio Fan%dPSU%ddoorlockalarmsafte_read_configsesDell %s: unable to read enclosure configuration %s: unable to register update task %s: unable to register ioctl ses_attachPSUFan%s: error in sensor data dmaledma%s at %s offset 0x%xespdmacable-selectiontpeauiburst-sizes: rev 0esc11+2fasunknown (0x%x) nameesp%s: line %d: CSR = 0x%lx ../../../../arch/sparc/dev/dma.cR_PEND%s: start %d@%p,%d dma_setup: dmasize = %d dma: cannot allocate DVMA address%s: intr: addr %p, csr %b INTERRDR1DR2IENSLVERRRST WRITE ENDMAENCNTTCDSBL_CSR_DRNDSBL_SCSI_DRNTWOCYCLEFASTERTCIDISENNXTDMAONALOADEDNALOADED%s: error: csr=%b dmaintr: DMA wasn't activeDRAININGdmaintr: discarded %d bytes (tcl=%d, tcm=%d) dmaintr: empty esp FIFO of %d dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d lebuffer%s at %s offset 0x%xburst-sizes: %dK memory nameqec%s at %s offset 0x%x#channels: no channels : invalid number of channels: %d burst-sizes: %dK memory %d channel%ss nameranges%s: PROM ranges too large: %d %s: reset failed. be: expected 1 interrupt, got %d board-versionchannel#burst-sizes pri %d: rev %x address %s %s: device timeout %s:%s qstat=%b unexpectedRXSRXPRXLRXSMALLRXDROPRXTXSTXPTXLTXDTX BE%s: resetting %s:%s stat=%b RXRCNTACNTCCNTLCNTRFIFOCVCNT TX TFIFO TMAXPKT NCNT ECNTLCCNTECNTDTIME%s: rev %d PAL not supported. %s: no internal or external transceiver found. %s: invalid tcvr type %s: invalid packet size %d; dropping %s: bmcr reset failed %s: bmcr unisolate failed qe: no interrupt found on parent mace-versionchannel# pri %d: rev %x address %s %s: device timeout %s: excessive tx defers. %s: excessive tx retries %s: late tx transmission %s: tx fifo underflow %s: jabber seen %s: babble seen %s: tx descriptor is bad %s: tx late error %s: tx dma parity error %s: tx dma sbus error ack %s: rx fifo overflow %s: rx late collision %s: rx packet dropped %s: rx buffer too small %s: rx late error %s: rx dma parity error %s: rx dma sbus error ack %s: unexpected interrupt error: %08x %s: resetting... %s: invalid packet size %d; dropping network: no interrupt : only %d register sets : can't map registers local-mac-addressSUNW,vge: no interrupt : only %d register sets : can't map registers hmeSUNW,hmeSUNW,qfe: expected 1 interrupt, got %d : expected 5 registers, got %d hm-revburst-sizeslocal-mac-address pri %d: address %s rev %d qfe%s: stop failed %s: device timeout %s: burst size unknown %s: setting rxreg->cfg failed. %s: reset tx failed %s: reset rx failed %s: link status changed %s: stat=%b, resetting. RXRCNTACNTCCNTLCNTRFIFOCVCNTSTST TX TFIFO MAXPKT NCNT ECNTLCCNTFCNTDTIMERXHOSTNORXDRXEEXLATERXPRXTEOPMIFTXHOSTTXALLTXETXLTXPTXTSLV SLVP%s: invalid packet size %d; dropping %s: mii_write failed %s: mii_read failed SUNW,fasptscII: expected 1 interrupt, got %d pri %dinitiator-idclock-frequency: expected 2 register spaces, found %d : could not allocate dma softc : can't map DMA registers burst-sizes: can't map SCSI core registers dma espattach: no dma foundespaudioamd|QEB;632*+,%#"""-+2LCBCA;;=43422$1*{*+#+,B.#%$+$#""A"#"3J!2,b2q"4R#z5& *c  # 3   > L!|"3"B2'"R:31,#"bQB;32*,%#"!  C3@DA1U BA` Br!" audio: expected 1 interrupt, got %d pri %d, softpri %d mulawmicvolumespkrhpmonitorsourceoutputinputsoutputsrecordaudiocsSUNW,CS4231: expected 1 interrupt, got %d : expected 1 register set, got %d burst-sizes pri %d %s: error interrupt %s: timeout waiting for reset mulawalawslinear_leulinearslinear_beslinearulinear_leulinear_beadpcm%s: timeout committing fspb %s: timeout committing cdf %s: timeout waiting for !mce %s: timeout waiting for autocalibration micvolumedaclinecdmonitoroutputmuteonoffrecordsourcespkrhpinputsoutputs%s: attempt to free rogue pointer cs4231_trigger_output: already running cs4231_trigger_output: bad addr: %p %s: trigger_input: already running %s: trigger_input: bad addr: %p depthwidthheightlinebytesstdscreen-#rowsscreen-#columns' char-height >body >user %lx ! ' char-width >body >user %lx !stdout @ is my-self addr char-height %lx ! addr char-width %lx !stdout @ is my-self addr window-top %lx ! addr window-left %lx !fb_get_console_metricswsdisplaydiagnostic ../../../../dev/wscons/wsdisplay.cscrdata->nscreens > 0%s: screen %d-%d added (%s, %s emulation) wsdisplay_forceclose: bad screen%s: screen %d deleted wsdisplay at %sdmuxwsdisplay_common_attach: no memory mux %dwsdisplay_console_inittedwsdisplay_console_device == NULL: console (%s, %s emulation), using %s !wsdisplay_console_inittedtype->nrows > 0type->ncols > 0crow < type->nrowsccol < type->ncolswsdisplaytty() on ctl devicewsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsrestorewswaitwsmoused_sleep   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000%s: couldn't allocate copy buffer wsevent_init: already initialized wsevent_fini: already invoked wsevent_readwskbdwskbd at %s mux %dcannot load keymapdiagnostic ../../../../dev/wscons/wskbd.cwskbd_console_inittedwskbd_console_device == NULL: console keyboard, using %s %s: attach error=%d !wskbd_console_inittedwskbd_console_device == scwskdetwskbd_detach: %s didn't detach wskbd_input: evar->q=NULL %s: event queue overflow wskbdread: evp == NULL %s: connecting to %s %s: disconnecting from %s ABCDEFGHIJKLMNOPQRSTUVWXYZwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmousewsmouse at %s attach error=%d mux %d wsmdetwsmouse_detach: %s didn't detach wsmouse_input: evar->q=NULL diagnostic ../../../../dev/wscons/wsmouse.cev->value >= 0wsmouseread: evp == NULL wsmux_getmux: no memory for mux %d wsmuxwsmux: attach out of memory wsmux_mux_open: busy wsmux_mux_open: no parent wsmuxopen: dev already in use wsmux_do_open: bad child=%p wsmuxclose: bad child=%p wsmuxread: not open wsmux_do_ioctl: bad child %p wsmuxpoll: not open %s%dwsmux_attach_sc: busy wsmux_detach_sc: %s has no parent wsmux_displayioctl: bad child %p wsmux_set_display: bad child parent %p sun$4$$$$$diagnostic ../../../../dev/wscons/wsemul_sun.cedp->console == 1wsemul_sun_output_lowchars: ESC in kernel output ignored wsemul_sun_output: kernel output, not consolewsemul_sun: invalid state %d888rasops_init: font table is empty rasops_init: couldn't lock font rasops_init: fontwidth assumptions botched!rasops_mapchar: no font selected????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? @ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?wsfont_unlock: font not lockedagtenPFU,agamodel: model %si128_fb_physaddri128_fb_sizep9100_reg_physaddrffb_depthffb_widthffb_height, %dx%d, depth %d bwtwo: p4model%s, %dx%d cgeight: p4, %dx%dcgfour: p4, %dx%d cgfourteen pri %d: expected %x bytes of control registers, got %x expected %d registers, got %d expected 1 interrupt, got %d model%s, %dMB, rev %d.%d, %dx%d cgsixSUNW,cgsix pri %d: p4model%s, %dx%d, rev %d cgthreecgRDI pri %d: model%s, %dx%d cgtwelve: %smodeldev_id (%s) %s: %dx%ducoderev, microcode rev. %scgtwo: %dx%d cgtwo_getcmapcgtwo_putcmapmgxSMSI,mgx: %smodel %s: expected %d registers, got %d fb_size %s: expected at least %d bytes of vram, but card only provides %d , %dx%d %s: unexpected engine id %04x pninekp9000 pri %d: expected %d registers, got only %d : bt445 did not attach previously : rev %x, %dx%d btchambt445: id 0x%x, revision 0x%x pnozzp9100 pri %d: expected %d registers, got only %d : rev %x, %dx%d stdout @ is my-self addr char-height %lx ! addr char-width %lx ! addr font-base %lx ! addr fontbytes %lx !p9100_romfontp9100_pick_romfontpqrs   $(,0#Sqn|uqn/C"c ]""%##rfxRasterFLEXRasterFLEX-TV: %s %s: no SBus registers! configuration, unknown %d bytes conf. structure, revision %d, %dx%d rfx_putcmap%Xh%XtcxSUNW,tcx pri %d: expected %d registers, got %d model%s, tcx-8-bit%dx%dx%d blit-widthstipple-alignstip-roptvtwoPGI,tvtwoPGI,tvthree: %smodelrevision, revision %sfreqcodehresvres, %dx%d vigravs10vs11vs12 pri %d %s: expected %d registers, got %dmodel: %sVIGRA,vs11, %dx%d zxSUNW,leomodel: %swidthheight, %dx%d %s: zx_cross_wait: timed out %s: lost carrier on UTP port, switching to AUI port %s: lost carrier on AUI port, switching to UTP port sbuslebufferledma: expected 1 interrupt, got %d pri %dbusmaster-regvalif_le: Lance buffer crosses 16MB boundaryUnknown3e/vmeonboardmultibus/vmeieie_mapie kmem_allocunaligned dvmamalloc breaksie pmap_extractunknown : RAM CONFIG FAILED! pri %d address %s, type %s %s: device timeout %s: parity error (ctrl 0x%x @ 0x%02x%04x) %s: receiver not ready ietint: command still busy! %s: receive descriptors out of sync at %d %s: tbuf overflow %s: reset %s: abort commands timed out %s: disable commands timed out %s: TDR command failed %s: TDR detected an open %d clocks away %s: TDR detected a short %d clocks away %s: TDR returned unknown status 0x%x ie: bogus buffer calc%s: multicast address setup command failed %s: configure command failed %s: individual address setup command failed xdcxdxddummystrat%s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) pri %dxdc malloc: couldn't read controller params : %s: : doesn't identify as a 753/7053 : Xylogics 753/7053, PROM=0x%x.%02x.%02x %s: controller config error: %s xdattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: write format parameters failed: %s %s: read drive parameters failed: %s %s: write drive parameters failed: %s %s: reading disk label failed: %s %s: <%s>, pcyl %d, hw_spt %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: write real drive parameters failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! %s%c: crash dump not supported (yet) xdnfreexdsubwaitxdcmd nfreexdc_startbuf freexdc_startbuf bp%s: warning: out of DVMA space xdiorqxdc_submit_iorq addingxdc_submit_iorq wrap upxdc_submit_iorq%s: off-line: %s xdc_reset%s: soft reset %s: diag: xdc_reset miscount (%d should be %d)! %s: diag: lots of done jobs (%d) RESET DONE xdc_start%s: fatal error 0x%02x: %s %s: soft reset failed! xdc_remove_iorq: controller DEAD%s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries] %s: diag: IOPB miscount (got w/f/r/d %d/%d/%d/%d, wanted %d) FREE: %d WAIT: MARK: running %d: mode %d done %d errs %d errno 0x%x ttl %d buf %p %s: watchdog timeout xdc_tickSoftware fatal errorSuccessful completionIllegal cylinder addressIllegal head addressIllgal sector addressCount zeroUnimplemented commandIllegal field length 1Illegal field length 2Illegal field length 3Illegal field length 4Illegal field length 5Illegal field length 6Illegal field length 7Illegal scatter/gather lengthNot enough sectors per trackNext IOPB address alignment errorScatter/gather address alignment errorScatter/gather with auto-ECCSoft ECC correctedECC ignoredAuto-seek retry recoveredSoft retry recoveredHard data ECCHeader not foundDrive not readyOperation timeoutVMEDMA timeoutDisk sequencer errorHeader ECC errorRead verifyFatal VMEDMA errorVMEbus errorDrive faultedHeader error/cylinderHeader error/headDrive not on-cylinderSeek errorIllegal sector sizeSoft ECCWrite-protect errorIRAM self test failureMaintenance test 3 failure (DSKCEL RAM)Maintenance test 4 failure (header shift reg)Maintenance test 5 failure (VMEDMA regs)Maintenance test 6 failure (REGCEL chip)Maintenance test 7 failure (buffer parity)Maintenance test 8 failure (disk FIFO)IOPB checksum miscompareIOPB DMA fatalIOPB address alignment errorFirmware errorIllegal maintenance mode test numberACFAIL assertedUnknown errorxycxyxydummystrat%s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) pri %d%s: can't alloc IOPB mem in 64K xyc malloc: %s: : doesn't identify as a 450/451 : Xylogics 450/451 [OLS disabled] %s: error: %s %s: 24 bit addressing turned off please set hardware jumpers JM1-JM2=in, JM3-JM4=out to enable 24 bit mode and this driver xyattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: reading disk label failed: %s (drive type %d) %s: <%s>, pcyl %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: %s and %s must be the same size! xy drive size mismatch%s: write drive size failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! %s%c: crash dump not supported (yet) xyc_cmd%s: stole control iopb xyc_startbuf null buf%s: warning: out of DVMA space xyiorqxyc_submit_iorq: stuck xyc%s: stole controller xyc_submit_iorq addingxyc_submit_iorq: xyc_chain failed!xyc_submit_iorq wrap upxyc_submit_iorq%s: off-line: %s xyc_reset%s: soft reset %s: DOUBLE ERROR! %s: soft reset failed! xyc_remove_iorq: controller DEAD%s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries]%s: watchdog timeout Software fatal errorDOUBLE ERRORSuccessful completionInterrupt pendingBusy conflictOperation timeoutHeader not foundHard ECC errorIllegal cylinder addressIllegal sector addressLast sector too smallSlave ACK error (non-existent memory)Cylinder and head/header errorAuto-seek retry successfulWrite-protect errorUnimplemented commandDrive not readySector count zeroDrive faultedIllegal sector sizeSelf test ASelf test BSelf test CSoft ECC errorSoft ECC error recoveredIllegal headDisk sequencer errorSeek errorUnknown errorsiswsi_attach: impossible bus type 0x%xsi: dma handle malloc failed pri %d si_intr: DMA conflict si_intr: DMA bus error si_dma_alloc: already have DMA handlesi_dma_alloc: xlen=0x%xsi: no free DMA handles.si_dma_alloc: can't remap %p/0x%x, doing PIO si_dma_free: no DMA handlesi_dma_free: free while in progress%s: DMA timeout (while polling) si_dma_start: bad pa=0x%lxsi: DMA error, csr=0x%x, reset si_dma_stop: excess transfer%s: bad outgoing adj, %d != %d %s: bad incoming adj, %d != %d sw: DMA error, csr=0x%x, reset sw: short transfer xA'W COPYRIGHT 1991,1992,1993,1994 QLOGIC CORPORATION ISP1000 Firmware Version 01.37 Customer No. 15 Product No. 00 $   qp \ pISpP p p?p 10 y8xc/   @B bxx xxO 85 xxx i8@h< !xh(hh hhhh#hh' i:  h hhhj-  i;  h? h2h7 h @hhdpx xdx1xGx62 ppxxxxx4xMx22xxxxp  p  z zp@xxVxU 8h!Ux'xx 8o!e@C 8j!!! `xOx> 8o 8i! @S @xx| a`@^|ppppp 8yn.. HW2 &cl{z 8yetrq @xsrq @p a` P @|qxp@x A A Sxppzxxxx ppISpP p p?p yx 10 Y )W Qp ar P @xUqrsp 10@psr Q I] ApO Ik Awpp qWpp@kp   B J &Sxp @kHk&Sxp &Sxqp! rxp%ppxprstprstҠ@xr@xx @xzz{~|vxxxxxxprstprst֠@܀x@xx @xz{|xxxxxx 8Y! rx 8A! x 8B! x a8@a bx 8E! x 8F! x 8G! x 8H! xyz xqā:jh@#kx$k xwxX kj 'x xHF a; `<F<xN   xS{zyx xwxX ijk xqġxxqġ 8A"~!xxq  "@pxxآ~ 8B"!~xxd2K a8@a bp`p`x a8@ap`xq  (@  2@  < a8@`~a#xx6xqġ 8G"!~xxqġ 8H"~!xxqrȡע!yx "z xxqā: rh~&@@@"" j @)@/@@@@@<xx@xx@r̂@rh@r a8@a(@Y2@_<@edHoxiPHoxiCHoqqrxj hhk qxwxX jk phph'x 85" p xqrs̡xxwxX jj 'xwxX jj h@xI 'xwxX jj h@xI 'xw A I Q xe 'jxwrswrsxh@'x x |  @x xww A! I Q xe a8@`g`xxI |wwwwƧ a8@``gxxI  A! I Q xeph>8< |xl 9 A! I QxX h i 8U?8?U ih0@@hK hH@pxyhK hH@px px y8x a8@```xxhh hF |xxx0qqyJ|tsrtsr y8 @x5@x@x>x` x 8h  # " $   , .%0~x1eeff``xI |p@xqpyxqq!hx ii -h p@x!p@pxqrs!!y/F[]_p@qrsxBp@pppwqx 1a&$0$"F3H 1aHx:x:x:UUwxX h0  'xwxX j4 'xw~ rȂxX l0j2 8''$xw~ rxX l4j6 8'$xy`qqġybxy`qxyTqqyVyXqqyZy\qqy^xyTqyXqy\qxp @pppqrs 0` Sx ppqp q p|p @pp pqrs 0x ppp  p 2q 2,Sp|xPe@=,xR c|~ y8xP b,xR| ]zR r@U/  xL | ;|xX)h**h.h i 8O! h@ ``h~ x ~he@`hxxx+'hhx+'ii |e@`` x>!x|`  @h(`h,`|~ q8@p@ʠ8- pB|~ q8@ 8r@!H!Ӂ!tB|xX hxe@/x,x`e@/` `,( 8O @/h` `hhxdx `d,h%`x`` xx+'hh | 9 A! I Q xe8:?8?: |h\ a`\xx]|@cxyeuw}uuuuuuuuxx0 x x xx0 x  8," x  xx0  xp a` @|,`, cxdxfxhyj@,xyn| ~ a8h- k`d`f`haj@-xanx+A |x@ ~`e@x `x>|xle@ xdxf,xnxj |xMytprТ"x@MxhM @xMx5@Mz|{x@! x$ @x@Dx>xxM xxxx xMxx`yN|VeVVVV 9xx``x`xx|x@lxVx`x`@x@xxxx|xxVxx|x@xVxg  `@  @ 9  @xxX- h+h/hh - h pxĂ@ xx>|xm,xx`x,h`x-`x`xxxxx `|.%0a`a@~x1eeff``gxX h@4 x x xxx` ;`"jh HJ@J 9xx, he@RaiVi!``hhxx h@@v@h x~~i0!h2i4i: xI xx|`` x xe@`x`xxx|ypxt xvpx@xh @|h )xle@x@~xą(x@ @| {yrpԢ"# |H | | q p?pr?? q@ x z{ `$@ @x@1xx? xxxx x?xxyx <xp֠ q | 8h ~ y 8@!b 8!bx0bbxD|~ # q8@ y 0^ +#@|x##S3xox xx pxpxpbxxxCxSx pG8pC | " x|  px" |  px¢! |  pxӡ" | "ϡ | ~ a`bc |" ~ a``` |" ~ a`` ` | ~ a``b `c  | ~~h@e a\xm@S a[ ~xm@? `p=x2xe[ q8@p``q` pxDxa q8@``q` pxD xg   |,@ `` ``x`xn| 8A"  ;"@ !!"|~h䠌 @堄`:p q@塌q~aap  @! x x pppp~aa!p |h~ qp. qpppÀ qp @ px~~~ #<~X|0}8?@@|0"x礜P"xy'!"Q"w$''((()bM7 'f7x  |pp?p0@Kp3 p\pyV^l^xx Fx&jpx9x/px~xxx x`xx[ x& ppp38px9x/qx~xxyxx`xx[ x& ppp38px9x/qx~xxyx qyx x`xx[ x& ppp38px9xx/9p hxox/,Phxn A xAx/9xp\ hox/,P`` hx 1 Ax0K x, t@@28 0qD*H) 8!de?!#qFpp?x9v@8qD&x.qF%h%Xu>,P`<p2~ / p"x"hhhh#x-ڠ-y"#"###--#--$$---$x禄@# x:xx9h@#hx/xii#3h#;h#+h@#xXx9@#;xXx9`@#@##Ix#c~Znxtzyx#V?k!hk"h@@#k~Znp#xx1x3exgx9x4jilk"@#""!|{##@~Znxgx9xg"#x3vx9x3x9xjx9xXx9xx$ i@#ši ~pH ````` x#@#i ~pH ````` ,H @#x/ x,X@#x`(x~X~Z#xUx9xix9~X$xXx9xjx9x-x- y@$xx$-#| @$%H$%x$'x#$z$'x$ $#@$=H$=x$#@$hh~X 0~Z`` ~pH `` ,H @$ax/ x-=x$p ~pH `` ,H @#x/ x,X@#x`(x~Z$xUx9xix9zx$#@$H$x$-x-x-x-xx@$xzx-y$-+-,آ$xx-xix9$xx. xix9P$x#y$$%%@$x p:py$$$$''L&$$x禄$x1M@%xh@%W%`` x*@%Wx+x1Mx%>(%Wx1M`` x+4`@%>`@%4@%4`x%>h(hx%`0@%.`` h@AhhpT ~ `h` `h-%T``xA~x&hh'o@%%%t`@%txzh.j*:"%x%" @%h%x&xA@%@Aih@%p8hix+ x+%`` h%x+x%pT `h`xxAH%x"y%%%%%xp@%x-xixjx9xxy@%x-xjx9hh&x-x& @&xx. xix9x/x0&&y||`&&h/h+x&&5hH5&5x1M| @&_xЀ&Cx4xx4y@@&Mh/h+x&2hH5@&Gp8&Yyzi.j*x&2@@&ih/h+x&2hH5@&cp8&uyzxЀ&|?i.j*!&x&2x4|@&`` hj(i,j:i>h+h/h3 hh py&&&&&&&&&xh&x+x&pT,P `h`*` !8W$@& x&-" k|wx.x/`@& ~ \ h  !\  x!j@&~ ![~  x!j@& p&x&8&xAx+ x+h'xox4J~!G@'x'/ ~h:`` x/kh@'9i ih@'@h !8Wh "j8ip2"y)-)))-xp)x+x1Mp4` x)p@)p \ hp>p2"y))))))xx. xix9p)x+x1Mp4` x)p@)pzx| i\--qV h@)h@* hx)p \ hp>p2~ / p*x)jhhh#n~Zh @*mx.x*mp*$x+x1Mp4` x*)p@*pzx|yy[--qV h@*Hh@*ahx*;p \ hp>p2~ / p*Yx*Rjhhh#n~Zh @*mx-~Xx*m~: `pJ`pN`pR`@*klih*{{||ަ~Zx3vx*h!#$@*{{||h~Zx3x/ j@* i ~Zy-p>: Hx9` @*̀`"`` p`&|x1Mhhh@hpy****+****xx+ x+xxAppy*********y pxAhx'h+ ``|x+'`@++x``` |x+4`@+&`|~~ 8.!@+1 |~~ 8/!@+> |~~ 80! |~~ 8/! |~~~ 8.! 8/#  80|x/hx+x/hx+x/hx+wx/q[-- h+xAhr@+hx+h hpx+ h+x+x+hh xxA-}~ii@, i@+H+@+ 1++x.@+x,x+x.O ~)```x, ii~X~Z+xUx9xix9 ~)```x, ~X,xXx9xjx9 ~pH `a@,KbH,@, &,$"0bp(,4,: x,: ,:  ",?"(x.S++x.@,Kx,x,Ox.Ox,xXxZ xix9 ~)``,r@,l,la | 2 x,bp(,, x, ,  cH,@, xxxz{hh | ~qH!` 5~`x~fxx`x7``` | ~pH ``xxx`xx |-zii@-i-x-cx,ȩ x/ x,X@-x`(x~X~Z- xUx9xix9~X-xXx9xjx9-%@-/qH! -/ x.Ax-cx,xXxZxix9 ~~)``  -S-Qax-` xxxzhh | ~pH `@-k @`xxx`x`` |~p@-x-x-֦ @-x@@-x@-{?-@--@-Ҡx4xx4yx-֦@@-x-?-Ҧ~Zyz -Ƣyyzzx4xgx2x9xgx9xjx9x. xix9x-xix9h#x.i ih@-hxix9 x.  x. x.  x.  x. xx~Z|~?;;: y@./x```88y@@.?x```|xxxxzx`x| 1 )2xxxx}~x`x|~ xy 8F (@.} !.  x. !/  d$@. #p.x.|~ 8F"2H.@. !.   2x.(@. !.  x. !/  d"@.H.̄ #p.x.|d.xpx x전@.$. !x.$|02BDTVfhxz  2BRbrfvxz|~"2BRTdtvxz|~xF| ;|yzxЀ/%?|~ y 8@ !y/5/g/?/?/?/?/?/=/=xxKxH/AxKxH/Hh@hxX@xZx0/g/gh /exx/gx | ~h:` /a@/`/`~ii  @/! x/ x/ ````~ii!` ` ` |xjx9xix9xXx9xUx9xx9xx9xx9xx9xx9xx9pxFx9~x0/xx x전!@/xx |xx |x0@00 x|xx x전!@00x~xx |p@0. ~-`/hx-x,h hxX?hh/h+xKx!̠ @!x전@!!x- ~h: ` HpJ`pN`pR | b G  0 8~*89(œèd;0(â0 (GajV:(✠d)0 0(ᜠ( dgo;p#vwxn> (+dgo;p#vw> i( D! ܢr<no00 Ht.?a22!ℨhe*#`B`*!0 ׈"(H0(0(= 0 &:  ~*8~ " I1Mprr p@1_x1dp |p1q1qx2.x1ip @1p1p1p@11ipx1@1x31@1ix1p |d$@1,p 91'hh 0h)!@18'1pu@1 91x1| ~ " y8 qp pp q p pp Ix | I1p2pqp1䡄0@101p2p 2q 21x2hppp2 pqH2xp I|~~~~ "qx2. |r!qp 2p 2p y2H2R2b2p2b222p2xp2[ Ix2_x32[x|p2ix2mx32ix|px1x/+h@2}h|xxx2rqp (x@2xx2x2',X`c ""c!$@22 +`x2+`1=,holkpx1|8'2`@2 ` 91Q@2p| Q|P9'2 91`d2-`|~ ~ " h `hklW1~ h@@2~ yxX@@33pp3p@3x$3!x3^,X'``~p`p !3N@3N3Nppvpx`p`pb $pb#pvp+`x2x3`x33^ |~ ~ " pp3lp |~ ~ "  I3vpp3~ h@@3h$@3 P 91-`x33 |~~~ ~ " ~ h@@3 I3h$U@3-p.` 91'hh "hH3ՊQ3x8'3pu `@3 91x3" i $"i#3x q x3 |p@4'!p!p!p!p~ yxX@@44vpx2|~~ ~ " I4 q4*h$@4:x1dx4:q42x2.x4pq44x2.p4p4p I |~~~~ ~ "  I4J 1p h&ppp@4hSpp4j Ip |~~ ~ "  I4yh `hklW1~pp4,X'``p`pppvp 1 4qp 4 H4x2pklp Ip | 4Ѣ4̀|~ @44H444x4#4~2 |~2x45c `x x"5[x$x" 84!5  ~?x/ `d5 i8@h@58@58h0 @58!@58 @6@ a;  `<@5N`>5N`@5N~xIp5Tx5> @5[ x5>x5xx5fx5x7 |x<x>5wx@x>xH@5wxJ5wxI|x4x65x8x6 xD5 xF[ @ e@5` @5`"@5`,@x5|x(x*5x,x*x05 x2;#@5ˢ "@5À 5# xI| i8@h@5h<@6@goxXh 6= 8+!@5`#x6=h!``?````` BgoxXh@6hhh h6xh`/`+,hx i8@gh xD A! I Q0xe 85"j>86" 8+  8, i8@h | 8O!d ix`hX?``H``/`+h0@@6|hK hH@6ip6ix6`hK hH@6vp6vx6m p6|x6xhh hF 8h xLxJ | y8x6x6x6x6x6 83 84 x3xGxK|  8F"<@6 {*{.| 0 8F"2@6 9"<@6 '{6{:|  8F"<@6  "2@6  {>{B| / 8F"2@6 9q"<@6 &&{"{&|  8F"<@6 ~ 81# 82# | 81! 7U 82! 81 83!7  ;"#@7U"@7@@7@@7@@7@ 7U #  !~ xI|np COPYRIGHT 2001 QLOGIC CORPORATION ISP2200 Firmware Version 02.02.06 $    ɫ Y+xx# ( Q*p ) 1 9 !h Ϡ 1A4ubvfw^tjtn qd   !A4qd4  A8Ќ   !A 4  A  2    K? |  . \z R5 fu $ h bs #H $\ 0 x#x Px#@x P @*pp*ppX >I .A \ S f  & p  YP Y yx(x* Xpp( a  yx'z(/z* X gC X g X gC J gC 0 p  C yxD J gC X gC   xx@xB s > r<„r>  ! {  - QI YX K(@pp El Q z ´z`ps pМ(p Kppr Yx  (O !pSpWpw yRxЬ•r YH  -ppp yx'x(x* *  } o YH a (Oa. ppp yx'x(x*  } o YH a (Oa. Y   Y  ~ ,psptpvp& pp0 * opЬМ@Є0  ! !Ќpؠ +m opД   + opܠppФд  Q S ЬV   N`8h^(^  ! !q   @   @ppqt @    @p0p2pp  '' > y YP Yx(x*    }  } o o.F& y 4! ({  Jy@yBy$Ѵx'@ќx'6VyTѬK YX Y(  p Y     XX Y@  JxCxC x М8 Y8x$Ь*px$ YЬ p  ''xPxRx/ FS gSxPxRx/ YX Y(  p Y     X  J xPxR Y xCxC !x `x МX Yx$Ь YF !!N!x'H  gx$h    p g` 4!   ({ Y@d( Ypx'x$ YЬX p(  ''H 4 x'Hx(x*xPxR^> X.N*p a c`` `  p !pSpSp[pspw a` `` ````` a``` ````` a`QL`OG` IC` (  pH 1 9 ! )衆    X  (U 8 M    a,#b,"b    a,#b, a, a"b   a ,#b,"b,#b, a, a"b  i8 7  Nx`( P"  yxЄy.x*x&9x:x#x P&VF  @  "@  $@  &@  (@N^. yx @   y$/ zX z y&/ zp y&/|(   @          @x   @     i  a ,V&! `.^ qq`q. !00@pd(" "# 8ЌHpd(pg  H tt& qphpp, h-p. kh.n q& p`pp, h-p. kh.n & qp, j-p.pp.8hh I  qp  qppp qpp& "pp qp" pp( y. qp( yprpqp֡ p hqx&h$x2h(x6h,x:h0x>hph phЄ p)p&q @@!prx"x xA.&6FVp x&q @@!p"Sx"x 3px^N>.6FV  Sx & xApppp .^N>6FV ) x& * S +  Sx & xpppp &.^N> q yyx p#l6d5 (6FVp x@p S4p^N>p px0x2x4x6 p p lp  Pp x0x2x4x6 p p lp hx0h&x4h*x8h.xp ]_ l  > H ( p l  > & " y0 q"pp.p.xx.i4,FhLм h`h.h\h*hXȡphLм Xh`h.h\h*hh "c h2hX@hLЬ hh "c h2h.h*hXhLЬ h.h*hX"c! i2-ih&hLhNh i|iiihLЬ h3"`-ihXh&hLhNh h.h*i|iii   袀 lhL   8ޢ  hh &F6& ".>Npq " # $ I .qp  8 .r "`&&6 "N>.$`a!hjbk^  h @pp qHpH  ЌhF N$``  @   МHx` ` xhxhxpp `aH H hpp qpP  Ќ`F N$``  (  МP  ЌPx``xhxhxpa H .&6FV q"p p y0p x ` 2   x@ &VxxЬxx pp^. ]  Y8f 1 ZEnX `% 8"  TV .! ^^N>.p q !p `!!$I .qp ( (O 8!`` h-Xh(Xh,@hL(hhhP0xhxhxh$ Ph `h0 @`4  -X   ` t д hh "@ p >'0hP((h)pTTpphpTpYYppp`YxhRkljpml ٜP(hon 0hRkljphkj mlkjmlon h4@ "% {"z&}2|6:~>srut"w&v*yqqh(h*h,h. -` "%(hhh "%(hh`hHh0h  "%!h  p `` hp  'phh i|iiih+h/hPhR W & "+hh `yxx XpxМ pѼќ}x }     xpѼg&6| }$~04xhxh  @x(x p k(j,$hn%hrk*j.>.no"%( ";hPhR*h&,h(h2hh HhL0p ` H p p V} ռ g^ h+h/hh i|yiyxhzjќ`Pp hLhNx phh p `` V .! ^p ` H  xhxhxyA   ?xxxx xxxpp ` H  8pєxМ8xМ   աH   xhzj xpѼlh4)ќ&6| }$~04xhxh  @x(x p  k(j, ";(h`4М(hh  hhє 5*h&,h(h2hh k*j.>.V}  g^ h+h/hh i|yiyxМ | x$xh|l xut w$v(p(p!x0Px48x8 x< xxpp Phh 0p ` H  xpp `` hhh l(k, .p q wp!  w!l- uh uh hhP!k,u!j(uhPhRhlx"phpx&phx2ph x6p"h ``4Мhh0 ֬hhx:p&h x>p*ox:x>p&p*o!uk,u!j(hPhRh0 i` М`x"phn` x&phr`x2p`x6p"x:x>p&p*`x"phn`x&phr`x2p`x6p"`x:p&` x>p*hxhxx  <"  x Ф ٠ & "p`p q@ ( (p.p.. Y `  8  f 1 ZEn  ( (p q!0 `` ``` I .qp @ (O! ]  `% 8" ( ( ]  q"p q!0 `` ``` I .q P 8   ` ,  YH !# `! ! A h  H8  !p qx i  0 I H& H +  )   0 I x 2 6 !    ps$t p(p(t&p7q.p/p7s&t" `% 8"& ] y   @ `  p p `   X x0y(y Ѥ ` .x dxЬ   !   ! q yp8xx x0x4x8x<x y0xЬ  yx>x:x6x2x"x0xЬ  o qIp֢ liLi4;;;;oN= hLд  h`h.hh\h*hh|h hhiXh48hLд  h`h.hh\h*hh|h hhhh "c h2iXPHhLд  hh "c h2iXh.h*hLд iXh.h*-hh4"c h2i&hLhN y x qIp r \p hxh hhlxh @ yx yx+hh$ Ph `h0 @`4iyqh xppppi,h i(hX6Fkl "N> Πx& y Y 9.ΠvfVF6&  ~p r:pr  }  }>'0hP(h) ` E E ` ` Y ` E ` J J ` ` ` Q JhRkljpml ٜ((hon kj mlkjmlon h48 "%  {"z&}2|6:~>ypph(h*h,h.p ppp "%.>N^n~ &   @xpp `` h 'hPhR` ab `Ȣ`hj`hfp ` W  P @ ~  } o.!& $ y qI+hh `yx p! !U!pќp  !  !xєHhPhRhLhN&6k(j,x hnx$hrx0hx4h"k*j.>. ";hPhR*h&,h(h2p!&xx yzx6  x м>yyxxʢx.xphpєhx ќ  &6k(j, ";(h`4М(hh  hh!! . qIp y  ! є  ! h 3   @  ! ! !  @x  pxxЬ @xp& qI y p@p `` h 'XhPhRh z hz   @xpp ` W @ ~  }.hjhLhN, '   @xp ih3h?@(p`hh ``4"c E Q PPA(, `- `h`4"s E !%)!'"X"T"b"X"_"\"b"_"Z"Z"b"Z"`"`"b"`k.l*hXU #-``4"c0 `\"``(E@#`e # (hٜ(h"h  h"h #PQ #@ @`e #0Q #@(X`e #`4"c( @+hhPhRX" +hlnkrٜhi$"i # h h`i$"i# h h+hlk"hPhR,h(h2*h&(  #(#)#,#/#4#7#<#A            & & y q i $> $. yx '\x ᐀ @ x/#d ᐀x; .& &xФ $+######## b|x b` b| b8A(1!.& y0  p 3    d W @0j Yx     Z X J_ $.h6FV q" ^N>( y2. qq( ! ! Y С I p! @   yyx '\y8 & q r p(p  . x7x/x/x/x/x7 x0м$Nx7x7 & ( a q`$`&`S0 '`P`R a2a6 '`a``K`C`/`/```  `+/. 2  1 & (&a$,*$$$$$$$$ i  i i i xh i yH iY( i i )..a$`(Мќ& Yxp`$x Y YH`' `C  X Y`$       X&Ѭ`$p0p( [R&  H    Z& [&Ѭ & Y`' &6 Yp     X>.>. YFdL8 adJ`C`CtΤp4Єx`p<ЄHp>6$  > >pTq0ь S"q2`b@ %bH%p4Ќ@  Ѭ%!6s  > >q0q2 S" Ѥ   h  - '  ѬH  +pV   N KK%^N  }  } {6  |w>`  (ќb(b*  # `'  Y@  X gє &b Ҵ &{ g z2`' #}px2P i@abx`x``C `Chhab n% ox pp7/`  i@h@ hh a`(8`* z%& #e ' &Ҽ & g```' i@h@ hh a`D`F`<Π@  g 8aaaa6  |w> #e O ќ '#p4Ь`V`'`/ & `&`/aP`R f& `` М0^aR`' (k&^aR`'`(`*  }  } {6  |w>`   Z  `' a&&& qqpơ(  >  > r 6 ' { a (  +>..& a'o"` '|"`.@@@ HX@ (!0 d8- -  i@   hRhV'& i@ ! hS( hV'. a`0`2V& i@i0" " h'h.^ S PФ@F . N& y@xH  # # h 0"Lx ! " 8  Y .x & (& p ..  h p L(   V y xTЌ(r^ a`0`H```P``` ``(``/`/`/@`/``*`````R```J`2`6  ' q!@ p! )^)b)f)l)r)x)~)))))))))****************))))))))))))))))****************))))))))))))))******************))))))))))))))))****************))))))))))))))))** $* $* #* #* $ #* $ #* #p* #p* $ #p* $ #p* # #p* # #p* $ # #p* $ # #p*  (:* (: $ (: # (: $ #` (: #p( (: $ #p (: # #p (: $ # #p@    &F ! Q*r  ҜH҄8Ҽ* *** Y p*Ҕ p*   ' Nq`  +@( ,3 +38sp>*- =? A~p (H  p'VpĄ N  Nqxą`rҌ`Ԅ N( ,p ,X ,3 +3p( ,@^*p^qN.p ~ Nq8 ,3ppv,h W hB -` `  N  N!& pp.  ~v,h W hB 8-`h~@h + `  N  N!& pp.  ~&  Nq 1p.v,h -` `  N  N!&  +p܀p.  ~&  Nq,h p-`c`b   " .f6& k k9 $!0( ~   N  P KK+܆ .>n6&b"pr& ) kv 9 j, ~.` Pbc KKbc.>`( P qpp qpܠ p ``6&V!x  S PФ@F - N &~ , ,࢈5! H   !`  R ) kv 9 j&!`b`( b., ~!` P.,W^.>F& S HФ8" ' ) .N&6r S"Ҭ! ' ,ӄ 8 h>.& &6!& ) *. >.5 eX aa + N. 5 ~}|{܀zـրՀԀӀҀyx̀̀ˀʀɀǀwvÀutsrqponmlkjihgfedcba|`zy_vutsrqn^ml]k\j[igZfYeXcW\VZUYVUTTSSRRQQPNOMLKNJMIGLFEC<:96K54J3I2H1.G-F,E+D*C)B'&%A#@?>=<;:9876543210/.-,+*)('&%$#"!   qpppp:p>p3p7p a`.@.@ q+xxЄ@*`x i/%. qp.I.J.S.d.R.R+xxЄ+x a`( /p h*`pp hh4*`+xp*`x @aB!?/a.//+/3/7/?/E/I/U/X/b/e////h//w//00$0M000111101Q1Z11/1/////11////////1/////11//////22r22/37KAs/////////b/e7M/7ZB BgB/C.CXCwC///7^899.999:2:A:P:S:v:;8;E>>>?////@@8@A\q< !@ =& / xЄ. |"y&z*{.x @p P. !@  !@ !@ !@ !@.% {(z,x$y0=x#x$.% {(z,x$y0=y$x(! /y$!/ Sy$z({,/x$ `   x;/}8|<@}8|< a ,`   //" iRx$y0/( /(hJiBx,hRx(hVhZh^ \/ iRx$y4/( /(hNiFx,hbx(hfhjhn R/.% /%y${(z,  A = /%  =p/h4 8 /% /%qp (p = /% ab$c(d,e0@ =p/h4 /%p hh8h: Mm(pp0 S&  S ! .=ax$`/ x#@x'ISx+P x/ !x2?x6 ab a`<x: !x>x P @ q '/%y$ N/(~8?@/(|(}, PmҌ P PF a& `H`m0h<h@P.  /% 0 W. /%/  S&   R.//% = /( Ok /% Py /%//% = /( P /% y$ P /%x(/(  gO/&  P )dP$% N P( b%  P xx$p  gO)././%./( = /( O Pm//% = /( O Pm//% = /( PH /% M P Pm/ = /( Ok /%b  P a kv 9 j  ~ Pm/ = /( Pm"/V ihi  h   ~ i5-u0pLqpYh1n#^/}@ / !x  iib//%aP-"cpbtgל 1׬ 1hפ 1@ Y 1 1~:>/a@bD #/& a4 c8./ = /(bDc8/a@bDx$`B{(cF iRhx, i- j/& x$`6x,`:./x8x(% /(x,- /( N bDc8dFe:  = /(x( /(x, /(bDaFc8`:/  /% ay$0  x-!  P&  `` ` =h7ph3h8h:p2-` 2 ../%/(  /% ay$0  x-!  P&  `` ` =h7ph3h8h:p2-` 2 ../%/( h0 /%/ as& `Єxab*``hx:`x>` r cH./! /% Y /%& bH`hH ' El././(  p aR` r  hr& x$3*333:3'3'3'3'3'./( !  4p   48(. !@ / 3 !  8  z 4 { , H P X 6 6T>' -` qI y ih$д@ } x> | x:  6 6 5K 6( 5 5  5; yx$Д0xx y@ 40x yx'x2x 4x$м x'&|x$Ь0X 44M 4PH z& {% 4@  398 " 3 3 1)% 4Mx$м()4M`3 0 x$ЬH "  0  @`' u `&,` @-hh3 x$Фh'  a `  4"@h' t h& y a x' r ` s `xx3e a`'aax$ (`P`R`/`,`.`K`C`C)*++./. !@ /4 ` d   0    "  I  & y  y2y6 'xP 0xR  xRx,x. F4 `4xPxR  x,x.xKxCxC 4xPxR axTЌx'HxPxRxC@  @ x' xC x'Hx$Ь q" y0  `p@Qм8pxx px z& {% дPЬHФX yxЄ@     q  p ! qnpcqfqpkps pwpxpzpppppp~pp6pp'p2p 6( 4!(p$м p' q" y0 ih$д hh8x:  6  6p q" y0y 5x&ќ5p5555ѼPPp xx y$xx"y&   5' x yp8x@ `0  `` %b2pxp`$ `&`a0@(x2@(x6@(x"@(x&@zpp`)8` `  `2 qI y yx-`&p6P6;6Gpќ  6` 6Hpx0  6 a  ` a  ``` t  8 v $ w  =h3 o&-h !8 '>h -h =h3 ph'-h v  r w p a y  ` @ r p ` s p`xxʠ`:`> q p&t2s6p:p> ! q"pAp pp@St0s4-` =` p-p`Π u  8 x $ y  =-`h3 o&-h !8 '>h  6-h =-``3 p`',` x  r y p r p s p 0 x$Ьx  !`' "  0  /&  @ @./}8|</ = /% Y K0 z,{(|<}8 =p7r h /(hЬФ /(Д aa8b aЌ aaa ! hЄXj(/(-! aZ0h(/(`Rh /(A/(/(h  /(h /(hHi@ /( /(hLiD /( /(h = /% z,{(|<}88 =p7 - in-Sp t ЬXx$  2?0 - iR-ShaB`F \ R` R`8h`* #  h p 6k (>hij k$`abc"lHh0i4j8k<`a bc  @ hi kpӄ 5  bhx`ht ` ```8z iR j0p @  (O !! a`/@`/ Y( @ '`Ƞ` 8 Yx X gC X g   X@ J_(` 8/  X p L 0 0` /% iRx0hBx4hFh 0 -z,{(|<}8= 'ˁ/% Yx     Z X  K0 J_//% Y/%ap?  @z,{(|<}8&  =p..p? i @ CeP-! !j ! N`8 8#$  -  j @  J9; = /( = /% S дPx$~ `Ќ`h7h8h:  /%pp9 = /( +,-S    J   J- +z,{(|<}8=/% = /( P//%x(/( = /( P /%  Py$z(/q` )~ adP$%) N8"  gO/% = /( Ok /% P//% = /( Ok /% Py/a/ = /(  /%֬ y$фh x>hx:kja/x$д`/%bPP @ z,{(|<}8=/% = /(`/% = /%h7h8h: P /%pp:h0 /% z,{(|<}8= 'x$/% Y K0x(/(y$8/(! '&& a`` Yx     Z X  }  } {6  |w> a  `J`C`C - J gy$ Y z( :../y$ Nq,/(/ /%`Ь0М /% = /%y$z,{(|<}8 =p;e  N0` !@ /֭ ijk lmnh  ;ܠ ;ܠ ;ܠ ;ܠ ;ܠ ;ܠ ;ܠ!1qȠs h0h2@(h h8h:࠾/(  <"  <"H  <0P <0  <" =hh8h:h7hShO h[ i~hjklmihh7h8h:h#h h l /%pp< /%h / /%  D L) ( <$  D L T \+ * ) (  /%`Ь0М /%y$!@`Ь /(/(z,{(`p@`tN /( /( =,h@X-` QF@$`@'&0@  @ /-p",p -` .X =+pP  /%h7h;-`h3h8،h:&  +.`  N  N!   /%pp<h0p `8 b/% h8/ QF/֠. 5 Ь0& q50 !  q.0!p$(X ho'n&$`-`؄h`8 @( @$hn8 5 Ь @ p=0 @ H 0 Nqcb/% = /%h7h8h:x$ /( /( - + /%pp=h0 /%/y$`Ь /(/(&  T5"e` KK 5 Ь`././% hp -pp0ph `-`p y$ N0~(?@f~$ N(@fq(!hi  qq 1 1 afa`b&c*d.e2, Cpp/& y  h>%xЄ@z"{&|*x @ qq8p0 `xp0 a,p2p6q:"bcd . qp8p& >| yxЄp4 `,x"`x&`x*x @p8p:0p3p7H p6.& S   > ./%& `0`2 Yx     Z X J_./x$ (a a//(/%`/% S Ь/% = /(` x( / = /%h7h3h8h: 1 /%pp>h0 /%/  /%$z,{(|<}8 = /% 1p#p/p&  N?d`0?d S Ь( QFלהׄX 4 S <0הH 4 S <0!הج S  4 S <"& Sה  5 Ь@׌ p~Pה (P?  q /p/qp p"w* a`fp$`b&c*d.e2, Cpp?p,pqp$ w( 1 ab$c(d,e0? q / )~y$z({,|8 /( /( /( /( /( /( /( /( /( /( /( /( /( /( /( /( aabc d/ S  r мahz$cy&//( /( `l /(y&bj/  /%|(}$~8, = /% p#p/p& 5,d`0`X` `  *H q /p/qp p" a`cp$`d&e*f.g2, Cpp@p,hqp$  ad$e(f,g0@Sq //%`ЬМ /% = /%y$z,{(|<}8 =p@֭ h(pHq0r/(h i$ ' Nqq"fen = =h7h8h:h#h h /%pp@/%q  ,h  /%-ph *  J jk lm a`no(pq@ /( =r/(T /(``*b&c*d.e2, CppABp hh  *  J * ab$c(d,e0=/%y, ! = /( Ok /%&  P./x$ЌЄ 9 = /( = /%`(x$Ќ ``0 S д 9x$~ 9ˠ 9ˠ 9`Ќ9h7h8h:  /%ppA = /(9 1!  /%   /% S Ь /%`ФЬ9h7h3h8h: 1 /%ppAh0 /% = /(A /%` /% S Ь /% = /(` /% =  /%h7h3h8h:y((iRy,iVH/(hShWh>   /%ppB^h0  /%/ /%` /% = /(` /% =  /% z,{(|<}8 =pB֭h@h(h/(h7h3h8h: =/( e  /%ppBh0  /%/ /%` /%~$ N/(P` /% = /%h7h8h: h   /%ppCh /%hh6h hz,{(|<}8= = /%y$/( z,{(|<}8 =pCJ *   S/ = /%y$/( S z,{(|<}8=x$/(&   aaB./ Y     Z X 8 a`0`2 J_& ay$aRaN`W`K x8`jx<`fx(`bx,`^ a `````7./& a q`DФЄ EFhЌ Dg@Д D8Мa.a(ќa* bLP`H0bJ`C`Cxq4Ѥ`b@bB(  J`@@`B`Cp{ppp pp J gV t ЌpSp| J gC`@ `B `DЌhDObBp`@`BbB0bBpp^p# DsDEEp  # ᐀ @ y {"xx xx8xxxx#x'x+x/ y {x   S y {x  S` ` JFp`C`Cpp% E-` дE+q E E&  " #D`C```Cpp  J g ii08h4 ih   " #0Ehp ᐀ @  S`C`C`@`B` д`  p ᐀`V`u z) 0p# EyEEEEFF9FjFFFGG1GGGgGzGGGGH"HSHHHII:ISIT a` a`````Cp  J gp`C` д yz0x4z8(pp J gCp G J_p`C J gC J  E` JFp J gC yz0xx4`z8(ppp) J_p J  40  K(`pxHqP( I K "&S ` JFp J gC yz0xx4`z8(ppp) J_p J  40  K(pxqXp-  I( @ ' "&S ` JFp J gC yz0xx4`z8(ppp) J_p  J  40 K(Ppx8 IUp '  &S ` JF Elp J gC@ yz0x4 `z8(ppp xz8(pppp Gg J_p " @ C  A J   K(  pT " BS` JFp J gCh yz08x4 p ) J_p  J  @S ` JFp J gC yz0Xx4@p Jp) J_pp```C`C  J g7p J gCp K(qp pt '~8  I ᐀ @  t S` JFp J gC yz0xx4`z8(ppp) J_p J  40  K(`pxHqP( I K "&S ` JFp J gC yz0xx4`z8(ppp) J_p J  40  K(pxqXp-  I( @ ' "&S ` JFp J gCp yz0@x4 Hz8(pp`z8(pppz88 t Фpp) J_ ᐀ @  S40 p K(Ppx8 IUp '  &S ` JF Elp J gCh yz08x4 p) J_p J  40 9' @S K('(%  *pT#$""'& @S ` JFp J gC yz0Xx4@p Jp) J_p ᐀ @  t S` JF )S%,  A( S   ( HIjI؂` ? ? Iء   ! #$@I# !&%I#()X 9":'IuR-)-uve2e6% '`e # p{&( S ( ! !   ! ! !#8', :qR-$-uve2e6% '`ep{ qp y q@ z2p@ pp& q# sx@&  JxBzB..&  p. ᐀`V`u z)  J g&&  }  } {6  |w>  J a`` a` a`C`C - J g7..& q z2 q@p@ pp Y Y   (O !   X0  '' J_. @ 3 J ᐀ @  S ᐀ @  S a 1 8  `JF S ФX *   ! *  +N J_pp  М&  !.V 5 KE^6V6F iR``` ``-#c #@  #@`>`B`N`R`V`Z`^`b`f`j`n`r`v`z`~````````a`m ``m `ޠ`Jh`:h `Fh`BN>^>& iDnH?@LBLG  L*5!e L`L`  P`  QpiL NH MiL  OiLx@ O( O( Mp`P 0- h`R(-`R`Nh j?.   (  5 Ь``мHa K )  ( ! ь hф @ )a ` H ) ) .& hD L5!e`,p .`-`` `  ` (@ 5 ЬX`м@a )  ( ! ь Pф ( ) ). , &  yiDMh N`phdoP 5 ЬMQ`мMQhdo Mih!@xЬjpklxp`xtN"#@"# =,p0 @@.` QF@$`@'&0@  @hfijjn 0P 8 @   .` -``h8،h:&  +.  N  N!  . ( ! ь 8ф  ) ) iDnH?@ࡈ5!e`hL  O10!hL O P ( @a ) H ) ) & `P 8- h`R.-`R`Nh & `Lp qph`Lh-`N.-`R`Nh p`L pph-p.& `Lm0h`R`N.`Lm0h`R`Nh`  - `-`` && b"`b…„b..& b"`b`Ьh S Ф@ b(b .& b"`bx`Ф` S Ь8 b.&5"e -` , `` KK.& &֡5"m -``m `m  ޠ..05!e V6F` ``` YX`~ i0 5 Ь- i ah bh`h` h`ލi- i@ h ih ih`^h`ba8 `:h`f ! S ! S ih`ji anh`rh`v`~ ii an Y С I p! @  aN>^& q.h qphph.& `mi@jH !(O} & j -`h  Ohn. & ` !hh` Ph hh  `.&  Q. M PH P.& `miP@jTp !(O & jV -`hS  OhWnb Nࠅ. &  j?. & `L h`p hHX0h<h@ -h h p }j`LbN"aR. ` h hHX0h<h@ -h h pj`b"a P  Q QF  QF i QF  QF  QF & `mhh7kJhG `  R P``.` !pph !0P٠& `m( -`hh  P. & `m0` .` !ppP` !(Q$&  ` hhThV  `.`Ф Yqqќ ~5 }Hxxx yRxФV   Nh```Qn^ Q  8 yRxФ0  Q g Q gC Q   ! S Ф0  Q g qpspw *V   N0`Fb' ) ```` ) kv 9 j  ~NQ^` ```  }x&& b5" bb.. 5"8  R+ g R+ gC 5"  qppppppp pKpOp[ p_@p q}ppp p]p p@p7 q5qqp S P S МqR r  s! RnRRRRRnRnRnRRnRnRnRnRnRnRnp6FV v S^N>(pp" 0pp! ppp"  p! ppppp qhL0p(p*(j`r6kds:hhp>pvhlpBpzhLp.hDp2 p ?!rnsrp(p*pV&h8SUh  qp,!hi j-p.pp qpSe 2ScS q5ri4SsiHhD@ "ScS:SSSc q 2ScpЄq"h q}pppp . C qp UBpUBh< q q VUBpUBh< h@ q q VUB& T qpЄq"h8 @i"h @p.p  (p V ࠎppmX V@p VpPpPp0p Vep VV q5qp q! r&V: r*V: r.V: r:V: r>0p"^V q5qؠp q! r& r*V\ r: r>   Bp"^p,q00p4pnp8prHpl@pn ppprq2p p& V  ! @ p .  p .pmp& pp-pp.   ## 0## `s,q0# -p& pVpS& ! . _p) 3 `'WWKWcWWWX WcWVWV ihhp( i-p Z`(`*p( i-p`(`*6FV q" ^N> ihhp( i-p [R`(`*p( i-p`(`*6FV q" ^N>ha$ Xx`8Pp  Xx(ppha$h@`` ` Y $.Vh hW}H hh0W Z^x^p(Xp@p(p p`` ` Y $.ha$X0Xp(@p(ppha$88 pp Xa$ Xx (8p p Xxha$`P(@p(pp! Xa$P(@p(ppha$xP(Xp@p(p p& a i@ q  Y  Ѵ!`'`$Xh    (`(`* YP Y8  '' Y Xx  ''p p"p%p!.& X g.& d X g. z2 q X$&6& z2 a i@ q `(`*  }  } { g6  |w>`   `'   ''.>.  @    ` Мh`hV -X `X^ a i@ q  XXXXYp"@p!(p# p$`C`h  '&  }  } {6  |w>.p`+(`+ V& `$Ь .^Yhhi0hYK Z.^ Y`Dh`P `R Z`R(h Z& X g.   V YHh0   a i@ q    p`h  'h`C`C`'`+/   r 0 r 00 r 0 r 0   Фp '6 ( +>  q . r`P``` ``(`/`/`/@`/`*`````h  'hhh`R`PV&6 a i@ q` 8  !Z  !`(`*`'h `$Zl `Zl  }  } {  |wh    h   $.`   '`h `' `$ 8Z `Z `(`*phh>.^V&6 a q i@`  h[h`h  ' ihh`(`*`' ip jp&p Z `Z[J i@ `' `$  [ `[  }  } {  |wh     $.h i@`phh   '`>.^V&6 a q`   }  } {  |w i@h    [  Ѵ`! X~ i@ $.h` ihh`(`*`' ip jp'p [ `[[`' `$ Ƞ[ f qp& X gC X g. i@`phh   '`  !>.^V&6F a qq0ь` S"q2 p0Ќ \Xq0q2 S" Ѥ0  V  ~ Np'     h\#^ѬH  +pV   N KK\O^   }  } {6  |w>`   XN>.^ qpppp+pOpSp_ pc@pppp qhH0p(p*(jPr6kTs:hXp>pzh\pBp~hHp.h@p2 ?!rrsvp(p*pp+x qpCp \\\\\]*]+]]]^](]]]]]]^^^^^^p \](](])])x0y0 x0y0p0 q,  -pZpc@ pW& ! p. _  -pZ  -ppc p ]2]5]C]\]\ \&ppX a  \H&p apX hppZhhh4:.. ^ qp ]i]i]i]k]npp^^^ ^_^^^^^^ _`$`m`^^^<^ ^^^`a^^<^^^^^a^^^^^^^^^^P^^^^^^^^^b^^^^^^ep h p ]]]]] \&ppX a  \H&p apX hppZhhh4;..^^ _^^ ^^ ^ ^^ _^ ^ ^ ^ ^ ^^ _^^^ ^^^^ ph8h:&  R.ph8h:&  R.ph8h:&  R.ph8h:&  R.h4  p_Ipp-pppK_Ih4 ^ p_hpp-pppK_hh4^p 1! h8h:hS L& h79hJiR R. ( hL pa.-pp $ ShXp^.j^.8hi __ pp ^ p-p"p `,h6p "q  q q" Cpppp h p h^.p hphh- hiq^p hph(hih4 a.__  vfonh `!' p xpxpxpx~ ( x`e0n~ 1! h8h:hS K S&   R. ( 1! hXh8h:hS LN& hJiR R. (  xph- hiqppp0p hppHpiDhH  xiD NfnP OnF  "$Ą$N N Q_hLЄ &  R.& p S Ф asaфxhXP`Є `8`` h` `hXx`hXH` hXb.a.a.a.a& p S Ф as`ЄbcЌ0lHpiX ! (! iX !0h!Ph``bc .a.a.a& p ascӌ c c .a.a& phLЬH as``HhXh\e 1  h``'iLѤiPa& A iX @&  h.hLH as`Ќ `` .a.aiT. @- (*0  !ࡆ p)0iD Nx``Xh\e `$  ` as`ЄЌa& b b.a.hSahSah4 ^x 0 pQ@pp-pppKa.& > 1! a ! єahH p a  aqp a a asa0hSh-pXqhLa.` h. hhi!hhLa..hSaф iD N`qhShShShhSPhS58 r hH p`\qpp мX 9pa9pa9hS(hS).hS* .` ` 2. >X @ (  hThV&  R. p,q00p4prp8pvXpp@pr0ptpvy2q2 h 6&pjDbd҄pjL5"e`,  bhDbCbHbKbQ  ` DH iP [iP D hW&  R..>hW hW phW XhW @hW ( "  = =p =`Ѽ>`pXh\@ G z҄ ^ V6F 0= >(v8p c 0x(x( c7N>^ ! o ऄpH cp դxVF  $. `% 8"N^Hh ? 0x(x(N>^90ph ? 0x(x(V f^ @  Ќx  H&6 H% > >.h` .  S .  S pd Hi C 9  e hj dq #d#p f dq$a p0Pp4d  d0  ddp4d  d"dp0hФ(hqirphv yyx  'y2y6 'iRp< q@p qpp4d dWXp4dhh 0dW@p4d dW  dW! dWR@p4d dWP@p4d dW@p4d $dW$ -ȠS * XSȠa " !!$ > d< #p` ?@x E  ""  ' NqfeXhpht``FPhp8hth ha`q a      (!0 d ~襖   5#Ӭ8 ! q50 ! ~ q.($#ho!k F$x X pd͂" eeeeeeeeqѼq !``Hh\0q$a F Ƥ eiqѼei ""  'ei Nqfe`bHbb 0a`q a q0a" D  a`q a ``` jh o   I >   a`q a q0a"```A j" oqѼxp `P8h\ E  -hq0 eeeeeeqѼp q ' Nqhfeb a `q a   Xa `q a  qѼ@0q$a  qѼ@A0q$a  p `X@   1i 1I 1) 1 p fF ""  ' Nqhfe,N`  -`&hh7l: /.Snf`>`` jh o n N qppappvpppp&p+zIp2p7zp;p?pBpGCpJp[g    :pn qg2 `p ppap& p@ ( qBpD a`4:rlPpn C  > & p$ p p"hp# q&p(p(p0 p,p.`p/ q2( zp4p8p:p<p>pL hpHpJHpK qN qPqNpXp pt Xpppr8ps qvpxpp 8p qp.pgXgYgq qp qrp  qppp q`aq NX`@`0&  o.pqp `& ``a` hhTphV  a . q  pp qp'p#    qq2p/    qqrp &pTpV a`Xph`2pd`.p``*p\`&, C. f qqvrzps  qpxpvpz ass `hT P as`Π8   ahLд8м  h0 t!Є8 B  C 0 B `H A a  C   ` hiRh`iLX asbҌ bb R`mv 9 h~V as``^hЌ8h h  h̀V ( h(#h2 ^2 & ( y. ih i- j`'xii;ii i;iii  g ob J gCx((x* JV  Jxx'x+ @ g<  @" xb`x+x$e   9 x$e x ix('0x* z% a qpЌP a q J_  8  b`x+x$e   U9 x$ xm hhy$!` i<  i>hTzyyxx' oa(igx ig n% jh oiU`'b`Ģxy<0 I    9 y< yDu0yFy<! 8````xHxJ& `, a` `"`H!a.aa i`hh h",hho`hX`V`[,hhZ i `V`Z,hh& `, a` `"`H!a .aa `, a`40!a6a:a6 vfV6&&. qv8&`&x k`( k  ` k p<6  |wp3p?pCpGpK> )p86f v:p46@,6/p6p7f f,~&x` '` h`h7kJhG6v   R~>  j,x` `j 6 o>..>^n~`X6v  ~>` jjf 1& yx8eh` `x<6  |wx3x?xCxGxK> 'x` h`h7kJhG R  ~:~6.n` `` & A lX.& y  l mW.f& qv&`&x l.`( l) ` l)p$8 ih g z2h ~p'6 i@k hh ih$Єh'> ` c p6f vp6@,6/ppf f,~&x`` h '`@h7kJhG6   R>   }k,x` `k.n`X6  >`(` `x` P& 5 e lf qfTpvp0ppv`X}~V/hZ`W`[`` M lv$覀  ihH g z2h ~p'6 i@k hh ih$Єh'>`<`>&` H&`` c lXh7kJhG   R }ln.f 1xe m7` `x$@ ih g z2h ~x'6 i@k hh ih$Єh'>(` c ,0` h 'h`h7kJhG R   }l~~n` X`(` `` `fxe m`T`W`[`` M m~$覀  ihH g z2h ~x'6 i@k hh ih$Єh'>`<`>&` H&`` c mi8h7kJhG R }mim\xxnf``LmhHp qp$5H  ``!n yx8&`` c  z2x ~p'6 y@{ xx yx$Єx' ~> M`<`>&` h7kJhG  R } qpn7n:nPninn7n5n5 p$eHp p"` Pr`pp'rr ` ` M``p p" `T@rpp'rr p$ep ` }`  r`Hrr 0p` }`  r`rr`` ` M`` }pe8`Trrrp'p$e@ }` Pr` ~p'rr ih0nnnn h@ha.b  c>,xq 5 ЬѼPq q@ (-, aa ussh/k&h+xxx@> h e8hh&h+ o ih0  Ѽ`h8}h3h>hGhK& $. 0. x.hCxx @j:xh3h? `h:h6 !f 1 ZEnX` p ptuptup p n% oV6F` a!xy 5"ҬѼPy y@ (-/ ,x aa@p3N>^q3q~qrhrrrrrrrrsHrsisqrsqspppppppppppp{={R{u{rprrpqrhprprprq,pppppppppp{%p !3N>^ppppppppp    sx h $  h< hP hT ` zx hh ijҬм   s  xh h h h h h ` zVF   s x x ` zN^VF   t!   4  S  S 3 q `L zN^  ` z   s R iRhЄPh(  '!(  S  S 5 Ь8x( 8   @   ` z   s  5 Ь8x( 8   @    S` z   sx `  Rx( ~0 b ´b  x( ~r* 5 Ф 3 3 3 ' 33 333 Y7? 3  S  S  r  r 3  r%h 5 Ф@  ` '` S  S  S  rH  rN S  rY r_`t z   s     yRyѬ Ѥ ` z   s Pq   s !  ` z   t!  ` z   t!   *` z   t! q   t!  x(  x ` z   t!   x hhi0i@ !X @ ( p yRyѬ Ѥ t! ф ` z   t!    ` z   t! q9   t!   *` z ᐀ @   t!  ` z& ᐀ @x( ~ " "   ""Т0 " 5 ЬҼȢ( " H5-lh" h i-h-֢5-lh" h "" )  z" / .& ᐀ @  " i-h- )    & ᐀ @x(  5"Ҭ~֠5-lh# h h@h( ( i-h-֠5-lh# h ""   z" z"/ . z" z"x .`  a!xy 5"ҬѼPy y@ (-/ ,x aattttttt F  ` zNF   u( x x `  zNF   ub   ` zN& ᐀ @x(  5"Ҭ~֠5-lh h i-h-֠5-lh h "" s& ᐀ @x(  5"Ҭ~֠5-lh h i-h-֠5-lh h ""  tq& ᐀ @x(  5"Ҭ~֠5-lh h i-h-֠5-lh h ""  tq,xx@ S y!`a 5"ҬѼPa a@ (-, aa@uvv~x:uuuuuuu}j}z}}uuu}Y VF   v5y!hiHy"!"""iL @ф  Ѭ HѴ  "0jn| 6! S>  "&` ᐀` `      N^ ᐀ @z# "x(  5#Ӭм֠5-lh h i-h-֠5-lh h ! ! ) " / V6F  x hh` h\ h h|  `  zN>^& ᐀ @x(  5"Ҭм֠5-lh h i-h-֠5-lh h ""   z" z"/ .V6F   wx h"""""x0xC+N>^w wwwwwww  6iLPkx#hh hd >wá kx#hh hd "ht "h|  wh|htV #wB^"""  ᐀ @x(  5"Ҭм֠5-lh h i-h-֠5-lh h ""   z" a> z    (( """ " """" p " "" %"""""`2 z (""""""` z """"" "x$ ""`  z 6{x"> " >h& ᐀ @x(  5"Ҭм֠5-lh h i-h-֠5-lh h ""   z" z"/ .V6F6x;>N>^xTxTxVxTxTxTxxxT yy   iRhм0h,  ?"""` z    & ᐀ @x(  5"Ҭм֠5-lh h i-h-֠5-lh h "" ! z" z"/ .VF6 a qqTx hh (v֬0м ijtT ijspttx y{ 衅`bbfcjdn`s )`whh`z`/`x`x pp`p`p `p`hl```` v `Ġ X g>N^pЬռ8`bbfcjdn8`bbf`kdn`s `whh`z`/`x`x pp`p`p `p`hl```Hj j b v `Ġ X g>N^x ppL y 5 Ьռ8`bbfcjdn8`bbf`kdn`s`whh`z`/`x`p``p\`p`p|`hl```Hj j b syi 5 Ьռ8`bbfcjdn8`bbf`kdn`s`whh`z`/`x`p`p`p `p`hl```Hj j b syiz# " ihC ᐀`V`u g` ` aa```a& a i@ Y  f 1 ZEn gh ai@P1hh aa(Xa*a$΁ g z)pa$@  g  .   aa(a* g J_ 8& g qq< a i@ Y6  |w>qqp6f vp6@,6/ppf f,~&x`` h '   }},x` `}Ԡ.n~`Ψ f&& qv8&`&x ~`~ɇ('~H`~Ʌ` p<6  |wp3p?pCpGpK>p86f v:p46@,6/p6p7f f,~&x`` h '  ~v,x` `~v..n`Χ q  ppf&& q,v8&`&x"p86f v:p46@,6/p6p7f ,~&x` ,x` `..nf& qv &`&x `( p$ ih  z2h ~p'6 i@k hh ih$Єh'>p 6f vp6@,6/p p f f,~&x` X ,   ~  ` h 'h`h7kJhG R    }8,x` `8.n`0 6V6F9 "* Ƞ8 !""SN>^>   t!  ` S  xx  z   t!   x x x( ` z  yy! ` ᐀`u z) gV66 ᐀ @x$ hrrrrqsqr pr pr .S`5j8p0`7>>^  `6a a*pphpJpO& q uHpL ``H p\ a `)uJ p\0uN.pO  quHpL ``H p\ a `)uJ p\(uNpO Ƞ Ȭ    `` ```````"`& a`H`J&  o. `:U*Ep( n% oG ^f` n8~ 8888888888 f` nSSSSSSSȏȁS i iS f` nn㊞܁nnnx{nnnn f` n  `a` hhO@h|h hhhhhT b, ' j&  o.GÁÁŁށÁÁÁÁ  n o`a!hhO h\hZhth~hxhhh na!h ' hK R  o n +a!h ' hK) R  oG! ` hhLhN => , ^a!hhKhS R  .` S 34 34(".#&< '0` ppp7 6s00` hhh`0 hhh7k2 > * ` S *`  S`  pp7  p0@p8 p<! `  J '@` ppp4pp7  .` SX` hV6&    .>^V6&   .>^Pp8h p.&6! ( kv 9 j`e P, ~>. N   o    n% +  ,`(  框~( 5 !  `2X q y /%`! P" 砲@ vwz}tttttttttttttttttttttttttttttttttttttttttttttttt        p N! n%`  ` o N! n%`6 ]#  @c> o  n%   o q y /% n%  o8 n%`  ` o& ЄЄ & '` pp49H 0 @ p8xp`!`=Hp7p3. .tp pp7p#f&hhޠ  fC  uf3 0f( Nf) ehf .0f f" Vf= pfD PS(1  م? !H@ => , ^.tp pp7  qpt p` h  N! , x   N! ,`` jh hЄh  N iRhФ  NN !"t` hj~  WG M` h( hh`8 hhh7h3  N! ,  q5.М qqr 8` ppмqr` hh8xh49X  @ @  N!`` jhh\  Y 5"    yx 'x 5"     N!  N yyy2y6 ' yyv!  'yR Nq,`  N!``` jh  N!    NN , & qpp(` >` h OZ  P` hhޠ  N!`up49H  @ 0pp7p3 ,   . !"X  N!`` jh  !"8  N!   J~ ?,f   <x  N  N!`` jh ! `` hh@phB` X ! &  J i-h` hh~8 i- jx  N  N!`` jh` h 'j4 !4  ! h p  N! (``K .֢9`` h 'Hh49h8 P` hh@@hB` `h~8 q K +` JX  N!`` jh   iX  N!`` jh X   N!`` jh  !8 !*!d N6` h q5. r ` 5! S ФX *   ! *  + q *V  ,^ Mhh q y. i jxp. i jxx2x6  ( "  ' Yp i qh rhphp hp @  N! , >&6V (# q.p   H   ^>. qppp `8p$ФЬvVF&& )%, !$$ a qrHph Bgh%P$8` LH 0  ` h '`h7kJhG R  ά p\9..N^~ 0 " #0#  `    h( , 8 n%  o @ՉՉՉՉՉՉՉՉՉՉՉ׉׉׉׉ՉՉՉ `a j"&  o.(`@o' n% +a!h 'hh7hK)hGiLiN R   o `@(F8E G   Є& (& i ..` MKKKKKKKKKKhhhhKKKh  n%a!h 'hh7hKhGhPhR R   o n%  o  n%` o`!  n%  `` o@Y  qa!hv =  skbsk^(( hKhKhLЬpij!Hppibj^8hKhKh7nF@  s(s,kVp  6#  G>q$iZp!` q# G h8 iZ h-x   7hKh7nFhLЬ0hi  Rb"hj<j> ` y|{~ }` xxLЬ8`!0"(X$y| #z&%|{~ }, ' j o`a => , ^@ 7  pxbpx^ 7  -xJLNh7x8h:xx@hBnF  skbsk^(hK`hK8hKhKoNxPhRxThVs(s,kVp  6#  G>q$iZ!P q# GPx8 iZ x-x ~` y|{~ }` x|{~ }, ' z` n oa!hiL @iHh8hLhP V!# r^hRhN!h   7h7iD(hK`hK8hKhK R   |w` n o n +a!h 'Ph7hK)hG R   ohK8hK ibh^@򍟍 v qa!xv~FLNb"hj<j>   pxbpx^ @  ~F (  -xJLNh7x8h:xx@hBnF  skbsk^(hK`hK8hKhKoNxPhRxThVs(s,kVp  6#  G>q$iZ!P q# GPx8 iZ x-x 0  qrs ~ => , ^`a!hiL v IiHh8  hLhP!xyDࠆ((hKxKXhKxK yDyF(hKxKHhLЬ0hi hHxJh`xbh\x^ V!# ^hRhN !h t!xyDࠆ((hKxKXhKxK yDyF(hKxKHhLЬ0hi h`xbh\x^hLxN   7Xh7iD(hKHhK iDiFhKXhKhLЬ0hi  R  n% n 'a!hh7 ! ьфaiJ) hG R  o ohK hK p@  & ^.ԎҎҎҎҎҎ ` a j"&  o.``  r'   n%  o  n%  o(` ' n% +` h 'Ph7hGhK) R   o  ࡆ n%` h ' `h7hGhKhPhRSQQQQQ^  n%  ``  o n%  `` o  zzzz|z  ' ` hhL h7hPд(hKhRHмhK hK hG R ` h 'h7hPд(hRhKHмhK hK hG R  ` h '@h7hK(hG RH0' 0 n%  oVf ) !0 i#  G xm  (h7h;- |=(&Y< <-x (/}6(/}6n^Xh}0h R/h  RV !# N^& `.}}xkxmxxkx 6  2``>` h 'h49(hKhS(  S  R ڠ `  ϐސ̐x}}xxxxxxx ` h ' `` ` j" o L 8 qp$ { { x6 qp<8  |w>P ~>( x` z ( z    n% o ` ' `,`  68Xjw6 jj6666t ` ppPpR qp$ {`` `  ` j" o` ` hhPhR`` ` j" o`` hhPhR  L`   ` hhޠ   aᑮᑮᑬ `P8 K ]`  z! ~" z= ~P` hhޠ +  a N 5 Ќ Y     Z X` h 5 Ьhмh@hB``` (-``P``( ~p 5! q K   +&  ,.   N!`` jh o  ,a 8` hh@ $hB` jh o    +&  ,```.`    ``  j" o  ' + 'h` hh7hKhGhPhR R,h Ph` -` -````` jh o `     ~ a!hhK R X@   &b.6& a qsHph`H   ά p\ P.>5! ( aa +V&  ^fe ` K .^ V& b ^P`e `%` P kv 9 j, ~ф( ڠ0 L .^ F ,x~,xx ! /` M NF ,xx~,xx !/` N NF ,x~,xx !   /` (/` R Nv&  PH ( PX %$ S R$ mb A 9& k j/&H a< lX o.~&  f a `-`  . &  f a `-` ! . &  f a `-` = . &  a `-`  . &  f a `-` D . &b"hj<j>.`p``  Q`f 1S&4(f&`nH On`@(`mHh498h8&  a `-` + ( . ءx !"tH M``) jh   (  N!衆 !"` h OZ p` hhޠ8  N! H   hH hPhR& q uHpL ``H p\ a `)uJ p\0uN.pO  &6   2 h  "   qqr d h  " R>.  (   qpp`$m &  xa `-` 3 . qp` hj<`,x pppjP`ptjT@b("  ,7 H   pTjT H &  a `-` C . qp`,x pppj0ptj  + H   pTj  x &hLЬxij!Ph`h\ ibj^.6c#hhJiR@c#` h8  QFjfijjf9#hkkrc#``hn R`>iDp! (hi  of` n(>(((((`(((((( f` nC͗CCCCCCCYYC f` n^Ğ@^Ǡez^^^^^  !@u| gb(;󗪗S  QP 5 ( @` `+ `p Q6&b"pr& ) kv 9 j, ~.` P.>f&` NΦ&4x a  `p` p (  xa`  -a j`p`p  -f&hn  N7pn@( nP&b("  ,7. OZ` p` p +`p  -f&hnަ P&b("  ,7.` p Q@ 5   Qf&48&  NN.P7 a { `pFd($$'F +N S! ѤX ) ` hhhN`p  NV&6    >.^h7 a a`` p Q@ 5   Qf&47 a 8  `pFd($$'F +N S! ѤX ) ` hhhN` @7 Pa`` p -  a`` jh`` jh `   - a` ` jh -`#` jh  - a& ", "` "``"p ",  "!``&` "`%h`p`$ !``%` jh.  NV&6    >.^ `1p  Y&6 YX     X Y>. - aa `+p`,p  - aa  `.p`/p& QX Q  qpp yrprx梄rtpvxp S Ф  Ь( * . t &  h -P8`E` jh +`` jhff&hn7pXn(nIh h bh$`* `hi h$ '0!  ,7 ih(`` ih@h` 0 @'    NN n%  oxzxxxzܜ  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx  n%  `` o  N yRxЬ  N` @ yxx` ``@`( >  8 yxx  N! n%``` jh oa!`  gOf&hnަ7P8    > f&hnަ7p H 0   NN n%  o&#####%###  n%  oa!hiф@ N!  N ,f&hhޠ  ;( km yRxЬ`}xx  N  N!``` jh o ""  ' N  h`` KK``  J8`` jh `  n%  o@ݜݜݜݜߜݜݜݜݜݜݜݜݜݜݜݜݜݜ VF&a qtD 9 0   h  `-h7 hh;lZ,h^`h` xxq0iJhFhOhShW6 R 0  0  [ D  isj҄ h -x`  xЌxx`hh7h;`h,hJ` xxq0ihFy(iy,iy0iy4ihS=rDhO@@hOhO  ! i i~ R.N^  Є  N```A j" o ( i- ihla a``C j" o@```A j" o   I > ````A j" o` ``p`@ S @ G`A  Є& (& i ..`pġ'  `@  NPPtNNNNNNNNNNNNNNN  n% o6`m`` мx  ``  ``> n% o ' ` h   `!  n%` д8` C ` o n% h  o n% A@ڞܞڞڞڞڞڞݞڞڞڞڞڞڞڞڞڞڞ `a => , ^@%%   n o` hhLPh A`` h h 6 n o` h  `(  ```>P`B  n% o'`B   NN n%  o@yyyyyyy{yyyyyyyyyy 6F => , ^N>` hhj xhL A0`` h ! ќ``! h@  jjhf@ ԟ֟ԟԟԟԟԟԟԟԟԟԟԟԟԟ `a j"&  o.`a j"&  o.`a, '&  j o. ^& 6֡@#>.1La ` hhL`a j" o` hhLh@`a j" o``  ` hhL  h`a, ' j o ^ n%aX!h 6 ) >  o naX!h 6 ) >  o ` a j"&  o.&  qr$br  `@`r$`` j" o o.``  '0 P  NN n%  o  n%  o   H0' 0 n%  o6  1``>&6 ,@ }Xv,8 ~g~(```@`  ` L` h ' ``  `>.6V yy8x< ' Nx.& ) * kv 9 j~v 9 ~ P&bb ,. KKfe^> !!t ii i  `` ppp`ii iii ixii```p`X` @` (``-&6Vb"hkxH0-` N      8Fj' S! Ѥ8 ) hh ) kv 9 j, ~  NNN^>. ih`&6V yy0x4 ' N   @   ^>.&6V ""  ' N   @   ^>.vfVF&& '@ )%, !$$ a qvHphP(M M! D B Dg h h%$ R` x`  LH 0  ` h '(h7kJhG   R   ..N^n~P(   hP Rȁ  0 -X`8 0  8 ,   D,!p  `Fp( $',  N6  2>  NV&6    >.^vf&& '@ a y 7 qvHph7(( y Bx$`g@(@`` `@`  ` L` h ' F N   ..n~ vV A ), b } 9 ~g ^~&FVvV, !(  6 N,V A% ) } 9 ~g ^>g^~^N.vVb A ) H } 9 ~g,  ^~&FVvV,  6 Np, A(( } 9 ~g >^~^N.8Ќ00hh}8hkR R/h kR RF6 a8 qtHph!h`H`0`$$@   @>N  h7 h^&    " .hJiVlFhO  hRhhh:hZ RgX@ ( ` pp(` ¡'x n%6` h  > o p   n%`  o     ` pp&6V (" #46؃#4"6 `  P `  ^>. q K *` pphPhRvfVF&& )%, !$$ a qvHphxg%$ B R`  L  ,    X..N^n~& q@դp4p6մp0p2լx%H0 qJ.& q@դp4p6մp0p2լx%H0 qJ.& qB!.. r p. r q@  qD i& q@pDpF. @ @2PTI,ptispptispSUNW,ispSUNW,qlcQLGC,ispQLGC,qla: expected 1 interrupt, got %d clock-frequencyscsi-initiator-idispPTI,isp%s: no mem for sdparam table ISR 0x%x SEMA 0x%x%s: cannot allocate request queue %s: can't mapin request queue %s: cannot allocate result queue %s: can't mapin result queue %s: cannot allocate FC scratch area %s: can't mapin FC scratch area %s: kdma handle already allocated%s: Request Queue Overflow++ %s: kdma handle not already allocatedfpu_cleanup 1 fpu ieee trap, but no exceptionfpu_cleanup 2fpu sequence errorfpu hardware error (%s[%d]) %s[%d]: fpu hardware error fsr=0x%x fpu errorbogus fpu queuefpu_cleanup 3fpu_addfpu_explodefpu_ftosfpu_implodefpu_rightshift 1fpu_rightshift 2pagesize %x l!/obio/interruptinterruptbootstrap: could not get interrupt node from prombootstrap: could not get interrupt propertiesbootstrap: less than 2 interrupt regs. availablebootstrap: cannot support capability of > 4 CPUsbootstrap: PROM has invalid mapping for processor interrupt register %dbootstrap: PROM has invalid mapping for system interrupt register/obio/countercounterbootstrap: could not find counter in OPENPROMbootstrap: could not find counter propertiesbootstrapvmelvmesx%cc%c%cobiosiswespbootpath_fake: unknown system type %dfdsbuslecdbootpath_fakebootpath: /%s%x/%s@%x,%x:%c WARNING: %s map is bogus, using default sd-targetscpu_configure: no memreg found!cpu_configure: ROM hasn't mapped memreg!device_typecpuPROM root device type = %s (need CPU)mainbusmainbus not configuredPROM sync command%d%s at %s %saddr 0x%xiono PROM root devicenameproperty lengthreghierarchical%s "reg" %s = %d (need multiple of %d) warning: %s "reg" %s %d > %d, excess ignored address%s "address" %s = %d (need multiple of 4) intrinterrupts%s "intr" %s = %d (need multiple of 8) WARNING: %s interrupt %d has nonzero vector romprop-- -led-H-@-0- - -------virtual-memorypackagesoptionsopenprommemoryinterrupt-enablealiasesauxiliary-iocounter-timereeprommemory-error-H-@-0- - ---p2bus-8- --------eccmemctlSUNW,sxSUN-4/%d series: %s obio missingfbno options in OPENPROMcould not find %s in OPENPROM audiozsfindzs: unknown zs device %dfindzs: no obio nodeslavefindzs: cannot find zs%dmakememarrmakememarr: hope version %d PROM is like version 2 makememarr: cannot find "memory" nodeavailablemakememarr: cannot get propertymakememarr: no memory foundWARNING: getprop not valid on sun4! %s node 0x%x property %s length %d > %d getpropintsearch_prom: null nodeiommuWARNING: opennode not valid on sun4! %s ' line# >body >user %lx ! ' column# >body >user %lx !stdout @ is my-self addr line# %lx ! addr column# %lx !romgetcursoraddrPROM exit failedPROM boot failedsdconfig_attach: device name too longgetdevunitvndraidrdstxdxycache enabled cache_enable: can't handle 4M with hw-flush cacheDVMA coherent in4_cksumstray interrupt ipl 0x%x pc=0x%x npc=0x%x psr=%b EC EFSPSETcrazy interruptsAsync registers (mid %d): afsr=%b; afva=0x%x%x SYSERR UNCORR TIMEOUT BUSERRAFONMI: system interrupts: %b VME0VME1VME2VME3VME4VME5VME6SBUS0 SBUS1 SBUS2 SBUS3 SBUS4 SBUS5SBUS6KSEASCTVI5MIFVMIME MAnmiclockprofih_remove: intrhand %p (fn %p arg %p) not found from %pintr_establish: level (%d) > block (%d)intr_establish: strange block level: %dintr_establish: level %d interrupt tied to unremovable fast vectorintr_establish(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%xintr_fasttrap(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%xsoftintr_establish: level %d interrupt tied to unremovable fast vectorreal mem = %u (%uMB) dvmamapunable to allocate extent for dvmaavail mem = %lu (%luMB) WARNING: not updating battery clock attempting to power down... power-offWARNING: powerdown failed! halted rebooting dumping to dev(%d,%d), at offset %ld blocks dump area unavailable mmu memory @0x%x:%d device bad device not ready area improper i/o error succeeded error %d Frame pointer is at %p Call traceback: pc = 0x%x args = (0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp = %p mapiodevmapdev: zero sizecurproc = %p, pid %d no curproc uvm: swtch %d, trap %d, sys %d, intr %d, soft %d, faults %d stack trace with sp = 0x%lx stop at 0x%lx 0x%x(0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp %p end of stack trace g0 panicw: case 4 w: unknown case %ld w: arg not allowed _bus_dmamap_load_mbuf: not implemented_bus_dmamap_load_uio: not implemented_bus_dmamap_load_raw: not implementedbus_dmamem_free: nsegs = %d_bus_dmamem_unmap_bus_dmamem_mmap: not implementedmmrwmmrw: out of space in kernel_mapmutex %p held in %smtx_entermtx_enter_trymutex %p not held in %smtx_leaveVA2PA: Asked to translate unmapped VA %pmmu_reservemon4m: no existing L0 mapping! (How are we running?mmu_reservemon4m: can't handle ROM 4G page sizemmu_reservemon4m: unknown pagetable entry typemmu_setup4m_L1: unknown pagetable entry typemmu_setup4m_L2: unknown pagetable entry typemmu_setup4m_L3: PTD found in L3 page tablemmu_setup4m_L3: unknown pagetable entry typeme_alloc: all pmegs goneme_alloc: LRU entry has no pmapme_alloc: stealing from kernelme_alloc: LRU entry's pmap has no segmentsme_alloc: LRU entry's pmap has no ptesme_free: no segments in pmapctx_freepv_changepte: pm == NULLpv_changepte: no segmentspv_changepte: pte == NULLpv_syncflags: no segmentspv_unlink0pv_unlinkpv_link_4_4c: allocation failedpv_changepte4m: pmap == NULLpv_changepte: invalid PTE for 0x%lxpv_syncflags4m: no pte pmap: %p, va: 0x%x pv_link4m: allocation failedpmap_bootstrap: unsuitable number of segments (%d) pvplL1 pagetableL2/L3 pagetablepmap_release: segment list not emptypmap_release: releasing kernelpmap_rmu: no segmentspmap_rmu: no pagespmap_remove_all: empty vregpmap_remove_all: empty vsegpmap_page_protect !PG_V: ctx %d, va 0x%x, pte 0x%xpmap_protect: last segmentpmap_changeprot: no segments in %d pmap_changeprot: no segments in %d! pmap_page_protect4m: empty vregpmap_page_protect4m: empty vsegpmap_page_protect4m: !TEPTEpmap_enter4_4c: can't fail, but didpmap_enter4m: can't fail, but didpmap_enk4m: can't enter va 0x%lx below VM_MIN_KERNEL_ADDRESSkvm_uncache: table entry not ptekvm_uncache !pg_vtrapsvr4 gethrestimesvr4 gethrvtimesvr4 gethrtimesvr4 setpsrsvr4 getpsrsvr4 setccsvr4 getcckgdb exec4.4 syscallsvr4 syscallinteger overflowfix alignrange checkclean windowsflush windowszero dividebreakpointsyscallv8 insn access MMU missv8 data access MMU missv8 store errorv8 idiv by zerov8 data errorv8 cp exceptionv8 unimp flushv8 cp disabledv8 text errorv8 r-reg errorlevel 15 intlevel 14 intlevel 13 intlevel 12 intlevel 11 intlevel 10 intlevel 9 intlevel 8 intlevel 7 intlevel 6 intlevel 5 intlevel 4 intlevel 3 intlevel 2 intlevel 1 intwatchpointtag overflowdata faultfp exceptionalignment faultwindow underflowwindow overflowfp disabledprivileged instructionillegal instructiontext faultasttrap type 0x%x: pc=0x%x npc=0x%x psr=%b EC EFSPSET%s[%d]: unimplemented software trap 0x%x trap T_RWRET 1trap T_RWRET 2trap T_WINUFfpe without being the FP usercoprocessor instruction T_CLEANWIN T_RANGECHECK T_FIXALIGN T_INTOF text fault: pc=0x%x ser=%b WRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGkernel faultdata fault: pc=0x%x addr=0x%x ser=%b text fault: pc=0x%x sfsr=%b sfva=0x%x CSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWdata fault: pc=0x%x sfva=0x%x sfsr=%b syscall cpcb/ppcbsyscall trapframesyscall nargsdvma_mapin: null page framedvma_mapout: extent_free failed vmapbufvmapbuf: null page framevunmapbufcpu_fork: curproci7i6i5i4i3i2i1i0l7l6l5l4l3l2l1l0o7o6o5o4o3o2o1o0g7g6g5g4g3g2g1g0wimynpcpcpsr kernel: keyboard interrupt kernel: %s trapFaulted in DDB; continuing... prom?%s(0x%x, 0x%x) at i7fpi5i4i3i2i1i0l7l6l5l4l3l2l1l0o7spo5o4o3o2o1o0g7g6g5g4g3g2g1g0fqwstateotherwincleanwincanrestorecansavecwppiltlpstatetbaticktttstatetnpctpcillegalasrfprspcasiccryxcciccfcc3fcc2fcc1fcc0pageone_writen_writesone_readn_readsfqtoifdtoifstoifdtoqfstoqfitoqfqtodfstodfitodfqtosfdtosfitosfxtoqfxtodfxtosfqtoxfdtoxfstoxfdmulqfsmuldfdivqfdivdfdivsfmulqfmuldfmulsfsubqfsubdfsubsfaddqfaddd34efaddsfsqrtqfsqrtdfsqrtsfabsqfabsdfabssfnegqfnegdfnegsfmovqfmovd4efmovsswapaswapcasxastwa8r7rprefetchaqrprprefetchldstubaldstubt2ds2dcasaldxaldshaldshldsbaldsbldswaldswstdastdstqastqsthasth6q6pstx5q5pstbastbe8e7eqepd8d7stadqdpstlddalddldqaldqlduhalduhq6p6ldxq5p5ldubaldub8e7eldfaqepeldf8d7dldaldmovrgezmovrgzmovrnzmovrlzmovrlez1jdmovrzsdivccsdivretrydoneid2dpopcudivccudivrestoresdivxudivxsavemovomovulemovugemovuemovlgmovulmovugmovuojdmovvsmovvcmovnegmovposmovcsmovccmovleumovgumovlmovgemovlemovgmovemovnemovn0jdmovasubcccsubcflushTdsmulccsmultvstvctnegtpostcstcctleutgutgetletgtetnetn0F12FtaWdumulccumulqpreturnPdUNDEFINEDmulxqdpdjmplYdrdaddcccaddcimpdep2sraxsraxornccxornimpdep1srlxsrlornccornFPop21Edsllx1DdsllandnccandnFPop1mulsccsubccsub1iT12Ttsubcctvxorccxor1iW12Wtaddcctvorccor1iP12Ptsubccandccand1iY12Ywrtaddccaddcc1id12daddfbofbulefblefbugefbgefbuefbefbnefblgfbulfblfbugfbgfbufbnap,mfbabrgezbrgzbrnzbrlzbrlexap,1lbrzap,ubvsbvcbnegbposbcsbccbleubgublbgeblebgbebnebna,mbaCdsethimilltrapncallnop undefined %s,a,pt,pn %%%s%%f%ld0x%lx%%asi0x%-2.2lx%%fcc%ld[%%%s + %%%s] %ld[%%%s + 0x%lx] %%asi%%fsr0x%lxl#%s%%hi(0x%lx)%%psr%%tbr%%wim%%y(UNKNOWN), -X-H-8-X-(-@`-X-- @`-X-- @`-X--ɰ  @`-X-ɠ-ɐ-X-ɀ-ɐ @`-X-p-X @`-X-H-8-X-(-@`-X--@`-X---X--ȸ-X-Ȩ-Ș@-Ȉ-Ȁ-p@Magma 2+1HS SpMAGMA 2+1HS SpMagma P2 SpMAGMA,P2_SpMagma P1 SpMAGMA,P1_SpMagma 8+2 SpMAGMA,82_SpMagma 4+1 SpMAGMA,41_SpMagma 2+1 SpMAGMA,21HS_SpMagma LC 2+1 SpMAGMA,21_SpMagma Fast 16 SpMAGMA,16HS_SpMAGMA,16_Sp_2Magma 16 SpMAGMA,16_SpMagma 12 SpMAGMA,12_SpMagma 8 Sp - 422MAGMA,_8SP_422Magma Fast 8 SpMAGMA,_8HS_SpMagma 8 SpMAGMA,8_SpMagma 4 SpMAGMA,4_SpMAGMA_Spmagmamttymbppmagma_prom %s (unsupported) clock pri %d softpri %d: %s magma_attach%s%x: fifo overflow %s%x: ring buffer overflow : %d tty%s smttydcd: %d port%s mbppdelaymbpp_sendmbpp_recvspifsttysbppSUNW,spif: expected 2 interrupts, got %d : expected %d registers, got %d revlevverosc: rev %x chiprev %x osc %sMHz stcpri %d ppcpri %d softpri %d : %d tty%s ssttycd%s-%x: ring overflow CCR: timeout : %d port%s bppSUNW,bpp: Zebra : DMA2 : Unknown type %s: draining still active (0x%08x) xboxSUNW,xboxmodel: model %schild-presentfalse: no devices write0-key ranges%s: PROM ranges too large: %d %s at %sexternal battery discharginginternal battery dischargingexternal battery charginginternal battery charginglid downexternal mouse attachedexternal keyboard attachedexternal VGA attachedexternal battery attachedinternal battery attachedmain power availabletctrluctrl: expected 1 interrupt, got %d : expected 1 register, got %d pri %d Tadpole_S3000XT %s: %s%s, %s: (op=0x%02x): unexpected data (0x%02x) %s: (op=0x%02x): unexpected return value (0x%02x) %s: command %x failed %s: (op=0x%02x): unexpected data (0x%02x) in state %d tctrl_set_glyph%s: SHUTDOWN REQUEST! %s: LOW POWER WARNING! %s: main power %s restoredremoved%s: external vga %s attacheddetachedtctrl_read_event_statustctrl_read_ext_statustctrl_belltctrl_brightnesstctrl_tfttctrl_lcdtadpole_powerdowntadpole_bellapmioctltslotts102ranges: expected %d memory ranges, got %d pri %d: %d slots pcmcia socket %d%s: slot %d still busy after 3 seconds, status 0x%x %s%s: unable to create event kthreadtslot_event%s: spurious interrupt on slot %d isr %x couldn't establish interruptstp socket %d: rev %x pcmcia%s%s: unable to create event threadstp4020_evstp4020[%d]: spurious interrupt? couldn't establish interruptstp4020_delaySUNW,pcmcia: only %d register sets : expect 2 interrupt SBus levels; got %d : attach: cannot map registers pri %d and %dpcmcia pcmcia_card_attach%s: error %d detaching %s (function %d) %s%s, " (manufacturer 0x%x%sproduct 0x%x)at %s function %d "pcmcia_function_init: function is enabledpcmcia_function_enable: function not initializedcard has intr handler, but no function doesfunctions have ih, but the card does notdisestablishing last function, but card has no ihchanging ih ipl, but card has no ih%s: can't alloc memory to read attributes %s: can't map memory to read attributes %s: CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: , %s %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecifiedmulti-functionmemoryserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus Adapterunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx%s%lx-; memspace %lx%s%lx%s%lx@; maxtwins %d; mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS pcmcia_parse_cis_tupleV1-1FD605 PCMCIA EtherNet CardSVEC%s: using CIS quirks for , %s : function enable failed : unexpected number of memory spaces %d should be 0 : unexpected number of I/O spaces %d should be 1 : can't allocate i/o space : can't map i/o space port 0x%lx/%dep_pcmcia_attach: impossible, %s:-h-Xz-P-H -@-0-(- -------@--@---(--@3--x-p-P-Hl-0--H-(------(---`-(-----(---HT--GC--x--p-(-` -X-@-(-0HT- - -@---- --`CGCZ)IeI---ZIZIIIIII0I0PI0--I0--IE0--p]IE0--pPIE0--p IE0--p@I I-h-`--@"--X--/-H-0-H--H--H--H----H- ")A--xu EE-p-X-P-H@&o@o @o @  @& 3BIE0@IE0HTIE0--p@IE0--pIE0--p I@#(01.00CFE-10CompactCard EthernetXircom8041TX-10/100-PC-Card-V2SMCcorega FEther PCC-TXDFEther PCC-TXFcoregacorega FastEther PCC-TXcorega EtherII PCC-TDcorega EtherII PCC-Tcorega Ether PCC-TDcorega Ether PCC-Tcorega K.K.PCLAE-CARDLINKSYSDFE-670TXDPCET/TX-RI-O DATADE-650Ver 1.0EtherFast 10/100 Integrated PC Card (PCM100)Linksys10Base-EthernetCFPCMCIA LANFast EthernetETHER-C16Fast-Ethernet10/100 Ethernet CardiPortEthernet CardR01NIC-2000pGVCTAMARACK004743118001ANDCLNT-10TN1.0VFastEthernetNE2000DCN40BC EthernetCNetP/N: EEN10B Rev. 00Seiko Epson Corp.V1-1FD605 PCMCIA EtherNet CardSVECAdapterEthernetW89C926ETHERNETEN2212ACCTONEP401 Ethernet NE2000 CompatibleRPTICISV100EP400RPTI LTD.DE-660+DE-660D-LinkUE2212PCMCIADEPCM-XXDIGITALPE-200PMX AMB8002TAmbiCom Inc: unexpected I/O space configuration : unexpected number of i/o spaces %d should be 1 or 2 : can't allocate I/O space : no suitable config entry : can't get subregion for asic : function enable failed : can't map NIC I/O space : can't map ASIC I/O space port 0x%lx/%d: can't match ethernet vendor code , %s%s: can't alloc mem for enet addr %s: can't map mem for enet addr %s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase Vw--p--X-H-0-(---(----Pttt3V---V---8V---pV-h-H-@-(-V---ps----oo PM--k&h= = s qPs&! qh-x-Xl C-@- --aWR211PCMAllied Telesis K.K.D-Link DWL-650H 11Mbps WLAN AdapterD-Link CorporationGW-NS11H Wireless LAN PC CardPLANEXLA4111 Spectrum24 Wireless LAN PC CardSymbol TechnologiesEval-RevAPRISM 2_5 PCMCIA ADAPTERIntersilRoamAbout 802.11 DSCabletronAWP-100 Wireless PCMCIAAddtron11Mbps Wireless LAN PC CardNTT-MEVersion 01.01Wireless Card CMZ-RT-WPNECNANOSPEEDSMC2632WSMCVersion 01.02HFA384x/IEEEINTERSILWLCFL-11ISL37300PWL PCCL-11coregaWireless_LAN_PCCB-11corega_K.K.Wireless LAN PCCA-11Wireless LAN PCC-11corega K.K.: function enable failed : can't alloc i/o space : can't map i/o space port 0x%lx/%lu%s: can't establish interrupt %s%s , wipwrmodem: can't map modem registers pri %dpwr-on-auxio . ..MAKEDEVconsole tty memkmemnullzerostdinstdoutstderrksymsklogeepromopenprombpf0 biodiskmapfd0afd0bfd0cfd0irfd0arfd0brfd0crfd0isd0arsd0asd0brsd0bsd0crsd0csd0drsd0dsd0ersd0esd0frsd0fsd0grsd0gsd0hrsd0hsd0irsd0isd0jrsd0jsd0krsd0ksd0lrsd0lsd0mrsd0msd0nrsd0nsd0orsd0osd0prsd0psd1arsd1asd1brsd1bsd1crsd1c ... ... ... . .. tmp db runempty`hash&`tzlist . .. tmp ...ho ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi  PMok0 < @ Mok0D(P  Mok0P@@<@T UMolyPpMolyyA Mok1YMok2Mok2rAMok1Mok1Mok1 yCMok1Mok1Mok1 AMok1!UMok1!UMok1!U AMok1!UMok4¨Mok4¨ vCMok1!UMok! hMok! h lAMok1" XMok1" XMok1" XD6Mok4¨MolsyMolsyPX`hpDMok! hMok! hMok! h/tmpN HMok lB8Mok5TopMok5Topx!Mok(9. Mok(9. Mok(9. X1;Ű͝L5վۭyPKBYFyaĵ+Ks[݊^G(/u[q>Sx\m2 mŤ; ~MMNS 4x? BT*?nqED"!̫t@Q۸1mV\%{9Iz WEXzsQ$Uf}}[\H݉B2|n( \+Y,\ޜezIU|-boe:{k y,)-f-x-:F21QQ/XCΚNǟ"^5^oQOa"kOJX/e {xKvw,۰0/ρq̾g:a)`'f-Cl ޾H"'47joRRZ:+JW@WmCAmDw O* e 5 \r Ubd=nTMlS6~LnX#F٘0Ɓq׏Iu+LgOWIQ9Pvn'ƧJV6Z#Rl3I&E9|j897/._3"^jdps&K(YJ '_Africa/ Africa/Abidjan Africa/Accra Africa/Addis_Ababa Africa/Algiers Africa/Asmara Africa/Asmera Africa/Bamako Africa/Bangui Africa/Banjul Africa/Bissau Africa/Blantyre Africa/Brazzaville Africa/Bujumbura Africa/Cairo Africa/Casablanca Africa/Ceuta Africa/Conakry Africa/Dakar Africa/Dar_es_Salaam Africa/Djibouti Africa/Douala Africa/El_Aaiun Africa/Freetown Africa/Gaborone Africa/Harare Africa/Johannesburg Africa/Kampala Africa/Khartoum Africa/Kigali Africa/Kinshasa Africa/Lagos Africa/Libreville Africa/Lome Africa/Luanda Africa/Lubumbashi Africa/Lusaka Africa/Malabo Africa/Maputo Africa/Maseru Africa/Mbabane Africa/Mogadishu Africa/Monrovia Africa/Nairobi Africa/Ndjamena Africa/Niamey Africa/Nouakchott Africa/Ouagadougou Africa/Porto-Novo Africa/Sao_Tome Africa/Timbuktu Africa/Tripoli Africa/Tunis Africa/Windhoek America/ America/Adak America/Anchorage America/Anguilla America/Antigua America/Araguaina America/Argentina/ America/Argentina/Buenos_Aires America/Argentina/Catamarca America/Argentina/ComodRivadavia America/Argentina/Cordoba America/Argentina/Jujuy America/Argentina/La_Rioja America/Argentina/Mendoza America/Argentina/Rio_Gallegos America/Argentina/Salta America/Argentina/San_Juan America/Argentina/San_Luis America/Argentina/Tucuman America/Argentina/Ushuaia America/Aruba America/Asuncion America/Atikokan America/Atka America/Bahia America/Bahia_Banderas America/Barbados America/Belem America/Belize America/Blanc-Sablon America/Boa_Vista America/Bogota America/Boise America/Buenos_Aires America/Cambridge_Bay America/Campo_Grande America/Cancun America/Caracas America/Catamarca America/Cayenne America/Cayman America/Chicago America/Chihuahua America/Coral_Harbour America/Cordoba America/Costa_Rica America/Cuiaba America/Curacao America/Danmarkshavn America/Dawson America/Dawson_Creek America/Denver America/Detroit America/Dominica America/Edmonton America/Eirunepe America/El_Salvador America/Ensenada America/Fort_Wayne America/Fortaleza America/Glace_Bay America/Godthab America/Goose_Bay America/Grand_Turk America/Grenada America/Guadeloupe America/Guatemala America/Guayaquil America/Guyana America/Halifax America/Havana America/Hermosillo America/Indiana/ America/Indiana/Indianapolis America/Indiana/Knox America/Indiana/Marengo America/Indiana/Petersburg America/Indiana/Tell_City America/Indiana/Vevay America/Indiana/Vincennes America/Indiana/Winamac America/Indianapolis America/Inuvik America/Iqaluit America/Jamaica America/Jujuy America/Juneau America/Kentucky/ America/Kentucky/Louisville America/Kentucky/Monticello America/Knox_IN America/La_Paz America/Lima America/Los_Angeles America/Louisville America/Maceio America/Managua America/Manaus America/Marigot America/Martinique America/Matamoros America/Mazatlan America/Mendoza America/Menominee America/Merida America/Mexico_City America/Miquelon America/Moncton America/Monterrey America/Montevideo America/Montreal America/Montserrat America/Nassau America/New_York America/Nipigon America/Nome America/Noronha America/North_Dakota/ America/North_Dakota/Beulah America/North_Dakota/Center America/North_Dakota/New_Salem America/Ojinaga America/Panama America/Pangnirtung America/Paramaribo America/Phoenix America/Port-au-Prince America/Port_of_Spain America/Porto_Acre America/Porto_Velho America/Puerto_Rico America/Rainy_River America/Rankin_Inlet America/Recife America/Regina America/Resolute America/Rio_Branco America/Rosario America/Santa_Isabel America/Santarem America/Santiago America/Santo_Domingo America/Sao_Paulo America/Scoresbysund America/Shiprock America/St_Barthelemy America/St_Johns America/St_Kitts America/St_Lucia America/St_Thomas America/St_Vincent America/Swift_Current America/Tegucigalpa America/Thule America/Thunder_Bay America/Tijuana America/Toronto America/Tortola America/Vancouver America/Virgin America/Whitehorse America/Winnipeg America/Yakutat America/Yellowknife Antarctica/ Antarctica/Casey Antarctica/Davis Antarctica/DumontDUrville Antarctica/Macquarie Antarctica/Mawson Antarctica/McMurdo Antarctica/Palmer Antarctica/Rothera Antarctica/South_Pole Antarctica/Syowa Antarctica/Vostok Arctic/ Arctic/Longyearbyen Asia/ Asia/Aden Asia/Almaty Asia/Amman Asia/Anadyr Asia/Aqtau Asia/Aqtobe Asia/Ashgabat Asia/Ashkhabad Asia/Baghdad Asia/Bahrain Asia/Baku Asia/Bangkok Asia/Beirut Asia/Bishkek Asia/Brunei Asia/Calcutta Asia/Choibalsan Asia/Chongqing Asia/Chungking Asia/Colombo Asia/Dacca Asia/Damascus Asia/Dhaka Asia/Dili Asia/Dubai Asia/Dushanbe Asia/Gaza Asia/Harbin Asia/Ho_Chi_Minh Asia/Hong_Kong Asia/Hovd Asia/Irkutsk Asia/Istanbul Asia/Jakarta Asia/Jayapura Asia/Jerusalem Asia/Kabul Asia/Kamchatka Asia/Karachi Asia/Kashgar Asia/Kathmandu Asia/Katmandu Asia/Kolkata Asia/Krasnoyarsk Asia/Kuala_Lumpur Asia/Kuching Asia/Kuwait Asia/Macao Asia/Macau Asia/Magadan Asia/Makassar Asia/Manila Asia/Muscat Asia/Nicosia Asia/Novokuznetsk Asia/Novosibirsk Asia/Omsk Asia/Oral Asia/Phnom_Penh Asia/Pontianak Asia/Pyongyang Asia/Qatar Asia/Qyzylorda Asia/Rangoon Asia/Riyadh Asia/Riyadh87 Asia/Riyadh88 Asia/Riyadh89 Asia/Saigon Asia/Sakhalin Asia/Samarkand Asia/Seoul Asia/Shanghai Asia/Singapore Asia/Taipei Asia/Tashkent Asia/Tbilisi Asia/Tehran Asia/Tel_Aviv Asia/Thimbu Asia/Thimphu Asia/Tokyo Asia/Ujung_Pandang Asia/Ulaanbaatar Asia/Ulan_Bator Asia/Urumqi Asia/Vientiane Asia/Vladivostok Asia/Yakutsk Asia/Yekaterinburg Asia/Yerevan Atlantic/ Atlantic/Azores Atlantic/Bermuda Atlantic/Canary Atlantic/Cape_Verde Atlantic/Faeroe Atlantic/Faroe Atlantic/Jan_Mayen Atlantic/Madeira Atlantic/Reykjavik Atlantic/South_Georgia Atlantic/St_Helena Atlantic/Stanley Australia/ Australia/ACT Australia/Adelaide Australia/Brisbane Australia/Broken_Hill Australia/Canberra Australia/Currie Australia/Darwin Australia/Eucla Australia/Hobart Australia/LHI Australia/Lindeman Australia/Lord_Howe Australia/Melbourne Australia/NSW Australia/North Australia/Perth Australia/Queensland Australia/South Australia/Sydney Australia/Tasmania Australia/Victoria Australia/West Australia/Yancowinna Brazil/ Brazil/Acre Brazil/DeNoronha Brazil/East Brazil/West CET CST6CDT Canada/ Canada/Atlantic Canada/Central Canada/East-Saskatchewan Canada/Eastern Canada/Mountain Canada/Newfoundland Canada/Pacific Canada/Saskatchewan Canada/Yukon Chile/ Chile/Continental Chile/EasterIsland Cuba EET EST EST5EDT Egypt Eire Etc/ Etc/GMT Etc/GMT+0 Etc/GMT+1 Etc/GMT+10 Etc/GMT+11 Etc/GMT+12 Etc/GMT+2 Etc/GMT+3 Etc/GMT+4 Etc/GMT+5 Etc/GMT+6 Etc/GMT+7 Etc/GMT+8 Etc/GMT+9 Etc/GMT-0 Etc/GMT-1 Etc/GMT-10 Etc/GMT-11 Etc/GMT-12 Etc/GMT-13 Etc/GMT-14 Etc/GMT-2 Etc/GMT-3 Etc/GMT-4 Etc/GMT-5 Etc/GMT-6 Etc/GMT-7 Etc/GMT-8 Etc/GMT-9 Etc/GMT0 Etc/Greenwich Etc/UCT Etc/UTC Etc/Universal Etc/Zulu Europe/ Europe/Amsterdam Europe/Andorra Europe/Athens Europe/Belfast Europe/Belgrade Europe/Berlin Europe/Bratislava Europe/Brussels Europe/Bucharest Europe/Budapest Europe/Chisinau Europe/Copenhagen Europe/Dublin Europe/Gibraltar Europe/Guernsey Europe/Helsinki Europe/Isle_of_Man Europe/Istanbul Europe/Jersey Europe/Kaliningrad Europe/Kiev Europe/Lisbon Europe/Ljubljana Europe/London Europe/Luxembourg Europe/Madrid Europe/Malta Europe/Mariehamn Europe/Minsk Europe/Monaco Europe/Moscow Europe/Nicosia Europe/Oslo Europe/Paris Europe/Podgorica Europe/Prague Europe/Riga Europe/Rome Europe/Samara Europe/San_Marino Europe/Sarajevo Europe/Simferopol Europe/Skopje Europe/Sofia Europe/Stockholm Europe/Tallinn Europe/Tirane Europe/Tiraspol Europe/Uzhgorod Europe/Vaduz Europe/Vatican Europe/Vienna Europe/Vilnius Europe/Volgograd Europe/Warsaw Europe/Zagreb Europe/Zaporozhye Europe/Zurich Factory GB GB-Eire GMT GMT+0 GMT-0 GMT0 Greenwich HST Hongkong Iceland Indian/ Indian/Antananarivo Indian/Chagos Indian/Christmas Indian/Cocos Indian/Comoro Indian/Kerguelen Indian/Mahe Indian/Maldives Indian/Mauritius Indian/Mayotte Indian/Reunion Iran Israel Jamaica Japan Kwajalein Libya MET MST MST7MDT Mexico/ Mexico/BajaNorte Mexico/BajaSur Mexico/General Mideast/ Mideast/Riyadh87 Mideast/Riyadh88 Mideast/Riyadh89 NZ NZ-CHAT Navajo PRC PST8PDT Pacific/ Pacific/Apia Pacific/Auckland Pacific/Chatham Pacific/Chuuk Pacific/Easter Pacific/Efate Pacific/Enderbury Pacific/Fakaofo Pacific/Fiji Pacific/Funafuti Pacific/Galapagos Pacific/Gambier Pacific/Guadalcanal Pacific/Guam Pacific/Honolulu Pacific/Johnston Pacific/Kiritimati Pacific/Kosrae Pacific/Kwajalein Pacific/Majuro Pacific/Marquesas Pacific/Midway Pacific/Nauru Pacific/Niue Pacific/Norfolk Pacific/Noumea Pacific/Pago_Pago Pacific/Palau Pacific/Pitcairn Pacific/Pohnpei Pacific/Ponape Pacific/Port_Moresby Pacific/Rarotonga Pacific/Saipan Pacific/Samoa Pacific/Tahiti Pacific/Tarawa Pacific/Tongatapu Pacific/Truk Pacific/Wake Pacific/Wallis Pacific/Yap Poland Portugal ROC ROK Singapore Turkey UCT US/ US/Alaska US/Aleutian US/Arizona US/Central US/East-Indiana US/Eastern US/Hawaii US/Indiana-Starke US/Michigan US/Mountain US/Pacific US/Pacific-New US/Samoa UTC Universal W-SU WET Zulu posix/ posix/Africa/ posix/Africa/Abidjan posix/Africa/Accra posix/Africa/Addis_Ababa posix/Africa/Algiers posix/Africa/Asmara posix/Africa/Asmera posix/Africa/Bamako posix/Africa/Bangui posix/Africa/Banjul posix/Africa/Bissau posix/Africa/Blantyre posix/Africa/Brazzaville posix/Africa/Bujumbura posix/Africa/Cairo posix/Africa/Casablanca posix/Africa/Ceuta posix/Africa/Conakry posix/Africa/Dakar posix/Africa/Dar_es_Salaam posix/Africa/Djibouti posix/Africa/Douala posix/Africa/El_Aaiun posix/Africa/Freetown posix/Africa/Gaborone posix/Africa/Harare posix/Africa/Johannesburg posix/Africa/Kampala posix/Africa/Khartoum posix/Africa/Kigali posix/Africa/Kinshasa posix/Africa/Lagos posix/Africa/Libreville posix/Africa/Lome posix/Africa/Luanda posix/Africa/Lubumbashi posix/Africa/Lusaka posix/Africa/Malabo posix/Africa/Maputo posix/Africa/Maseru posix/Africa/Mbabane posix/Africa/Mogadishu posix/Africa/Monrovia posix/Africa/Nairobi posix/Africa/Ndjamena posix/Africa/Niamey posix/Africa/Nouakchott posix/Africa/Ouagadougou posix/Africa/Porto-Novo posix/Africa/Sao_Tome posix/Africa/Timbuktu posix/Africa/Tripoli posix/Africa/Tunis posix/Africa/Windhoek posix/America/ posix/America/Adak posix/America/Anchorage posix/America/Anguilla posix/America/Antigua posix/America/Araguaina posix/America/Argentina/ posix/America/Argentina/Buenos_Aires posix/America/Argentina/Catamarca posix/America/Argentina/ComodRivadavia posix/America/Argentina/Cordoba posix/America/Argentina/Jujuy posix/America/Argentina/La_Rioja posix/America/Argentina/Mendoza posix/America/Argentina/Rio_Gallegos posix/America/Argentina/Salta posix/America/Argentina/San_Juan posix/America/Argentina/San_Luis posix/America/Argentina/Tucuman posix/America/Argentina/Ushuaia posix/America/Aruba posix/America/Asuncion posix/America/Atikokan posix/America/Atka posix/America/Bahia posix/America/Bahia_Banderas posix/America/Barbados posix/America/Belem posix/America/Belize posix/America/Blanc-Sablon posix/America/Boa_Vista posix/America/Bogota posix/America/Boise posix/America/Buenos_Aires posix/America/Cambridge_Bay posix/America/Campo_Grande posix/America/Cancun posix/America/Caracas posix/America/Catamarca posix/America/Cayenne posix/America/Cayman posix/America/Chicago posix/America/Chihuahua posix/America/Coral_Harbour posix/America/Cordoba posix/America/Costa_Rica posix/America/Cuiaba posix/America/Curacao posix/America/Danmarkshavn posix/America/Dawson posix/America/Dawson_Creek posix/America/Denver posix/America/Detroit posix/America/Dominica posix/America/Edmonton posix/America/Eirunepe posix/America/El_Salvador posix/America/Ensenada posix/America/Fort_Wayne posix/America/Fortaleza posix/America/Glace_Bay posix/America/Godthab posix/America/Goose_Bay posix/America/Grand_Turk posix/America/Grenada posix/America/Guadeloupe posix/America/Guatemala posix/America/Guayaquil posix/America/Guyana posix/America/Halifax posix/America/Havana posix/America/Hermosillo posix/America/Indiana/ posix/America/Indiana/Indianapolis posix/America/Indiana/Knox posix/America/Indiana/Marengo posix/America/Indiana/Petersburg posix/America/Indiana/Tell_City posix/America/Indiana/Vevay posix/America/Indiana/Vincennes posix/America/Indiana/Winamac posix/America/Indianapolis posix/America/Inuvik posix/America/Iqaluit posix/America/Jamaica posix/America/Jujuy posix/America/Juneau posix/America/Kentucky/ posix/America/Kentucky/Louisville posix/America/Kentucky/Monticello posix/America/Knox_IN posix/America/La_Paz posix/America/Lima posix/America/Los_Angeles posix/America/Louisville posix/America/Maceio posix/America/Managua posix/America/Manaus posix/America/Marigot posix/America/Martinique posix/America/Matamoros posix/America/Mazatlan posix/America/Mendoza posix/America/Menominee posix/America/Merida posix/America/Mexico_City posix/America/Miquelon posix/America/Moncton posix/America/Monterrey posix/America/Montevideo posix/America/Montreal posix/America/Montserrat posix/America/Nassau posix/America/New_York posix/America/Nipigon posix/America/Nome posix/America/Noronha posix/America/North_Dakota/ posix/America/North_Dakota/Beulah posix/America/North_Dakota/Center posix/America/North_Dakota/New_Salem posix/America/Ojinaga posix/America/Panama posix/America/Pangnirtung posix/America/Paramaribo posix/America/Phoenix posix/America/Port-au-Prince posix/America/Port_of_Spain posix/America/Porto_Acre posix/America/Porto_Velho posix/America/Puerto_Rico posix/America/Rainy_River posix/America/Rankin_Inlet posix/America/Recife posix/America/Regina posix/America/Resolute posix/America/Rio_Branco posix/America/Rosario posix/America/Santa_Isabel posix/America/Santarem posix/America/Santiago posix/America/Santo_Domingo posix/America/Sao_Paulo posix/America/Scoresbysund posix/America/Shiprock posix/America/St_Barthelemy posix/America/St_Johns posix/America/St_Kitts posix/America/St_Lucia posix/America/St_Thomas posix/America/St_Vincent posix/America/Swift_Current posix/America/Tegucigalpa posix/America/Thule posix/America/Thunder_Bay posix/America/Tijuana posix/America/Toronto posix/America/Tortola posix/America/Vancouver posix/America/Virgin posix/America/Whitehorse posix/America/Winnipeg posix/America/Yakutat posix/America/Yellowknife posix/Antarctica/ posix/Antarctica/Casey posix/Antarctica/Davis posix/Antarctica/DumontDUrville posix/Antarctica/Macquarie posix/Antarctica/Mawson posix/Antarctica/McMurdo posix/Antarctica/Palmer posix/Antarctica/Rothera posix/Antarctica/South_Pole posix/Antarctica/Syowa posix/Antarctica/Vostok posix/Arctic/ posix/Arctic/Longyearbyen posix/Asia/ posix/Asia/Aden posix/Asia/Almaty posix/Asia/Amman posix/Asia/Anadyr posix/Asia/Aqtau posix/Asia/Aqtobe posix/Asia/Ashgabat posix/Asia/Ashkhabad posix/Asia/Baghdad posix/Asia/Bahrain posix/Asia/Baku posix/Asia/Bangkok posix/Asia/Beirut posix/Asia/Bishkek posix/Asia/Brunei posix/Asia/Calcutta posix/Asia/Choibalsan posix/Asia/Chongqing posix/Asia/Chungking posix/Asia/Colombo posix/Asia/Dacca posix/Asia/Damascus posix/Asia/Dhaka posix/Asia/Dili posix/Asia/Dubai posix/Asia/Dushanbe posix/Asia/Gaza posix/Asia/Harbin posix/Asia/Ho_Chi_Minh posix/Asia/Hong_Kong posix/Asia/Hovd posix/Asia/Irkutsk posix/Asia/Istanbul posix/Asia/Jakarta posix/Asia/Jayapura posix/Asia/Jerusalem posix/Asia/Kabul posix/Asia/Kamchatka posix/Asia/Karachi posix/Asia/Kashgar posix/Asia/Kathmandu posix/Asia/Katmandu posix/Asia/Kolkata posix/Asia/Krasnoyarsk posix/Asia/Kuala_Lumpur posix/Asia/Kuching posix/Asia/Kuwait posix/Asia/Macao posix/Asia/Macau posix/Asia/Magadan posix/Asia/Makassar posix/Asia/Manila posix/Asia/Muscat posix/Asia/Nicosia posix/Asia/Novokuznetsk posix/Asia/Novosibirsk posix/Asia/Omsk posix/Asia/Oral posix/Asia/Phnom_Penh posix/Asia/Pontianak posix/Asia/Pyongyang posix/Asia/Qatar posix/Asia/Qyzylorda posix/Asia/Rangoon posix/Asia/Riyadh posix/Asia/Riyadh87 posix/Asia/Riyadh88 posix/Asia/Riyadh89 posix/Asia/Saigon posix/Asia/Sakhalin posix/Asia/Samarkand posix/Asia/Seoul posix/Asia/Shanghai posix/Asia/Singapore posix/Asia/Taipei posix/Asia/Tashkent posix/Asia/Tbilisi posix/Asia/Tehran posix/Asia/Tel_Aviv posix/Asia/Thimbu posix/Asia/Thimphu posix/Asia/Tokyo posix/Asia/Ujung_Pandang posix/Asia/Ulaanbaatar posix/Asia/Ulan_Bator posix/Asia/Urumqi posix/Asia/Vientiane posix/Asia/Vladivostok posix/Asia/Yakutsk posix/Asia/Yekaterinburg posix/Asia/Yerevan posix/Atlantic/ posix/Atlantic/Azores posix/Atlantic/Bermuda posix/Atlantic/Canary posix/Atlantic/Cape_Verde posix/Atlantic/Faeroe posix/Atlantic/Faroe posix/Atlantic/Jan_Mayen posix/Atlantic/Madeira posix/Atlantic/Reykjavik posix/Atlantic/South_Georgia posix/Atlantic/St_Helena posix/Atlantic/Stanley posix/Australia/ posix/Australia/ACT posix/Australia/Adelaide posix/Australia/Brisbane posix/Australia/Broken_Hill posix/Australia/Canberra posix/Australia/Currie posix/Australia/Darwin posix/Australia/Eucla posix/Australia/Hobart posix/Australia/LHI posix/Australia/Lindeman posix/Australia/Lord_Howe posix/Australia/Melbourne posix/Australia/NSW posix/Australia/North posix/Australia/Perth posix/Australia/Queensland posix/Australia/South posix/Australia/Sydney posix/Australia/Tasmania posix/Australia/Victoria posix/Australia/West posix/Australia/Yancowinna posix/Brazil/ posix/Brazil/Acre posix/Brazil/DeNoronha posix/Brazil/East posix/Brazil/West posix/CET posix/CST6CDT posix/Canada/ posix/Canada/Atlantic posix/Canada/Central posix/Canada/East-Saskatchewan posix/Canada/Eastern posix/Canada/Mountain posix/Canada/Newfoundland posix/Canada/Pacific posix/Canada/Saskatchewan posix/Canada/Yukon posix/Chile/ posix/Chile/Continental posix/Chile/EasterIsland posix/Cuba posix/EET posix/EST posix/EST5EDT posix/Egypt posix/Eire posix/Etc/ posix/Etc/GMT posix/Etc/GMT+0 posix/Etc/GMT+1 posix/Etc/GMT+10 posix/Etc/GMT+11 posix/Etc/GMT+12 posix/Etc/GMT+2 posix/Etc/GMT+3 posix/Etc/GMT+4 posix/Etc/GMT+5 posix/Etc/GMT+6 posix/Etc/GMT+7 posix/Etc/GMT+8 posix/Etc/GMT+9 posix/Etc/GMT-0 posix/Etc/GMT-1 posix/Etc/GMT-10 posix/Etc/GMT-11 posix/Etc/GMT-12 posix/Etc/GMT-13 posix/Etc/GMT-14 posix/Etc/GMT-2 posix/Etc/GMT-3 posix/Etc/GMT-4 posix/Etc/GMT-5 posix/Etc/GMT-6 posix/Etc/GMT-7 posix/Etc/GMT-8 posix/Etc/GMT-9 posix/Etc/GMT0 posix/Etc/Greenwich posix/Etc/UCT posix/Etc/UTC posix/Etc/Universal posix/Etc/Zulu posix/Europe/ posix/Europe/Amsterdam posix/Europe/Andorra posix/Europe/Athens posix/Europe/Belfast posix/Europe/Belgrade posix/Europe/Berlin posix/Europe/Bratislava posix/Europe/Brussels posix/Europe/Bucharest posix/Europe/Budapest posix/Europe/Chisinau posix/Europe/Copenhagen posix/Europe/Dublin posix/Europe/Gibraltar posix/Europe/Guernsey posix/Europe/Helsinki posix/Europe/Isle_of_Man posix/Europe/Istanbul posix/Europe/Jersey posix/Europe/Kaliningrad posix/Europe/Kiev posix/Europe/Lisbon posix/Europe/Ljubljana posix/Europe/London posix/Europe/Luxembourg posix/Europe/Madrid posix/Europe/Malta posix/Europe/Mariehamn posix/Europe/Minsk posix/Europe/Monaco posix/Europe/Moscow posix/Europe/Nicosia posix/Europe/Oslo posix/Europe/Paris posix/Europe/Podgorica posix/Europe/Prague posix/Europe/Riga posix/Europe/Rome posix/Europe/Samara posix/Europe/San_Marino posix/Europe/Sarajevo posix/Europe/Simferopol posix/Europe/Skopje posix/Europe/Sofia posix/Europe/Stockholm posix/Europe/Tallinn posix/Europe/Tirane posix/Europe/Tiraspol posix/Europe/Uzhgorod posix/Europe/Vaduz posix/Europe/Vatican posix/Europe/Vienna posix/Europe/Vilnius posix/Europe/Volgograd posix/Europe/Warsaw posix/Europe/Zagreb posix/Europe/Zaporozhye posix/Europe/Zurich posix/Factory posix/GB posix/GB-Eire posix/GMT posix/GMT+0 posix/GMT-0 posix/GMT0 posix/Greenwich posix/HST posix/Hongkong posix/Iceland posix/Indian/ posix/Indian/Antananarivo posix/Indian/Chagos posix/Indian/Christmas posix/Indian/Cocos posix/Indian/Comoro posix/Indian/Kerguelen posix/Indian/Mahe posix/Indian/Maldives posix/Indian/Mauritius posix/Indian/Mayotte posix/Indian/Reunion posix/Iran posix/Israel posix/Jamaica posix/Japan posix/Kwajalein posix/Libya posix/MET posix/MST posix/MST7MDT posix/Mexico/ posix/Mexico/BajaNorte posix/Mexico/BajaSur posix/Mexico/General posix/Mideast/ posix/Mideast/Riyadh87 posix/Mideast/Riyadh88 posix/Mideast/Riyadh89 posix/NZ posix/NZ-CHAT posix/Navajo posix/PRC posix/PST8PDT posix/Pacific/ posix/Pacific/Apia posix/Pacific/Auckland posix/Pacific/Chatham posix/Pacific/Chuuk posix/Pacific/Easter posix/Pacific/Efate posix/Pacific/Enderbury posix/Pacific/Fakaofo posix/Pacific/Fiji posix/Pacific/Funafuti posix/Pacific/Galapagos posix/Pacific/Gambier posix/Pacific/Guadalcanal posix/Pacific/Guam posix/Pacific/Honolulu posix/Pacific/Johnston posix/Pacific/Kiritimati posix/Pacific/Kosrae posix/Pacific/Kwajalein posix/Pacific/Majuro posix/Pacific/Marquesas posix/Pacific/Midway posix/Pacific/Nauru posix/Pacific/Niue posix/Pacific/Norfolk posix/Pacific/Noumea posix/Pacific/Pago_Pago posix/Pacific/Palau posix/Pacific/Pitcairn posix/Pacific/Pohnpei posix/Pacific/Ponape posix/Pacific/Port_Moresby posix/Pacific/Rarotonga posix/Pacific/Saipan posix/Pacific/Samoa posix/Pacific/Tahiti posix/Pacific/Tarawa posix/Pacific/Tongatapu posix/Pacific/Truk posix/Pacific/Wake posix/Pacific/Wallis posix/Pacific/Yap posix/Poland posix/Portugal posix/ROC posix/ROK posix/Singapore posix/Turkey posix/UCT posix/US/ posix/US/Alaska posix/US/Aleutian posix/US/Arizona posix/US/Central posix/US/East-Indiana posix/US/Eastern posix/US/Hawaii posix/US/Indiana-Starke posix/US/Michigan posix/US/Mountain posix/US/Pacific posix/US/Pacific-New posix/US/Samoa posix/UTC posix/Universal posix/W-SU posix/WET posix/Zulu posixrules right/ right/Africa/ right/Africa/Abidjan right/Africa/Accra right/Africa/Addis_Ababa right/Africa/Algiers right/Africa/Asmara right/Africa/Asmera right/Africa/Bamako right/Africa/Bangui right/Africa/Banjul right/Africa/Bissau right/Africa/Blantyre right/Africa/Brazzaville right/Africa/Bujumbura right/Africa/Cairo right/Africa/Casablanca right/Africa/Ceuta right/Africa/Conakry right/Africa/Dakar right/Africa/Dar_es_Salaam right/Africa/Djibouti right/Africa/Douala right/Africa/El_Aaiun right/Africa/Freetown right/Africa/Gaborone right/Africa/Harare right/Africa/Johannesburg right/Africa/Kampala right/Africa/Khartoum right/Africa/Kigali right/Africa/Kinshasa right/Africa/Lagos right/Africa/Libreville right/Africa/Lome right/Africa/Luanda right/Africa/Lubumbashi right/Africa/Lusaka right/Africa/Malabo right/Africa/Maputo right/Africa/Maseru right/Africa/Mbabane right/Africa/Mogadishu right/Africa/Monrovia right/Africa/Nairobi right/Africa/Ndjamena right/Africa/Niamey right/Africa/Nouakchott right/Africa/Ouagadougou right/Africa/Porto-Novo right/Africa/Sao_Tome right/Africa/Timbuktu right/Africa/Tripoli right/Africa/Tunis right/Africa/Windhoek right/America/ right/America/Adak right/America/Anchorage right/America/Anguilla right/America/Antigua right/America/Araguaina right/America/Argentina/ right/America/Argentina/Buenos_Aires right/America/Argentina/Catamarca right/America/Argentina/ComodRivadavia right/America/Argentina/Cordoba right/America/Argentina/Jujuy right/America/Argentina/La_Rioja right/America/Argentina/Mendoza right/America/Argentina/Rio_Gallegos right/America/Argentina/Salta right/America/Argentina/San_Juan right/America/Argentina/San_Luis right/America/Argentina/Tucuman right/America/Argentina/Ushuaia right/America/Aruba right/America/Asuncion right/America/Atikokan right/America/Atka right/America/Bahia right/America/Bahia_Banderas right/America/Barbados right/America/Belem right/America/Belize right/America/Blanc-Sablon right/America/Boa_Vista right/America/Bogota right/America/Boise right/America/Buenos_Aires right/America/Cambridge_Bay right/America/Campo_Grande right/America/Cancun right/America/Caracas right/America/Catamarca right/America/Cayenne right/America/Cayman right/America/Chicago right/America/Chihuahua right/America/Coral_Harbour right/America/Cordoba right/America/Costa_Rica right/America/Cuiaba right/America/Curacao right/America/Danmarkshavn right/America/Dawson right/America/Dawson_Creek right/America/Denver right/America/Detroit right/America/Dominica right/America/Edmonton right/America/Eirunepe right/America/El_Salvador right/America/Ensenada right/America/Fort_Wayne right/America/Fortaleza right/America/Glace_Bay right/America/Godthab right/America/Goose_Bay right/America/Grand_Turk right/America/Grenada right/America/Guadeloupe right/America/Guatemala right/America/Guayaquil right/America/Guyana right/America/Halifax right/America/Havana right/America/Hermosillo right/America/Indiana/ right/America/Indiana/Indianapolis right/America/Indiana/Knox right/America/Indiana/Marengo right/America/Indiana/Petersburg right/America/Indiana/Tell_City right/America/Indiana/Vevay right/America/Indiana/Vincennes right/America/Indiana/Winamac right/America/Indianapolis right/America/Inuvik right/America/Iqaluit right/America/Jamaica right/America/Jujuy right/America/Juneau right/America/Kentucky/ right/America/Kentucky/Louisville right/America/Kentucky/Monticello right/America/Knox_IN right/America/La_Paz right/America/Lima right/America/Los_Angeles right/America/Louisville right/America/Maceio right/America/Managua right/America/Manaus right/America/Marigot right/America/Martinique right/America/Matamoros right/America/Mazatlan right/America/Mendoza right/America/Menominee right/America/Merida right/America/Mexico_City right/America/Miquelon right/America/Moncton right/America/Monterrey right/America/Montevideo right/America/Montreal right/America/Montserrat right/America/Nassau right/America/New_York right/America/Nipigon right/America/Nome right/America/Noronha right/America/North_Dakota/ right/America/North_Dakota/Beulah right/America/North_Dakota/Center right/America/North_Dakota/New_Salem right/America/Ojinaga right/America/Panama right/America/Pangnirtung right/America/Paramaribo right/America/Phoenix right/America/Port-au-Prince right/America/Port_of_Spain right/America/Porto_Acre right/America/Porto_Velho right/America/Puerto_Rico right/America/Rainy_River right/America/Rankin_Inlet right/America/Recife right/America/Regina right/America/Resolute right/America/Rio_Branco right/America/Rosario right/America/Santa_Isabel right/America/Santarem right/America/Santiago right/America/Santo_Domingo right/America/Sao_Paulo right/America/Scoresbysund right/America/Shiprock right/America/St_Barthelemy right/America/St_Johns right/America/St_Kitts right/America/St_Lucia right/America/St_Thomas right/America/St_Vincent right/America/Swift_Current right/America/Tegucigalpa right/America/Thule right/America/Thunder_Bay right/America/Tijuana right/America/Toronto right/America/Tortola right/America/Vancouver right/America/Virgin right/America/Whitehorse right/America/Winnipeg right/America/Yakutat right/America/Yellowknife right/Antarctica/ right/Antarctica/Casey right/Antarctica/Davis right/Antarctica/DumontDUrville right/Antarctica/Macquarie right/Antarctica/Mawson right/Antarctica/McMurdo right/Antarctica/Palmer right/Antarctica/Rothera right/Antarctica/South_Pole right/Antarctica/Syowa right/Antarctica/Vostok right/Arctic/ right/Arctic/Longyearbyen right/Asia/ right/Asia/Aden right/Asia/Almaty right/Asia/Amman right/Asia/Anadyr right/Asia/Aqtau right/Asia/Aqtobe right/Asia/Ashgabat right/Asia/Ashkhabad right/Asia/Baghdad right/Asia/Bahrain right/Asia/Baku right/Asia/Bangkok right/Asia/Beirut right/Asia/Bishkek right/Asia/Brunei right/Asia/Calcutta right/Asia/Choibalsan right/Asia/Chongqing right/Asia/Chungking right/Asia/Colombo right/Asia/Dacca right/Asia/Damascus right/Asia/Dhaka right/Asia/Dili right/Asia/Dubai right/Asia/Dushanbe right/Asia/Gaza right/Asia/Harbin right/Asia/Ho_Chi_Minh right/Asia/Hong_Kong right/Asia/Hovd right/Asia/Irkutsk right/Asia/Istanbul right/Asia/Jakarta right/Asia/Jayapura right/Asia/Jerusalem right/Asia/Kabul right/Asia/Kamchatka right/Asia/Karachi right/Asia/Kashgar right/Asia/Kathmandu right/Asia/Katmandu right/Asia/Kolkata right/Asia/Krasnoyarsk right/Asia/Kuala_Lumpur right/Asia/Kuching right/Asia/Kuwait right/Asia/Macao right/Asia/Macau right/Asia/Magadan right/Asia/Makassar right/Asia/Manila right/Asia/Muscat right/Asia/Nicosia right/Asia/Novokuznetsk right/Asia/Novosibirsk right/Asia/Omsk right/Asia/Oral right/Asia/Phnom_Penh right/Asia/Pontianak right/Asia/Pyongyang right/Asia/Qatar right/Asia/Qyzylorda right/Asia/Rangoon right/Asia/Riyadh right/Asia/Riyadh87 right/Asia/Riyadh88 right/Asia/Riyadh89 right/Asia/Saigon right/Asia/Sakhalin right/Asia/Samarkand right/Asia/Seoul right/Asia/Shanghai right/Asia/Singapore right/Asia/Taipei right/Asia/Tashkent right/Asia/Tbilisi right/Asia/Tehran right/Asia/Tel_Aviv right/Asia/Thimbu right/Asia/Thimphu right/Asia/Tokyo right/Asia/Ujung_Pandang right/Asia/Ulaanbaatar right/Asia/Ulan_Bator right/Asia/Urumqi right/Asia/Vientiane right/Asia/Vladivostok right/Asia/Yakutsk right/Asia/Yekaterinburg right/Asia/Yerevan right/Atlantic/ right/Atlantic/Azores right/Atlantic/Bermuda right/Atlantic/Canary right/Atlantic/Cape_Verde right/Atlantic/Faeroe right/Atlantic/Faroe right/Atlantic/Jan_Mayen right/Atlantic/Madeira right/Atlantic/Reykjavik right/Atlantic/South_Georgia right/Atlantic/St_Helena right/Atlantic/Stanley right/Australia/ right/Australia/ACT right/Australia/Adelaide right/Australia/Brisbane right/Australia/Broken_Hill right/Australia/Canberra right/Australia/Currie right/Australia/Darwin right/Australia/Eucla right/Australia/Hobart right/Australia/LHI right/Australia/Lindeman right/Australia/Lord_Howe right/Australia/Melbourne right/Australia/NSW right/Australia/North right/Australia/Perth right/Australia/Queensland right/Australia/South right/Australia/Sydney right/Australia/Tasmania right/Australia/Victoria right/Australia/West right/Australia/Yancowinna right/Brazil/ right/Brazil/Acre right/Brazil/DeNoronha right/Brazil/East right/Brazil/West right/CET right/CST6CDT right/Canada/ right/Canada/Atlantic right/Canada/Central right/Canada/East-Saskatchewan right/Canada/Eastern right/Canada/Mountain right/Canada/Newfoundland right/Canada/Pacific right/Canada/Saskatchewan right/Canada/Yukon right/Chile/ right/Chile/Continental right/Chile/EasterIsland right/Cuba right/EET right/EST right/EST5EDT right/Egypt right/Eire right/Etc/ right/Etc/GMT right/Etc/GMT+0 right/Etc/GMT+1 right/Etc/GMT+10 right/Etc/GMT+11 right/Etc/GMT+12 right/Etc/GMT+2 right/Etc/GMT+3 right/Etc/GMT+4 right/Etc/GMT+5 right/Etc/GMT+6 right/Etc/GMT+7 right/Etc/GMT+8 right/Etc/GMT+9 right/Etc/GMT-0 right/Etc/GMT-1 right/Etc/GMT-10 right/Etc/GMT-11 right/Etc/GMT-12 right/Etc/GMT-13 right/Etc/GMT-14 right/Etc/GMT-2 right/Etc/GMT-3 right/Etc/GMT-4 right/Etc/GMT-5 right/Etc/GMT-6 right/Etc/GMT-7 right/Etc/GMT-8 right/Etc/GMT-9 right/Etc/GMT0 right/Etc/Greenwich right/Etc/UCT right/Etc/UTC right/Etc/Universal right/Etc/Zulu right/Europe/ right/Europe/Amsterdam right/Europe/Andorra right/Europe/Athens right/Europe/Belfast right/Europe/Belgrade right/Europe/Berlin right/Europe/Bratislava right/Europe/Brussels right/Europe/Bucharest right/Europe/Budapest right/Europe/Chisinau right/Europe/Copenhagen right/Europe/Dublin right/Europe/Gibraltar right/Europe/Guernsey right/Europe/Helsinki right/Europe/Isle_of_Man right/Europe/Istanbul right/Europe/Jersey right/Europe/Kaliningrad right/Europe/Kiev right/Europe/Lisbon right/Europe/Ljubljana right/Europe/London right/Europe/Luxembourg right/Europe/Madrid right/Europe/Malta right/Europe/Mariehamn right/Europe/Minsk right/Europe/Monaco right/Europe/Moscow right/Europe/Nicosia right/Europe/Oslo right/Europe/Paris right/Europe/Podgorica right/Europe/Prague right/Europe/Riga right/Europe/Rome right/Europe/Samara right/Europe/San_Marino right/Europe/Sarajevo right/Europe/Simferopol right/Europe/Skopje right/Europe/Sofia right/Europe/Stockholm right/Europe/Tallinn right/Europe/Tirane right/Europe/Tiraspol right/Europe/Uzhgorod right/Europe/Vaduz right/Europe/Vatican right/Europe/Vienna right/Europe/Vilnius right/Europe/Volgograd right/Europe/Warsaw right/Europe/Zagreb right/Europe/Zaporozhye right/Europe/Zurich right/Factory right/GB right/GB-Eire right/GMT right/GMT+0 right/GMT-0 right/GMT0 right/Greenwich right/HST right/Hongkong right/Iceland right/Indian/ right/Indian/Antananarivo right/Indian/Chagos right/Indian/Christmas right/Indian/Cocos right/Indian/Comoro right/Indian/Kerguelen right/Indian/Mahe right/Indian/Maldives right/Indian/Mauritius right/Indian/Mayotte right/Indian/Reunion right/Iran right/Israel right/Jamaica right/Japan right/Kwajalein right/Libya right/MET right/MST right/MST7MDT right/Mexico/ right/Mexico/BajaNorte right/Mexico/BajaSur right/Mexico/General right/Mideast/ right/Mideast/Riyadh87 right/Mideast/Riyadh88 right/Mideast/Riyadh89 right/NZ right/NZ-CHAT right/Navajo right/PRC right/PST8PDT right/Pacific/ right/Pacific/Apia right/Pacific/Auckland right/Pacific/Chatham right/Pacific/Chuuk right/Pacific/Easter right/Pacific/Efate right/Pacific/Enderbury right/Pacific/Fakaofo right/Pacific/Fiji right/Pacific/Funafuti right/Pacific/Galapagos right/Pacific/Gambier right/Pacific/Guadalcanal right/Pacific/Guam right/Pacific/Honolulu right/Pacific/Johnston right/Pacific/Kiritimati right/Pacific/Kosrae right/Pacific/Kwajalein right/Pacific/Majuro right/Pacific/Marquesas right/Pacific/Midway right/Pacific/Nauru right/Pacific/Niue right/Pacific/Norfolk right/Pacific/Noumea right/Pacific/Pago_Pago right/Pacific/Palau right/Pacific/Pitcairn right/Pacific/Pohnpei right/Pacific/Ponape right/Pacific/Port_Moresby right/Pacific/Rarotonga right/Pacific/Saipan right/Pacific/Samoa right/Pacific/Tahiti right/Pacific/Tarawa right/Pacific/Tongatapu right/Pacific/Truk right/Pacific/Wake right/Pacific/Wallis right/Pacific/Yap right/Poland right/Portugal right/ROC right/ROK right/Singapore right/Turkey right/UCT right/US/ right/US/Alaska right/US/Aleutian right/US/Arizona right/US/Central right/US/East-Indiana right/US/Eastern right/US/Hawaii right/US/Indiana-Starke right/US/Michigan right/US/Mountain right/US/Pacific right/US/Pacific-New right/US/Samoa right/UTC right/Universal right/W-SU right/WET right/Zulu  . ..MAKEDEVconsole tty memkmemnullzerostdinstdoutstderrksymsklogeepromopenprombpf0 biodiskmapfd0afd0bfd0cfd0irfd0arfd0brfd0crfd0isd0arsd0asd0brsd0bsd0crsd0csd0drsd0dsd0ersd0esd0frsd0fsd0grsd0gsd0hrsd0hsd0irsd0isd0jrsd0jsd0krsd0ksd0lrsd0lsd0mrsd0msd0nrsd0nsd0orsd0osd0prsd0psd1arsd1asd1brsd1bsd1crsd1csd1drsd1dsd1ersd1esd1frsd1fsd1grsd1gsd1hrsd1hsd1irsd1isd1jrsd1jsd1krsd1ksd1lrsd1lsd1mrsd1msd1nrsd1nsd1orsd1osd1prsd1psd2arsd2asd2brsd2bsd2crsd2csd2drsd2dsd2ersd2esd2frsd2fsd2grsd2gsd2hrsd2hsd2irsd2isd2jrsd2jsd2krsd2ksd2lrsd2lsd2mrsd2msd2nrsd2nsd2orsd2osd2prsd2prd0arrd0ard0crrd0ccd0arcd0acd0c rcd0ccloseallnfs_mountobp_xmitoopenbendbootfile__ashrdi3crc32nfs_statinflatePrimenoioctlreadgateipnetif_putpeekcharfile_system_ufsnfsysprom_nextsiblingstrncpyprom_initnet_closesocketsufs_seekarp_listfilespanicbp_server_portsendudpinflateResetmemcmp_uremxdr_inaddr_encodeinflateSyncfile_systemufs_readmemsetmainarp_replyufs_opengetcharinet_ntoanfs_seekifnamereadudpprom_findnodecd9660_closecngetcstrcmpzcallocsocktodescxdr_string_encodegetdevtypecrc32_combinedomainnamelenprom_open.urem.rempmap_extractrpc_pmap_nummmu_initxdr_inaddr_decodeobp_recvprom_getproplendvma_mapinprom0_closenetif_getdbufprom_boothowufs_readdirnullsysin_cksumprom0_xmitkdoprntexit_divufs_writestartfile_system_nfsbceaprom_getpropstringarpwhohasufs_stat__muldi3netif_closeinflateSetDictionarystrlenopenreadether.umulprom_firstchild__data_startinflateEnddevswprom0_iopenobp_closeinflateInit2_dvma_freepmap_mapcloseprom_bootfileget_crc_tablefbufinflate_tablefreelistrpc_pmap_putcachefree#!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]=";chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]=";chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]=";chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]=";chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 bio diskmap R fd0 sd0 sd1 sd2 rd0 cd0 ;; std) M console c 0 0 600 M tty c 2 0 M mem c 3 0 640 kmem M kmem c 3 1 640 kmem M null c 3 2 M zero c 3 12 M stdin c 24 0 M stdout c 24 1 M stderr c 24 2 M ksyms c 122 0 640 kmem M klog c 16 0 600 M eeprom c 3 11 640 kmem M openprom c 70 0 640 kmem ;; vscsi*) M vscsi$U c 128 $U 600 ;; uk*) M uk$U c 120 $U 640 operator ;; tun*) M tun$U c 111 $U 600 ;; systrace) M systrace c 50 0 644 ;; *random) n=0 for pre in " " s u a do M ${pre}random c 119 $n 644 n=$(($n+1)) done ;; pppx*) M pppx$U c 130 $U 600 ;; pf*) M pf c 59 0 600 ;; openprom) M openprom c 70 0 ;; nnpfs*) M nnpfs$U c 51 $U 600 ;; lkm) M lkm c 112 0 640 _lkm ;; hotplug) M hotplug c 131 $U 400 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 24 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; diskmap) M diskmap c 129 0 640 operator ;; bpf*) M bpf$U c 105 $U 600 ;; bio) M bio c 124 0 600 ;; audio*) M sound$U c 69 $U M mixer$U c 69 $(($U+16)) M audio$U c 69 $(($U+128)) M audioctl$U c 69 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 30 0 644 M apmctl c 30 8 644 ;; wsmouse[0-9]*) M wsmouse$U c 80 $U 600 ;; wsmux|wsmouse|wskbd) M wsmouse c 81 0 600 M wskbd c 81 1 600 ;; wskbd[0-9]*) M wskbd$U c 79 $U 600 ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyIcfg ttyI0 ttyI1 ttyI2 ttyI3 ttyI4 ttyI5 R ttyI6 ttyI7 ttyI8 ttyI9 ttyIa ttyIb ttyHcfg ttyH0 ttyH1 R ttyH2 ttyH3 ttyH4 ttyH5 ttyH6 ttyH7 ttyH8 ttyH9 ttyHa ttyHb R ttyGcfg ttyG0 ttyG1 ttyG2 ttyG3 ttyG4 ttyG5 ttyG6 ttyG7 R ttyG8 ttyG9 ttyGa ttyGb ttyFcfg ttyF0 ttyF1 ttyF2 ttyF3 R ttyF4 ttyF5 ttyF6 ttyF7 ttyF8 ttyF9 ttyFa ttyFb ttyEcfg R ttyE0 ttyE1 ttyE2 ttyE3 ttyE4 ttyE5 ttyE6 ttyE7 ttyE8 ttyE9 R ttyEa ttyEb ttyDcfg ttyD0 ttyD1 ttyD2 ttyD3 ttyD4 ttyD5 R ttyD6 ttyD7 ttyD8 ttyD9 ttyDa ttyDb ttyCcfg ttyC0 ttyC1 R ttyC2 ttyC3 ttyC4 ttyC5 ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 78 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 78 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; bpp*) M bpp$U c 104 $U 600 ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 20 $(($off+$n)) M pty$nam c 21 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 125 0 666 ;; tty[a-z]) u=${i#tty*} case $u in a) n=0 ;; b) n=1 ;; c) n=2 ;; d) n=3 ;; e) n=4;; f) n=5;; *) echo unknown tty device $i ;; esac M tty$u c 12 $n 660 dialer uucp ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 36 $o 660 dialer uucp M cua$U c 36 $(($o+128)) 660 dialer uucp ;; spif*) case $U in 0) offset=0 nam=j;; 1) offset=16 nam=k;; 2) offset=32 nam=l;; *) echo "bad unit for $i: $U"; exit 127;; esac offset=$(($U*64)) n=0 while [ $n -lt 8 ] do name=${nam}`hex $n` M tty$name c 102 $(($offset+$n)) 660 dialer uucp n=$(($n+1)) done M bpp${nam}0 c 103 $(($offset+0)) 600 ;; magma*) case $U in 0) offset=0 nam=m;; 1) offset=16 nam=n;; 2) offset=32 nam=o;; *) echo "bad unit for $i: $U"; exit 127;; esac offset=$(($U*64)) n=0 while [ $n -lt 16 ] do name=${nam}`hex $n` M tty$name c 100 $(($offset+$n)) 660 dialer uucp n=$(($n+1)) done M bpp${nam}0 c 101 $(($offset+0)) 600 M bpp${nam}1 c 101 $(($offset+1)) 600 ;; cua[a-z]) u=${i#cua*} case $u in a) n=0 ;; b) n=1 ;; c) n=2 ;; d) n=3 ;; e) n=4;; f) n=5;; *) echo unknown cua device $i ;; esac M cua$u c 12 $(($n+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 11 $n 660 operator M ${pre}rst$U c 18 $n 660 operator n=$(($n+1)) done ;; ch*) M ch$U c 19 $U 660 operator ;; vnd*) dodisk vnd $U 8 110 $U 0 dodisk svnd $U 8 110 $U 2048 ;; rd*) dodisk2 rd $U 17 106 $U 0 ;; fd*) typnam=$U${i#fd[01]*} case $typnam in 0|1) typnum=0;; # no type specified, assume A *A) typnum=0; typnam=0;; *B) typnum=1;; *C) typnum=2;; *D) typnum=3;; *E) typnum=4;; *F) typnum=5;; *G) typnum=6;; *H) typnum=7;; *) echo bad type $typnam for $i; exit 1;; esac case $U in 0|1) blk=16; chr=54;; *) echo bad unit $U for $i; exit 1;; esac nam=fd${typnam} n=$(($(($U*128))+$(($typnum*16)))) M ${nam}a b $blk $n 640 operator M ${nam}b b $blk $(($n+1)) 640 operator M ${nam}c b $blk $(($n+2)) 640 operator M ${nam}i b $blk $(($n+8)) 640 operator M r${nam}a c $chr $n 640 operator M r${nam}b c $chr $(($n+1)) 640 operator M r${nam}c c $chr $(($n+2)) 640 operator M r${nam}i c $chr $(($n+8)) 640 operator ;; cd*) dodisk2 cd $U 18 58 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R presto0 bpp0 ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 R sd1 sd2 sd3 sd4 cd0 cd1 rd0 xy0 xy1 xy2 xy3 tun0 tun1 tun2 R tun3 bpf0 bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 pty0 R fd1 fd1B fd1C fd1D fd1E fd1F fd1G fd1H fd0 fd0B fd0C fd0D R fd0E fd0F fd0G fd0H diskmap vscsi0 nnpfs0 ch0 bio cuaa cuab R cuac cuad ttya ttyb ttyc ttyd hotplug ptm local wscons R audio0 audio1 audio2 uk0 random lkm tty00 tty01 tty02 tty03 R apm pf systrace xd0 xd1 xd2 xd3 raid0 raid1 raid2 raid3 std R st0 st1 fd ;; presto*|xd*|xy*|sd*|raid*|ccd*) case $i in presto*) dodisk presto $U 26 25 $U 0;; xd*) dodisk xd $U 10 42 $U 0;; xy*) dodisk xy $U 3 9 $U 0;; sd*) dodisk sd $U 7 17 $U 0;; raid*) dodisk raid $U 25 123 $U 0;; ccd*) dodisk ccd $U 9 23 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} ec.Vsun4c compatiblecr .( OpenBSD/sparc: this kernel does not support the sun4d) cr.Vd'(^ <<d d@HIG1vFED-|u @@5w@H0  ([([([([([([([([([([([([([([([p([h                          vTUVWa_Y\]^XgZ[`jicehSbfGHIJKFEDwxyzLMNO#$%:;<#$|} !:;=>?@A(2&=?. . .w.{L.h.|.w.{...w.{/V/W.w.{...w.{...w.{...w.{...w.{...w.{...xX.{.8.L.w.{.8.L.xX.{.8.L.x`.{...xh.{.`.t.w.{.`.t.xX.{.`.t.xp.{..$.x`.{...xX.{...w.{...xX.{. . .w.{//.w.{//.xX.{//.x.{//.w.{//.xX.{//.x.{//.w.{//.xX.{//.x.{//.x.{//.w.{//.xX.{//.w.{r//.w.{//.w.{//.w.{+7/8.x.{&/h/|.x.{&//.x.{&//.x.{6//,.x.{6/@/T.x.{6/h/|.x.{6//.x.{6//.x.{6//.x.{6/ / .x.{6/ 0/ D.x.{6/ / .w.{/ / .xX.{/ / .xX.{/ ,/ @.xX.{/ T/ h.xX.{/ |/ .xX.{/ / .xX.{/ / .xX.{/ / .x.{/ / .xX.{f/ / .xX.{V/ / 0.xX.{f/ / 0.xX.{f/ D/ X.xX.{f/ D/ X.xX.{V/ l/ .xX.{V/ / .w.{'/ / .w.{'/ ..xX.{V/ ..xX.{V/ / .xX.{V/ 4..xx.{/ 4..xX.{f/ 4..w.{~'/ 4..xX.{V/ 4..w.{^'/ / .w.{/ / .xX.{/ / .xX.{f/ / .xX.{f//.x.z(//.x.{m/|/h.x.{p/NX/Nl.xX.{V/N/N.xX.{f/N/N.x.{/N/N.x.{/N/N.xX.{V/N/O .x.{/OH/O\.x.{/O/O.x.{/O/O.x.{/O/O.xX.{V/O/O.x.{/O/O.xX.{V/P8/PL.xX.{V/P/P.xX.{V/Q/Q.x4.{r/QP/Qd.xX.{V/Q/Q.xX.{V/Q/Q.xX.{/R/R,.xX.{V/R/R.xX.{V+8/S.xX.{V/SL/S`.xX.{V/S/S.xX.{V/S/T.xX.{V/T..w.{u/T..w.{u/T..xX.{f/T..x.{/T..w.{u/T..w.{u/T..xX.{V/TXhhi(ppTisbDc$g8gh3$233''3L''333< @ @(`..)` aT T H  0 \TT  )gi)4T֘,) Pׄl 34)H h)@ 2<)8 )0s)(sl) s)3|)4$).h)up)n)r\)t)r)r)r)r)t`)t)s)t)t)u)xu$)h)`uX)Xt4)PP)(xP) x\)xl)x|)x)x))@)t)t))H)))nL)nL)n`))))))),)xh)ph)hy`)`v)X h)@ 2<)P.)H.H)@u)80)0x)y||~~P~X~`xx3߸3߸P.6)@.p)8.)(.l).d).h).4. 32)`)X)P)p)h)X))))))x)x))x)x))))))))))))@ɜɬT) !<  T) ) ) x) p) h) `) X) P-Pa ##$ 33PX hTF L PN RR CE ST NM 0 HCL 0PL 0RE 8@RR CE ST SL RR CE ST ER CE ST   ( d 0 PP ( d \         P P   (  0Pl d \ռ8߬ H  P  ( 0 0(PH0 d \00pҼt ,00 0000 P00@ U U V = Vl G A \ G W G V0 H OD T \ T  .4 s`.native&L9.0 h& xl znative&L9.0 & )7)7)7 l d    4 d !Z l|  T4 l !Zp k$t{ vt l l 6  H  @ 0Ttt~, t!X k!X & ml  %  m< P |H | L  t  9x@  x  !YL!@!]D l  l l!]X lP   l l D m z, k n "!? l !@|!C!@< \ l   l ~   !R }!V\!T& d` l !Fl!E!Et !E !UX !V l 4  l 8 T  h!U, u uT!Z<!Z Ь@4 l l !S!@h!C!D4!D!G m~!Z !T4 l l l lJ@!Z l l l l@ l l l'U l l l l l l ll l l l l l l xh yx w l l l l l l ld d d , x t l Ĕ ld k l < < < < < < < < < < l ` l l l J K M o l o8 l   T l l l l l  l l l l l l l l l h 8 "x m  l8 < l l l l l l4 l ld ڼ ۔<Ŭ  l l l l l l l o p r sh l    w  cD ¸ [X r  Hd @ kT T P  È` p D`` L T \ d  T | `  ՜ ـ 4 h.4.4.4.$..D .)C)C)C)C)Cp)Ch)C`)CX)CP)C@)C8)C0)C()C)C)C)B)B)B)B)B)B)B)B)B)B)B)B)Bx)Bh)BX)BH)B8)B()B)B)B)A)A)A)A)A)A)A)A)A)Ax)Ah)A`)AP)AH)A8)A0)A )A)A)@)@)@)@)@)@)@)@)@)@)@x)@h)@X)@H)@8)@()@)@)?)?)?)?)?)?)?)?)?)?x)?p)C 0  ƴ @...d)Q)QB@)S.{)V()V)V. H . Ǹ  ET )k)k)k)k)k)k)k)k)k)kx)kp)kh)k`)kX)kP)kH)k@)k8)k0)k()k )k)k)kX)k)k)j)j)j)j)j)k8)j)j * ,$ / 0 3\ 1x 2$ 3 4 3 4 B| B B DX F` Fttyclsttyopnttybgttyinttyout D  | < H  }  h  | | < H  }  h  |, xd |hHL0X͌ h  | 8 H  D  h H  h  hD H   h )xH @  `  $0@)z0.x.x6h776\)P ..xLP*tffs*mfs*0ext2fs)-cd9660)msdos*dnfs*nnpfs)/Xudf .2lockf@` )))))))))))))))))))))))))))))))x)p)h   stt (08 hʰ   Ʉɼ \ 0 ( H0  (00pҼth,00(0000 00@0Ԉ Plռ8߬H H . ..  h\hhdD|k<hPCA`T(EDTTCtCkTjJaPhTThU\L`PGiDa(M t.. .0123456789abcdef^^3333)))8)))stx#$%&'()*+;,-.;/;0;1B@2T 3T 4T 56T 7T cdeB@B@LK@O[T@n6%Ql7Jpp@@@@ j j j@)h.ΐ..)8d0123456789abcdef#2F$We6tHZl~3"VG,ud>ɍ@ۮRdv!0g&vD4UJÎXn|1 wf.TE<ˬBُPftBSap '26L^׈hzRC q`(7&:DV`rcr@Q%"40N\թjxsbPA5$*8FTbp,ӥ>@+R:Nd_mv|ҭ$6 H;*Z^Ol}l~ .<ѵ)B8 Pof~Lt]&н49(J Xnn\M| ׅ(:JD[iVx `/r>֍ 2ZKLyh^ h?.zՕ*8kFzHTY-b<pԝ"0{jNXI\=,jxiiiiiiiiiiiiiiii0123456789abcdefܘh<ڔܴh@ڔph$< $ph$< $          ))x)p)`)P)@)())p(@)Ède)ø)Ę)Ġ .Ф. fPh7d<a6\):..)) )ʐl)Ϡ),2.$xh.@ `Ӵ.l"Ƥd\Ϭ. d.o dk,z.d9.a:dD.).:. d#$&.3UW,dT.2Wt]dT.lXdU<./d.7@d@.pxd.|d.bdfbiL. d)0. .1 dd.4.0dX.\.`.h.p.d}E#(D<8Q @X,..(.0.<.. ...X......... .... .$4(@AAA==(A*E@ dd%(i @@@@@@@@@@..545(.... .$.$.....)9H9P9\9d4)PX )llpLp{T))߰|$,.ڤ.....))))帀*KP @HPX*W ,|*Wh*W8*WHd *W  \*W$*W$*W$*W @ |@ *X *X8@(0*X X@  *X  `@VPWD*X0 `@xt*X@ @XT\l*XP00g$hP*X`@@ ]\Dg*Xp4 @*X4 @*X$4 @ *XX  *X`VPWD *XX  *X`VPWD*XZd*XZ.Hx @.H  @.H  @!*Zx..H1  ....*_H*`( @@      ?BEFF'' EF''' ?F''F'' F''' F'' EF'' ?EF''' ?EF''' ?EF''' ?EF'''' ?F'' ?BF''' ?BEF''' ?EF''' F'''' F'''''F''FF''FF''F''........ .$.@.\.x......(.>.J.T.^lN@R\ZIa\fpxx,ÌH|, dpv@hvA ~L@t\`TpLjBd4wGh PhvAռ8߬TlBw 0(P0hvA00pҼtT000000w00@*r*r*r*seL` 6`p} dl $kP ԈP@h@ X tdؘ lP  Ԉռ8߬tؘ 0l(P0 Ԉ00pҼt000000ؘ00@*x*w*w*w*w*w*w*w*w*w*wx*wp*wh*wX kkkPjklkkh\kkkh4kkkpkkkkLkkkkkhdkk*** ... ...l 8 d'Pl 6HP0Gl X]\E0|THx`p P  6Hռ8߬T 0(P0 6H00pҼt00000000@`t(,  T*nnpfsר4\؈hЬҸЌl |lpP׌ӄԀ<0p   \...*ր`p*@0123456789abcdefdd...):< . `.l!`ƤϬ. D ʰ р.:F D ʰ @Xvh.<).+ ..,+.3^T.2` T.laU<.) D ʰ . D ʰ .gD D ʰ L.p D ʰ . ʰH. D ʰ *.0.1@@ X Xd.<.@.D.H.L.P.T.H.D.`.X.\.d @E8(@AAA==(A*......(...... ........ .$gQ .h.h +(|0.6h L7 ٴ`~~bb<,`b~ `~B`bBBBbvvBb~ ~ b~<,`@ ~ `~BvBBBBF@BvvBv!f!f+ (@!r!s+ @!r!wL+ @!r!v+ @!r!x+ 0!\!+H 0!$!+0!!H+0!!+0!|!,+ 0!x+C+B+B+B+B+B+B+B+B+Bp+B`+BP+B@+B0+B+B<"<"D""x+8"H"t""L+h"4"`+(+X+P+HKH"$"P""(+h#h##X#(+h4#8#8+X#: #;#=X+h#H#H#J+Px#V`#V+(x#]#V+0H#et#e+\#g<#gx+p+px#m#m+P#D#h(##S###T#+(##x?"0#`#t#####$#@#\#######$#@#\##+amd7930xaudioamd#t####T#\##@######\#T#p#π#ϸ#L#P#\#l#լ###4###h#####X+SUNW,CS4231aonboard1@%+>IV"k}3 3 D +##(#$$$+$@$@$D$Dd2d$I$K@$LL$M$T++#aa@(([//\))](-{/-|)-}!!c/l-y-soxoco<<>>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy+H$o$o$pH$p4$|$|@$y$~$$$t$,++p+h+`+X+P+H+@+8+0+(+ +++۸+۰+ۨ+۠+ۘ+ې+ۈ+ۀ+xBoldface.iso1 /pwfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xp/0/!p  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ް/Hp/Ip2/Ix)/Ia/I/JH/J`/K/K/K$/K4/KD/KT/Kd  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/Lo/L/M@/MH/MX/Mh/Kt&/Mx!$$ܐ$$<+$$$4|$H$+$$$4#dx$$$+$$0#dt$$t+$,$($$$+$$$|$4$+% |% % %%+ 1+$A'* + + %`% % % +X%<%h%|%H%+%% % |%D%+%,%.%0,%*8%*|+4%8%8$+P%;%>d%AX%8t%8+p9100_romfontE!c%R%S%T%P0%P+%Z%^ %]+P%ld%m%nh|%i%j+%qd%r%w%oD%o+%z%{%%w%w+(%\%++++*8%\%+%%+%h%+%\%, &&H,  P&.h0&)&*,0&)&*,&?&A&B&B&D&F, &@&B<&B&B&D&F,d&:&;   0&&--8--0 -( -- --- & &&t&&p& ` nL ""`""# $#  ( <  * ,H -, 6H ? >%$%d%%P%%####%\#8 !!H!4!!! """|"4"d"X < < < < < <   AH A B C C C| DD  D  \ P   &̰&&&& & ڌ      & && & 4&   ڌ   " """""l"     l P  ""`"""   ڌ###$d#$#%\   ڌ"" "$  x h <  ͨ  , h < T  ׀  * ,H 50 5 6H   ڌ    ڌ     ''Ԕ '  'l       ` !0)       %$%d%Ќ%и%P   ڌ         `t(,    !!H!!!   ڌ    """""4   ڌ            \D, $ &p&Ґ &X         #$p$$$$<$8 $$$I$J$Kd $L $S $w$x\$y $y ${ $}$l$@ $ $                   '<''|''p''<  ''''' 'L ''''4' ''  ''''' ' '' '$'  oPop8s8t     ڌ    ( D  <   ڌhju|x,q }@ ~< 2 6h 6  <  <  <  <  <  <  ѐ ј Ѡ  $   ڌ#9#9 #9   %&&$   ڌ   ڌΨΰ θ   7$>8 8 < = FX F` H` Hh Fh   ڌ  \Ԭ հ    |! !/t/u&4&ؘ--------x-h-X-H-8-h-h-h-h-h-(-----------x-h-X-H-8-(-h-h---h-h------h-h-h-h-h-h-h-h-h-h-h-h-h-h-h--h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h---p-`-P-@-0-----h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-h-------h-pޭ-@6<-86@-06D-(6H- 6L-3-6P-6T-6X-6\-6`-6d-6h-6l-6p-6t-6x-6|-6-6-6-6-6-6-6-x6-p6-h6-`6-X6-P6-H6-@6-86-06-(6- 6/{L-'s-----------x-p-h-`-X-P-H-@-8-0-(- -----------h-`-X-P-H-@-8-0-(- ---------------------------H---x---------p-----------------------------@-P-H-@-8-0-(- --------------------- ---¸- -°--¨-- -@- -˜@--˜@--˜@--˜@--˜@--˜@--˜@--˜@--˜@--˜@--˜ @--˜@-¸-˜ @-°-˜@-¨-˜@- -˜--ˆ$-€-ˆ-x-ˆ -p-ˆ -h-ˆ-`-ˆ@-X-P@-H-P@-@-P @-8-P @-0-P @-(-P@- -P@--P@--P@--P@--P@--P@--P@--P@--P@--P-X--H--@- -8- -0- -(-- ---------------------Ȁ ----Ȁ ----ȁ ---- ----Ȁ ----Ȁ ----ȁ ----x --p-h-Ȁ -h--`-Ȁ -`--P-ȁ -P---H --@-8-Ȁ -8--0-Ȁ -0-- -ȁ - --- -- --Ȁ ----Ȁ -- --ȁ -- --Ѐ(--Ȁ( ----Ȁ --(--ȁ( --Ё(--ȁ( -- --Ѐ0--Ȁ0 ----Ȁ --0--ȁ0 --Ё0--ȁ0 -- --Ѐ8--Ȁ8 ----Ȁ --8-x-ȁ8 -x-Ё8-p-ȁ8 -p- -h-Ѐ@-`-Ȁ@ -`--X-Ȁ -X-@-P-H-@-8 -@-0H-(-ȀH -(---ЁH-P--- --P--ȀP ----Ȁ --P-P---Б --ȁ--Ё --ȓ--Г --ȃ--Ѓ --ȕ--Е --ȅ--Ѕ --ȗ--З --ȇ-0-Ї -0-ș--Й --ȉ--Љ --ț--Л --ȋ-x-Ћ -x-ȝ-p-Н -p-ȍ-h-Ѝ -h-ȟ-`-П -`-ȏ-X-Џ -X-ȀX-P-ȀX -P--H-Ȁ -H-X-P-@-8- -8-`-0-Ȁ` -0--(-Ȁ -(-` - -` --` --` --` --` --` --` --` --` --` --` --` --` --` --` --` - -` --` --` --` --` --` --` -x-` --` --` -p-` --` -h-` --` -`-` -X--P-ȁ -P-h-H-Ȁh -H---Ёh-@-ȁh -@--8-ȁ -8-p-0-Ȁp -0--(-Ȁ -(-p- -p - ---Ё --Ѐx--Ȁx ----Ȁ --x$--x--ȁx(--x--ȁx,--x --ȁx4--x--ȁx8--x--ȁx<--x--ȁ----8 --0-- ---- ---x-p -x-h-`-8 -`-0-X- -X---P --H-@-8 -@-0-(-8 -(-0- - - --- ----p --h--8 --0-- ---- ----p --h -- ---- -- -- ---- --(--( ---- --(--( --(--( --x0-p-0 -p--h- -h-0-`-0 -`--X- -X-8-P-8 -P--H- -H-8-P-8 -P--H- -H-@-@-8@ -@-0-8- -8-H-0-8H -0-0-(- -(-P- -8P - -0-- --X-@-8X -@-0-- -- ----h--h ----8 --0h--h ---- --p--p ---- ---- --x--8x --0-- -- --x@-p-x`-h-x-`-x-X-x-P-x -H-x@-@-x`-8-x -0-x@-(-x`- -x --@--`-------- -- @-- `-- -- -- -- -- -- --x@--x`--x--x--x-x-x-p-x-h-x-`-x-X-x -P-x`-H-x-@-x-8-x-0-x -(-x@- -x`--x'} '}`-h4''8-p''-x'P'-x''-ˀ4'$'P-ˈD'p'-̠x''---ΰ-ΐ-x-X-@-0----Ͱ''-''H''-Ѡ'8'h'p'ܸ''' '0'''''-'' '('p'x''''''@''H''-@p'' '\c0' c'c055$s ?/ ޸5/p/5/0/=/p/=/0/(//T(//P/p/U/p//p//p/--ڠ-ژ/0/()`(*(,(,b5= V@t@(.h(/(5(5'`(:(:(=x(>(@(@$.symtab.strtab.shstrtab.text.rodata.data.bss@(h!([h()--///[(S/[(4/\= 1&@([h-/iX 'Pp-ŰL>#T|I 8T6dj6w ѠxDl %P0.\E%G``!(4X5 ( &L&@'rIr`'mx {|$XD! /roPh|@,3 !p.=H2'h?#<K^Yjlth|&!k/..? m<0&d&Vh L/u% P.d=J.DY!`h v4 d. .4% / .`pdR*D D  . 9D>.4E'[''|o.\}̘d/!<#$.  dT0ThT5T !D8$p5 4EQD^ miTvt./}4P%_0(A@p`%8$ K8.P. J95˸DT|Mmc4<}!`%0DD@ l6ڠ.ݘ$ t P%94B\HT8d.<j $8 <v&xn` TT$CXl4! 8 $|"P,xT8!L)ո> HHK X8\'eXxw~$#) \46߀\#H\ . ҸH %"8l` 26( =.( M}, W3d bx0 r4 {"T 4D Z8 4 .  = .p $| D x  "dH %| $4 "L +  /fL D( Qht ]'  l\ 7` 'p "1(H J|P  lL .  %b X( "P ".а ," A hX K-( `., l0 |/ $8 |, L D !bD@ &t llt  t` 4! ![  -, 9D M]\D X l> }& $ % v 5 t ( &p  && $( #8 l ޸ '.$ 5<@ >. N$t \6  i x, 8 &$ !4, (X .HL !! $ "Y|< #  4($U45٤l? B(ITD [$i ?,z4 `Hr8/Wtt4@ 58p4l  |H ,0(M8 ˔hA4I(L dc +<l$pH{^h.0 q xLX6ڤ/0ɜE3 h>JHO%[ΰd'm-Hv3(~&/ &(4TP |j ``(Bl$ &#t@3 lEXp.y|@#t rH<j\6Y 4fD"$)$5@@#}pMd$X T`8hqz.< X\&p\p.x74$h4P3H%@$)"~p=NXYt4,ll|.v/P( iPX \340t$ @@D84t2/:'<HT.4`LxB!/ D Ȑh `4 ( "X8+ 2(*CStV(f.Xl QHw"@? W \ "}'0p.xd<H,@?J `x4U`TdxLm `yr,b(A@@Ҙ$' kT8 4h"%1$BeT4 d\n/u8x(n @%dt.,Thp 0 44t#E8#4// D99TCS$Ϝt_ lfxL%P    d t*V(.ܬXt,6  o8H*#p$6!`DBS x[d&Tr$I@!_t$!T!h  (Xɬ\#8hHl"@ /Nl#d0"%DH+;\G (Sl0hx'##8,4J(0. 6x@.8# |+557B V0<L&HU ?(_ R<i zHpL&t  f..o X Tp ~44@>M$ L:XYe.0om$ LP |,4!@T<tP4(h$C 4` _ 6 L$"62I$B$S.d_p`x+-T8  hlH~<ٌ. @ "vL4&L2/ 8&gXA*hLdXZ|s&ly"Q(6BЌ8@MD(%d$!x4A" 54BN.PZ$Ffh(s8p 6$!x'4#L h .0 $ 1 6$ G$  W$4 k$4 6$ , b l\  /R, !,H 6| !4!#`!.T!14B`!: n\!F!R!0!_!q4&!x@x!ЌT!4!3! x! s` !*dP!d! |L"6" h8"!f8"."1 0(D"<^<"H."W pD"e<"v" "h".,"h "'U """#w4"# \"&H".d#5##4#6/| #=!<L#J=t#XP#d#w4#4HP#",#/ pl#4X# d#.#"tT#.#. $ 4<$&l$,.<$=.($H t\$W.$^#$l.$~$4Bd$>8$"$4$00$ L $$/ %#|D%"|%<%/!L%9 H%C%R.%`z%l%v 8%=%<(%&$% 0%.%.%(%4%T %&_&6ڨ&5&D|&+ &7" &D++z&V!t&d È&ug(&& \&$<8& &6 x&&d& &.&!H'!y'ڜ''4pd'6$'A4'_"?'n'&\' V'HT''.'LD'!p'580'4J,'.($44(!.(+ T(7(H&4(U w(a!s$(j/Q(t$SX(~44(( (L(.<(/((T(4().)/u)" )5 )D0)P)^ t)j ۔)u )~ t8){) >) ) ) `) X )%<,).H)5$)'>*Ap*K*!!TX*4H*D'*N*W%pd*g/T,*y#Rx0*4J0* *eD*#`* P* A*%;L**4((*h8++$+ +08+F<+T$0+`#P+w-+5L+'+%u4t+!f$+Dl+.+60+ {$+'4h+,,@, , <,&,,@,9$T,K6ڬ,Y$h,ch<,k5,s\,,/u,34 `,6,,B,$f,,H-V8 -ܠ`-: -D&Q@-P8P(-[i`-l ՜$-|.0-8-fD- l--xh-"|L-6ڰ--.p. 'Ԕ.!p. 7 .0x|.Aм.Y<.e€.tl.~". T..!\.%.2.... X./ / `/'|/+#/@p8/H 8P/Q2h$/Z!~/bh/rҤ/ ,/3H/cp/%/4&/>(/ l//4$/.H/m\00000/.0? D0J01u.1D\1'rhD1f1#141&1+1 2_h2'pH2.2+ 28.2J4x2U<2bl2u|2Ol2 2$.42 2z,2 L$2#d24,3dT3ވ3.w`3 '$3/$@43> 83N t3^5\3l/ 3r  3}B333r3/NX3#T3DP3 3.3&h4;$44&'4<V4R<4Z!84e-(4tT4(M4"Cp4& h4|4И4/Q4"`444 5#|5d5 T`5) l054H5?% 5MfT5g#s`5oͰ5x  55 @55.,55 85 5@6d6D460/R(6>6L$j6^#P 6u#t6}6(p@6 Tl6 6x6P6 zP6h6"jt68d7 '<7h(7"ü7<47D.ΐ87U !7^ (7m.P777.L7 ^x7 H7Lj(7=<87)9 07 8 x88'.088P88@(F$8J.h@8U&x8`(8uռ8$(8.8td8t8hT8;8p88'8x9.,9.L9HT949H t\9` .`9m x9{.$9$<9 y89]9|9 9 49p9:t:#<t: "T:3р :F#V(8:O$d4:fhD:|.L:,:D:5:4:/v:&:!:; rl;;1L<;D;O;Z<P;f$[;v4;~p;.w;+T;L;=;(;!;.P;#P;#< <V0<(3$<1.4>3>@$>4e >; (>I~P>R5x >b.>o">|8>  >%sp>.>l>`>s>!> P>F0?6LH? ?x?,.(?: Mx?E#kd?O?d?q|?.?$G?!D4?/{L?3D? ?/T?,@#3 @ Ҹ@ @'@$@6 2@>!9p@H@W <@iOX@}#@`@+@(h@!X@L@/T@.@%`0@@L@A.A;\A"VA-,A5 AA VAIZPAUAd0tA'<Aϰ A AݰA (\A# XA6Ӹ`A7DA.BBu B# B/ BB>,BW.<BbPBllLB{OLB/B"tB5B8B4B ڼB<B @@B6\BC (C!@C)C7C?!$CITCS„\Cf.PCsC|7C C%HC, lC!\C< C/ZhCC*4ClD!eL,D } D 9D)6$DD>#DMDUDf Dok8lD.8D!4XD8DkD#9pD!`lD.<D<D4D#*PE!XE#. E3<E? `ESFxE` Eh E{EE'\ETEEEEE%HEhF 0F(AF&#͔F:FE F\<$Fsy|F~|DF8FLFlFF *4FuF $FG/TG 'PG "tl0G3'BGDgDGOGT6՘G`'dGq4G{G#GG(Gc$G0G/S(GG5(G&(L$H4̰H >lH'$H-#gxH7"HI7$HS4H^&@PHn.ytHx(TH.H!hH!30PHH yxHv(HHH |H)H%w$I.I,IHI$fI4IA (IP5IY,hId.pIuȬpI lIŬI&4II $,I&)pHI.8I4pILJ`@ J 4J!'ƠJ, HJ6 J?.yxJI"lJ[  Jn3Jz3<TL TY HT`PTq/ T&T`TT/T(ST6ڈT0DT6T%D8T.| Uk$U"xU#4U-)UF.UM$UV+,U^TUi"JP Uv0UzxU  U tUjl@UR@UTU%,TU$|0UV.VElV'%TV.$;,V;/0VN!xV]dVhhVy'$V)V<V!VVZ0`V Al@V V.LVv@V&wDVAW-4W W%hW28W<5WK.WX m(lWh |Wx(] WhWЬ W XW W5W 8W.W4 W WHX &XP(X ]`X-PX>  XH@XT@DXidTY!|Y.Y!2(YhY/ YZ&Z (Z&LZ8xZE8ZNJL|Zd4@Z Z3hZ$HhZZ.t$Zt|Z`Z.ȄZ[ x[ HP[4|[#H[1'P[Al[X3ߔ[e$.D[v6| [[P[uL[(@$[$|[4q\[[ @[7\\"" \)(\7`d\Bt\L$L\X҄\j `\sS\ \l\ nl\0\'q4\\x$\G\ ]%P]]+]:$lh]F#PH]U:]m]l] T]$~\]ݴ8]]]$|]$h]/ ].4^$^^ ^''E8^: 0P^G"i\^W/R@<^e!<@^p o8^;4^$,^`d^.^^pT^!^,^_5d__.P_:.X_H.v_M<_Z LD_e4$_w>d_ ,(_"|_5_34_! (_ 4(_ @X_p_!_ ,_``.l`.Ҥ`B4`T^@`u!f`$h`4J4`@ `%ldP`kl`.`` ` `a a P|a xa!%F,4a5jHa>yPaNg(ah aq PXa'hTa<`a P4a Da ODaa<atbxb!mb2 kbJb_4bi U(bx3pb0<b#0b[b30b%bE`hb b|b4Bhc %c`c'.4c4 c@/ hcF/ cLPcVcT8cg$8cuULc |c#8c"*lccc|(c.c(C,@c Hc6d& 4d PPd%"dd44d=0dT%\dd\/|de'Mddsd"g@d K$dphLdcdlHd(ld#Zxdeڨe/e'e(% e5LPeE/ eN.he`|em\4e}/ eze.Te0e$Hee$e#he/,e'h(e#JDfLf, xf$Sf7)f@ |fU \fd fs#ɘfQffTf `f"fLf.`f(fTg 6 gҸdg%w`Hg- |Tg9#gH \gW g_+)Ngrg},gpgHg"iPXg'H8g6tg_pgUg.Thh/Th6`8h!60h, Th7 8,hOh^5hhg DDThn/hz/ hhh6h 3h.<h'`h$h hMi/Ui4i60i.W|i<V iE d|iQ"ɜi`3lin(iy ҀLi&ii0pi` HiiͬDihi%"`i IDi <i j&<Xj >lj%j4$j?=jO itjcs8jtl$jd0j*PjGPj|4j/j!`jjO,k*hk"lk&5k3MTkAkM!ZTki hk~/yk 3k `Dk3khk(7 k qk `kl)dl$l l+'0lJ'D lW\le#lq 5 8l4l.l%l!`l߼l/P`'l$ol#%\l"$ll xmmim YT`m4"xtmA4TmH fm]/mx%ԬXm#1m pm(mx\m"^ ,m.m:m 50m6m'xn n@pn*n>6nO (pn[!` zG zdzVzl)z m(z z ;z z"+(z`zz!Qttz$}zh{;{" [\{3X{84C0{E.{O-dD{ax{m@8{|${ΰ\{4q{&h{"tl{\@{VH{{Z<{p|oh`| WP|"|h|/L\|;D|M@|h@P|{<X|/Q|4 |8,|/ |.L|D|3|B|!p|Gl} ^D}(&4d}7*\P}? i@t}R$@}^6}k%f}w O4}3߸}3H}.L}+} @} Øx}%H}#}Ì }($~'B~.~.~)PX~:!@<,~V`~e~v~4J8~ap~\~ȜP~$!~.p(~+8~Ld~\~6.}0μ6%|dB"tK @[.\\iЬ'DtaT /x 0.x4|sl$*.(= N#X(^'ho q@~5l4 0/ D 0`A\$8` /yp!-'X?:l`N hW3Xc/|!(6Ԥ&4(:P7d L'4ph <@ (Q(/OHX( 009+U^0l('LPT.\ D<6 sh.H?L' @6 L?6hV0b^hpO4| t8%CD"H+lT 0.,$t"TuT, A`! ml-#/d$6ԤLJ 5x[tr](} x86h+@4.D4H 2$@.4\tD1!:+7BRhQXXbq & h!(>D M,H@!5.@@0V\-/ 4b @BNU^ PLi.lo/ @uD | ¸.#d8$,.$/  p3(#: 4&\?g <LP`3iu44.*x }/S#l,/{T  d | 54R ,,G"pT\e'x{"jp{bD6l'lpN@=.p, pX#@+L2?J$HU݈gRXn |$%,4 XL0,''0hL[|vh""0&9J&2t[4`|Xi4xz \D&0XHqx,$T43j`($6Ps<5/O(E. V&a Pr| x|T<@'|."at .L< ("d$l2یK'P`V#k z@lT$lteP& GHw(L=4H4J@Q. Z,j$@}.h 0& !H'`6(T.,$ L%8$P#n X"64\AO,X L\b#xj P,~#"b<"X0!$|  t. s <((d$.,5.D4TM4pY $gt./(  %. PPO44# !L! D6||# :06;.G.lQ4K@YD`i9,y""xdPɼ0 <0h.vpDtt /U* 8p`D""X@i"x@x!a,}.Ep d3h$d'l4.W|4)l AH'"{4\!4$d 1"h<.wE/V V ʀl_.i3v(-x0D';6#ddX.'$d4q ,/N7$xI<L\rxHB5.%a0$4 E<Z$#c":(p"Lah45p<޸x.`p|',@ (  4"X@5L.W%blTn.  uT/4G%p_ #q`,@d#1%d =K^ X>f@`8nw&T4. /4/@tH.d,H  !X 9D'"j06!טXA.`P! [.`fy,o[ wH#X Hx#u #Fh\t/pd%1@ .ޘ(#(0< \ BKe,X/{Pbt'(W / T/ 6Ph\(/p 0@ 4'qp D$4. <H&Zd >lx{', dT8T4".T 4`(Lx( ڜXN (/0,PA% P.a8n4G~= " /Dg/e.ؤ @%%.5@h4M]htT D/N(w {pd#g8@DS#4/r  rD*&F4S4` PtqL's#$:(,`#$|  p .$ (/9/AXM$Y$yDf#r $~%|3HG`|LP04IL @.8 ,(+8TC#TU!$\e(v`<` ܜp%`<6/!e.Dl4" `\ D 4d(/(: ;E#=XR4fOu4 #(5 d -T/</<l(8$@t0'SL@"XN4' Y5ti Ǹ0y.P(M< 4l  9P (L!`4&tc`44 @* ep2{C*dZ f.hw"P 5$H4H T.+-F4D(LP(4%<$.X6B'K d]!Xi.s%R0}4(P4&|! =D``(0@u|%XT 6T'+6*(?8PP]Ze%l $H{$L$,5ͰX!XPL/$+/8%,+14Tt%@.0 @J HS/['d$$xp$@@|44& M$x!   4,t,'"8l:0(B&T<Z5ߨm U  6C 6՜pHH$w#d8 4 /X"L!,p"6*+1< o$F3U4b#txi2Ls[ ʰ1hh!q T. ~t ~` <(l<6>G#Ox<\!7u"< 0/.w$"c ŌL.0 8p3   .v! :$,4;5I D(Rohy&, < 8XpAh\'"H",90$#uh x.=,53pCdO_Tnt,zhx@ e Fh#ɀ .ht3'H$.l$#,4$x5aGAtX#w _' n\`u\!t${0 UD#_&|DĜ &HP&$P/.HH<Vy@f.vmdx.. N\o5pG(=x"p$$! &4 4)"kT4:N8_R Hr? < +> Z4Ҽ<?p Eh"+;4q`D4lT5bo9 D*r.4z #lHL $0,.d<4l ,$*-/ 85XI!Z<4` {0g ETTn@|& H,"@`(&d)t `P D*DTD!O!hY8(j.8|׌ )t0 j.' %S84y X Xu-o;#4K[0c hLr xz3P$#"ˬ/ l/!kh  # 6ڌ+(.@=$H`N&,(^?Lpn `@w@/Tt%V.l_L$@@EXD/U5 $+ 5L@DR _.xu#v4dx &< FT` xph'!0.((,t*D:2C.P6[ 8g3sTL / $ILT. <dZD\4qd'Ϭ8 \("X h,4<E. N5h]$|@(o} (T| 8bG /N(!C4d .%iD".1. ?hH5TFxT^frzXt !Z4 ,\PX&.$up .8X &#|3&|PNDWa6l{/Q%qdP!P/d .04*`#$" 48+5"wl4$IdLU0f.o3,w"Xl T*|, ;8 $5'T0N @"G{T8R4(`[ <hi4qhq { xh X!P , pl6'H|&ؘ<*&/l<<4P%PZ}lg sKT' !˼$!(0!T4 ˌp )( _|#t,X 0.y85KZ6`n5loP Dll.Dv4pTT `&8L4xH/ 0W,l ltz4* 6 ('` ):x'L Po  r 0#,X1d; 4lI$)X.m!@h.$  \3%d.D t !|5""$T/ =̄J/O\T0g_s#]h*r$\d P!`<#2DA+/  E0 8)4xB@O!Fl@d |,jy€4OX h@|.${X 0"   ]. t'h!/Up/$X<pK. Y=XPitu4 !,0 T &#6H@;H P'06ڐhـ$ 4 -$D!p+ |?#˔P](n&60$~@DX$ n`(%dX_h6#@"=#h" &{2$!\`CF POi&$$v4D 4t\.0>4%<3#0 .@n hb&42$APN\|l'E|8ƒ/ H@¡'$­Ҩdk4k]H h$424!(>d[ df4&o<À {0@Æ\xÞ.å&zhîn.,.% 04 .\5< % 1/9DLOXMne}O$ĉ t(ĕ"H,ĝ$Ĩ Hij/{&<0!o|.d  H0 р\< HI5S.[exltŅ ŗŧdŵk\|4, TdȨ<<t#8(!LL,&l="H4I RxXU#(k 8z$WxƆ7Ɣ/`ƛ/Q((Ʃ^(LƼp3p|\p4&G64@@ 2XLkavϔǂ RD4Nj Tǘ ǘ Ǭ 4Ƕ %$h \@ @ ј4"47*.5¸,M'cq.Ȇ $ȓ V,ȡDȬ/T|ȳ$$XJ<$".tX p 4+.(; A2D$I5Z[@Tf$1d} ,ɍ.Xɡ/ lɪ\DT tH$Ht%` ,<.v%646=hF.,P,Wnh%h|<ʇ ʖVʬʾ+pT.(,04 6"+/"k$0>.4Jt\l|r@} dˆ6ˎ˚ˣ˴&˾$L . .tP Dy,5!'"p(4xP Eu|HP8\ tl̃.X̚4̤& ,̫#`H̻|$ܐ&K<(E0H(X '/< `-'h?6S^i L\}/ ̈́5 ͕5ͨ#j|Ͷ#T( ~L$DX.p`hp$9\p p8) =HhQrc$0Lr.(z.΅.Δήh*4V$C.$.!CH2&\4:!lGɜSG^(Cl@huφ(ϖ ϧ "pϯd|.X<sL%ߜ.dH.T"X%"Lt1.A.wI"oU ^hm5vЉ.Ж(/Ч#et<вH6h |/R( H *| :\.,$d: 2$EQ3|8e'p|X$ю \pў.ѫѹ`PT(@4.{#w 8P.#'/ 0`DV H`b|hp"(Dx!Xҁ2dҖNHҡwHҩb<ұFҶ,l..<$ P֘! x |@#.2 ¸A(M6hTc(&8{Xӏpӛ4 Ӣx0ӫӶ3 .@ x/8>4p\ 5X<47``H*tV0e4p'\ԄDԑ4pԙ"HԦ|ԳOh.x #H 4`'L%\(.50Bg80Vde r%]\4{hՆ.՗3ՠiյ%P#7DF\#4$!$D4,?"Jz\ d.t4"80}<ֆ# P֍ ֗ 8 ֧<ֽ6ژ$z8$/T.5`</Ux* K5$8B! Q4KDX\_$h/8Tw.ѐׂ|א Hןר!0״=*P#6Ѐ401(? LMo\]4"hDfKhw ~؄(M؊$h ؝Ґخmxط %w( 0p.4KX h  8X&2( &.\0@@B1V/uf 8oHy$ى.D٘٪.<ٷ!|t  8 n,$ Qh$%'Id2"\P,=K.[8ds>T@ڀTڕ#tڣ"^8گھ0'LD|8|0 .t.Ф|,2@J Z.e.p Hx pۇ۔ۢ@,۳ ۾8@T44!U,,4# o` $0L0$B&vQXY g@q ~4'܈xܛ(ܢ6ܦ!tܳ/"\|xD te@4& 4, #8pڼ8(.4F%oD\Q.m6~Hݍ7tݗHݢ(> ݵYx/&X</ $$'H>$JTUH<a/th/UHn 4|0ޘ8,ް޽$$$#d<"NL648& ,H/X<GR\U.j'pu߃dߏ $<lߗT߫#ߺ$X+*&|%!<Dh.'+%:P<D!K<dY.hb#]Pn+3LtH!E\p,&l`#H` 8l4H"< ( 2<\(.Ѩ6 (@X@'ܸPe58Ty. w%46tp\/  %t.xD\'|75pG\6(i(8d%8j$6X P - T PX$|ht'.0120>ALE% <P5^p`~4t] $/(6͸8\DP"|P6ۼ$l "0H#.P(2 B#Q4CX4(do  "mP|5(tϐ%I",.0. EdX DZ 40/ A PH|ixtD= R5t#G<6&|@3ߘ#| (M.%4G01.=<HPWbxrD+D H , Ph.'%]|#,"D5pT0{8#56|`DĔP.$YѠ$g8r ,~9tx4 UdDhd x #t<<G lH8<$5,0h9Kt Z#le"hr|'@'U,`(:h 9d,!,X\x#\'D$.3 rPl;v|TOl\.f4Hx/u1D4 %/l6ՠ$|r!/ F %T\%*8D"Hl.X:%\A N Kh^i ~t&*  .*0 &h.mt| #404;.J/ S5c/O (t1t`,``X%.T @4##h,"4," ($o #HT1.Dl0Q([hW%Bx8f"@l``z!a@"V`. |3p", )l`&f<L!4C  !G! +,=d0M6[ih.o"40!< \4$  C| <5\ \P %p 8!3t/D<K$,]|dkx5@L(F04(B0D$"\.h !..$ "! !AD)<6 +`F.wlIT``.n ` 5`h4(|/P$4"lZ ƄL+\9@F%XdP",W (mt   otdd$4\'Pp.h.<  %`0$"|0p ?#e<8J!ktV4&c"'T4n skHl T:h4pp t$k\d '  x'.D/'m7 xB(T4<^.h'Hr%_@T{"l t`D'\"h.\mL4 T'H1lA!-M `VP ft\L}(/!ƈ$+ $. 'ބ.dL_$np ( 3"AHHP=D^GLl w"D4O\3l 44/$"ll ["`fP 0d5T4 .!&!HB wJ"ӴVa%p"4 hx4Dl ,0 @{P4&+< h'WHx  (T+"](9lI<X^l%%$}k" ^T'"\3Ӝ58(L<$ )<@<d&$4> TH P\ $kxȼ ,0 l4.|t,5  .| <( <,/%X8EϬ\PD\'Hi T4u xl8z"+.X&!Hx /S$(..8Y<<JP DWb<khx(L 0Y<8.4 /l4D+(&1x9t b p5t0$h7A$4VX\b F@ir\x5`/uP<"3pT@"h6%H.d&p.  @8 4 'dh(+ h5SH(dZ$ll!Pw+(&d3ߜ|H4H&L|+'p.6#լ4:` 4l!$79PH4T` Pj(<~l",%8Q$c@`?lh3)dl7. @ҜLoDU Pf6y.@L  \ .80^Hkl P6p)v5 QI t Z g{9X&1 l@\.߈(.tP@$9!x@\ t/ 0#5h.#`7!DTa $pv(&Xè, $/N9P <hD4 "d< |h" P8%58L\Dh$W@LuTL## !M.x3(0;t06ڜ4&(<6&0IF<0Π"!Lkp0%.x40.TH!Sb f.Pj%u"D45h0 \D y_# 5<!aM G3'.w\)4&@<.I 0 V.b 4j Ds,~ Q4 ,.'A$I.'-<D#D!`. D"6Ԁ/>n<P.HZ#h!,s.0z D@$LLP,L.Ʉ8Ќ   T +& 5H 1 ? T L< [$T n_| v  ̤  @ . L  `t  y`( x / % x, !3 +  9- < D%Xh$ M ` ` ( rr <8    4* % . l 6אd . 4< (@ !4 #T 2N C6 T! ]5\ k#E0 w.  !d\ 0 4 'v@ ", & è0   < <0d d  6Gx E&(\ Q e l ojH< %~xd .H 4p` %#`T \l . u4( #ƴL 4l H$ &8 )pL 8Tt G6 P< a.D s5L  (M 4H %0P L <    L Ll  p@$ T)!2EMhS.]!3$hXx. (FT q6 dph| ((, .#$p25< 6hE'O CLZtc I0q'Xr"e\'h4 H c r`|(l  ,x4.8EL_pl0}+/0(t@D@ t( lL3x.(kd"0 hd*6=T`A,P#lb60u l~`3xD04{ %` S68&8+!$5@BO6tXo.d{ m|+; "8P $tZh4$$k% 4Op ox !l(64 dtC$<O W P` p0lʐ4x5$/ "{ԈhpYp/ X#!|J$T 8%! 4:dK4pXdq3|.w\!0$4"*$3x+$h'@$4) 1.w:"7XDoD S'he4I r=|h4op$3\'@$!  5h'F(0 T( ̘.<|<h\$I Q6ׄjP(v(<"/Vt$ |H!$N'8Z5j Dw (΄.&8\g \8z5`x 4Hdh&'HB%HX g XodT|.L <P=$@!aH86#0"H' <P3p@KJXs,lg$/,@""+).8(` D$x\p.8 .!(<- |\;K\U@_{|kZz.Р6d h@ `)lHre%*|   &`X##\0Ԡ<@oO\.q$ht([h3`d`!aL$i U$6"%@\4(VH:A`I V.\eIw'8.#@t.(4.wh h8 -8( rT83&8<p2F5V``xpL|0y'| @. . &$xt {H3@' 5/ h,= 9x4H!ZpD\.lTP{|4@s !X 'nX!]Dڄ м hT ' 6xh C4 KK _f u@,L , .ڤ  +| ` %n8 .L !` ' !3!@!+/!4"ZT!B/!K.X!Xͨ!e ZD!s%o<!P! W!()t!(!'8!#`<!!!!! !4"" D"!TD"*("2P"<6"I d"`40"j" P"" u8" vt@"6Ԩ"&6l " "/O""X##`#-tT#8d#D2|#Q #c tH#q!?`#.#4T#%KX#$H<# |#<#S$ \$&\$ZD@$-|$9#3$C($Tk$^5T$mp<$v%4 $"Hl$&<$$!YL$':l$$.t$"0$ɤ$ % )%.wd%#.%3D$%;b %H'`%[&%c"|%p 04%~oX%'<4%#%x%PT%4$%'d%!\ % L% <T&.& `&'<X&& 5D&1#\&9w@&K.&[ ,@&i@&xnp&4&]4&&8& 4&&. &.&<& ,$' (@')8'#@'0|'=5'Q(`'Zh'j\'~!<'&4'|'6 '.'"tH'!(' (t'!oPH(y,(.`(!.l(+((8(GpLp(Sp(] |(k8({(X(|(`@ ('8d(.|(4(.)'Td) F)"mP),))9 `)I )X%0)blP)t!$)}/).ش) x)40`)6))&hp).))3|)* !\*x,*9H(*)@*6&*>%#$<*Np*^ T*j"M<*{ eH* h*&h*`t*.8*%4,*$lT*p(* }TX*/*"|H*Y+ +$+ 8+-.$+5.И+C.+L +S:+dY<+s'h+|%7++}((+4P++2+`+ |+5 ,H,rdD,!)x,).x,2dP,A Tl,IH,ZH,j"sp,v! t,<,6,, , ,,5, 48,(-. -x-@-( t4-=x-Ln -[$(,-h,-x$ -&,-x,- d|- `--!\-./. c8.$P.6#>x.Hu.X.e.Hp.r$.z-$. H@.'T4L. L.HD.l. h.".(Ll."k /4///0D/9 /GD/QQ/f!@/4$p/H/hT/ X/ @`/ /']L/50/PL/L0 t0 ex80)'04+3h*0G @D0['¨ 0j50~0l<0$;400#0D80oPX0"|L0408050 |1 4*@16@1$(1-R@1A.L$1P#N1apT1n.l1{1 1 S1#$d|1.` 15141 H1D1$88$2.24L2 Y2-L28!2D.`(2["d2c(2q|L2|t2/P2#2.x2ؼ24$t@2'2424*42 2 %343 &3!03).0t31.4399(3I.@3XH 3a/W3luX3'T343D03o3Y$3$h34434ox3$x84!t4,4P4/L4=504P4[p4iΌ84rd4~ |4*4D04!V\T444 t,4L444Q0D5/S5 %a56ڔ5)55>H5M5^/S5g'$5p"l5}E5/S5>X5 585+/&55 x53ߠ5`5'066/6' !61# x6?@X<6Ju6U 6a̰6s 6 L 6/ 6N@6 ͨl6 6'6'E86+&:6!47 7%A|7887Dl7O4&7Y(]7`67lWP74*87 7>7 t7 \747(7 G(7 738758 8 ;83.wx8;/P88K"4(8Y8e'E(8y&6T858w8x88C8/ 848Č8'PD8#m|9&l96Ԙ9! l9+49559B9Vh<9c3PX9ui9+> 9<9؄9d 9$T9$Kd99 D:/ ,:'D:n:+:@:U@ <:cC0:z ,:$o:4: O`:!b::: : 2@`:qL;h; 6; Lt;3 Y4;:/\;U.P;f&@;usl8;;/ ;&t;D;"C\;L;$D;{< qX</O<'$-`<1=L\ m(x>$ >(>6 ,x>DT>O~>`.8>j"H>q/>z0L>nL>/>w,>(>.><<>FdL>&<$>HL> <,>#H?t?u?D?''$,?1_4?>i(?I"l?Z(?f ?vhL?8L?? 0|?հ,? '? 6 t?(?4=(?!DT@8@@4@#9 @74@F P@Z0@d <@o'j0@fX@4H @@. @@`d@#4@ `ADA x(A.A*"lA6$AE.AM&lAVAcAl!Az oHAA/LA6׈AA!HA TADA.AhB lB B#z<B3oDDB?PlBJ&,BSBYBb.Br|BTB6դ BH0B߰B BBdBB `C$<dC(C4C4CB!ctCJ.CV XCe HCq sC},CP<CWlhC9`XCCP|C!PC&XCXT@CD"$,D6D* DD84$8D> *LDF(D[@Df#dHDt' D5xDhDD||xD B|,D#8TDYD@DTEtE3ͰE#hE37E9.6E@"lEGREN.(Ee"` LEr"3xEE dEEhE.vE\E.EhDF f0F=F,PF)ŨlF0 <FBPTFJ.F[ Fh FuF! F+FFeF,TFF (F4F(LFA$pG '`G$XG-DxLGF(MGL&٤XGV Ge&8GvHG)GxG%,|G#G"$GpGS|G"9LG|HH `H X pH'#.H0 H:4HGl,HX5He|L8Hv4DH~ @HH3H/ Ht@H&H/QH.H PH/@H%dI#l@I0I' I6|IF% $IT(Il4&Iq5I$H(I.@I 0I#`IxI" II'Hp|I.J$<J xJ :J* ,J3$L0JB4JYOtJd%wJn!$dJx.PJL4J)4JB|dJ 4JJ'FtXJB@K8K(5K03K@8LK`u8KnxK}(8K/K Ka$K TK80K. K%|K $KK%LdL4L#4L?4pLH<LZ5Lj`LvLHL|L'ET(L6x LTHL>L DL.L%j`M!s(M M"M2:MA 6HMJHM\ ڌ0Mmu,M 0Mu0M<\M!MMM'<MLMiT4MDN %$N l<N^,N$pN3HNFuNSr 4Nl%0,xNy'N(`N"s(HN"CtN+,NTN`phN mpN!qN SH$N `O & O lO& O8ӨORD$Od@OpOz h4O&!t8O#LO 2PDO.O"L\tO"OglhOlO*sO.$P ,pP6P'DP6pPElPXXPj$$|Pw7HP&PbP`DPdP4P!&TP ƴ8P/hQDQ8Q'0Q5% Q>!QJQU4Qb.Qt QQ (Q&Q LLQdQ E 4QXTQ#@Qk LQCR (R6R*!T R=RW3Rb'HRk+/R~6xR"(RDR HTR"R!pRdTRt`R3|,R `R'UDR6 S$yS :S4<SHS2 ѐ8S@SP!S]BtSh$@S~#SS9S/U4S/ HSdS.4@S` T(88T .T!ZT' T/t$TCXTR&`xTZ$DTe#RTv<T hTxTTTxlT%w0PT.T0TxUHdUlU(.U9&NUA.UK UV$ehUb Up$ptU"wHtU`U(U3U$dU U DU kxUV.xVc|tV&'LV8xVEVQDV[DVr4Vx\VV DV V.V lV vV W&lW $4W$W+6W2>WS&hW_'Ҩ,WlIxWz3W/uW$TP8W)WPWx4W -,DW'@$XXc X͌X% X1 `XD'\XXV pXboXm'X}.PXr,XX( X5XX Xl,XXXYPtY^@Y!:hXY.!c,HY5d$YCYY~hYf(XYv.xYxYYPY!aY4$8Y%&(Y(4Y4@Y'*xZ |Z /Z)5ZFZ\ pZn'|ZLZ&$Z|Z3Z%U<Z'sHZnldZ% PZj[% |L[%$td[2^tL[F6`[TDD[j[ԬX[[[ p[$1T[tH[+8(hf ]$phqh{ @h,h:h6԰h5hEh$h*t4h PThP i &Zi:(i#<i7%iE30iR.8i^\Lil li 8i$di|8i5i%\xi%4i",i6pi'j!2j 3j'j0"x j@"jH B,jR. j]Ψje hHjm"U$<j{j.j%$j(Bt4j+dj/`j5jj#`k"ptpk 6dLk(5Xk3Tk?"q<kQI(k_!X krk~%k#eTk4KHk/QPk$k'4k.k'hk`kll @ll %el.4dl6 !Tl?|lNGPlT*Ll^$tlt& l|"l.l `pl'ט`l#xlll\l$tl<m#Hm&Mm4$0mD `mVtmd@mo4 m|(VHm!|mG |mCm/ym0m`mh0m Tm.m ڄn%s\hn n-`n;4 nJ $,nT (ng/4 n ntnEn!0n"mhnDn n' o $ޜoo) Po8doK ЬPoW"8Do`.onPopoo #\o o oto[ho'Tp9p.\p%\p6(:pF&$pP(XpU"pb.pn dp{Pp$yPp\p H p=,p=p4p pJ,p`p4q4(q 4qHq5hq,5Hq7 qGp8qV%tqbt<qoq~q0qhq 3\tql@q qd(q/P(rg,rPr#+ r-50r; rIrQ(ApPra5ru)8r rrX|rr@rr4r r.r u4sCsXs)N@s9%APsD0sQPs_Lsq4sw(|s:@s.`s#,s$`sXsgts$@h s&s/Ls+.t t0#tF!1 tV 8tfxtx/t"h@tt3߬t`dLt# t+<0 t`t0LHt{$u*04u<0uju(6HTu8ʰ@uB3߰uMhuZېunW$u|Ӑ0u uXu&X$u&uҼdu%muuHu!Ov @v!Xv)Lv8\vClvTuvd/vlLv0Xv#v Ɣv!_T v ~\v4&vCv#v v Npww ww)|w;4HwL lw]Dwe cDwt@ww3|w Hd0w&{w4 w \w34w;<wxǘ0x!Dx,(x7(,xJƤ\xX Pxl3<xu4&x"Epxg,x xb`x x|x'(xTx |,y 'yty'˰y6lPy> 8yNdyY lyb4%yk y{/ y% $`y$DDy8Hy8y$K@$yy3ƨy/ z%04z+ z.z-6Dz9x zH zT, z`[zr zz8z$ zHz 8z z'2z5|zK z{5{\{# {..{6"@P{H 8{Sg{l<{v$,{dP|{8{ {{ߔ{.hT{$)<L{"{\{#|&{| ZX|,|1 |Bd|XE(D|]3p|o;xp|~%\|e|%p4|44|~`|+|$| H|%#p|"P}}m8l}&r\,}7.}N l}X4D}`T$}o/Zl`}v"4t}'h }d8}^,}D}'<}q}hT}~<p~ ~/!p<~$g ~:'~G$J\~R~]4=,~l!~u!^4 ~{ FX~d~X~&(D~.~ Up~t4~4~W~i(Q 8" !<h2 6@&UI#TR"al]8kdl}c(0 F`/.v( D'X <$0(`X7$7<H$#_&u ۈ%D&4x(:$'@"t 0`+#$;DWR. e>8w!T<g<` &8 5D h- 3TT/ |"d&̰D$@H 26PALphRbE(j"w8v.4/TL4&@ l` l#%(,<5.?qN.8[:\ f|(v%.<Wt<Ƅ ltx8_D8/O .ȠP .' <:H.TS>T\\&o.@{M$#g<<;0" x4H(5ި h#(!rT- \4 <H?=Q:_&wmDHs $ |lL54!( .L 0l(.h$#4.'!h1Q,tE T|Ha"t0m5P}@ (( A.`53h%U4T44?!8..\(<D9ԈlJ"9D[4f4xm4KLt }<x4`e X|X*x4l.H !T&,(4<=/W$PE TLW+`'H\r ~t# .X `8# #0(< [X60 5D+=P3W4F+"X j.x//!T 5K .X8##p'.0|DiT 8aQPq {@\#9Dp`5YtT x< s HhP $U8).t; 3hEPRx^0<v 6X }lt6L<kL<'.H.x.4 (. x 0v&4*6 <A&( P!8_$LDj"9\Ds%K2| v 4&`("#h h $H).0o:'r\ CtP T\l^5oHP| "P(4&  B%3<!df\4.d H.@0@:tC$U\(i($y4 h'phP"0L $.Ŵxl$ "d&66hF'La(dr"?t $6մ!X!,o3<qX`/TL .$%iL3/Q(ChNTVjb"@u h$|J@/V !}tHx!exL+=P 3` 8.0$ .1$@CN!]Xa/drL Bl/N'Ʉ4! |vX44*\$Sd.~P*#h464>0G @8RDn/ 0w L%{S8</O'F 0#,  ..t@5F. R._"X@,kgh..z6H$D6׌3Έ%$ C%4.;54Hp\V\nm}&@H``D 3 @ /Q!P.(0 %)h*/},D2#= |G5DX#Xpa Dx/.М38d| m@@ Ƥ8/ # _.'#T`Au ]&hvl(5`"oT%!DX. D RP$$"T|!| .h&!01kGWthr%l{/t%v`5`H!68  Ь0' .4.z4L(/P4'8>T(K(d_&4q.x4\dΤ4.| 4$p Vl'\h.Hn|< )p  L0!#A|4 D'NQy@|[n$#T@KP r&Ґ6P4'D@6&4hdCXL#T\*r$cDr 0H.p $|,d$c D 3Τ(x0(Y,(=8I/ P'\|['|`d$0t 8 -N|, /R'/uMD $8#$ x,$(3 h>d0JUdcWDm!+\y4H0 46Ә 0%AX <  T,$`@"}p|+4D6&?L4 \/c5@(n<H{LP4t4H@; 0D'DHU`,g$ӄ/ <64Q6V&^.lez~,5T%H!ʴ$!D44L944&J<c.To !dx`;xcd4'6$t&LHG%c`$fH  Q)T0x8Mjz$`/u θh&W,"!L`!S Ol Ph(MD.+0p@ 1W4=8`^ Tk~,td P@(hb/<|6!xL/u&h<5p' .8; Tgps&$'ߠ4"RL" :$؈84|4 #j01!` 8A4$K؄S NTi TsL+ <| $h5Ϝ `<+3 G! |&KD9G Ϩ4P l8[,<sxL~!EsX4( HFp44PHxP0/'4F lDWdc$l,uD4p4 !X+l+,' U(.t 'pL ( 9$T! x 9D-$@t;#04DHU8`"Xh!.X{.$ |<<"LT/R64.,9 %0p8*'|lD#"HP"\\eH0s4}S && w / D'X.d0"v`."/r*<09$8XF&8DS (b(j w\D4 d|\/|/N0(.X $ G#6Դ&i0<;lLdZ'Pq,ld&2$$4)4LPx<4l #Sd,~@0*x(@6<L%\SSd4q9H} u$p\DxXl4@(?(#\d x 7&) .DB& Js`$U|k o<{#9D <h!p$.d!.tHP'$"  'T+= DI DT\X`#$k5xhHd\3t$95 (p x  @T $ aDpH$-'B&ܸU"$_!3 x#0 P (l @4l( P\\.T. 4"$0 `H8$4E!RZ5q/TPw$|pƈ@6D$ $.x ~ @ , 5 T(A%n,M Spx\f g@s.z *\ \.&T <'F<8 c+/Oh% 4$B|lT 4['$dؘp P d 7$`.6HdH d   *u3  05dE6PVD^.4Lmdz $. t.(O..0!4 % "d' T`8!l\L6T_atp@$ .#(0\!h.LH&|P/ (@$!dl.d<; ;G.dQp c$n&UlHw.$wx#8/(Q(.m$(@+44KP H' 0t0/R7'}`D<R.h[.wT` $ jx(]<d"! p  $ ahX@b@$,L+9#TtB5XM4%S:Li1 T~ ?7Pp &8.T$, zl  $`k,0 Rx,(|>Р P$'(^xgqOlz.T8_/h5v8/<\^4h!2p':hC ׀O.D_q1`X L.  D 4d6 ..tH&P,Kt3%h>$P"lZ:Hk.y/PL o40H"t4 tl, Kx|&\`6 PN `0] pmhx'08'D(#/@ǜ< kT"h/@55A9\N `|^4oj$*hx' #X6LdPil   L8%Ќ,  4D*6@ HDZ*khHu 85 4-lt/\&P.8/{t?` " ".,Xt9hH VP \"Do Tx:H ,8",dBp Cx<8 "(P!G4t8)h5" `B wDO dc.({Il|$p4W,H *X$.wX  $%8!%?: K8^k. u..]H  $<0Dd( q@.8 4"# @-h9:K6PZ' ``m<|"Ҁ\T  (3|/V<.. D,'} @( D:Z TLa4i3Dq/ x"D!4"> nH*8(Cl4p "0 tl, T:"c,F}\4pe,l hD|i‹"\ D˜\¥#D$­"x¹ ,|0$T"\D :%!T, m<#\T+"(bt<p{ Q\Æ@HÖ ã 3\lë6PúL / 4,0P/"$s8`-.8  FCah\t/Qx(Ą$Đġ.(Ľ \/(8#Ht.D4|P&eLD*="5<HR3` <,j4L}%4(Ň LLŜ%ZŦ Ųˠ)u..5X 5h# !-Dd+=4,R.a4<v$ Ɗ68ƕ ƟɴPƨLƷ 9.4 t0.@h .ɠ?tQ$,`dmA| ǔ(ǤhǶO44}$!8.l H(Ftʴ);5G W#;hdp(p8~"C|,ȍ$U@tț!DȦ<Ȱ/Oȹ(DD..8 ѐ*!.)̌1 \4C$,DRH4Hf+z.ɉ5ɒ,ɞ4&ɥLxɳ`ɿ/u6\Lxp.P3ߨ'\X2 ((@/SLI'R`Xe.à$pnL~r< xʒdlʙ4Dʣ"lʯ%\ʹ@4E!| .0p$t0.=,K PWuq ˂ ˏ(@$˟,˯ h˽ lH&(M's l)#ϸ? U3a@ow R8̆$t̒$$̡ ̰#x̺$qU<4H8 &[<|..0.7$@E4KTOnhc&0p y͂PX͏YXͥӴ ͮ.Ͷ$T G  8!@|<)-4)= I5 U@a p |y6·hΕ"LXΠ;θ@x@!t  +4<6X%. |'^hh7Ml<ePq/$~5ވχϑ4ϠŠLϵϿ#0 X$//'80'!X Dׄ*>|I8Y(hn6xЃ 8Ў4O`ЛDФżdЪ\PжB.@@a(($p Hpl l.7l:5 F X P`(^"`jD~ ы4і24ѣ!mѼ yר8.p X 4jH&0#@& hT8KuX!UXnv/T\қ',|ҮK 3-</.w|֐l$5X64G ,[3Hb xl&Ӂӏ=ӧ ӯlh ,$ `|#4q i4iDd&.h2 -(h>#ZH$<Z)@,co`}%\ԇԖ`$ԥ0Գ5Լ4h&xs&`$]\| F`'-$VX;3HK/ (UH]4Fdi qu\dՅ/U|Փ!`X<՚+,լ &6"w@6֔`P8D$@;EN#xlV.ܨe.߰(|!Z4֔.`@֟ ߬pְ.04ּ4oŐY< 6\!" < .@̌4@@@.$N]0Tq XP׀$`א8pמl,ש(׵.$0$#$"<8]X!,  \ 14 D+#\BP4[l,g5}jD؏ؚ,`د 0ظɴX-#| ـd.ݼ$# 9 : LPC!HXP ?Xhh y و68ْ`٘3l٣ ٵ!5`lX 5$>6  (%)T0[<|B M 8[/hnt<@g48ڌa hڛ@ڱ.d<$.H ` $3(#DL|3/ <%OtG3(\Ij(@sL}ۏ/yۘ.۠/uۨ.Tۯߘxۿ$4 8/%#]&h  %.-\7DDAQ4]KnL{l܉.ܒ%ܜܮԀhܺP%$l k$06XH xx.$.: (|<J)/X4UD _/U eHv@|݂s@ݜ"(xݧA4ݴL ~X$"@l0. &HL"* SLCHT!ɀ,c 0o&{ F0ޅ \ޗGhޤX8޷.lTph'p.LĘ@)&`6 ETA @O!D]4 fu%4} k߉4ߟ"n4,߰/߸"DxL40X#QD4"P//HH h H)9"DHD!tM!H<[j  &l3LPAd4d$P\t5# 5h$h-,t<&2H`M/\  egLs5Xz.4'.p< ݤ0 .p<.4.tP L8t %,.*;P; ʠ|J#4Y"@e.u)CD~X )< Zx\$$dRtP.$9,4P& (< 1<D'@Uf"p w4P.. #m$`!t5X8#8f  $4ql l4X( _p3 <M(Yif$@dp|~3$J  (t$ 5pH4 "oX4$$x'(|L3,lBX4P`s/ \(|$X|3, a .h .V!h d$T\8h'4l0. <.HtQ!,Xdcr`0X.a\d  tV ļ.h% $/Th ' L&l1'8h@4GU%WXd! vX P`? h &R%'$Լ|!$hfx d FX0'/Op(<F0(U^<l!} ,<\@DA4D< .X aX'ih"#z ).65pN]Z Hpg+spp4$0.|"*|( Vt<'|D#xD 0.X4 yD $.47+$hFV@T^ :iP`@!.`@"6 $463l8 6``!!L('x3.P@.LZta.l Nhu"L i  TH03@7 (P C4#U\  0&k1.9%_Gl V la"DXm4G,y p ),NtT´~p %fTt"\ U$@4"6/2<4x(LTlc qh}NL@##)`3 /8L.$uEl(D6Ը. 15P;4OhN&H]hkBtt#Nj6<'&p@ y #ht%'"H,2 r@ ]I*_iaPy.&P.'<x.3&Xk4 B , #Š.mH75p@~pxV4*< _:Tv(L%zs,(&p*H3d#l, /DTh/St(!h4(*$X@:!<4PLb.`z/ shP Ψd%$`O,< JT`.4" /"pH,<",D6ԜQ nhh.Hp+7 /|&^8%/< , l.h PX <<`. ..;!1@FzU g D{lr| #\ h 3 h+3X  XD!$~/ Jt4.>^W`@j6@{ \nLt< l ",d" 4'J.4^ kj3r5t|D<. %nh<6Ԡt!//0</D ]05x<<Oq8dZ/rb8<$nO\~HpplL4Zx4$@.H4 m$d/hswap_onwi_set_nwkeyisp_gid_ft_ct_passthrutrunk_port_statepfslowtimonanouptimebuf_rb_bufs_RB_REMOVEuvm_map_callrandomreaduvm_page_lookup_freelistpfsync_in_errorrfxmatchnfsv2_procidpf_normalize_iplongjmpp9100_ras_eraserowsimport_flownewblk_in_progressdivert6_packetxyc_unbusysr_crypto_discipline_initkdb_trapvfs_allocate_syncvnodepcmcia_printarpresolvedp8390_readchange_displayparamzsc_intr_hardchrtoblktblsw_reg_strategysys_minheritlinear16_to_linear8_le_stmbridge_startsystr_policy_pleeprom_takepfkey_addruvmfault_unlockmapschild_returnhmewatchdogrtlabel_unrefHMAC_SHA1_Updatene2000_write_mbufsearch_promfdcresultuvm_map_initne_pcmcia_caipsec_soft_first_usenkmempagesncr53c9x_scsi_cmdcopyinstrsys_getgidgem_resetih_removefpu_dtofdofilewritevdumpmagttyflushsys_setsockoptipcomp_inputcomdefaultratesunkbd_setledsclock_gettimewihap_sta_disassocdefrouter_lookupinetswwdog_periodcgthree_burnerses_cdffs_fifovopsip_reassrt_maskedcopyin6addr_anyVOP_ACCESSpfr_fix_anchorip6_get_prevhdrtrunk_fail_inputscheduler_startdb_logstp4020_chip_io_unmappmap_changeprot4_4cnfsv2_repstatpflowioctlisp_put_markernsphy_cdzs_printhme_mintipmforwardingsys_closepf_addr_setupdivert_detachbmsafemap_pooltrunk_port_watchdogsunkbd_ioctlrtflushclone1in6_purgemkludgeffs_inode_allocnfs_receivedes_encrypt2sys_setsidbridge_timerax88190_init_cardudpencap_enableprefetchaudio_attach_mitcx_setcolor__ashldi3gem_mii_statchgvn_statbtcham_matchnnpfs_stat_deviceunp_detachnd6_nud_hintether_ip6multicast_minsys_msggettcp_secretrti_findchange_sign16_swap_bytes_be_mtsam7990_watchdog__mainsppp_lcp_downepreadufs_quota_deletehardclockpf_get_wscalegem_reset_txnptesgenc_xform_aes_ctrsr_rebuild_threadwi_read_data_iohandle_workitem_freeblocksipsp_is_unspecifiedmyip_ifplacp_port_disablein6_domifdetachvtagsudf_mountfsmtx_enter_trynfs_syncfilt_audioreadwskbd_cndetachdb_get_variablezs_read_datacd9660_vgethotplug_get_eventgentbimatchcrypto_dispatchsr_discipline_shutdownsunkbd_setclickif_group_routechangetprintf_openrw_assert_rdlocksbppreadtcp_del_sackholesisp_reinitwsdisplay_burnerbstp_received_tcndest6_inputgsignaloptionsnodebstp_info_superiorpf_socket_lookupfb_alloc_screennnpfs_root_commonipport_firstautowi_txeofmii_mediachgcpu_hotfixipsendredirectsbpf_setifpfi_bufferunp_internalizetk_rawccscsi_xs_sync_donefc_lfcemptyvfs_export_lookupif_cloners_countifnetyieldm_freemwsmuxattachget_mif6_cntfilt_seltruesc_print_addrcgthreeattachcgfourteen_promcomspeedloguvm_rb_subtree_spacennpfs_fhtovpvn_writechkpmap_alloc_cpusoftdep_count_dependenciesin_ifscrubmttyioctlzskbd_rxsoftuvm_pmr_freepageqlacp_attachdp8390_media_initpdevnames_sizetcx_copyrowsbstp_message_age_expiryscsi_mode_select_bigroute_dstch_usergetelemstatusinit_execuvm_pmr_size_RB_NEXTcarp_clonerbridge_rtdeletewskbd_cdwsemul_sun_detachbstp_set_all_rerootnamecache_rb_cache_RB_FINDsys_getdirentriesbcmpcypress_cache_enabledb_set_breakpointsnd6_dad_startexec_maxhdrszam7990_stopblf_zerokeydb_force_whitespaceSHA512Initipsec_delete_policysppp_ipv6cp_openmmmmaprasops1_initxdc_remove_iorquvm_map_spacefitsnewblk_hashtblsetjmpaes_ctr_reinitopenpromopenxyc_e2strwsdisplay_switchnfs_get_xidnmeacloselacp_compose_keyuvm_deviceopspppioctllogread_filtopsrasops_cursorvndxfer_poolfilt_fifowritetcp6_mtudisc_callbackcopyoutstrmainbus_matchpromcngetc_remmodule_hypersparcimport_saxldcontrolblxtphy_servicecs4231_get_propsswcr_newsessiontcp_attachla_hold_totalwskbd_cngetcbuf_dirtysoo_writennpfs_pollm_zeroagten_putcmapnd6_llinfo_timerunp_gcingreaddoslabelpf_pull_hdrpf_icmp_mappingbdevswnnpfs_pioctl_callbaddynamicportsworkq_initsemu_listau_set_lr_valueX_db_line_at_pcuvm_mk_pclustervether_clone_destroybswap16ptsstartdomainnameuvm_pmr_addr_RB_REMOVElockinitwsmouse_detachswap_encrypt_ctlnnpfs_select_wakeupgetdirtybufttywrite_filtopsnd6_ns_outputbpfkqfiltersorwakeuppppoeintrpmap_rmu_pzs_init_regnfsfifo_readtrunk_lb_attachsppp_ipv6cp_RCN_nakttyunblocksr_meta_opt_loadmgx_write_1bioclosemttystopremovedepfr_sinsi_dma_allocgetproplenigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2mfs_closefilt_procdetachcbq_remove_queue__divdi3wsemul_getnameamd7930_opensys_clock_settimepfr_destroy_ktableisp_get_gid_ft_responsennpfs_message_installdatalocnamesnfs_vinvalbufdisk_busydb_breakpoint_allocpfi_initializetcp_pulloutofbandevcount_sysctlpf_anchor_global_RB_FINDsddetachtcp_signature_tdb_inputmouse_copy_extend_linebe_tcvr_readarprequestsiginitisp_get_pdb_24xxepconfigbridge_clonerpool_set_constraintsxydumpnfsrv_mkdirpfsync_actspf_frag_tree_RB_MINMAXnnpfs_getattr_commonip_sysctlsppp_ncp_checkpf_main_anchorxdc_e2strmsdosfs_vptofhscsi_mode_sense_bigpfsync_out_statebstp_inputdb_vnode_print_cmdgem_rx_watchdogtrapbasecgtwo_accessopssetdisklabelpfr_lookup_tablebio_registerisp_nanotimenfs_disconnectpflow_sendoutdeflateknote_removebstp_set_other_tcpropsequencesr_hotspare_rebuildmtty_catslot_create_event_threadroutedomainsr_crypto_meta_opt_loadicmp6_errorimport_identityVOP_MKDIRpool_large_freertl80x9_media_initepgetufsdirhash_recycleip_protoxsys_settimeofdaypcmcia_read_cissdstrategypf_purge_expired_fragmentsaddlogep_pcmcia_attachpf_state_key_setupisp_scan_fabricep_cdmsg_lookuppf_osfp_flushuvm_page_physgetmsdosfs_synccheckdisklabeludf_inactivescsi_mode_sensebppcloseip_savecontrolstackgap_randomvlanattachendtrapcodeffs_clrblockgre_clone_createtcp_timer_freesackbpf_filterchgproccntpriq_getqstatsip_drainvndbdevsizedb_map_print_cmdpflogstartsoqremque__adddi3uvm_map_inheritnfsrv_initcacheisp_put_msfifo_printinfoapmopenbridge_flushrulesys_getthridcd9660_syncpfsync_in_updcgtwo_setcolorin6_ifawithscopesppp_set_ip6_addrbuf_page_offsetaudioreadfdc_cduvm_pmemrange_addr_cmpnfs_rootcgtwo_burnersync_printvnopssys_lchownmsdosfs_removecd9660_readdb_read_tokenfilt_timerdetachwi_get_idsafte_bio_blinknnpfs_open_validzeroin_addrbmtphy_cdvscsi_i2tuvm_map_protectwsfont_enumprintfgif_clone_destroytrunk_ether_cmdmultixdioctlendrun_atoirandomwriteprelist_updatenfs_sigintrhmac_ipad_buffercrypto_drivers_numsppp_pap_closeinit_machclkip6_protoxsys_shmdtsys_recvfromcs4231_opensun4_hotfixswcr_freesessionttrstrtsys_sbrkpv_unlink4_4cwskbd_mux_openrandombt_loadcmapfdmatchzsnull_stintsysctl_doprocaudioattachkcopywsdisplayopennnpfs_write_commonext2fs_inittiocm_to_zsrtfreeagten_cdfb_pfour_burnermgxmatchpf_counters_inccuio_getptrcd9660_linkisp_parse_nvram_2100hypersparc_get_asyncfltsbpp_rwwsdisplay_emul_detachukattachhostnamelenlinear16_to_ulinear8_be_stmipcompctl_varsmulticast_register_ifgre_mobile_inputsched_cost_runnablenfs_flushttyopennfsrvhashraw_ctlinputudf_printxyattachccdlookupnd6_ioctlsched_chooseprocspec_setattrcarp_carpdev_statexystrategyfill_prlistHMAC_SHA256_Finalipsec_in_useipsec_exp_allocationsbpfclosesoftdep_setup_removesys_writevsys_setprioritypfr_setflags_ktablescopywordsm_tag_prependfrag6_insquevetherstartip_defttlsppp_auth_type_namemplsintrarpintrkqueue_registercred0in_delmultipfr_ina_definetcp_signaturebuf_nkvmsleepnfs_fsyncuvm_forkdisk_lookupuid_finddivb6tablend6_rtrequestncr53c9x_selectuvm_km_suballocrasops_eraserowsip_mrtprotobstp_update_infopfsync_deferredsunkbd_keydesc_esif_getgroupattribsbpfdetachsys_closefromfifo_ioctlnfsrv_cleanentrytunkqfilternnpfs_attr_validttydefcharssigexitscsi_link_openhidirtypagesepsetfilteruk_cdfpu_normin6mask128lacp_unselecttcp_signature_tdb_attachisbadgentbi_serviceuvm_amap_poolin_pcballoccarp_set_vhe_enaddrVOP_LOOKUPsr_meta_readdb_shift_exprisp_fix_nvram_wwnsxdclosepf_qid2qnameclockmatchifa_delpcred_poolenqueue_randomnessbridge_ipsecipcomp_initemul_nativewskbd_inputdes3_zerokeysppp_cisco_sendsystrace_nameiswap_ctxtcgsix_ras_copyrowshypersparc_memerrcrypto_getfeatpf_translatetctrl_read_event_statushme_poll_stopsl_compress_initsched_cost_loadlockmgr_printinformc_delete_classwsmux_attach_scwsemul_sun_cnattachwsdisplay_kbdholdscreenuvm_km_pagesufs_quota_alloc_inode2ipcomp6_input_cbmicrouptimesr_validate_iopnozz_cdtimerattachsb_auxio2_regaes_xts_decryptsocket_poolesp_read_regnfs_realign_countpgrphashsys_setpgidaltq_enablefd_set_motorbstp_assign_rolesprofhzAES_GMAC_Updatelacp_xmit_lacpducache_enterdb_watch_tablesysctl_file2exec_elf32_makecmdspf_osfp_insertext2fs_bufatoffsys_setloginamap_listdb_trapiommu_matchip6_maxifprefixesudf_statfsam7990_rinttcp_do_rfc3390sys_setresuidpfi_group_changegre_in_cksumsppp_attachcrypto_kinvoketcp_sackhole_limittrunk_rr_inputprocess_get_wcookiern_deleteberintsd_get_parmsiskmemdevstat_rush_requestsreq_clear_inodedepscarp_set_state_allccodeszs_get_speedsppp_ipcp_scrwi_watchdogcarp_proto_input_cipsec_def_compfc_lmdistancezsms_txintcs4231_sa_hw_ifnch_poolphtree_RB_REMOVEsomaxconnscsi_xs_get_doneip6_mrouter_veripsec_exp_timeoutsystrace_processreadyxyc_remove_iorqip_directedbcastppp_clonersystrace_fnameisp_cdbe_tcvr_writedivert6_recvspaceuvm_pmr_pg_to_memtypeuihashtblvscsiclosezsms_speed_changennpfs_message_versionpf_src_tree_RB_INSERTau_get_portaudiommapdma_cabe_tcvr_idlesd_buf_donepfr_validate_addrfdcswintramap_initffs_flushfilesetherip_allowicmp_sysctlsys_lseeksystrace_iovscsikqfilternfs_nodetree_RB_INSERTmapdevaudio_check_paramsoclock_canprocsdes3_decryptllinfo_arpmsdosfs_pollfpu_implodepmap_enter_pdiradd_poolmsdosfs_accessaddupc_intrdvd_read_bcasunkbd_keydesc_nosb_auxregbiscsys_thrsigdivertam7990_copytobuf_contigtrunk_hashmbufau_set_mutewsevent_fininfs_connectip6statnfs_doioip_mrouter_sethotplugread_filtopsviking_memerrvmebus_translateuvm_pageboot_allocconfig_pendingpf_rm_rulepf_state_tree_RB_REMOVE_COLORmii_phy_updatepfr_enqueue_addrsmmu_reservemon4mudf_islockedti_read_eepromether_crc32_lenfs_numasyncrn_searchiommu_dmamap_unloadipipstatsecureleveldb_consolewsemul_sun_output_haveescarpt_keepdb_printsymisp_put_cont_reqpcache_flushsys_seteuidvmeprintbtcham_cdwskbdpollmax_protohdruvm_map_checkprotmixer_opendes_is_weak_keyep_isa_mediazsops_ttyepstartesp_sysctlpfr_destroy_ktablessr_raid1_discipline_initeeprom_cabufpagessleep_setup_signalpf_setup_pdesctbr_dequeuebridge_outputprocess_newsys_keventcopyargsarc4_reinitsr_chunk_in_usemi_switchcd9660_statfssysctl_sensorstsleepkern_sysctlcgtwo_ioctlnd6_delaynfsrv_descript_plpmap_enu4min_pcbinitnfssvc_addsockcompat_43_sys_recvpfsync_in_del_csbppwritetdb_walknmbclust_updateie_hardware_namesses_ioctlhw_prodfdremoveuvm_tree_RB_NEXTigmp_fasttimobufq_disksort_queueudf_getattrp9100_ioctlbstp_ifsflagsuserconf_cmdbuflinear8_to_linear16_lewi_get_pmaudio_init_recorddb_print_loc_and_instpf_reassemblecgfour_mmapamd7930_query_encodingrt_mpath_matchgatesppp_ipcp_downapmioctlvigra_putcmapiommu_printendrun_decodeauxreg_cauvm_map_entry_poolcrgetsttywriteunp_bindisp_unlocktcp_delackcsignalreaddisklabeldb_print_cmdwskbd_set_displayvirtual_availenc_starttunopentcpstat_udivreplace_endmpls_ip_adjttldma_constraintdb_break_tableuvm_anon_poolicmp6_mtudisc_timeoutncr53c9x_pollfillmapentrynfsspec_accesstcp_timer_persistnfssvc_iodlacp_select_active_aggregatorsys_umaskfpu_comparepow2dividesyn_cache_reaperfilt_fileattachsysentlinear16_decimatortun_lookupcpuset_addtcp_setpersistufs_ihashlookupscsi_inquire_vpdpmap_extract_pread_machclkicmp_rediracceptapmcloseledattachworkq_create_threaddb_boot_halt_cmdsoftdep_setup_inomapdepbridge_stopisp_getrqentryip_outputzsms_rxintptcpollbpf_mtapfdc_resetcgsix_ras_do_cursore2fs_i_bswapnfs_reconnectnkmempages_maxfindblknameti_eeprom_putbytepool_inituvn_referencepcmcia_card_attachuvm_pmr_addr_RB_PREVbpfreadpool_putm_copym2bus_mapbuf_alloc_pagesau_gain_matchsysctl_structpf_statusam7990_startxdcmatchbufqs_stopnfs_ngetsysctl_rdstringuvn_attachlasttimefiforead_filtopssr_wu_putti_64bitslot_warcryptoclosetrunk_lacp_inputsysctl_disklockcnkqfilterpf_state_tree_RB_MINMAXdesiredvnodespmap_redzoneufs_pollmsdosfs_readlinkp9100_setcolordes1_encryptxygetdisklabelukmatchnchinitexec_mapdb_qualifysnprintfext2fs_readlinksoftdep_setup_blkmapdepaudioprobeether_ioctlsyscalltqphy_servicesppp_state_namenmea_time_to_nanofilt_vscsireadip6_forwardingsr_shutdownkdb_kbd_trappf_print_state_partshme_meminitarp_allocated_bus_dmamap_load_mbufrasops_isgraypfsync_bulk_updatepflogattachtslot_mem_mapifindex2ifnetcd9660_ioctlrt_mpath_conflictmsg_queuesbridge_rtagepfr_dynaddr_updatein6_savemkludgein_pcbnotifyallfilt_audiowdetachmouse_copy_worduvm_pglistallocsyn_cache_addpool_large_free_niwsdisplay_addscreenbuf_kva_endsr_raid1_intrincorehztslot_io_allocagten_setcolordefrouter_resetcd9660_ihashinsfreefile_poolbe_casched_exitcheckaliaspflowif_listdl10019_mediachangeagten_caamd7930_round_blocksizegetquotattyretypestartuphook_listsrmmu_vcache_flush_regionuvm_pmr_remove_addrgem_ioctlstp4020_intr_dispatchrt_timer_queue_changelf_initcpu_attachrn_mpath_countisp_put_plogxfdchwintrmii_phy_matchsun4_vcache_flush_pagepflow_sendout_mbufsr_raidp_assemblepninek_cdsdclosevop_generic_kqfiltertdb_freepffasttimonnpfs_mkdirinitsiginfosys_getuiddb_set_cmdcgtwelve_mmappf_anchor_global_RB_NFINDberesetdel_m6fcexec_setup_stackgetfplacp_peerinfo_is_compatibleuao_createdb_free_watchpointspfsync_update_net_tdbgem_pintsensor_detachifaddr_items_RB_INSERT_COLORbuf_mappfr_clean_node_maskrfx_accessopsffs_realloccgwskbd_load_keymapcs4231_round_blocksizeqe_rintnnpfs_create_commonm_clpoolmsg_copyoutcd9660_bufatoffaudiocloselacp_port_statusgroupmemberuvmspace_initscsi_plug_detachether_sprintfsttyttymsdosfs_unlocksoftdep_move_dependenciesselwaitppp_bsd_compressktrnameicarp_set_addr6icmp6_mtudisc_callbacksgif_checklooplacp_enable_distributingmodule_ms1nd6_slowtimosys_forknfs_readdirsppp_ipcp_tlfbufq_implspfkeyv2_dump_walkerip_setmoptionscarp6_proto_inputdivert_sendspacepf_hash__qdivrempil_to_vmeldcontrolbifaddr_items_RB_PREVspec_opencgfourteen_mmapswcr_sessionsfilt_bpfreaddb_watchpoint_freesr_disk_attachuvm_fault_wireenc_unsetifpcmcia_ccr_readcrypto_initnfs_niothreadsvm_nphyssegifaddr_items_RB_NFINDpfsync_insert_stateshmget_allocate_segmentip6_randomiduvm_pseg_initproc_filtopscarp_destroy_vhostself32_os_pt_noteSHA512Transformtrunk_ether_purgemultifiledescopensys_vforkuvm_pager_initwinChkNameisp_restartst_decide_modedvd_read_copyrightbio_delegate_ioctldmaprintuvm_pmr_addr_RB_MINMAXcarp_del_all_timeoutsdb_history_prevnnpfs_devwritecarp_ether_delmultisppp_ipcp_TOmyip_initializedtrap_typesun4_cache_enablepfkeyv2_sysctl_walkersys_mkdirdl10019_media_finiuao_reference_lockedbstp_set_port_rolecom_resumeufs_fhtovpcrypto_donewskbd_translaterttrashbridge_brlconfmblowatrasops_rmasklacp_port_enablegetnewvnodeufs_inactivepromcnprobend6_mmaxtriesamd7930_start_outputbe_tcvr_read_bit2sys_socketpf_state_insertnwindowsncr5380_wait_req_timoffs_cgreadxdc_rqtopbspec_close_clonevop_generic_bwritenanotimeep_mii_clrbitufsspec_writelxtphy_cahme_tintiso_disklabelspoofpcmcia_cafdfreefifo_badoppfsync_in_insepmbufemptyuvn_detachwsemul_sun_scrollupipcomp_zeroizeuvm_km_valloc_trysppp_get_ip_addrstty_countie_setupramdmaattachfindnodemkdirlisthddeflate_globalraw_disconnectipsp_pending_acquireipsec_ipcomp_default_levelsensor_task_registerip6_neighborgcthreshbufkvmticket_altqs_inactiveuvm_pmr_extract_rangebrelvpsensor_attachgem_tickmsdosfs_mountfsvfs_relookupzstty_attachffs_checkblkpfr_match_addrvigra_getcmapncpusfoundwi_stopip6_sprintfsync_fsyncsetstatclockratecd9660_strategypf_init_thresholdvscsi_doneuserconf_parseexpire_upcallsip6_keepfaithsys_msgrcvqec_resetnnpfs_reclaim_commonext2fs_alloccheck_inode_unwrittenusercryptowskbd_deliver_eventcompat_43_sys_getrlimitdb_eregscom_fifo_probempeattachgentbi_cdsr_raid0_set_vol_statest_loadbread_cluster_callbackfdcopyrmc_get_weightlkmopenemul_findAES_GMAC_Finalsystrace_msg_ugidpf_state_key_attachqeintrb_to_quvm_pmr_size_RB_INSERTin_len2maskled_blinkred_getstatsxd_cdudp_sendspacetcx_accel_initnfs_mknoduvm_objtree_RB_PREVifg_headvfs_rootmountallocSHA1Updatenetintrcd9660_openrw_inituvmcnt_dumpnfsrv_wakenfsdpf_frag_tree_RB_REMOVE_COLORxboxmatchip6_mforwardAES_GMAC_Reinitsoftdep_setup_allocindir_metaudf_vat_maphme_mii_writebsdi_sibuf_rb_bufs_RB_FINDcmaskext2fs_blkprefdb_pool_print_cmdgem_meminitwi_alloc_nicmem_ionfs_nodetree_RB_PREVenc_clonerbstp_stopdb_delete_lineellist_get_mindlzsops_nullscsi_activaterpc_auth_unixVOP_ISLOCKEDshm_committedsys_kqueueAES_GMAC_Initccdgetdisklabelauiopuao_referencennpfs_devreadauxio_powerdownin6_addrscopebuf_getled_cycledb_searchvfs_getcwd_scandirmaxlockdepthpppcloseraw_usrreqsystrace_closepolicyksymsopenisp_get_fcp_cmnd_iuoclk_set_secsnnpfs_setattrnblkdevinitidnnpfs_vfsopssr_crypto_hotplugscancttyinput__stack_smash_handlerpf_frag_tree_RB_FINDesp_dma_isintrbiodonecarp_hmac_verifyah_inputdb_set_breakpointmachclk_tcmyetheraddrgettdbicmp6_rip6_inputukopensunkbd_rawrepeatmaxslpext2fs_makeinodeswap_bytes_change_sign16_lest_read_block_limitsviking_mmu_enableufsread_filtopsufs_symlinkendrun_date_to_nanom_dup_pkthdrptmopensr_crypto_assembleufs_mkdirvfs_getcwd_getcachembppioctlisp_get_responsegetidpromgre_recv_keepalivenamecache_rb_cache_RB_PREV.mulcgtwomatchin_iawithaddrbstp_transmit_bpdu__anddi3cs4231_setup_outputenc_outputphtree_RB_REMOVE_COLORisp_add2_blocked_queuert_missmsgVOP_BMAPip_dooptionsvn_lockintreg_set_44cisp_fc_runstatetimeout_add_tspf_change_icmprip6_ctlinputchange_sign16_swap_bytes_le_stmxd_castty_modem_controlscsi_link_shutdownpmap_extract4_4cSHA384Init_mulpar_err_regstpattach_commonnmea_nxidlacp_sm_ptx_timerqe_readsbdropaltq_assertsr_meta_native_attachlacp_set_muxzx_accessopsnnpfs_remove_commonmkdir_poolxyc_entoacttcp_debugsppp_ipv6cp_uppmap_protect4_4cqecattachnfsrv_lookupcachevscsiopeninpcb_poolsplassert_checknextralocnfsm_strtombufpf_consistency_lockzs_abortexport_tagsetusesys_setegidblf_keynoswap_bytes_mtssppp_ioctlpf_osfp_find_exactzx_matchmpls_mapttl_ipfifo_readrn_matcham7990_setladrfisp_pdb_synccd9660_symlinknfs_progppplogcharautoconf_verbosein6_setpeeraddrunp_externalizesys_munlockalluvm_faulttrunk_bcast_startrandomioctlxyc_rqinitdivertctl_varssoftraid_disk_attachpppwritesoreceivesystrace_newpolicytctrl_intrnmea_scanpool_getuextralocscsibus_printlinkdb_show_radix_nodepf_frent_plnfs_in_committed_rangefpu_initffs_dirprefpf_calc_mssrip6_outputsoftdep_freefilemfchashtblinflatescsibus_cdin6_get_rand_ifidndflushti_cmdipsec_last_addedpf_commit_altqpmap_kenter_pa4_4ccompose_tab_cmprn_insertspec_pollbpf_wakeupfilt_kqdetachkernel_segtable_storesbppioctldb_flush_linepfsyncstartpf_osfp_findwsmux_getmuxipsec_exp_bytesipcomp_sysctlbufqueuesconfig_defergf_mul_bus_dmamem_allocm_tag_initvscsi_t2iif_attachmpedstisp_mstohzfpu_sqrtlacp_fill_actorinfogre_lookupsr_crypto_free_resourcessttyioctldqsynctcp_sack_adjustsys_setrtablem_reclaimsr_raid_read_capnameipfi_kifaddr_updatennpfs_rename_commonpfi_ifhead_RB_INSERText2fs_readdirip6_ctloutputdead_pollpv_syncflags4_4cdivb6hashsizepfr_clr_tstatsisp_get_24xx_responsetqphy_funcsmfs_reclaimwihap_initversionzs_breaktslot_slot_enablevpagezsms_enable_bus_dmamap_syncuvm_pmr_remove_sizelzs_dummybuf_needvakqueue_initnnpfs_devpollnnpfs_setpag_callxysizeuvm_pagezeronnpfs_renamenfs_readrpcin6_setsockaddrigmp_leavegroupcom_common_getcgem_mifinitmasterpaddrmountlistbstp_initializationuserconf_histbufcgtwo_getcmapnfs_mknodrpccomsoftwihap_mgmt_inputtunreadconfig_deactivateVOP_REVOKEcarp_group_demote_adjSHA256Finalclallocipsec_esp_trans_default_levelbiowaitzstty_cafilt_ufsreadxdwriteunixswuvm_objtree_RB_INSERT_COLORudf_reclaimstp4020_chip_mem_freedb_stop_at_pcpfr_attach_tablesccswinuf_invalidtqphy_casw_2_leftovercarp_sysctlwsdisplaymmapccpupf_sn_item_plncr53c9x_readregsobio_cduvm_map_replacermc_newclassaudiocs_casr_raidp_recreate_wuti_intrnfsrv3_procsboothowtofdinitarc4randomnsphy_funcsuvm_map_entry_unwiretcp_delack_ticksttopenip6_randomid_initbstp_update_tcether_ipmulticast_minconfig_rootsearchrip6_sendspaceuao_dropswapip_mrouter_detachin_addprefixenxioesp_attachsys___getcwdcd9660_specvopsslowtraprnd_event_headwsdisplay_switchtoconsolein6_maxmtupfopenpf_compare_state_keyswsdisplay_update_rawkbdnnpfs_message_receiveRMD160TransforminflateInit2sys_setreuidSHA1Initie_cauvm_map_findspacesystraceioctlwsevent_initcryptoopenpfr_ktable_cntuserasymcryptodb_var_rw_intno_asyncflt_regsptcread_filtopssdsizefdstrategysys_pwritevesp_dma_intrkqueue_scansys_semgetpf_find_rulesetisp_mbox_continuetcp_closeepioctlicmpsrcpfr_ina_commitsd_patternsX_db_search_symbolscsi_initmsdosfs_advlockdl10019_mediastatusisp_delaytctrl_tftswcr_idwdog_registerif_indexlimdb_varspfr_kentry_plmpls_controlfallocisp_mbox_releasezskbd_consopsctx_allocnnpfs_unmount_commonispfc_fw_statenamelxtphy_cd_udivdvma_basesppp_lcp_tlupromvecdatp9100_ras_copyrowsdeadproc_mutexdb_breakpoint_freepfctlinputsysvmsgplmarker_info_tlv_templategem_cdufs_lockcomintrsys_accessnsphy_statusgif_ioctluvm_swap_iouserconf_initkillpg1pfsync_if_dequeuepf_state_key_detachti_ifmedia_stsp9000_ioctlwsmouse_mux_opentrunk_port_destroytunwrite_filtopsvputonfreelistierintmouse_removesunkbd5_keymapdatacpumatch_sun4cnfs_getreqext2fs_mountrootxboxprintregyearpf_commit_rulescompat_43_sys_sendmsgpf_find_statesetrunnablepool_do_putclock_cdnfs_closesd_crazymapuvm_pmr_getpageswi_set_ssidnd6_prefix_onlinknnpfs_removegre_ioctlsppp_ipcp_initffs_specvopself32_read_fromau_get_lr_valueosversionisp_locknnpfs_closefind_pfxlist_reachable_routerip6_pcboptsfilesys_syncertvtohzip6_mroutermsts_countphtree_RB_NFINDnewfreefragratecheckin_rtchangevfs_syncwaitffs1_reallocblkscansignalhotplugpollmsdosfs_check_exportpfi_detach_ifgrouplf_setlocknbigpipewsfont_map_unicharnfsv3_procidin_controlwsmux_srcopslmaxuvm_pagecopyphtree_RB_NEXTpfsync_update_state_reqpfr_clr_astatssysctl_quadsys_readexec_process_vmcmdsvndclearpf_nfrentsdb_nfsnode_print_cmdcs4231_closetunread_filtopsudf_disklabelspoofm_cldropmbstatttyinfodb_flush_lexp9100_mmapzs_putcttyinexport_udpencapmfs_checkexpqe_cacarp_set_addrgetnulldevlacp_disable_distributinggre_compute_routedb_dmesg_cmdti_ioctlsr_meta_save_callbacknfs_nodetree_RB_INSERT_COLORextent_destroydb_lpwsdisplay_rawkbdinputnfs_writebpenc_xform_rijndael128if_group_egress_buildaltq_detachloop_clonergetcttsetwaterudf_readsl_softc_listsr_raid6_intrfilt_apmrdetachifaddr_items_RB_INSERTdb_last_addrmouse_copy_startuvm_pseg_lcknnpfs_islockedenc_getifsr_ioctl_volcom_obio_matchcgfourmatchmsgbufenabledisp_put_marker_24xxfilt_ptcrdetachnfs_nodetree_RB_REMOVE_COLORunp_disconnectzsopenufsfifo_writesys_listensys_mountcgsix_ioctlhotplug_put_eventpgsignalpf_get_sportbpf_mtap_etherfirstcshm_delete_mappinglinear16_to_ulinear8_bedb_read_bytespf_poolmasknnpfs_mount_caddrsppp_ipv6cp_tlstdb_deletecgthreematchaudio_silence_copyoutpfsync_sendoutksymsattachqe_ifmedia_stspf_state_tree_RB_INSERTti_free_rx_ring_minisr_failioffs_fsyncwsmux_mux_opennfs_sillyrenameau_portofpfsync_in_upd_cagten_ioctlrasops8_putchar12wsdisplay_consinetdomainwsfont_findcbq_pfattachmemcpypmap_is_modified4mkthread_exitscsi_req_detachp9100_romfontpowermatchdisk_constructvfs_unbusywsdisplay_paramufsdirhash_getprevip_nhopsrip_usrreqpf_anchor_node_RB_NFINDpfkeyv2_cleanupspec_writeaudiostartrdqhashcarp_ifgroup_ioctlipsec_esp_network_default_levelkq_timeoutmaxnbpgin_broadcastfd_getfilesr_sensors_deletencr53c9x_free_ecbptcwritesdioctlrpc_msgdeniedutsnamefdcstateip6_setmoptionsexit2nnpfs_printgetcpuinfoip6_mloopbackext2fs_cgupdatebridge_clone_createmulticast_encap_iphdrtcp_update_rcvspacemsts_time_to_nanopf_anchor_global_RB_INSERT_COLORiommu_attachpppasyncctlpcpu_setperfufs_lookuptvtwo_ioctlufs_bmapdoasyncfreeip6_mrouter_detachip6_randomflowlabelttpolllacp_pdu_inputdegetlogpollkthread_createp9100_ras_erasecolstunclosedb_elf_sym_initam7990_copyfrombuf_contiglogclosesppp_increasing_timeoutpcmcia_submatchnnpfs_open_commonpfr_skip_tablend6_dad_findudf_readdirufs_strategylacp_sm_rx_record_defaultsr_crypto_create_key_disksr_put_blockcopy_statfs_infobounds_check_with_labelcarp_check_dup_vhidsif_qflushsysctl_sysvmsgarc4_timeoutsr_raid1_assemblesd_ioctl_cacheext2fs_checkpathpppoe_softc_listzx_copyrectfilt_nfsdetachsocantrcvmoreepreadeepromprocess_poolip6_setpktoptnnpfs_devopenfile_filtopssr_raid6_rwst_cdch_cdbuf_unmappf_tbladdr_setupcgeight_resetmsdosfs_renamesysctl_proc_argsqeinitzskbd_putcnnpfs_syncext2fsfifo_reclaimdes1_zerokeypipe_wfiltops__lshldi3purge_detachedreginvalturbosparc_cache_enablepfxrtr_addcd_load_unloadipq_poolturbosparc_get_syncfltlematchzstty_cdpmap_activatebuf_dealloc_membmtphy_resetconfig_make_softcpf_anchor_node_RB_FINDncr53c9x_msgoutunp_discardpfsync_bulk_statusdma_setuphandlersip6_outputwi_read_record_iofd_camagma_hardcgthree_mmapip6_mrouter_getsafte_caswap_syscall_lockufs_kqfiltercarp_setrun_allscsi_autoconfcheckdirsexecswgem_disable_txwsfont_addnnpfs_dnlc_entersr_raid0_createqeattachnsphyter_cdkdvma_mapinses_detachin6_are_prefix_equalin6_controluvm_pmr_rootupdateleapyearsleep_finish_timeoutsys_sigsuspendcd9660_unmountcs4231_intrtcp_seq_subtractswcr_authcomputenamecache_rb_cache_RB_NFINDtrapsignalzsclosetrunk_lb_porttablerushjobrn_inithead0db_single_step_cmdnd_defrouternnpfs_createblf_decfdcloseexecti_sbus_attachevcount_attachlimcopysunkbd5_keydesc_itbio_doreadwi_do_hostencryptnfs_vptofhtcp_timer_rexmtscsi_req_probepcmcia_io_mapvmebus_scuvm_swap_markdecryptrt_timer_initnd6_useloopbacksr_crypto_rwxyc_carip6statip6_id_ctxptydevnamesr_raid6_free_resourcesintreg_clr_44ctcp_debxcnpollstp_sbus_cacd_casys_truncateesigcodescsi_xfer_poolsysctl_wdognfs_boot_getfhmttywritecgfourteen_getcmapsched_choosecpu_forkpf_remove_src_nodesi_dma_intr_timosrv_ipcache_alias_distsppp_pap_opensoacceptkqueue_pollcdgetdisklabeldb_call_depthmpe_input6db_printfbootstrapin6_ifaddlooppflog_clone_creatennpfs_pushdirtytrunk_lacp_startufs_createmgx_putcmapnd6_freend6_optionscd9660_seekpv_link4mnd6_llinfo_settimersr_roam_chunkscgsix_mmapmsdosfs_unmountelf32_load_psectiondb_show_all_bufsisp_make_goneslinputrn_mpath_nextpf_src_connlimitnamecache_rb_cache_RB_MINMAXmtty_cdcpumatch_turbosparcdb_add_symbol_tablem_tag_nextpf_check_congestionch_getelemstatusmax_softdepsmsdosfs_writeendrun_scancompat_43_sys_getdirentriesexec_script_makecmdsignore_bogus_trapsfilt_pipedetachcd9660_rootentropy_add_ptrdb_unaryne_pcmcia_get_enaddrdisk_attach_callbackselrecordffs_validatecomstopffs1_compat_readrip_outputstp4020_chip_intr_disestablishstp4020printext2fs_accesshme_rxcksummld6_fasttimeounode_poolkthread_qxdc_piodriverimaxnnpfs_setattr_commoncg3_videoctrlwsmouse_matchstioctlchioctlmpls_outputuserconf_pdevuvm_object_printitsr_detachtcp_sack_partialackzstty_rxsoftmbpoolclock_secs_to_ymdhmsisp_register_fc4_type_24xxxdcintrst_write_filemarksaes_xts_setkeytcp_canceltimerstrunk_rr_attachtqphymatchrip_recvspaceroute_initccdreadswap_priorityipsp_spd_inplink_rtrequestffs2_reallocblksbstp_calc_path_costuvm_vmspace_poolpipe_createstackgap_initfifowrite_filtopsnfsbootdevnamesysctl_vnodend6_sysctlnmi_hardipsec_common_inputpf_tbladdr_copyoutvn_opensr_raid0_alloc_resourcespf_frag_tree_RB_NEXTnfssvc_sockheadpf_anchor_node_RB_NEXTisp_setdfltfcparmsppp_pap_TOif_clone_createbufq_fifo_requeuepf_route6sr_boot_assembly.udivSHA384Finalbstp_info_cmpuao_detachpowerattachmallocamap_pp_adjrefmfs_vopsauth_hash_hmac_sha2_384_192ep_pcmcia_matchrpc_versesp_inputin_pcbrtentryudf_readatoffsetcpumatch_vikingknote_dequeuesr_discipline_initamd7930matchtcp_outflagskqueue_statsbus_testdmanfs_boot_initpppdealloccd9660_rrip_analyzeoclock_cdnfs_vfsopsbio_unregisterip6_v6onlysys_preadvms1_mmu_enablesystrace_execve1db_tok_stringpf_src_tree_RB_MINMAXnfsv3_typesys_recvmsgses_read_configpipe_statHMAC_MD5_Finalvn_writesr_hotplug_unregisterVOP_LINKpcmcia_megahertz_xjem1144_func0icmp_inputvcountms1_cache_enablevm_page_zero_enableinodedep_hashppptioctluvm_vsunlock_devicein6_delmultilacp_inputstathzpf_test_state_udpenc_xform_cast5route_ctloutputwdog_ctl_cbhfsc_add_queuesched_idleah4_input_cbpfr_ktablehead_RB_INSERTmem_access_faultwskbd_cnattachktrcansetvirtual_endledmamatchsys_getloginifaddr_items_RB_NEXTbuckstring_initipsec_hdrszicmp6_rediracceptms1_cache_flush_allnnpfs_channeldetruncdb_elf_symbol_valuesgem_init_regscgthree_cacopyoutintreg_set_4mbufq_peekpfindesp_caip_ctloutputp9100matchwsevent_readenc_xform_arc4enc_max_unitpf_routeti_add_mcastarp_ifinitdb_write_variableufs_dirbadcd9660_readdirisp_nanotime_subvfs_unmountallpf_match_portsr_ioctlccdattachwsdisplaypollrasops1_putchar16copyrightvigra_mmapsdattachsched_peg_curproctcp_timer_keeptcp_mss_updateregister_sendffsfifo_reclaimnfsrv_getslpe2fs_cg_bswapdb_proc_print_cmddb_show_all_procsrw_enter_readpower_cdvunmapbufnnpfs_vopsfb_cookieroute_outputrti_deletesys_geteuidchange_sign16_swap_bytes_bedb_output_positionicmpmaskreplmsdosfs_mknodin6_pcblookup_listenrfx_putcmapiommu_dvma_allocpflogifszs_read_regip6_defmcasthlimsys_munmapsttymatchfilt_solistenvsnprintfmgx_getcmapwsemuldisplaydevprintsrmmu_cache_flusharplookupamd7930_halt_outputuvm_map_pageableproftimer_trampolinetvtwo_cdchainallocsw_reg_startpf_change_a6sun4_cache_flushdivert_usrreqsr_ioctl_deleteraidifmedia_baudrateedataxyc_startpf_step_into_anchoruvm_pagelookupudf_trans_poolfree_allocindirsoshutdownuserconf_hist_cmdnfs_writerpcuserconf_listproc_cansugidcd9660_rrip_getsymnamedb_command_tablewsdisplay_getc_dummyip_mloopbackbpf_iflistnnpfs_deadvopsip6intrqnnpfsiommu_dmamem_mmapnd6_rs_inputpf_rtlabel_matchscsi_activate_buspmap_is_referenced_psoabortlinear16_to_linear8_bememerr4mm_free_unlockedmemerr4_4czx_cross_loadwidcast_encryptunp_inoxy_calogkqfiltersw_cdbpf_mtap_pflogtcx_mmapni6_dnsmatchuvm_tree_RB_INSERTdb_extent_print_cmdip6_init2uprintfsensordev_installrandomiddivert_inputuvm_page_printitamd7930_start_inputpf_tcp_secretmainbus_canfs_pollcoredump_elf32softdep_flushworklistmarker_response_tlv_templatesys_issetugidinitclocksudf_hashinscd9660_mmapzsstart_txcarp_hmac_generateif_detachttcompatsetlflagswsmuxopensetup_allocindir_phase2isp_controlnd6_cache_lladdrcatqsession_poolifqmaxlenipsec_get_acquireunp_connectuvm_pagermapinlacp_compare_peerinfoif_detached_startpool_serialopennodescsi_probe_lunni6_inputvfs_mountedondb_expressionrt_lookupfc_lookupsppp_ipv6cp_opt_namesemu_allocpf_hash_rulepim6_sysctllacp_sm_mux_timerlinear8_to_linear16_be_mtspfr_destroy_kentryep_mii_readbitcgtwo_cdif_downndqbconsdev_prommodule_swiftVOP_GETATTRticket_altqs_activenfs_reclaimiommu_dmamap_load_uiowihap_deauth_reqpf_purge_expired_src_nodespgt_page_allocnfs_advelf32_check_headerbt_setcolormmu_has_holetcx_putcharque_createdb_historygf_logmodule_cypressnfs_loadattrcachempls_sysctlttytstamplehwinitnfsm_rpcheadnfsrv_readdirtrunk_port_ifdetachpmap_unwireipaddrip6_auto_linklocalbridgeintr_framecompat_43_sys_getdtablesizeuvm_pageunwireHMAC_SHA256_Initrti_fillhw_serialam7990_intrnfs_init_rttti_mem_readwsdisplay_resume_deviceauth_hash_hmac_md5_96tcx_caufs_chmodpfr_kentry_byidxv8mulip6_mrtprotouvm_unmap_psr_raidp_discipline_initzx_setcolorcdattachuserconf_devicenonidempotentsr_raidp_alloc_resourcesin_localaddrpflog_clone_destroysys_sigaltstacknfsrv_fsinfozs_majornfsrv_symlinkDES_versionsl_uncompress_tcpsoisdisconnectingfree_nnpfs_nodeBlowfish_initstateauth_hash_key_sha1sched_steal_procwi_media_changesttyclosenfs_vgetnull_decryptsyn_hash2rttimer_queue_headptsreadses_cabridge_filterruledp8390_enablertredirectuvm_map_printitdb_read_variablepfr_destroy_kentriesdb_regsdb_stack_dumpsr_raidp_rwstty_compute_bauduvm_pmr_pnaddrttymodemdb_lbuf_endwsdisplay_defaultscreenszsms_attachi7mtx_enterkqueue_poolvntblinitbuf_rb_bufs_RB_INSERTcpuset_intersectionstp4020_chip_socket_disableallcftablesudf_hashrem.divcgfour_caAES_GMAC_Setkeysleep_queue_initpf_src_tree_RB_REMOVE_COLORti_startti_newbuf_stdax88190_mii_bitbang_opspmap_prefernfs_ptimersin6_ifattach_linklocalVOP_REALLOCBLKSregion_lrunfsrv_accesssys_setresgidsr_crypto_encryptsdebuguvm_pmr_freepagesmsdosfs_sync_vnodesplassert_failtty_initwsdisplay_clearoncloseindir_truncpriq_add_altquvm_km_freesys_killp9100_ras_copycolszswritern_mpath_repriouserconf_numberperflevelpfr_update_statsagten_getcmapuvm_pmr_addr_RB_NFINDrt_setmetricsprocess_auxv_offsetsys_getegidst_spaceuvm_objtree_RB_FINDudf_get_spartmapsw_reg_iodone_internalam7990_getvndgetdisklabelhas_iocachepfr_create_kentryst_quirk_patternsenc_max_iddirchkifaddr_items_RB_FINDipip_outputpipecloseVOP_REMOVEpppoeinqnfs_node_printufsdirhash_findfreeconsinitzsms_cauvm_pmr_isfreeext2fs_dirremoveipsp_aux_matchuvm_vnp_uncachesysctl__stringxyopenbus_untmpffs_clusteracctnfs_timerconfig_detachifaof_ifpforaddreeprom_updatecryptop_poolsensordev_listsr_checksum_printrt_timer_queue_destroydma_cddivert_initsr_meta_proberequest_cleanupque_lookupwi_cdsd_cduvm_pseg_getnfs_createnfs_sndlockicmp_mtudiscsys_fstatipport_hifirstautohmestopmsts_timeoutslclosecgfourteen_ioctlenc_xform_3desgem_sbus_causerconf_enablepf_statetblsafte_matchgetpropintext2fs_vinitbstp_set_port_protodb_endlpffs_alloccgbuf_object_storecryptodevallowsoftsa6_anysys_getprioritypfsync_request_updatetcx_cdhmeinitsparc_db_command_tablenfs_bioreadsysctl_diskinitnfsreqplbridge_listuvm_km_vallochandle_allocindir_partdonescsi_xsh_delpfsync_defer_tmostp4020_chip_io_allocscsi_plug_probesys_unmountsr_meta_native_probeiommu_scapmkqfilternfsrv_getattrnfs_nodetree_RB_NEXTelf32_probestcp_signature_tdb_outputin6ifa_ifpwithaddramd7930attachvgonelendrunattachbridgeintrbwtwomatchnnpfs_read_commonsofreend6_dad_timerctrl_eventdivstatcpuset_uniondb_del_symbol_tabledb_add_exprmbpp_attachpmap_removebpf_mtap_afnfs_statfsicmp6_fasttimouvm_pmr_addr_RB_INSERTnnpfs_returnzeroext2fs_removemtx_initif_clone_destroysi_vme_dma_startmyipbpf_setfuserconf_historyktrsettracevnodexymatchuvm_page_unbusysppp_print_stringfilt_hotplugreadipsp_skipcrypto_unmarktk_noutpf_state_key_plext2fs_mountcgfourteen_putcmapmif6tableBlowfish_expand0statecgsix_accessopsdb_symformat_elfcpu_sysctlcd9660_deftstamphotplugkqfilteraudio_rintip_randomidnettxintrpf_state_tree_id_RB_INSERT_COLORcd1400_compute_baudlacp_sm_muxnosuidcoredumpukphyattachpfsync_qssr_startwu_callbackcddumpdb_search_cmdisp_put_extended_requestsbppattachcs4231_trigger_inputtcp_disconnectuvmspace_execcbq_remove_altqgem_disable_rxwsmux_createdeallocate_dependenciessys_mmappf_anchor_global_RB_INSERTbstp_getstatebootnd6_is_addr_neighborblf_ecb_encryptnnpfs_install_deviceunp_rightshostnameaudio_cddb_print_llinfowsdisplay_emulbellsadb_exts_allowed_innmeaattachme_allocfdstartext2fs_bmapip_mforwarduvmexpenc_xform_blfbufq_donebtcham_attachesp_dma_resetsppp_ipcp_opt_namesensordev_getpmap_changeprot_pufs_diremptyesp_output_cbreinsertfinishduphme_iffsleep_setup_timeoutcs4231_query_devinfoukphy_serviceqsphy_resetmemregattachdeflate_decompresstdb_hashlogwakeupshutdownhook_listpool_destroydl10019_mii_readregep_pcmcia_lookupip_dosourceroutesoread_filtopsdmapoolsdisk_changebdevsw_lookupamap_lookupsdoreallocblksstp_cdcache_revlookupisp_put_request_t2red_destroylerdcsrbpfread_filtopsque_wakewriterssoinitamd7930_getdevzsc_intr_softcpumatch_unknownVOP_MKNODuvmnd6_ifdetachin6_ifaddrroute_protosync_vopshw_uuidPHYS_TO_VM_PAGEext2fs_truncatecd_play_tracksscsi_do_mode_senseuvm_pmr_allocpmrnnpfs_rootvirttimer_trampolineti_txeof_tigon1ip6_maxfragpacketsdb_errorax88190_media_finizskbd_rbuf_lowatuvm_km_threadsppp_cp_inputsr_checksumzskbd_device_lookupgem_fill_rx_ringscsi_probe_buslminttydebugm_leadingspacesys_fpathconfpfi_addr_plpf_get_msswsmuxpolldvma_mapoutarpt_prunesoconnect2knote_poolcnopentslot_io_freescsi_test_unit_readyfdattachrmc_modclasszs_hwiflownmbclustintr_sbus2ipl_4cdma_freesominconnpf_osfp_listep_pcmcia_get_enaddrpf_src_tree_RB_FINDpmap_enk4msegm_freelistledmaintrnnpfs_dnlc_purge_mpsoftraid_cdpcmcia_matchlacp_disable_collectinguvm_vnp_syncpool_allocator_large_nicgeight_cawsmux_set_displaypfr_unroute_kentryufsdirhash_checkblockuvm_map_hint1wihap_assoc_reqinodedep_poolarpt_downtcx_accel_plugwsmoused_wakeupudf_accesspfr_ina_beginstate_regstrunk_port_checkstackingp9100_write_ramdacbpf_tapdb_lookupuvm_pmr_addr_RB_NEXTnumnegchange_sign16_le_stmwsmousedmii_phy_autouvm_pmr_addr_RB_FINDnfs_mountrootmax_datalengem_initufs_mindirhashsizemsdosfs_initwi_write_record_ioesp_cdext2fs_writestp4020_statintrlf_clearlockisp_put_request_t7uvmpd_scan_inactivech_exchangenfs_udpsockdb_lastsymmgx_read_1ip_srcrouteip6_accept_rtadvsr_raid6_alloc_resourcessys_setregidpcmcia_cdcpuset_infoslemediachangevinvalbufmii_bitbang_writereglo_microtimebestartpfi_ifhead_RB_INSERT_COLORnfs_mkdirsys_ftruncatetcx_stippleaes_ctr_cryptah6_input_cbsoftdep_fsyncm_splitisp_donesoftintr_disestablishentropylockncr53c9x_attachgentbi_cafifo_polltcp_timer_initdb_tab_stop_widthdb_putncharscarp_clone_createau_get_muteoclk_get_dtudf_find_partmapsscsi_sem_enterfdc_wrfifond6_maxnudhinttcp6_inputip_mroutersosetopttcp_mssifa_addcs4231_attachcache_purgebeqintsafte_temp2uKsl_clone_destroybpf_mcopyti_attachax88190_mediachangepcmcia_3cxem556_func0p9000_ras_initauth_hash_hmac_sha1_96pcmcia_intr_disestablishfork1mpestartam7990_ioctldb_activeaudio_set_blksizetslot_slot_disablevfs_hang_addrlistst_cach_camrt6statdead_writemagma_caufs_dirrewritecarp_set_enaddrinsmntquettreadtk_canccdb_write_bytesext2fs_blkfreeudp_outputvlan_taghfind_last_setisp_requeuesoftintr_schedulesys_chmodccdsizecopy_flow_dataspifstcintr_rxprelist_removeuvm_objtree_RB_NFINDnnpfs_appendqffs_vgetinitprocbt2pmtip6_getpmtuti_init_rx_ring_jumbobcstats__umoddi3pfkey_buildprotoswnfssvc_nfsdmbpp_cdsppp_lcp_RCN_rejcgtwelveattachip6_log_intervalnull_encryptsched_idle_cpuswihap_auth_reqscsi_activate_lunuvm_page_physdumpccdbuffernfs_readlinkrpcX_db_sym_initsyn_cache_timermbpp_caext2fs_checkoverlapsolisten_filtopsin6_update_ifamyleintrstat_inode_bitmapSHA384Updateep_mii_sendbitsnnpfs_printnode_commonpfsync_delete_state_udivreplacebwtwo_accessopsrt_msg2suser_ucredaltq_remove_queueqecprintcarp_vhe_send_ad_alltcp_sack_optionsd_shutdownmem_noext2fs_buf_allocdp8390_startsoftdep_disk_write_completehicleanpagesbufbackpagessystrace_seteuidipcomp_input_cbdb_prom_cmdcs4231_trigger_outputwihap_sta_deleteep_pcmcia_detachstwritepfkeyv2_get_proto_algpfkeyv2_releaseRMD160Update_intrevarprequestkernel_mapwi_init_iozskbd_rbuf_hiwatdumpdevppp_dequeuebwtwoattachwsmouseioctlsppp_lcp_upcd9660_lockietintgf_powchange_sign16_swap_bytes_le_mtsm_printuvm_pmr_splitnnpfs_node_purgevfs_mount_foreach_vnodekqueue_kqfilteraudio_resumesoftdep_typenamestimeout_add_usecpfr_ktablehead_RB_NFINDamd7930_get_propsimport_lifetimeip6_mrouter_donepriq_remove_queuewi_mgmt_xmitaudio_opencgtwelve_ioctlzeroin6_addrmemreg_castrncasecmptimer_filtopsuvm_objwire__guardtcp_mss_advbstp_ifstateSHA512Update_intin_ifaddrsunkbd_keymapdatand6_optionsafte_detachufsdirhash_findslotsppp_chap_initwin2unixfnmax_hdresp_dma_setupnum_inodedepffs_readinet_ntoa4tun_clone_createphtree_RB_FINDm_freetslot_cdzs_cacbq_add_queuene_pcmcia_dl10019_get_enaddrsr_meta_attachsr_meta_native_bootprobescsi_inqmatchfdesc_poolufsdirhash_poolpool_page_allocsr_switchin_pcblookupm_tag_delete_chainfilt_pipewritecd9660_pollipe4_initbzeropromcnputctickfixintervalmii_bitbang_syncswapdrum_addufs_closemrtstatdefrouter_delreqfixjobcpf_anchor_removeuvm_pmr_size_RB_REMOVEpflowattachdb_show_all_cmdsscsi_devidsparc_noopin6_addmultistat_ino_limit_pushrn_newpairmsginfopppfcsbiospfsync_request_full_updatesunkbd5_keydesc_ptsys_obreak__udivdi3blf_setkeyxdc_tickdesirednfsrvcachepf_routablesttystopsystrace_msg_emulmemregmatchcpu_classrfx_ioctllastddatepppoeattachromgetcursoraddrzs_set_modesuvmfault_unlockallsr_meta_getdevnamem_inithdrpf_rtlabel_addisp_fw_statelemediastatusuvm_pmemrange_addr_RB_NFINDisp_get_fc_hdrin6mask0swap_key_cleanupbpf_validatevaccessieinituao_set_swslotmbinitchange_sign8tcp_secret_ctxhypersparc_mmu_enablegem_pcs_writeregwskbd_default_bell_datascsi_readsafe_cmdsbpp_caxdc_submit_iorqsunkbd5_keydesc_sfamap_allocVOP_LOCKbuf_rb_bufs_RB_INSERT_COLORMD5Finalstty_casbppopencgsix_resetwskbd_matchenc_ifpscp_timennpfs_readdir_commonncr5380_initcgfourteenmatchsbus_attachnnpfs_devioctlcd9660_vget_internalsystracef_readlinear16_to_linear8_ledb_page_print_cmdpf_osfp_initializewi_intrcypress_cache_flush_allipsec_acquire_poolbstp_same_bridgeidrw_caslkmioctlvgetti_iffzs_conschannfs_cache_enterwsmouseopenamd7930_set_portwinChksumbufq_requeuefreeclusterchainmld6_initscsi_get_linkhardmemerr4mswapmapsunkbd_keydesc_sgdisk_initpf_tcp_iss_offisp_get_rio2beintrnfs_nameiSHA256Updaterip6_ctloutputnfs_getattrcacheiommu_dmamem_mapdisk_readlabelpfi_updatend6_na_outputisp_get_response_typeext2fs_fhtovptrunk_ether_addmultisr_validate_stripsizeext2fs_createsppp_ipv6cp_downhmeintrnfsrv_createexec_aout_prep_oldomagicwi_sync_medianfs_realignpipe_pollnsphy_caseminfobmtphyattachsysctl_dopoolep_detachpmtu_expiretcp_respondsys_readvpf_trans_setcrypto_getreqpgofsetamap_cow_nowroundrobinuvm_map_createworklist_tailissignalhypersparc_pure_vcache_flushsr_attachin6_selectroutektrinitheadertagname2tagpfr_insert_kentrycdevvpget_sg_cntmbppreadch_get_quirksigmp_joingroupinflateIncomppfr_pool_getbeeintuiomoveled_cdmsdosfs_startlf_allocdb_loop_countwi_intr_ackisp_port_logoutcpu_idle_leavebpf_reset_dpf_anchor_node_RB_INSERT_COLORnd6_dad_stopuvm_tree_RB_PREVdiskmapioctlcs4231_readcarp_send_nauseloopbackuvm_waitpf_anchor_stacknfsfifo_closefilt_apmreadnexecsststartmclpoolssppp_set_ip_addrsnfsm_v3attrbuildbetintpmap_referenceprocess_worklist_itemsys_bindax88190_mii_statchgclockattachcarp_addr_updatedloioctlrw_exit_writeisp_mbox_wait_completedma_gofindrootcarp_iamatchfpu_cleanuppmap_bootstrapgre_input2ipsec_auth_default_levelbstp_rerootedblf_cbc_encryptcputypsys_mquerynfs_specvopsbigadjkmeminit_nkmempagesnfs_sysctlipsec_policy_poolsppp_ipv6cp_scrwi_pcmcia_detachscsi_io_putfdsizeuvm_pmr_size_RB_REMOVE_COLORshm_last_freemcllivelocksscsi_iopool_initvether_media_changegif_clone_createuvm_pmemrange_findsppp_ipv6cp_RCRfillinusemaprecvitfill_kproc2bmtphy_funcsipsec_common_ctlinputtdb_rehashep_media_changeipcomp_outputfilt_sowriteti_alloc_jumbo_memuvm_kernacccnpollcsys_linkadd_to_worklistlog_opensr_rebuild_initnumnfsrvcachegettdbbyaddruvm_pmr_size_cmpfragtbl124userconf_totdevrt_tablesrt_ifmsgqec_putrealitexpireaudio_resume_topf_src_tree_RB_REMOVEunix2dostimeipstatsr_raid6_recreate_wusrmmu_get_syncfltnfs_initscsibus_caffs_dinode2_poolcompat_43_sys_truncatecrfreecnputcin6_gif_inputxyc_perroripsp_delete_acquirecarp_lsdropendruninputip6_lasthdrdl10022_mii_bitbang_opsviking_cache_enablelacp_partner_admintcp_reapermpeoutputnfs_bmappool_sethiwatpf_state_tree_id_RB_NFINDsbus_printmicrotimeuvm_pmr_addr_cmpppp_deflate_draftnnpfs_reclaimpipeunlocksysctl_sysvsemncr5380_wait_phase_timostp4020_chip_mem_allocrfx_mmapuvm_pmemrange_addr_RB_MINMAXuvm_swap_getaudiosetinfoepmbuffillisp_update_busext2fs_reloadcs4231_get_portnfsrv_getstreamcsefindelf32_copyargsisocharpf_frag_treeuvm_km_alloc1fb_show_screencdopentcp_usrclosedqec_cansphyter_caiommu_removennpfs_message_rpccarp_send_ad_alludf_checktagphysmemuvn_flushsunkbd5_keydesc_depagedep_lookupwskbd_holdscreenintr_fastuntrapuvmfault_relockinferiorpfr_ktablehead_RB_INSERT_COLORxy_cdclusterallocrfx_loadcmapcryptof_readxformswsr_raid_syncrt_if_remove_rtdeletewskbd_attachin_pcbbindisp_sbus_canfs_node_pooludp_notifyendtsleepwihap_check_txuvm_pageratopsigactssharesadb_exts_allowed_outdb_set_watchpointbe_tx_harvestbpfattachmpls_initif_detach_queuesitimerdecrvnddumpfilt_nfsreadether_outputshmexitmbppopenexport_authauth_hash_md5crypto_kdonenfs_removebpfilter_lookupm_copym0pppoe_clonervm_physmemiso_shipdirrnd_timeoutufsdirhash_dirtruncpipe_ioctlfilt_timerexpirewskbd_enabledivert6ctl_varscd9660_mountrootbpf_allocbufsrt_gettablemsgbufmappedtctrl_write_datagetphysbufcdsizedb_symbol_valuessppp_lcp_check_and_closedb_evarssppp_ipcp_openwsmouse_mux_closeufsfifo_closewakeupnnpfs_update_handlesoftdep_slowdowngetnanotimedivert_outputsppp_ipv6cp_tlfcgeight_accessopscompat_43_sys_sethostidgem_mii_writeregiommu_cdtvtwomatchtcprexmtthreshkprintf_mutexsetquotastat_countprt_getifaslstartdb_malloc_print_cmdwi_get_fid_ioisp_trestartenosyscompat_43_sys_creatlockmgrbstp_tickrtlabel_name2idisp_uninitgetdevunituvm_vnodeopsdb_bcstats_print_cmdvfsconfisp_fibre_init_2400be_tcvr_initsrmmu_vcache_flush_contextVOP_OPENcompwroffwsdisplay_console_inittedlacp_selectpninek_cavigra_ioctlsunms_abort_inputconsdev_ttynfs_vopsbuckstringgem_pcs_readreggemmatch_sbusscsi_interpret_sensepfkey_unregistersunkbd_layoutsext2fs_flushfilestrunk_ioctl_allportsaltq_attachdes_ecb3_encryptpower_capromveclxtphyattachufs_readlinkin6_ifadddoscheckpathpcbmapaudio_readnd6_option_initbufq_quiesceaudiopollext2fs_setsizeprocess_set_pcffs2_ballocin6_init_prefix_ltimessoftdep_change_directoryentry_offsetesp_outputnchstatscd9660_fhtovpmsgbufpti_loadfwsys_setgiduserconf_common_attrfd_dev_to_typefilt_ufswritert6_flushnnpfs_inactive_commonmpls_shim_swappppoe_clone_destroyuvm_mlk_callenc_setiftctrl_lcdpgt_page_freemmrwbstp_destroyisp_put_sns_requestrfxattachffs_bufatoffah_input_cbpf_insert_src_nodestp4020_chip_io_mapfdcattachcpumatch_hypersparccompat_43_sys_getsocknamedohooksnfs_quotactllacp_timer_funcspriq_add_queuegf_invmpls_ip6_adjttlif_detached_ioctllocnampstat_ino_limit_hitpfr_initializepsegsbridge_rttrimstat_blk_limit_hitbstp_enable_portfilt_tunreadisp_save_xstun_outputuserconf_shownnpfs_dnlc_lookupip_mtudisc_timeout_qpf_remove_if_empty_rulesetsr_scsi_cmdffs_fhtovpgetvnodefilt_ufsvnodecrypto_get_driveridamd7930_devicennpfs_uprintf_devicepool_setlowatkmembaserip6_inituvm_aiobuf_poolisofncmppcmcia_card_detachipsec_add_policysysctl_emulseltrue_filtopssttyopensys_sigprocmaskdb_commandnfs_renamerpcsys_shmctle2fs_sb_bswapin6_if_upfilt_pipereadskip_spc_rightmpls_push_expnull_ipcompat_43_sys_gethostidenc_xform_aes_gmacsoreservepidtakendb_formatpfr_ktable_pltcx_erasecolsmfs_pripf_test6vmeintruvm_mmapnfs_bufqmaxxdr_string_decodescsi_report_lunstrunk_gethdrpf_osfp_matchufs_quotactlcgfour_cdviking_get_syncflttcp_newrenosparc_interrupt44cdma_enintraroundin6_pcbnotifyifaddr_items_RB_REMOVEncr5380_scsi_cmdstrrchrst_check_eodnnpfs_checkexpgetdevvpm_clgethme_cdnfsm_srvsattrdefrouter_selectamap_unrefext2fs_statfsbpf_mtap_hdrcompat_43_sys_sigveccrdupamap_wiperangecuio_copybacktickdeltaisodirinodb_strlcpycfrootswsmousepollchrtoblkscsiprintisp_put_gid_ft_requestuserconf_pdevnamminphysacctchkfreqah_output_cbpmap_rmk4msw_3_leftovercgfour_ioctlether_addmultitimeout_mutexrtalloc_noclonenfsrv_rmdirpflow_clone_createfdcstartudf_strategyxyc_tickip6qffs_vptofhvfs_isbusyifunitcd1400_read_regdvma_endbstp_hello_timer_expirybawritetputcharintstackwskbd_detachcsedeletepool_print_pagelistcs4231_set_speedffs_fragacct_umulreplace_endsi_obio_intr_onffs1_ballocsys_fchownSHA384Update_intdb_breakpoint_cmdwzeronfs_strategyvwaitforiobootpathbe_ifmedia_updmii_phy_tickcs4231_writecd_read_subchannelextendfilelortrequestwsdisplay_resumeicmp6_inputnnpfs_message_invalidnodexyc_ioctlcmdbuf_valistuserconf_addnfs_openwi_func_ionfs_nodetree_RB_MINMAXcreatedepf_tcp_secret_initfb_setsizesbreleasedb_history_sizepf_cksum_fixupmsdosfs_islockedpflogoutputmax_linkhdrwsdisplayioctlcryptof_statsysctl_rtablemsdosfs_reclaimpmap_is_referenced4_4czs_defspeeduserconf_hist_eoctslot_matchuvm_objtree_RB_REMOVEuvm_map_reference_amapext2fs_getattripsec_adjust_mturtlabel_id2namesbdroprecorduvm_coredumpsvlan_tagmaskudf_ds_poolnamecache_rb_cache_RB_REMOVEip6_sysctlsavacctppf_thread_createsuseruvm_page_physload_flagssemtotdiskconfvn_syncer_add_to_worklistvme_camemalliestarttrunk_media_changeenc_clone_destroytk_ninsysfilt_opsufsdirhash_mtxclusterfreerootdevaudio_fill_silencepfi_xcommitpf_normalize_tcp_initpf_print_statem_tag_firstmixer_closecdmatchnnpfs_outqpfxrtr_delffs_checkoverlappfr_clr_tablespriv_regsdumpsysiommu_dmamap_load_mbuficmptstampreplif_detached_watchdogsys_nnpfspioctlrip6_sysctlext2fs_fsyncnfs_ticksdoforcesys_fsyncpfr_get_astatsfree_allocdirectuserconf_add_readsr_crypto_writedivert_packetuvm_mapent_copyifconfamap_wipeoutuser_configswap_bytes_change_sign16_be_stmcast_setkeyhme_mediastatustcp_output_bus_dmamem_mmapnsphyattachmsg_enqueuewsdisplay_emul_attachpfdatatopacketupdate_ledsext2fs_updatebpp_camgx_accessopsuvm_swap_initcryptnfs_accesstcp_timer_2mslpf_osfp_entry_pltbr_setne2000_writememffs_reload_vnodebuf_putpf_tag_packetmsdosfs_setattrVOP_RMDIRwdog_tickledb_delete_breakpointsr_ioctl_installbootif_addgroupmsg_freeudf_readlinkpool_allocator_freefilt_proceopnotsuppxdopenffs_reallocblksnfs_removeitphtree_RB_INSERT_COLORrandomcloserootvpuvm_pmemrange_addr_RB_NEXTtimerblurbsr_raid1_free_resourcespcmcia_intr_establishtrunk_enqueueuserconf_maxlocnamespool_reclaiminitdisklabelbpf_sysctlxdc_cdufsdirhash_removetrunk_ether_delmultivflushpfr_reset_feedbackcddetachtcpctl_varsarptimerbufq_dequeuenfsrv_dorectcp_reass_limitruaddm_copymallocdirect_poolam7990_initmouse_copy_extend_charip6_freepcboptsdb_free_breakpointssa_hw_iflacp_aggregator_bandwidthif_upcoredump_notes_elf32pfr_del_addrswsfont_getflgchkdquotlesetauitimeout_add_nseccpumodcache_alias_bitsuvmfault_lookupm_extfreeslopenne2000_ring_copycgsix_ras_erasecolsVOP_BWRITEbufq_fifo_peekrt_timer_queue_createbstp_received_stpm_cluncountmsdosfs_ioctlno_constrainttdb_soft_timeoutsys_opensr_crypto_change_maskkeyseginvalrasops_pmaskscsi_sem_leaveinet6domainisp_get_24xx_abrtether_crc32_be_updateendrunopenpgdeletetregionbstp_createpf_matchuvm_pageidlezeroemulinstrwskbd_do_ioctl_scdead_vopsdb_symtabspfsync_undefer_divreplace_endpf_anchor_copyoutraw_attach_umulscsi_ioc_cmddb_boot_sync_cmdisp_updateifnewlladdrisp_get_ga_nxt_responsetrunk_rr_startether_ip6multicast_maxpipe_poolxyreadhme_mii_statchguao_initagten_mmappfsyncintrfpu_executegre_usrreqifa_ifwithroutem_clinitifppmap_changeprot4mspec_kqfilterdvma_malloc_spacepmap_page_protect_pnfs_renametcp_notifycd9660_tstamp_conv7hme_caffs_dinode1_poolpfi_ifhead_RB_NEXTqec_translateses_psu2sensorsys_sstkdb_print_positionnfs_lookuprtflushclonedb_radixgetblksr_raid_turmouse_pastenfs_readsystrace_prepinjectsppp_flushti_jfreedl10019_stop_cardmouse_copy_endmaxsmapaltq_inputip6_mcast_pmtunnpfs_message_installattrlacp_aggregator_is_compatiblemfs_vfsopssoconnectwskbd_repeatnfs_writevtypesswap_encrypt_initializedcompat_43_sys_sethostnameromhaltsunms_attachnnpfs_startrtrequest1__lshrdi3_umulreplacecarp_vhids_ioctlgem_mediastatusSHA256Update_intktremulpf_trans_set_commitpf_pool_limitssr_scsi_ioctlxdc_xdresetnfsd_waitingtcp_identtcp_rst_ppslimifinitsd_cmd_rw10cd_load_tocunpst_recvspaceshminfoscsi_io_getget_ifidquotaoff_vnoderpc_callgre_send_keepalivezlib_versionne_pcmcia_attachlebufmatchfree_inodedepraw_inputcd9660_reclaimtcx_accessopsfilt_logrdetachtimeout_add_btpfattachnd6_ifattachunpdg_recvspaceaudio_quiescepipe_closeaudio_draindb_show_all_nfsreqsstp4020_chip_mem_unmaptrunk_port_lladdrcd9660_inactivedesireddquotsoftdep_mountmsdosfs_rmdirmsdosfs_fsyncpfsync_in_tdbcfdataufsdirhash_endusefulffsbetickufs_checkpathesp_enablespifppcintrpfxlist_onlink_checkbstp_update_rolesdiskmapreaddb_elf_lookupzsstartinittodrpfi_ifhead_RB_REMOVEm_tag_findblf_encadler32vputisp_put_requesttcbhashsizeworkq_syswqcd9660_setattrfilt_hotplugrdetachcache_printufs_quota_initz_freekqread_filtopscoredump_writeaudio_closepf_frag_tree_RB_NFINDpcmcia_check_cis_quirkslacp_aggregator_getbuf_acquirebioopssltioctlbpf_setdltpf_cache_treempls_getttlipprintfspool_setiplti_eeprom_getbytezsms_cdmsdosfs_statfslboltpipe_initnnpfs_update_write_credlacp_port_creatern_mpath_prioaes_gcm_reinitsyncerprocpcmcia_card_gettypeifa_print_rbsemseqszsms_softintufs_ihashinsin_setpeeraddrgem_stopwindow_inflatedb_readlinepf_rollback_altqwsdisplay_delscreennum_quesmbpppollzx_putcmappflow_clonerpf_test_rulesr_meta_native_readether_ifdetachdivert6_inittcx_promnnpfs_bmapuserconf_histcurrndstatspfsync_clone_destroyisp_print_bytesxdgetdisklabelst_touch_tapenfs_bwritemsdosfs_inactivepf_add_thresholdhmeioctlpanicstrwsdisplay_kbdinputaudioioctlscsi_delayext2fs_sync_vnodepppintrunpdg_sendspacesession0if_startviscpyptmattachsystrace_answerpf_step_out_of_anchormem_pagewsmouse_do_ioctlnnpfs_make_dead_vnodexyc_cddivert6_sendspaceespstatsppp_ipcp_tlssw_1_leftoversys_msgsndisp_shutdownsbus_translatehw_vercopyincomparamep_pcmcia_prodmpe_clonersppp_up_eventcd9660_defattraltq_addsunkbd_bellnnpfs_message_installrootrtalloc1rmc_dequeue_nextqestopuao_swhash_elt_poolufs_ihashgetswcr_combineddes_set_odd_paritygre_keepaliveencode_comp_tne2000_read_hdrsigacts0ncr53c9x_dequeuefindblkmajorntohlwsemul_sun_controlbmsafemap_lookupsorflushgem_tintvigra_burnernnpfs_link_commonttioctlarpintrqslpquettycharsvprintfsi_vme_intr_offtdb_hashstatssyncdelayuvm_vslock_devicepf_src_tree_RB_PREVsparc_led_blinknmeaopenffs_mountwsmux_mux_closeicmp6errppslimpfsync_delete_tdbmsdosfs_vopsobio_scanlinear8_to_linear16_bedp8390_mediachangeencattachconfig_process_deferred_childrenwsdisplaywritekvm_setcacheluphymatchin6_setmaxmtumpls_mapttl_ip6pf_state_tree_RB_REMOVEmsdosfs_rootmii_bitbang_sendbitsesp_write_regtqphyattachbpf_getdltlistti_mem_settslot_attachm_tag_getnfsrv_commitsb_lockpfr_add_tablesudf_unmountrt_labelscrypto_unregisterpf_state_tree_RB_INSERT_COLORHMAC_SHA1_Finalsuid_clearacctresumettwritedma_alloc_initpfsync_q_delintreg_clr_4mchange_sign16_lennpfs_readbuf_rb_bufs_RB_NFINDbuflowpagescompat_43_sys_recvfromswapdev_vpdp8390_resetvlan_set_promiscrasops1_putchar8wsemul_sun_attachbootpath_storeah_initaes_xts_cryptdead_readufs_pathconffile_pooldb_boot_reboot_cmdunputcendeeprom_matchpcmcia_verboseluphyattachVOP_CREATEcpuset_firstSHA512Updatecarp_ifdetachxywritefbwscons_console_initifai_cmpacctsuspenduvm_map_referencevigramatchnd6_recalc_reachtm_intervalpagetables_startpfi_if_comparein_ifinitfifo_closewi_pcmcia_activatein_pcbhashlookupapmread_filtopshypersparc_cache_enableipcomp4_inputsafte_cdcgfourteen_intrgettdbbysrcdsttadpole_register_extvideobwtwo_ioctlnfsrv_initVOP_ABORTOPbpp_cdsw_cacoredump_tradchange_sign16_swap_bytes_lesr_raidp_free_resourcesswap_encryptcgeight_ioctlwsemul_sun_resetopqeresetsys_acceptnsphyter_statusuvm_map_entry_kmem_poolbackoffpagesccdclosetrunk_lladdrwi_inquirenfsrv_setattrtcp_rst_ppslim_countmagma_softif_clone_listsys_futimesccdinitpflow_clone_destroysdgetdisklabelwi_do_hostdecryptinternal_commandsunkbd5_keydesc_nlxyc_rqtopbmgx_setcolornfs_update_rttmalloc_errintvlsunkbd5_keydesc_frin_losingfddumpsppp_ipcp_tluvscsi_caledma_resetsunkbd_keydesc_ukVOP_SYMLINKcompat_43_sys_sigblockgeteblkmmu_pageinwsscreen_detachred_addqcarp_join_multicast6scsibusmatchcrypto_kregistervn_ioctlufsspec_readdb_show_calloutvether_clonerpipespacetslot_mem_unmapget_last_resort_ifidpfi_ifhead_RB_NFINDip6_sendredirectsshmforkcgtwelve_promdiv6statcast_decryptddb_sysctlnnpfs_is_nnpfs_devsr_get_blockukphy_caitimerfixmplsctl_varsip_stripoptionspflow_sysctlspifstcintr_rxexceptionsyn_cache_countep_vortex_probemediand6_timer_chne_pcmcia_ax88190_set_iobaseuvm_pseg_releasep9100attachnfs_mountpvpooltcp_ctlinputether_multiaddrstart_cleanerffs_blkfreeexit1sys_thrwakeupnnpfs_message_updatefidwsmouse_add_muxnnpfs_devsppp_lcp_tlfbdevvpiewatchdogfreefrag_poolifa_ifwithdstaddrpf_free_statesemu_poolpf_state_expirestslot_capim6statdb_watchpoint_alloctag2tagnameselectroutekernel_regtable_storein6_nigrouprasops1_copycolsscsi_mode_sense_big_pageauth_hash_sha1trunk_rr_detachgemattach_sbusuihashpf_frag_tree_RB_REMOVEpf_tcp_track_fullrijndaelEncryptscsi_ioh_deltcp_keepintvlnnpfs_symlinksr_raidp_createp9100_pick_romfontcdwriteufswrite_filtopsttybgconfig_searchisp_parse_nvram_2400isp_parse_statussunkbd_accessopsphtree_RB_PREVhandle_workitem_freefraglacp_sm_rxsppp_ipv6cp_RCN_rejwihap_sta_finduvm_km_valloc_prefer_waitsyn_cache_poolqeioctlffs_allocpf_check_thresholdsegm_lrurompropdb_prevbe_mcresetbswap32ipsec_exp_first_useplimit_poolip6_defhlimcarpattachnnpfs_readlinkgre_outputbstp_timer_stopunp_connect2isp_login_devicesystrace_findpf_testnnpfs_onqpool_prime_pagelkm_maprn_walktreetcx_burnerstclosechcloseproc_waitingsys_chownuvm_pagewireufsdirhash_freeold_setgroups_funcin6_joingroupsys_munlockudf_vopshotplugattachuvm_anfreedofilereadvipip_sysctlvn_statfilepfr_detach_tabledivbtablerw_exit_readwi_intr_enableip6_mrouter_settablefullbewatchdogsr_meta_chunks_createisp_get_portnamevscsiioctltcp_maxidlepppallocvfs_getcwd_commonpfsync_upd_tcpststrategyzsms_disablecttyioctlmbpp_mstohzprocess_write_fpregssys_lstatisp_scsi_channel_initnfs_clearcommitpppopeniso_uiodiripe4_inputimport_addresscttyopenamd7930_query_devinfospifattachinet6ctlerrmapshmctl1icmp6_redirect_diagnnpfs_insertdisknamessched_queued_cpusdumploRMD160Updatemsdosfs_mountpf_pool_copyinp9000_loadcmap_immediatezstty_unitffs_clusterallocsppp_set_phaseexport_credentialsnullcnpollcrfx_burnerp9000matchuvm_km_inituvm_objinitxddumpffs_sbupdatencr5380_pio_outudp_sysctludf_rawnametounicodeax88190_mii_bitbang_readpg_flushcachem_clcountsystracef_ioctlsadb_exts_required_outvmmapbsyxyc_startbufuserconf_histlendb_list_breakpointspf_begin_rulesnfs_getcacheblksppp_inputnkmempages_minledma_carpc_msgacceptedcgfour_accessopsncr53c9x_resetdb_nfsreq_print_cmddivert6_outputmrt_ioctlcgsix_ras_copycolskq_ntimeoutssys_sched_yieldvmspace0stmatchchmatchscsi_decode_sensettywaitwsmousedevprintuvm_map_setuptcp_syn_cache_sizenfsspec_readetextp9100_ras_initzsttyifa_ifwithnetmemchrqsphy_statuscomp_algo_lzssysctl_cptime2ncr53c9x_scsi_resetscsi_mode_sense_pagepipelocksr_raidp_addiofpu_shrsunkbd_getledsproc_pooludp6_inputttcompatsys_writepfsync_update_tdbswap_key_deletemap_forwmergedb_get_valuesb_maxcd_set_pa_immedemul_flags_translatennpfs_install_filesyssr_uuid_printwsdisplay_maxscreenidxip6_insertfraghdrcnstopextent_print_allihashtblsys_dup2nfs_asynciosppp_pickdb_inst_countdb_read_linepf_rule_copyinwsdisplay_switch1bread_clustersys_readlinkext2fs_sizebstp_disable_portpf_state_tree_id_RB_MINMAX__ashrdi3wsdisplay_burnip6_auto_flowlabelmfs_initpfkeyv2_expirevscsi_filtopseeprom_cddevid_copylf_splitifafreeVOP_STRATEGYtimeout_add_sectznnpfs_uninstall_devicerip_sendspacecoredump_writenote_elf32udf_sysctlaltq_getqstatsamap_addtcp_freeqif_setgroupattribscom_attach_subrcgsixmatchdvd_authtrunk_bcast_detachsppp_pap_scrswap_bytes_change_sign16_be_mtspfsync_sysctltdb_firstusetcxattachcdreadbufq_disksort_requeuesr_check_io_collisionspec_inactivedp8390_stoppf_anchor_global_RB_REMOVEwsmux_do_ioctlsys_sendtospifstcintr_mxicmperrppslimgeneric_filtopsknote_dropzx_copycolstrunk_startin6_selectsrctrunk_lb_inputlebufprintiommu_entersoftclock_sizskbd_initbstp_set_port_tcshmget_existingsr_ccb_putin6_pcbsetportnfsrv_nullpflow_timeoutpfi_kif_matchalldevsdp8390_rinticmp_do_errorvmcmd_map_readvnmbpp_startrandom_startamap_extendsigpropvmapbufvndencrypttrunk_link_activedehashtblsocketopsmbpp_sendtcx_intrscsibus_bioctlnnpfs_devclose_commonbuf_acquire_unmappedX_db_sym_numargspcmcia_activatezs_maskintrnd6_maxndoptuvm_map_clip_startffs_fragextendrawcbtablenmea_gprmcspec_readpflow_pack_flowimport_authunp_markisp_parse_asyncdes_key_schedcarp_hmac_prepareicmp_mtudisc_timeoutnwsmuxzs_loadchannelregsskip_char_rightttyread_filtopstslot_event_threadmodule_ms2drain_outputisp_mboxcmd_qnwgetinoquotatrunkattachfifo_ebadfscsi_do_ioctldivert6_usrreqrtable_existsfilt_nfsvnodewtab_alloccd_resettimedeltapf_altqs_inactivegreattachX_db_forallstty_cdscsi_ioh_addsemctl1scsi_detach_busroute_inputsystrace_detachudpstatpf_test_state_tcppfi_allzscninitpfkeyv2_sysctl_policydumpersetrootcd_read_toccarp_inputcgtwelve_resetcdioctlbstp_addr_cmpendrunclosebufq_switchsystrace_policympe_clone_createifmedia_addacctplxtphy_funcssr_matchmttyclosesppp_pap_initsppp_chap_inputlogopenisp_read_nvram_2400luphy_serviceufsdirhash_hashnfs_nodetree_RB_FINDbridge_deletemgx_ras_copycolssppp_phase_networkcd_buf_donebreadntcp_hdrszxboxattachscsi_devid_pg83pf_osfp_pltcbtable__xordi3frag6_drainuvm_objtree_RB_REMOVE_COLORdosdiremptypfr_walktreeigmp_slowtimoifpromiscmsts_scanrtl80x9_mediachangeip6_setpktoptscarp_send_adtrunk_fail_detachfork_returnsys_getsocknamecd9660_lookupep_mii_writereggem_rintmask_rnheadvscsi_cdsw_reg_iodonenfsd_head_flagbridgeattachuvm_swpkeyscreatedufs_rootptyttylesetutpnnpfs_emptyqtcp_sysctlVOP_SETATTRpmap_kremovesigactsinitffs2_blkprefexec_elf32_fixuprt_newaddrmsgvop_generic_lockuvmfault_anongethandle_allocdirect_partdoneconsttypv_changepte4_4cfdclosesr_ioctl_diskisp_fclink_testtvtwo_accessopsusermountext2fs_dirrewritebridge_ioctlsppp_clear_ip_addrsvn_closefile__ucmpdi2vfs_free_netcredip_mtudiscmld6_start_listeningtcp_signature_tdb_initpidhashtblwsemul_sun_opssi_dma_pollm_pullupenterpgrppagedep_in_progressnull_zerokeycrypto_freesessionisp_resetwsdisplay_kbdholdscrpause_timercnbellpf_find_anchorm_copydataintrhandzskbd_txsoftgetdirentries_internalcd_setchanpmap_zero_page_pxdc_rqinituvm_cnt_headmtx_leavecpu_cafilt_signalsigactsfreestp4020_delayfilt_tunrdetachttymallocicmp6_notify_errornnpfs_remove_nodewsdisplaykqfilterzsms_matchsunkbd_keydesc_itmmioctluvm_coredump_walkmapdb_nexttrunk_bcast_attachsched_choosesendsigsunkbd_keydesc_debpf_ifnameeintstackcs4231_halt_inputvfs_busylkm_listmouse_copy_extend_afterfilt_ufsdetachlacp_sm_ptx_tx_schedulebufq_initvlan_ether_delmultilf_getlocksr_raid6_xorpieresetsolistenwskbd_compose_valuespec_getattrpf_anchor_global_RB_REMOVE_COLORetherip_getgifip_ecn_ingressmsdosfs_bmapaltqs_inactive_openrip_ctloutputffs_vtblif_getgroupsosplicesystrace_findpidpfi_ifhead_RB_PREVmpls_inkloopipmobile_sysctluserconf_morekqueue_ioctlsys_wait4rip6_recvspaceamap_share_protectfs_sysctlfilt_sordetachpfsync_state_exportpsignalwsdisplay_console_confnfs_getattrconfig_pending_incrsys_osigaltstacknmea_degreespfsync_update_statefrag6_deqsi_dma_freeamap_pp_establishauth_hash_gmac_aes_192ip_mobile_allowti_newbuf_jumbocgsixattachuvm_pmr_nextszzscnprobeuvm_anon_initffs_reclaimbmtphy_cadqfreelisthmeresetzs_set_speedifaddr_items_RB_REMOVE_COLORsysctl_sysvipcqzeroif_link_state_changepmap_virtual_spacepf_tcp_track_sloppybpfpollpfr_route_kentrybwtwo_cduvm_pmr_nfindszupdatepripf_anchor_global_RB_MINMAXbmtphy_serviceptcwakeupsched_kthreads_createp9000_ras_eraserowsulinear8_to_linear16_be_mtswskbd_cnbellnfs_printsr_crypto_intrfbwscons_setcolormapqe_eintttcompatgetflagsuvm_doswapencryptpf_default_rulewi_seekfilt_soreadrtable_addisp_put_24xx_abrtzeropageipsec_def_encffs_nodealloccgsoftintr_establishuvm_pmr_removeip4_input6pfr_ktable_comparepdevinit__iordi3dmamatchtslot_intr_establishnsphytermatchuvm_pmr_findnextsegmentinetctlerrmapresetpriorityau_set_portenoioctlwsemul_sun_output_lowcharsudf_mountcgthree_accessopspfsync_in_ureqsigacts_poolexecsigsmachclk_freqzs_modempfkeyv2_getkrpc_get_xidconfig_initgif_outputip_weadvertisegem_reset_rxicmp6_redirect_inputkrpc_portmapsppp_ipv6cp_tlubuf_rb_bufs_RB_REMOVE_COLORrw_enterinitiate_write_inodeblock_ufs2lacp_sm_rx_update_default_selectedpmap_enu4_4cst_interpret_sensech_interpret_senseuvm_pmr_size_RB_MINMAXcarp_join_multicastsppp_down_eventmixer_ioctlepresetpfr_ktablehead_RB_NEXTnd6_ra_inputffs1_blkprefin6addr_loopbackuvm_objtree_RB_MINMAXttypendvprintuvm_swap_freepagesreserve_spitunpollpfi_buffer_cntqsphymatchnd6_dad_starttimerin_revarpinputstrlcpycompat_43_sys_sigsetmaskX_db_symbol_valuesphys_availext2fs_advlockknote_fdclosetslot_io_mapnnpfsdebsppp_keepaliveif_clone_detachpipe_rfiltopspfr_maskin6_cksumpf_state_plstrncmpcom_obio_disabledes1_decryptvfs_shutdowngetsockmouse_hidein_interfacessyn_cache_respondif_creategroupxdmatchllinfo_nd6sbcheckreservepreemptuvm_iobioattachzstty_stsoftmfs_printunixdomaindb_next_free_breakpointeeprom_uiouvm_tree_RB_REMOVEsmdzx_putcharscsibusattachetheripstatsystrace_replaceaudiowritesysctl_sysvshmpf_unlink_statecs4231_getdevsyn_hash1ulminwihap_data_inputmsginitdb_last_symtabtctrl_requestproc0paddrrn_addmaskrombootifaddr_itemsudf_quotactlbpf_bufsizeselscansoo_pollnfsrv_noopque_freertafidx_maxknote_processexitsig_filtopspmap_kenter_pa4mwskbdopenttclospmap_protect4mcs4231_matchpfkeyv2_acquireipsec_soft_allocationssleep_setupsparc_led_tobridge_addrulesppp_lcp_opt_namesr_rwmodest_mount_tapenet_sysctlcom_cdnnpfs_symlink_commonsystracef_writepfi_address_addwskbd_do_ioctluvm_pmr_size_RB_FINDudv_listdead_ioctlnnpfs_fsyncpppasyncrelinqfill_eprocsunkbd5_keydesc_dkufs_dirhashchecksysctl_iflistsys_thrsleepep_read_eepromrasops_alloc_mattrvwakeupsystracef_kqfiltertrunk_bcast_inputsl_compress_tcpif_clonersvgonetcp6_ctlinputsched_init_runqueuesdb_stack_trace_cmdcypress_get_asyncfltsbus_cacgthree_setcolorimport_tapufsspec_closene2000devstcxmatchnd6_prefix_offlinkuvm_anon_dropswapdl10019_mii_bitbang_readwi_detachigmp_inputkmemusagenfsm_mbuftouioswcr_sesnumlf_getblockwsemul_sun_console_emuldatatcp_rttdfltcleanerprocfifo_reclaimgetcacheinfo_obpsbappendstreamm_tag_copy_chainpmap_copy_page_pfdformatsppp_ipcp_RCRsafte_ioctlsowrite_filtopssr_chunks_unwindstrncpycseaddrevarp_in_progressdb_disasmsdreadsys_opipelinear16_to_ulinear8_leep_statchgupdatefatsvfs_getvfsffs_sync_vnodesr_raid6_discipline_initncr53c9x_sensepv_link4_4clacp_update_portmapproc_stopvfs_vnode_printzx_cross_waitdb_history_lastrrticks_initmgx_wait_fifobpfilter_createsysctl_lockax88190_mii_writeregamd7930_shareintrlockfpoolwihap_disassoc_reqsi_obio_dma_stopgre_link_statepfsync_out_delnpmemarrnnpfs_data_validaudioread_filtopsufsdirhash_listcpu_switchtohtonlsched_all_cpusp9000_intrin6_mask2lenvndioctlrmc_initmrt6_ioctltcp_dooptionsdos2unixtimesys_sigactionsr_scsi_donewsdisplay_suspend_devicezscnputcnnpfs_rmdir_commondeupdatpow_wsl_clonerexport_tapSHA256Transformrndlock__negdi2tunioctlin6_purgeaddrcpu_modelsystracecloseuvm_tree_RB_FINDcttyreadcd9660_unlockti_chipinit_pciisp_put_gxn_id_requestsppp_to_eventuserconf_cmdswsdisplaycloserpc_replylkmclosembppwriteschedclockbpfioctlconfig_attachsr_sensors_createstty_paramipsp_addressdl10019_init_cardbmtphy_statusmbpp_rwtdb_timeoutsysctl_filesys_semopdisk_unbusysoisconnectedisp_parse_nvram_12160nnpfs_opensystrace_msg_resultamap_clean_workscompat_o47_sys_getpeereidin_gif_inputti_handle_eventsdefheightcs4231_devicenfsm_buftombufetherip_sysctlVOP_PATHCONFdk_mountrootassertwaitokdb_run_modeauth_hash_key_md5tuninitscsi_minphys_remreplace_endmfs_strategyppp_restartvattr_nullsys_getsockopthme_tcvr_bb_readbfrag6_nfragpacketstdb_initvlan_unconfigdb_linesr_raid0_assemblenfsm_srvfhtompool_allocator_largelehwresetin6_restoremkludgeuvm_anon_lockloanpgvfs_sysctlpmap_statshypersparc_cache_flush_allcpu_matchVOP_READLINKbuf_mem_initfoundfpulacp_enable_collectingdb_ed_styleshm_find_segment_by_shmidnsphyter_funcsmii_submatchktrpsiguvmexp_printwsdisplay_unset_cons_kbdmsdosfs_pathconfxdc_errortimeout_wheelisp_mboxcmdbpf_m_xhalffdioctlaverunnablecd9660_getattragtenattachttyfreettysleepdp8390_initcarp_setrunpnfskqunp_disposechquirksscsi_inquireufs_getattrBlowfish_enciphervfs_exportlebuffer_cdamd7930hwintrfsrtonamesr_hotspareuvm_km_pgremovesoftdep_disk_io_initiationpfkeyv2_sysctlnfs_nodetree_RB_REMOVEex_region_plpfr_ktablehead_RB_REMOVEpf_anchorsfscalenewallocindirffs_alloccgblkbridge_hashwsemul_sun_translatezsenqueue_txip_optcopypf_altqssunkbd_keydesc_befrcarp_setroutevfs_registerpmap_rmu4_4cm_livelocksys_dupmcllowatmii_printbpfilterattachpmap_cache_enableproc_stop_tofilt_vscsidetachisp_rdnvram_wordtimeout_todoswcr_initdb_lccd1400_write_regrasops8_putchar8cpumatch_mssppp_cisco_inputudf_checkexppmap_clear_reference4msr_ioctl_createraidpanicsppp_ipcp_tldmsdosfs_lockseltruewsdisplay_console_devicebpf_m_xwordepwatchdogscsi_xs_syncautoconf_nzssoftdep_initializeipsp_skipcrypto_markti_rxeofunp_shutdownstackgap_alloccpu_confwi_resetext2fs_sysctlmark_ecngif_startkthread_run_deferred_queueintr_fasttraparc4_initpf_tagssr_raid1_recreate_wusunkbd_decodenmea_date_to_nanolastdaycheck_execdb_max_linetcp_initsystrace_execve0pcmcia_attachdeferred_config_queuedp8390_getmcafbuf_rb_bufs_RB_MINMAXnetisr_initpfsync_upipport_lastautoudf_unlockwsmux_detach_scmtty_attachnum_on_worklistcom_raisedtrnnfs_init_headpppgetmdb_last_commandintr_initpfsync_clone_createip6_pcboptwinSlotCntvn_kqfilterext2fs_syncproc_waiting_timeouttrunk_stopsched_stolenep_mii_readregstp4020_create_event_threadwcopycrypto_registercache_purgevfspostsigsys_pathconfsppp_lcp_RCN_nakgetmicrotimein_addmultirasops_reconfigmaxnnpfs_message_sendbridge_ifdetachmmu_3lsppp_outputipsp_acquire_sapf_match_rcvifscsi_probedevpmap_page_protect4_4ctcp_templatenfs_commitmsdosfs_readdb_object_print_cmdam7990_zerobuf_contigtctrl_cdsr_crypto_finish_iocomopenzstty_softintsunkbd_keydesc_nlauth_hash_hmac_sha2_512_256esp6_inputbcopywsmouseclosewdog_autoncr5380_wait_nrq_timoaltq_lookupkqueue_wakeupip6_unknown_opttcp_reasssys_getfhext2fs_vgetrt_timer_timerrtbl_id_maxfb_burnerSHA1Update_intcuio_applyni6_addrsdefrouter_addreqin6_clearscopesppp_nullpflog_bpfcopyp9000attachnd6_dad_ns_inputuvmpd_tunepmap_pa_existsespdma_resetaudio_free_ringne2000_readmemffs_setblockipsec_expire_acquirewsscreen_switchwaiticmp6_mtudisc_clonepf_normalize_mssinflateResetti_free_rx_ring_jumbomemcmpwskbd_init_keymapnamecache_rb_cache_RB_REMOVE_COLORudf_lockip6_dad_pendingp9100_read_ramdac_uremmsdosfs_createcd9660_startdb_output_linepfi_update_statuscomstartauxreg_cdfbwscons_attachaes_xts_reinitdb_examinepf_rollback_rulescfroots_sizedb_end_linetickadjpool_alloc_item_headerip6_splithdrpf_init_rulesetpf_rule_plpfi_kif_reflacp_transit_expiretcp_secret_initsbreserveisp_setdfltparmvrecyclembpp_timeouthandle_workitem_freefilein_pcbnotifymissextent_printaudio_careserve_dumppagesblf_ecb_decryptcrcopydb_symformatsys_revokestp4020_map_windowstat_direct_blk_ptrssysctl_stringsys_rebootcompat_43_sys_lseekext2fs_specvopspfsync_timeouttrunk_capabilitiesbufpooldl10019_mii_bitbang_writefdopenproc_finish_waitcpu_forkcompat_43_sys_getpagesizebstp_received_rstpaudioopenpfr_add_addrswi_write_data_ionew_nnpfs_nodedb_print_ifattylistflush_inodedep_depssppp_suggest_ip6_addruvm_vslockcast5_setkeyxformswNXFORMSWdeflateResetpf_osfp_validatettyoutputtvtwo_directcmapmodule_vikingexplicit_bzerosbpppollcd9660_tstamp_conv17vndbufplisp_print_qentrywskbd_calxtphy_statustqphy_cdnfs_fifovopscarp_set_ifpsemundo_cleartvtwo_setcolorcryptodev_cbudf_lookupep_pcmcia_enable1pcmcia_scan_cismbpp_hztomsfb_updatecursorfdcmatchclockintrcpuset_add_allrn_mkfreelistbstp_timer_latchvndreadVOP_READpfcloseufs_ioctlffs_freefilein6ifa_ifpforlinklocallastdtimeisp_get_sns_responsenfs_sndunlockenc_clone_creategetdisksys_setuidtimeroksi_obio_dma_setupstart_updatecgfourteen_caufs_quota_free_blocks2senditsr_crypto_decryptuvm_swap_finicrypt_alludp_detachbridge_spansppp_lcp_tldbufq_fifo_destroycluster_writecompat_43_sys_waitrnd_event_tailvscsi_attachp9100_external_videowsemul_sun_selectattributeuvm_setpagesizennpfs_mount_commonnfsrv_zapsockipsec_update_policyfpu_ftodtcp_xmit_timersr_raid1_rwst_rewindin6_recoverscopemfs_badopufs_dirhashmemnfs_nullp9000_ras_erasecolsnsphy_servicefirstchildcompat_43_sys_fstatpmap_enter4msr_raidp_set_vol_statetimer_cdch_positionnnpfs_unmountbridge_ifenqueuetimeout_add_tvtickmclpool_warnmsgdb_termpflog_packetmem_access_fault4mmmclosescsi_preventcd9660_accesssr_wu_getmttyttybe_tcvr_read_bit1ffs_statfsxdr_inaddr_encodemsts_nxidpmap_rmu4mzsnull_rxintcpuset_complementrijndael_set_keyudp_recvspacefill_file2mttyopenudf_fhtovpgf_initsyn_cache_unreachuserconf_histszsys_getrlimiticmp6_errcountbpf_attachdicmp6_ctloutputsppp_qflushnnpfs_vgetbridge_rtfindcpuset_issetufs_dirremoveahctl_varsnumvndif_attachsetuppipe_writeisp_get_gxn_id_responsem_clsetwmscryptof_pollnnpfs_lookupstat_sync_limit_hitsbappendpfsync_out_iackin_pcblookup_listenrmc_queue_packetsi_vme_dma_stoppfr_remove_kentriesm_copybackipcomp_enablescsi_remove_linksunms_ioctlnd6_rtmsgiommu_dmamap_loaduvm_swap_puticmpbmcastechogre_allowfifo_advlockHMAC_SHA1_Initesp_zeroizelacp_tickextent_print1db_continue_cmdcarp_hmac_prepare_ctxcarp_ouretherufsdirhash_lookupsoftdep_errorstp4020_event_threadmpls_raw_sendspacetcp_signature_applybufheadprocess_write_regsconfig_scantun_ioctlwi_get_nwkeyfilt_ptcwdetachsr_raid6_addiozx_burnersppp_cp_type_namefdfinishprom_inSrc_nameripsrcshminitiso_nchstatsnfsm_srvwccvether_clone_createxyc_chainnlineswdb_restart_at_pcdb_sstep_printether_ifattachfdcstatustunwriteinflateSyncsr_raidp_xorxyioctlmgx_wait_enginebridge_rtlookupsignal_initnsphyter_servicefill_drlistptyioctlxyc_cmdffs_updatedb_print_formatzx_copyrowswsmuxclosenfs_checkexpdp8390_getmagma_cdzs_to_tiocmclear_inodedepsunix2dosfnisp_put_ct_ptspec_advlockfragtblraw_sendspacepfsyncifnulloppf_find_fragmentam7990_meminitsttyreadp9000_ras_do_cursorpfr_copyout_addrgem_unconfigbw_meter_chsunkbd5_keydesc_sgip6_ecn_ingresssystrace_insert_processsackhl_pooltrunk_watchdogsppp_dotted_quadcomdiagextralocnnpfs_fhlookupunsleepvop_generic_bmapti_init_tx_ringscsi_xs_getsunms_speed_changeX_db_lookupkernel_segmap_storeblf_encrypttdb_allocsched_proc_to_cpu_costipintrsppp_ipcp_closegetnanouptimedes3_encryptmaxdmapaltq_removeti_watchdogpfkeyv2_flush_walkerext2fs_symlinkdb_skip_to_eolinverse_charip6_savecontrolbridge_blocknonipdevice_registerau_check_portssr_raid6_set_chunk_statend6_dad_stoptimerq_to_bpfkeyv2_initsoftdep_process_worklistmountrootpf_tbladdr_removewsemul_sun_output_normalsafte_read_configsyn_cache_resetdb_inputchardb_boot_cmdsip_initreaddemsgctl1process_read_fpregscd9660_rrip_getnameufs_check_exportdes_encryptsysctl_rdintcd_interpret_sensein_mask2lenscsi_iopool_destroylodirtypagessr_ioctl_disciplinefindwin95sys_nanosleepVOP_WRITEtcp_update_sack_listcompat_43_sys_getkerninfostart_init_execputtdbifa_update_broadaddrmsts_decodenmea_timeoutnd6_addr_addpmap_unuse_finalsppp_ipcp_upifa_ifwithaddrpf_match_uidsr_dumpclock_ymdhms_to_secsstty_startsunkbd5_keydesc_ukprocess_checkiopermxbox_fix_rangestat_indir_blk_ptrsdb_write_cmdif_clone_attachwsmoused_releasehme_readsys_getfsstatbpfopencdstrategynetisr_intrendrun_timeoutnfsrvhashtblvlan_configkmemstatsnd6_slowtimo_chset_pim6uvm_km_valloc_alignenc_xform_nullses_make_sensorsipsp_reffreedb_max_widthip6_pullexthdrfilt_audiordetachmalloc_printitstreadnv2tov_typenfsd_headsvlan_taghcomwritecpu_idle_entermouse_copy_selectionipsec_policy_headbuf_kva_startsppp_pap_tluVOP_RENAMEoclk_set_dtauth_hash_gmac_aes_128cdclosecast5_zerokeysys_fchdirsr_crypto_readcgtwelve_cafbwscons_initext2fs_fifovopssysctl_ifqprocess0bppopenm_cltick_tmorandompidfilt_ttyrdetachsys_ktracearp_inuse_bus_dmamap_destroyvn_pollinet6swrouteswencap_findgwifadosdirtemplateslattachmainbus_cddb_uvmexp_print_cmdspifstcintr_txvlan_tagmasksys_mincorene2000_test_memipcomp4_input_cbrasops8_putcharlastsecondswdog_timeoutwsmousedoopensunkbd_bellstopwi_get_txpowerip_mrouter_doneaudioactivatetcp_maxpersistidlespec_ioctlnewblk_lookupufs_initlacp_detachproc_reparentpf_osfp_getuvm_exitcompat_43_sys_sendfc_bmapcallspr_rmpagepfr_ktablehead_RB_FINDffs_initbridge_filtersppp_chap_tluzx_catcx_copycolsdvmamap_extentnfssvc_sockhead_flagcluster_wbuildsr_crypto_createvigra_castpmatchscsi_ioh_setuvm_initvigra_cdsppp_ipv6cp_initsys_ioctlnfs_renameitsunkbd_keydesc_svif_free_sadlktrsyscalldb_dotquotaon_vnodetslot_io_unmapfilt_bpfrdetachwsdisplay_emul_caudf_startst_loadquirksicmp6_initgem_confignnpfs_writetrunk_lacp_attachfilt_ttywritepool_update_curpageaudioamd_cdin_setsockaddrptcclosepool_set_ctordtortslot_resetpmap_is_modified4_4csunkbd_keydesc_dkzs_write_csrnnpfs_message_installnodepfi_dynaddr_updatenfs_advlockbpf_moveinacct_procostypevndbuf_pooluvm_km_getpage_plalastpidaudiogetinfouvm_pmr_remove_1strangeptswriteip6_insert_jumbooptipintrqepintripcpermgre_clone_destroyccd_softcsoftdep_workitem_pendingvlan_ioctlpfi_attach_ifgroupmaxproctslot_functionszskbd_cnpollcip_slowtimopmap_clear_modify4msi_obio_intr_offpagedep_hashtblnfs_setattrrijndaelKeySetupEncip6_nexthdrrtdeletemsg__bss_startrt_tab2domqsync_vnodespifmatchbeattachpv_syncflags4mauxio_regmstscloseshm_nusedrpc_mismatchrijndael128_encryptVOP_KQFILTERpf_tcp_secret_ctxpf_calc_skip_stepsukphy_funcssys_msyncallocdirect_mergedeflate_compresswsemul_sun_jump_scrollwskbdreadsbappendrecordevcount_detachsd_capcmcia_function_disablepf_change_apsr_crypto_getcryptoptrunk_lb_port_createvscsi_ccb_getsoftdep_fsync_mountdevinitmsgbufwsmouse_attachtcp_signature_tdb_zeroizeconfig_activatememsetsema_initcuio_copydataptsstoppipe_free_kmemufs_getlbnsti_chipinitpmap_clear_modify_pnnpfs_fsync_commonphysiopcmcia_3cxem556_func0_cfe0nfs_realign_testin6_selecthlimdb_show_all_vnodesdb_symbol_is_ambiguousaudiocs_cdxyc_resettrunk_fail_startmii_phy_delete_mediain6_unlink_ifacrypto_kdispatchicmp_mtudisc_clonesppp_print_bytescgsix_caclass_cmpuvm_pmr_insert_sizesodisconnectrw_assert_unlockednnpfs_uio_end_lengthsys_setgroupsmainsunkbd_decode5pmap_rmk_plxtphy971_funcsnfs_vfs_initaudio_resume_taskprocess_sstepbppioctlether_crc32_le_updatepf_anchor_setupisp_attachcarp_ioctltimespecfixpf_remove_fragmentrasops_init_devcmapsr_raid1_set_chunk_statefree_all_nnpfs_nodesipsec_acquire_headktrgeniopfr_clstats_ktablepfr_insert_ktablesstminphysip_flushget_pim6svlan_clonerpf_state_tree_RB_PREVdp8390_configrasops_mapcharnfsspec_closempls_do_cksumaudio_polluvm_unmap_removetickdelayzsreadfd_typesdb_hangmanicmp_errorwsmuxdevsuvm_swap_markbaddes_set_keykqueueopsaudio_pintpf_addrcpyoldmon_w_tracevholdbufq_fifo_dequeueqestartidgen32db_help_cmdpfsync_defersbppmatchrt_if_removesr_minphysscsi_default_getghash_gfmulsystrace_wakeupsl_clone_createm_adjloadfpstatemld6_stop_listeninghotplugioctlppsratechecksys_ptracebridge_rtagenodekmemlimitcompat_43_sys_setrlimitbstp_decode_bpdufilt_tunwritebuf_rb_bufs_RB_PREVgre_softc_listncr5380_cmd_timeoutamap_copybufq_draindvma_mapin_spaceuvm_rb_spacesched_wasidlennpfs_mkdir_commonsysctl_kmemlockisp_put_request_t2elf_findoverlapcs4231_set_portsr_raid_start_stopovbcopycarp_proto_inputpppoediscinqlf_wakelockdb_sym_numargsvmel_cadumpconfgem_ringsizewi_rxeofsunkbd_enablesys_shmatpf_match_addrzsops_mswsdisplay_cons_kbd_pollcdead_badopoclockattachpool_large_alloc_nigem_intrisp_register_fc4_typesparc_interrupt4mcalcrusys_unlinkblf_cbc_decryptdb_cmd_listrt_setgatesetpte4mdqrefsema_gettcp_ack_on_pushtrunk_port_creatennpfs_dead_lookupzsaddrext2fs_rmdirufs_chownsysctl_intuvm_shutdownnnpfs_stat_filesysbridge_localbroadcastkqueue_closewsdisplaystopuvn_initlacp_sm_ptx_update_timeoutpfr_clr_addrsstrlcatifnet_addrssysctl_int_arrau_set_gaindisk_unlockep_roadrunner_mii_enableufs_ihashrempf_map_addrfrag6_enqti_encap_tigon2cttywriteoclk_get_secs_bus_dmamap_createSHA256Inittcp_update_sndspacesdmatchpagetables_endpool_chk_pageproc0ccdopenisp_parse_nvram_1080ufs_renamesppp_lcp_inittslot_printext2gennumbersr_already_assemblednnpfs_attr2vattrrt_ifannouncemsgsoo_readhme_reset_rxuvm_km_doputpageufs_opencopyout_statfsbstp_set_port_statepfr_ffaddrgem_mii_readregm_catidle_uzsstoprtinitncr53c9x_variant_namestqphy_statuszskbd_stsoftlacp_sm_rx_update_selectedtrunk_lb_startcluster_collectbufsepbusyeepromcpcbuvm_swap_inittcp_nowdb_trace_until_matching_cmdproc_printitpfi_match_addrdes1_setkeyunp_gcsys_clock_gettimecsefreeip6_hdrnestlimitpool_catchupcpuset_clear_uremreplaceswift_hotfixfrag6_initpf_enable_altqbuf_replacevnodeuvm_pmr_size_RB_NFINDvlan_ifdetachtimeout_settrunk_list__subdi3pfi_kif_updatetctrl_read_datawsdisplay_resetpf_state_tree_id_RB_FINDntohsgetptep4mmsgbuf_putchar_bus_dmamem_freeinet_ntoalacp_info_tlv_templatedb_boot_poweroff_cmdcgsix_ras_eraserowssd_flushcd_setvolext2fs_mkdirext2fs_direntermii_pollstatisp_put_cont64_reqpfkey_registerrw_exitst_erasedupfdopenidgen32_initchange_sign16_benfsrvlruheadifmedia_list_addpidhashrtprefpfr_lookup_addrtree_src_trackingbe_cduvm_totalsppp_lcp_TObtcham_caencdebugpfr_table_counttctrl_ext_statuszx_eraserowscs4231_halt_outputicmp6_ratelimitdb_unread_charsr_raid1_createcgtwelvematchdl10019_mii_bitbang_opstimestat_worklist_pushwskbd_rawinputvme_cdstart_initbe_tcvr_write_bitether_fakeaddrscsi_ioc_ata_cmddivert6_inputpmap_copy_page4mtcp_mssdfltbt_putcmapuvm_swap_freeudf_hashlookupti_init2cgsix_setcolornnpfs_update_read_credpfi_unmaskzx_attachzs_iflushdb_look_charin_pcbdetachmsdosfs_vfsopspf_state_tree_id_RB_REMOVEttycheckoutqpf_rule_to_actionspmap_zero_page4_4cicmp6_mtudisc_callback_registerdb_set_variablene_pcmcia_detachrnd_event_spaceswap_bytes_change_sign16_le_mtsrt_getmetricsbstp_pdu_flagsin6_ifdetachcn_tabdb_search_symbolswaplist_insertvndstartip_forwardppp_compressorszx_resetextent_createti_stats_updatexdstrategybstp_timer_startbpf_freedswap_bytes_change_sign16_bedisklistin6_lifaddr_ioctlallocindir_poolsys_fstatfspfsync_in_iackpfr_ina_rollbackpfsync_inputpmap_clear_reference4_4cidpromtun_link_statem_injectmpls_shim_popip6_mforwardingtvtwoattachbusprintnd6_setdefaultifaceffs_isfreeblocketherip_input6ccdioctlufsdirhash_uninitseltrue_kqfilteruvm_map_lookup_entryhztoBlowfish_expandstatem_pullup2zscngetclacp_xmit_markerdead_strategymtty_matchvif_deleteni6_store_addrsnnpfs_node_findktrcswspec_fsyncpriq_pfattachlacp_linkstateuvm_map_deallocateicmp_reflectpf_anchor_node_RB_MINMAXp9000_burnerpmap_dumpsizescsi_xsh_iohmii_phy_activatesunkbd5_keydesc_noext2fs_reclaimffs_ballocsys_getgroupsiommu_dmamap_syncmsg_copyinsystracef_pollmakememarrpfkeyv2_createip6_raw_ctloutputsoftdep_setup_allocdirectpf_rtlabel_removekernel_textufs_startbufq_disksort_dequeuexyc_errorcs4231_set_paramslkminitkinfo_vdebugnsphy_resetzstty_stintuvm_rb_insertufs_bmaparrayfragtbl8nfsv2_typepfioctluvn_sync_lockpcmcia_function_enableaes_ctr_setkeynnpfs_close_commonlacp_marker_inputcgeightmatchpf_frag_tree_RB_PREVxyc_piodriverswaplist_findufs_quota_alloc_blocks2bstp_transmitfc_fileextendsexport_lifetimefilt_sigattachwsmouse_cdVOP_FSYNCsr_uuid_gettslot_intr_disestablishmgx_mmapsunms_inputffs_sysctlarpinit_doneipport_hilastautouvm_anon_pageinspec_closecd9660_closectx_freencr5380_pio_insys_shutdowncngetcam7990_resetesp_dma_stoppfsync_alloc_scrub_memorypfi_instance_addisp_mbox_acquireprom_vstartgetcacheinfo_sun4cnnpfs_message_wakeup_datarnd_statesm_gethdrsunkbd5_keydesc_svvmeintszs_shutdownbridge_inputconfig_rootfoundzstty_diagzs_getcputcbufbackoffisp_nxt_handlesysctl_rdstructtrapregion_lockedwsmousereadschedcpusemasys_ogetdirentriestprintf_closesbappendcontrolsunkbd_inputnfs_kqpollwsdisplay_screenstatefb_get_console_metricsnfs_lookitupwihap_sta_timeoutsi_cdesp_switchsoftdep_flushfilespf_frag_tree_RB_INSERT_COLORipv4_inputm_getclrpool_headcompat_43_sys_quotaptsopenax88190_mediastatusncr53c9x_watchfpu_mulwsmuxioctlses_write_confignfs_in_tobecommitted_rangesysctl_ptysr_crypto_read_key_diskncr53c9x_msginpf_tag_refvigra_intripforwardingdb_lexicmp6_redirect_timeoutaudio_calc_blksizesyn_cache_lookuparc4random_statefpu_addprtactiveaudio_mmapksym_upcaseufs_makeinoderasops_copyrowsscsi_xs_ioip6_process_hopoptsufsfifo_readsystrace_lckwsdisplay_set_cons_kbdpfkeyv2_sendmessagefilt_ttyreadsys_getpgidfifo_writecom_common_putcswaplist_trimpmap_remove_holescache_lookupaudio_clearred_allocnnpfs_message_gc_nodesrijndaelKeySetupDecdb_boot_crash_cmdbstp_migrate_delay_expirysystrace_forkuvm_objtree_RB_INSERTle_cdnewdirremdp8390_intrrijndael_encryptstackdumpbwtwo_burnerrasops_do_cursorfbnodepf_state_tree_id_RB_REMOVE_COLORpv_unlink4mtadpole_bellncr53c9x_donepf_altq_pldumpsizewskbd_set_console_displayethermulticastaddr_slowprotocolspppoutputsowwakeupccdstrategystp4020_chip_intr_stringsr_raid_inquirytunattachpppstartextent_freeuvm_aiodone_daemontslot_queue_eventaddupc_tasksched_synctslot_slot_intrext2fs_vopsdb_mount_print_cmdcomclosepcmcia_print_cisnewblk_hashtdb_add_inpsetsigvecmountnfssys_sendmsgbridge_rtdaddrvn_marktextsppp_isemptyam7990_readfrag6_remquestrcmppf_print_hosttrunk_lb_port_destroysys_quotactlep_vortex_mediatrunk_clonersr_raid_startwuisp_asynctcp_mtudisc_increaseulmaxdb_show_all_nfsnodesmgx_ras_copyrowsin6_pcbconnectdehashpmap_page_protect4msystrace_msg_policyfreeluphy_cauvm_pmemrange_addr_RB_INSERTcarp_ether_purgemultihook_disestablishtctrl_brightnessbpf_catchpacketstrayintrffs_isblocksystr_proc_plrfx_getcmapdb_stack_trace_printpf_anchor_node_RB_REMOVEmgx_burnerpf_anchor_node_RB_REMOVE_COLORcgthree_ioctlcgfourattachuvm_swap_allocpagesuvm_aobj_poollacp_sm_rx_update_ntttrunk_rr_port_destroyhotplugclosepflow_get_mbufpfr_insert_kentriessys_adjfreqmouse_copy_extenddb_examine_cmdqsphy_funcslacp_stopicmp6_reflectnfs_nodetree_RB_NFINDsetrunqueuepf_icmp_state_lookupudv_attachsettimertable_initpppdumpbscsi_ioh_runqueuehfsc_remove_queuedp8390_detachlacp_aggregator_delrefqe_tintmii_phy_auto_timeoutsyn_cache_getendrun_countdb_clear_breakpointsnetisrisp_handle_indexxdc_perrorttyrubpfsyncattachrevarpwhoamitrunk_ioctlvop_generic_islockedmgx_cdwsscreen_attachmfs_ioctlbufcachepercentm_pulldownnewdirblk_pooltlv_checkpmap_initufs_rmdircryptodevkey_cblacp_port_destroyminsr_meta_native_writeip6_initconfig_detach_childrencgfourteen_loadcmap_immediategif_softc_listrawcbtcpcb_poolz_errmsgpf_addr_wrap_neqmgx_ioctlsppp_chap_openti_init_rx_ring_minimii_bitbang_readregBlowfish_stream2wordudf_openvscsi_ccb_putswallow_zsintrstimeout_add_mseccarp_prepare_adipip_allowsys_polluvm_map_clip_endufs_makedirentryvlan_vlandev_statepf_normalize_tcp_statefulmodule_sun4ckcurm_defrag_mulreplacenfsrv_getcachecbq_getqstatspf_get_transaddrhme_putrtable_l2setvnode_hold_listpmap_enter4_4ccgfourteen_loadcmap_deferredlastdosdatetadpole_powerdowntrunk_media_statusbuf_rb_bufs_RB_NEXTufs_linksched_choosecpusys_mkfifodb_cmd_searchisp_port_loginimport_tagifa_ifwithafhandle_written_mkdirpcmcia_parse_cis_tupletimerreg_4min6_ifinitin6_leavegrouprtlabel_id2sasddumpiminsppp_cp_sendsys_chflagsstp4020_chip_mem_mapbestopget_hw_ifidnnpfs_getattrpfsyncoutputdelaysdstartpower_regip6_hopopts_inputinitiate_write_inodeblock_ufs1ch_get_paramsddb_regsselfalseacct_shutdownscsi_default_putuvm_km_putpagepf_fragqueuepmap_clear_reference_pvn_isundercarp_ether_addmultiuvm_pageoutpf_qid_unrefncr53c9x_timeoutpffindtypepdevnamesp9000_ras_copycolszshwiflowinodedep_in_progressqsyncwi_setmultiuvn_clusterifaddr_items_RB_MINMAXsomovefifo_opencd9660_vptofhsystrace_replacefreewi_attachmii_phy_downuvmspace_forkraw_initsemundo_adjustknote_enqueueswap_bytesvigraattachmodule_turbosparcudpcksumtcp_sendspacedl10019_mii_writeregisp_startdb_maxoffmmuregionsuvm_pmemrange_addr_RB_REMOVE_COLORffs_oldfscompatnfs_rmdirrijndael_decryptmaxlocksperuidin6_matchlenstat_dir_entrysys_madvisetadpole_get_videopfr_tst_addrstctrl_matchscsibusdetachnnpfs_devclosexdr_string_encodesystrace_setegiddisk_attachwskbd_displayioctlip6_clearpktoptsncpusdb_cmd_loop_donexdattacharptfreevlan_ether_addmultisppp_pap_inputisp_find_handledb_show_arptabbufadjustcom_detachep_isa_probemediamfs_startdead_printmii_media_tablesr_discipline_freeswap_bytes_mtsti_cdxycloseflush_pagedep_depsttyprintfccdinterleavevattr2nnpfs_attrsigcodeespdmaintrdb_elf_search_symbolipip_inputpfkeyv2_parsemessagedb_delete_watchpointcomttyne2000_detectbuf_undirtysysctl_tstringrmc_dropallsr_meta_cleardma_setupnfs_unmountdb_watchpoints_insertedpfsync_out_tdbnfs_fsinfofilt_ttywdetachxdsizeuvm_tree_RB_INSERT_COLORamap_swap_offpool_allocator_nointrnnpfs_vnodeop_psys_sysarchpf_src_tree_RB_NEXTBlowfish_decipherlacp_suppress_distributingbio_validateigmp_initpfsyncstatspmap_zero_page4mcgsix_ras_initmii_phy_add_mediannpfs_pathconfqec_fix_rangenfs_del_committed_rangeputphysbufcache_zapMD5Initnnpfs_devopen_commonpfi_attach_ifnetclockregcryptodesc_poolpf_state_tree_id_RB_PREVbwtwo_mmapffs_vfsopssysctl_mallocwihap_ioctlfpu_ftoifrag6_slowtimouvm_pmr_insert_addrcgtwo_putcmapwant_reschedppp_deflatemsdosfs_mkdirkthread_create_deferredbufq_disksort_destroyrasops8_initnnpfs_dnlc_enter_namenfs_xdrneg1xycmatchzx_do_cursordevid_freeiommu_dmatagmbpp_recvexport_keypfr_kcounters_plmtty_modem_controlscsibusactivatezsparamnd6_timertcp_do_ecnbioopensemexitqsphy_servicein6_ifloop_requestmpls_defttlzx_fillrect__cmpdi2cd_patternszstty_rbuf_hiwatcrypto_workqsr_crypto_create_keyssd_ioctl_inquiryscsi_xsh_adduvm_pmemrange_addr_RB_FINDraw_detachaudiodetachscsi_xsh_runqueuenfsrv3_accesscompat_43_sys_stataudio_writexdc_ioctlcmdlebufattachdomainnamelenmgx_calacp_fill_aggregator_id_peercd1400_write_ccrigmpctl_varstslot_mem_freeadd_m6ifnfs_sendip_rtaddrfiledesc_inittcx_eraserowsmaxmsgsudf_initbstp_send_bpduvrelewi_set_pmwsmux_do_displayioctlcallromscsi_xs_errorprtrealloccheck_consoleapm_record_eventhme_mii_readamap_freebstp_ifupdstatusin6_domifattachwsdisplay_cnputcpfr_ktablehead_RB_REMOVE_COLORses_matchpfi_set_flagscgfour_setcolornd6_prefix_lookupsync_inactivespec_printlocleanpages.uremtimermatchext2fs_lookupmsdosfs_opendvma_cachealignext2fs_linkvop_generic_revokefifo_printfilt_sigdetachtcp_do_sackfilt_seltruedetachvigra_setcolorext2fs_renameesp6_input_cbipsec_def_authttywflushcd9660_rrip_offsetwskbd_default_keyrepeat_dataclosefpfsync_clear_statespf_state_tree_id_RB_NEXTcomioctlscsi_ioh_deqsoftdep_sync_metadatapf_setup_pfsync_matchingpmap_releaseagten_loadcmapif_clone_lookupgetmicrouptimenfs_mount_disklessrandom_initmii_tickip6_dad_countuvm_pager_dropclusternfs_fhtovpfilt_generic_detachip6_getmoptionssensor_task_unregisterpool_print1del_m6ifsppp_auth_sendpcmcia_card_deactivatenfsrv_fhtovpdb_breakpoint_listisp_put_icb_2400wi_pcmcia_matchksymsread.remcd_get_parmsespctl_varsnd6_ifptomacsppp_chap_TOwsmousedoioctlamap_unaddti_ifmedia_upduvm_pmr_insertmplsip_decapshmseqscd9660_printsr_meta_saveif_congestionshmsegsnfilesgem_eintepstatusindirdep_poolipcompstatcd9660_islockedswap_bytes_stmcgtwoattachin6if_do_dadrevarpwhoarewevm_physseg_findbstp_set_all_synccryptodev_keypipe_kqfilterext2fs_openacct_threadsoftdep_setup_directory_addcgtwelve_accessopstun_switchsr_meta_validatest_mode_sensefreeblks_poolstopprofclockdb_hangcom_obio_enablestat_blk_limit_pushbstp_etheraddrnullioctlpfsync_in_buscryptof_closenfs_estimate_rtoipsp_ref_matchmpe_clone_destroyisohashmpls_raw_usrreqmclsizesparsediskncr53c9x_schedbstp_timer_expiredpf_get_src_nodep9100_intrwi_set_debugbcstats_printbstp_transmit_tcnbreadamap_lookupnetaddr_matchipctl_varspf_osfp_addwsdisplay_suspendrt_timer_remove_allsppp_get_paramswskbddevprintksymsclosesbpp_cdsunkbd5_keydesc_essoftdep_setup_allocindir_pagewsdisplay_closescreenexport_identityproc_stop_sweeppfsync_bulk_starttctrl_cascsi_xs_exectcp_usrreqdb_playsuvm_swap_needdecryptsd_interpret_sensegentbi_funcsudp_usrreqrmc_delay_actionifmedia_initext2fs_vfsopsrtable_l2uvm_mapent_freeext2fs_inactivedead_bmapdb_guessespf_send_icmpti_init_rx_ring_stdesp4_input_cbif_getgroupmembersdb_show_all_poolssoo_kqfilterfpu_explodecpu_startupfifo_pathconftvtwo_mmapquotaonpfr_setflags_ktablettcompatsetflagsamap_refcompat_43_sys_lstatpfr_get_tablesam7990_putfilt_fifordetachdb_command_loopxbox_cannpfs_uninstall_filesysfilt_fiforeadfb_free_screenfdexpandsrandomcoredump_countsegs_elf32ticksmsdosfs_closehme_eintpool_do_getncr5380_intrhotplugreadnnpfs_statfsext2fs_setattrxdr_inaddr_decodehfsc_remove_altqsysctl_clockratevn_rdwrnd6_need_cachennpfs_dnlc_purgeip6intrpflogif_listsys_msgctlsync_crashsyncer_masksystrace_msg_askpfi_buffer_maxpf_state_tree_RB_NEXTuvm_pagedeactivatelinear16_to_ulinear8_le_stmcarpdetachufs_unlockep_pcmcia_activatetcp_ctloutputendrun_time_to_nanoccdbufplmono_timeukphy_statuspf_anchor_global_RB_NEXTMD5Updatepf_purge_expired_statesblktochrifmedia_setpcmcia_function_initbio_lookuppf_find_divertpmap_createuvm_map_extractnfs_readdirrpcnfs_msgnd6_prelist_addufs_removeptsignalboottimecd9660_readlinkaudioamd_cacgthree_intrwsdisplay_set_console_kbdVOP_ADVLOCKdb_watchpoint_cmdwskbd_mux_closebridge_updatepf_default_rule_newqe_cdzx_erasecolsfrag6_inputunpst_sendspacevscsi_probeffs_indirtruncnnpfs_ioctlnfsrv_mknodpf_find_state_allptcreadpf_osfp_fingerprintrasops8_makestamptcp_rscalettwakeupuvmspace_freepmap_enk4_4cext2fs_inode_poolipsec_common_input_cbpfr_del_tablesffs_ino_poolti_txeof_tigon2isp_getpdbvmes_camii_phy_statusmsgpfkey_initpf_anchor_global_RB_PREVvscsipollwsdisplay_internal_ioctlswapdrum_getsdpVOP_PRINTfdsharenfsrv_removephyint_sendicmpv6ctl_varsinverse_regioncdstartsnapshotgf_premulclockfreqsppp_pap_tldfilt_generic_readwriteuserconf_disablevlan_ether_purgemultivrefnfs_request_printin_scrubprefixiematchtun_clone_destroylewrcsripforward_rtdb_elf_forallrasops_lmaskpf_addr_copyoutnd6_dad_na_inputmgx_ras_initsd_cmd_rw16ghash_updatedb_set_temp_breakpointdb_buf_print_cmdinpcb_pool_initializedsys_nosysallprocpf_tag2tagnamecdevswzskbd_cngetcnfsm_uiotombuftun_createpf_scrub_ip6sr_rebuildstp4020_chip_intr_establishpf_anchor_node_RB_PREVne2000_attachfree_diraddsys_mlockallvndsizegallant12x22isp_parse_status_24xxpmap_rmk4_4cwskbdcloseuvm_sysctlmalloc_lasterrstatintrgetsndiskmapopenepstopsrmmu_get_asyncflt_bus_dmamem_unmaprthreads_enableddisksortsys_fchflagsnamei_poolrt_timer_countvfs_buf_print__builtin_saveregscryptodev_opfilt_audiowriteworkq_destroyfpu_stofhme_rintukphymatchuvm_pager_putuvm_tree_RB_NFINDmfs_mountlacp_fill_aggregator_iddiskmapclosezs_cdmmumodhypersparc_get_syncfltip6_ecn_egressin6_gif_outputnnpfs_get_pagin_canforwardvlan_inputrasops_unpack_attrsppp_update_gwremove_selectionwsdisplay_shutdownhooksrmmu_cache_flush_allnnpfs_message_wakeupifa_item_removexycattachsrmmu_vcache_flush_segmentwi_pcmcia_attachrasops_copycolspmap_destroypfsync_in_delscsi_mode_selectnfsfifo_writeti_chipinit_sbushme_mediachangebstp_addam7990_configetherbroadcastaddrpfi_dynaddr_setupfdcpseudointrvfs_getnewfsidSHA512Finaludp6_ctlinputitimerroundudf_vptofhisp_get_gff_id_responseuvm_pmr_size_RB_PREVwdog_shutdownuk_cascsi_print_sensemmopenwskbd_update_layoutffs_inode_freepf_normalize_tcpifa_item_insertrtioctlscsi_xs_putipsec_acquire_pool_initializedifaddr_item_plzx_cdbstp_edge_delay_expiryeptxstatprofprocsip6_inputbuf_free_pagessleep_finish_signaltbr_getsr_crypto_alloc_resourcesmgx_ras_eraserowsroute_srcspeedup_synceraudio_blk_msvscsi_dataaes_xts_zerokeyigmp_sendpktsched_cost_residentesp4_inputvether_media_statusexport_pflow_ifpfkey_senduploop_clone_destroypriq_remove_altqcgeight_cdifmedia_baudrate_descriptionsv_putcsystrace_msg_childipcomp_attachgre_clonerm_getptrviking_cache_flushufsvnode_filtopspf_send_tcppfi_skip_ifqecmatchuvm_fault_unwiresppp_cp_change_stateuserconf_common_attr_valsched_noidleipseczeroessys_getitimerhme_tcvr_bb_writebiommu_dmamem_unmapdoniceudf_allocvmerge_inode_listsetherip_inputcpu_configuresr_rwip6_freemoptionssr_raid1_alloc_resourcesvscsi_cmdzscnpollcptcopenaudio_alloc_ringmodule_sun4udf_syncne_pcmcia_matchwsdisplay_common_attachbufhighpagesuvm_swpkeysdeletedzs_attachrn_refinessunkbd_attachmfs_statfshmac_opad_buffersockargswsdisplay_getactivescreenvmes_scanvop_generic_abortopsr_raid6_set_vol_statestattachchattachsetregshandle_written_filepagepfr_prepare_networkepsetmediani6_nametodnsufsdirhash_delslotnfs_rcvunlocksobindvmcmd_map_zerodb_read_charzstty_matchnfs_asyncdaemonnfs_del_tobecommitted_rangevfsinitcnclosetimer_canfsm_adjdb_tok_numberrfx_setcolordivert6_detachnnpfs_abortopsppp_ipv6cp_closereplacemultcp_do_rfc1323ip_fragslacp_sm_rx_timerfilt_fifowdetachmii_phy_setmedialacp_sm_txlo0ifphostidpool_chkaudio_ioctluvm_pagermapoutrt_if_linkstate_changesppp_gen_ip6_addrrw_assert_wrlockpf_pkt_addr_changedsr_raid0_rwcheckreplaywindow32ipqmaxlenif_downallktrsysretext2fs_vptofhnfs_linknam2blksr_raid6_assembledefwidthtadpole_set_videocoredump_writeseghdrs_elf32esp_wrreg1rt6_deleterouteip_maxqueuesysctl_ttyamd7930_halt_inputamd7930_set_paramsin_socktrimsys___semctlmmusegmentsext2fs_dinode_poolsys_mprotectrtallocpf_find_state_byidsunkbd_keydesc_usnfsrv_updatecachept_softc_lockwi_pcmcia_cazs_def_cflagpfkeyv2_ipo_walkbridge_rtflushdequeue_randomnessmplsintrquvm_km_kmemalloc_plasyncer_maxdelaypf_normalize_initwsdisplay_getscreencs4231_allocdeadprocbstp_pdu_bettersamesppp_set_paramsstart_reaperpf_detach_statesys_fcntlisp_prtukioctlpf_change_areq_clear_removevfs_free_addrlistsys_setrlimitsys_sigpendingloop_clone_creatediskmapwritepfsync_state_in_useuvm_map_cleanuvm_pmr_get1pageicmp_redirtimeoutccdiodonepf_tcp_isssppp_chap_scrulinear8_to_linear16_leworkq_add_taskttyclosesintrhandmfs_inactivelacp_reqmtty_paramicmp6_nodeinfocomp_algo_deflatemaxvfsconftimeout_addcpu_cdip6_forwarddb_fncallme_freenumcachenfsrv_linkpfsync_droplkm_nofuncintr_establishcpu_initclockswskbdioctlmii_downp9100_initialize_ramdacrn_mpath_hashbrelseext2fs_unmountpsratioisp_polled_cmdisp_scan_loopsdminphysbe_ifmedia_stssppp_close_eventcpuset_delaudiokqfilterwsdisplay_switch3ttyoutuvm_map_pDebuggersppp_dequeuedevice_lookupinodedep_hashtblnfsrv_statfssystraceopencdminphyslacp_sm_rx_set_expiredschedhzrip6_inputlkmdispatchp9000_ras_copyrowsfd_motor_offuvm_tree_RB_MINMAXtcp_totbackoffvdropuserconf_basebstp_pdu_rcvtypeisp_plogxlooutputwsemul_sun_outputrijndael128_zerokeytrunk_lb_detachsoisdisconnectedmstsinputcpu_coredumpdvd_read_disckeyuvm_aio_aiodonesystrace_attachcrypto_freereqfifo_vopsclrbitsdb_boot_dump_cmduvn_putvndshutdownscsi_add_linkmap_nousermergeufsdirhash_initstp4020_chip_socket_enablepcmcia_card_intrmii_phy_statusnfs_repheadzs_hwflagspfkeyv2_dump_policyfdwritepf_anchor_node_RB_INSERTcommajordl10019_mii_resetle_cacrypto_newsessionbufq_disksort_peekenc_xform_aes_xtsdivert_sysctlp9100_accessopsgre_sysctlsoclosesr_ccb_freescsi_detach_targetnfsrv_pathconfwakeup_nsys_connectbuf_daemoncarp_outputsys_nfssvcintr_sbus2ipl_4mvmeintr_establishufsdirhash_buildskpcluphy_funcsdb_lebufq_fifo_createipv6ctl_varsroute6_inputcgfourteen_burnervlan_startcompat_43_sys_mmapzstty_rbuf_lowatsys_socketpaircnreadbwtwo_catctrl_init_lcdfdcretrydounmountti_encap_tigon1uvm_swap_allocmpeif_listkthread_create_nowwskbd_pickfreetcp_ackdrop_ppslim_countdb_elf_line_at_pchmeattachprom_vendchkdqchgttspeedtabulinear8_to_linear16_le_mtsledma_cdkqueue_readzx_mmappf_alloc_state_keycgfourteen_cdpmap_copy_page4_4cnnpfs_linkcd9660_mountst_mode_selectufsdirhash_addnfsrv_renameuserconf_maxdevuvm_pmemrange_addr_RB_INSERT_COLORnnpfs_eopnotsuppnfs_backofffork_tfmratelxtphymatchsr_hotplug_registervscsi_switchpv_sizeuvn_sync_qah_zeroizewskbd_activatewsdisplay_cons_pollmodepfr_sin6wi_media_statuswsemul_sun_output_controlnd6_purgecarp_multicast_cleanupshm_pooldb_mult_exprtcp_keepidleif_attachheadnextcdb_listbreak_cmdwi_scan_timeoutiszerodevsoftdep_printtrunk_inputpfsync_sync_okmstsopenti_initcgtwo_cacpu_spinupcarp_clone_destroyauth_hash_hmac_ripemd_160_96lf_freemgx_ras_do_cursorsys_fhstatsparc_ist_unmountnullmodemwihap_sta_deauthstdetachsystrace_setscriptnamememreg_cdif_attachdomain1raw_recvspacepfi_ifspf_disable_altqsr_raidp_set_chunk_statediskerrwi_startptyattachcd_cdwsdisplay_screentype_pickudf_bmap_internalpf_qidswsdisplay_addscreen_printdb_machine_commands_installsun4_vcache_flush_regionsys_preadne_pcmcia_activatescsi_movemgx_loadcmapkmem_mapcd9660_check_exportconfig_pending_decragtenmatchqsphyattachcpumatch_sun4soqinsquediskstatspflow_get_dynportauxregbiscisp_fastpost_completedes_ecb_encryptswap_key_prepareudp_inputieattachlacp_run_timersnchrtoblktblvigra_loadcmap_immediateihashrn_search_mresettodrpmap_protect_pufs_readdirsys_flockspifsoftintrlkpflowoutputpvspec_badopvscsi_matchcgtwelve_cdmbppclosemsdosfs_linkisp_put_request_t3enode_has_propertymplsswhfsc_add_altqpfr_ktablehead_RB_MINMAXicmpctl_varsigmpstatsppp_proto_nameudf_bmaprwindow_savedivbhashsizevn_initialize_syncerdpipeselwakeuppf_check_proto_cksumsafte_read_encstatcd9660_quotactlpmap_dumpmmuicmp_sendwrite_user_windowsrasops1_erasecolshme_reset_txufsdirhash_adjfreepfi_get_ifacesgem_bitwaitdb_mbuf_print_cmdopenpromclosebsdi_stringstime_uptimeti_mem_writeuvm_pagealloc_pgkrpc_calluvn_wlistuvm_pmemrange_addr_RB_REMOVEsowakeupses_cool2sensorinsidempls_shim_pushsystrace_freeprocisp_get_plogxtcp_autorcvbuf_incbufq_queuesr_raid0_free_resourcesti_newbuf_minicgfourteen_resetsppp_get_ip6_addrssystrace_make_msgpfr_nulltabledb_putstringtcp_clean_sackreportisp_find_xs_edatatctrl_bellmttyreadmouse_copy_linesigactsunsharetimeout_hardclock_updatepf_state_rm_src_nodespppattachrijndael128_decryptttkqfilterrfx_castpattachwaittimem_tag_deletecd9660_ihashremti_sbus_matchsensor_findepinitfilt_timerip_fragmentsys_statfscarp_send_arpSHA1Finalexport_flowsched_nomigrationssensordev_deinstallrawin6pcbtablesystrace_getprocp9100_burnerkprintfdevice_unrefrc4_keysetupcgfourteen_setcolorscsi_startuvm_pmr_addr_RB_REMOVE_COLORvnode_poolin_cksumdeflateInit2vnode_free_listfdcioptcp_savetiexport_pflowuvm_pagereallocncr53c9x_reselectsensordev_countuvm_fault_unwire_lockednnpfs_revokeklist_invalidateisp_put_icbpmap_extract4muvm_km_createthreadipsp_process_doneaudioprintpool_printitpfi_ifhead_RB_MINMAX_endgetpropdes_check_keyrt_senddesyncsogetoptsoftdep_freequeuegem_mediachangep9100_ras_do_cursorfdprintzs_write_datatun_softc_listdb_deletewatch_cmdpfsync_send_plussoftdep_load_inodeblockenc_allifpssr_crypto_calculate_check_hmac_sha1sr_raid0_set_chunk_statevlan_clonerpollscandomaininitetherip_decapvflushbuftime_secondip6_forward_rtslioctlsppp_lcp_openpfi_dynaddr_removetcx_blitwskbd_get_mapentryinitiate_write_filepagevndcloseuvm_pmr_initnfsrv_slpderefsr_crypto_putcryptopsr_hotspare_rebuild_callbacksbcreatecontrolsys_mlockhotplug_device_detachinitfpstatennpfs_initqbioioctlfpu_xtofdvd_read_structzs_get_chan_addrcompat_43_sys_getpeernamencr5380_abortvdevgonehtonswrite_all_windowssunkbd_keydesc_sfdb_show_callout_bucketbucketkqueue_writesys_syncnfs_readdirplusrpctrunk_port_ioctlaudio_selwakeuppf_addr_incipsp_process_packetpfr_ktablehead_RB_PREVcominitie_mapzs_enablenfs_pathconfpgt_allocatorfpu_newnannfsstatsenodevlacp_portreqsr_raid0_discipline_initcarp_update_lsmaskffs_mountfsin_delayed_cksumsrmmu_pcache_flush_linenfs_rcvlocktslot_intrm_clticksgentbi_statuszsioctlpf_ip2keynnpfs_advlockicmperrppslim_lasttrunk_clone_creatertstatttvtimeoutncr53c9x_intrtimingsafe_bcmpspeclisthbdwritencr5380_reset_scsibusvndattachcpu_idle_cycleversion_to_spcsppp_open_eventVOP_INACTIVEswap_decryptwsmux_do_closetcp_syn_cachesoftdep_deallocate_dependenciessunkbd_keydesctabsppp_ipv6cp_tldfd_do_ejectwihap_sta_is_assocsr_raidp_intrkputcharsys_getsiddb_trace_until_call_cmdRMD160Initcompat_43_sys_sigstackdb_show_all_mountstrunk_port2reqfileheadvndsetcredrc4_cryptm_trailingspaceisp_parse_nvram_1020nextvnodeidcttypollsr_meta_initisp_destroy_handletadpole_get_brightnesssensor_task_ticksys_swapctlrasops1_do_cursornfsm_buildbd_reqwskbd_set_mixervolumest_patternsch_patternsspifstcintrcopypktoptsin_selectsrcmsgscpu_exitip6_initpktoptsworkq_threadfdgetdisklabeluvn_getudf_get_mpartmapwsmux_add_muxhmestartbpfilter_destroyunp_attachch_moveimport_credentialstcp_syn_bucket_limitpty_getfreesys_renamepfr_get_addrssr_raid6_xorqti_free_tx_ringpnozz_cafrag6_nfragsip6_log_timepf_flush_fragmentsxdcattachadd_m6fcrtalloc_mpathcd1400_enable_transmitterst_buf_donescsi_activate_targetufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnms1_cache_flushsys_shmgetlebuffer_castp4020_queue_eventmpls_raw_recvspacesbflushscsi_link_closebstp_deleteipsec_require_pfsswapdevcopy_flow_to_mwsdisplayttyrominterpretsysctl_intrcntvn_readfilt_ptcreadpfsync_out_upd_cah_massage_headersnclrunegheadbwriteleavepgrpqsphy_cdagten_accessopsuvmpageropsuvm_page_initudf_closewsdisplay_common_detachstatminufsdirhash_movesr_copy_internal_datawihap_sta_alloccast5_decrypttadpole_set_brightnessnamecache_rb_cache_RB_INSERTpf_match_tagsi_vme_intr_onwsfont_locktcp_timer_funcsipqent_poolmpls_do_errorif_attachdomainpfr_set_tflagsaltq_pfattachses_bio_blinkicmp_ratelimitsr_crypto_decrypt_keysegm_lockedieintruvm_km_page_initrttimer_poolipe4_attachadd_entropy_wordsax88190_mii_readregti_jalloctdb_soft_firstusepfr_clstats_kentriessosendsema_poolwi_pcmcia_resumehme_tickdosetrlimituvm_pmemrange_addr_RB_PREVrn_inituvm_objtree_RB_NEXTxycintrloopattachnnpfs_readlink_commondp8390_watchdogukcloselkmexistsiommu_dmamap_load_rawnfs_hashlockti_cmd_extzs_matchled_scRMD160Finaldb_listwatch_cmdtslot_intr_stringscsi_cmd_rw_decodechainlengthprocess_read_regsisp_rd_2400_nvramau_get_gainttwakeupwrisp_put_hdresp_dma_gopagedep_poolbstp_set_timer_msgagern_lookupuvm_map_reserveudpencap_ctlinputstate_listallocate_copybuffernum_dirremuserconf_show_attrsys_execvefdallocwsdisplayreadprfindisp_make_herestp4020_chip_io_freemmu_reservemon4_4cscsi_doneexec_aout_prep_oldzmagicespmatchnfsspec_writechkvnlockhw_sysctltrunk_clone_destroyphtree_RB_MINMAXdb_siftinglacp_select_tx_portque_key_lookupdb_look_tokentcp_syn_cache_limitnumvnodescryptof_ioctlcomreaduvm_pagefreecompat_43_sys_acceptpf_frag_tree_RB_INSERTie_cdcgsix_burnerext2fs_inode_allocswcr_encdecpmemarrwsdisplay_switch2bufq_fifo_queuedb_examine_formatin6_pcbbindpool_large_allocicmp_do_exthdrreaperpflowstartisp_fibre_initcoredumpfilt_kqueuetvtwo_resetmalloc_roundupnfsrv_readep_mii_syncled_capipe_readaudiostartpifioctlsys_utimesdb_symformatssun4_vcache_flush_contextlkmenodevpmap_is_referenced4mnd6_storelladdrsunkbd_keydesc_sv_nodeadrip_initsocreatesystracef_statcgeightattachbstp_update_stateureadcbppwriteufs_setattrrijndael128_setkeylogpriworkq_queue_taskdoclusterreadregion_freelisthandle_workitem_removecast5_encryptsys_exitsystracef_close_uremreplace_endsbtrypf_state_scrub_plisp_mbox_notify_donenfs_decode_argspmap_kenter_pa_pm_applymodule_unknownswcr_processcryptof_writefree_newdirblkudv_lockpppasyncstartbufqsamd7930_trapsadb_exts_required_indb_watchpoint_listeeprom_givealtq_disablemgx_write_4cd_playHMAC_MD5_Updatesys_clock_getresiommu_dmamap_createpmap_is_modified_psyn_cache_insertbridge_rtupdaterc4_getbytesttystats_initne_cdstactivate_remreplacefd_motor_onnd6_umaxtriescarp_set_statetag_unreffindzsisp_get_pdb_21xxti_sbus_capcmcia_intr_stringcbq_add_altqgem_watchdognd6_setmtu0nd6_debugpf_hash_rule_addrti_gibinitfpu_itofip6_maxdynroutesuvm_map_piestdumpzskbd_rbuf_size_divwindow_deflatedb_delete_temp_breakpointpf_src_tree_RB_INSERT_COLORsunkbd5_keydesctabcpu_cpuspeeddefrtrlist_updateudf_vgetrfx_cdmagma_attachSHA1Transformmrtdebugesymvndiodonecrypto_invokeosreleaseVOP_RECLAIMpflow_setmtuscsi_probe_targetturbosparc_hotfixsr_raid1_set_vol_stateip6_getpcboptipcomp6_inputgre_inputbuf_releasepflogioctlwsmux_evsrc_set_displayHMAC_MD5_Inithmematchtcpqe_poolpgrp0pf_state_tree_RB_FINDpf_src_tree_RB_NFINDfilt_ptcwritesppp_ipv6cp_TOwihap_timeoutuserconf_changegetpropstringdb_panicmpeioctlwsemul_sun_resetuserconf_helpsr_ioctl_setstateufs_advlockicmp_initmsg_dequeuepcmcia_cis_read_1sr_raidp_openingsmouse_movereluvm_growcsecreatevfinddevmfaketi_del_mcastam7990_tintfd_cdsavefpstatenfs_falsert_msg1pfi_ifhead_RB_REMOVE_COLORcarp_group_demote_countah6_inputbw_upcalls_chimport_udpencapether_delmultipf_test_state_icmpsave_rteptckqfilterdb_history_currsr_crypto_get_kdfrn_mpath_initheadpppinputpf_match_gidgif_clonerexec_sigcode_mapsys_gettimeofdaynbootpathipsec_soft_timeoutipsec_policy_pool_initializedtrunk_fail_attachviking_pcache_flush_linevcleancgtwo_mmaprasops8_putchar16cd_getvolpf_free_fragmentsplassert_ctlcgthree_cdsys_getresuidsys_fhopensr_crypto_ioctldos2unixfnscsibussubmatchrtentry_poolbufq_restartlinear16_to_linear8_be_stmfilt_tunwdetachuvm_km_pgremove_intrsafeext2fs_sbupdatein6_init_address_ltimesdefrtrlist_delsystrace_getcwdsys_fchmodmtty_startnnpfs_unlocklacp_sm_rx_record_pdupmap_clear_modify4_4cuvm_unmap_detachamd7930_get_portwskbd_srcopscarp_our_mcastaddruserconf_common_devvfs_mount_printsema_releasestartnfs_bufqlenipe4_zeroizeaudiogetbufinfowdog_cookieskip_spc_leftstp4020_iointrst_identify_drivevscsi_freeppp_clone_createvn_isdisksys_selectisp_get_mscryptoattachvop_generic_lookupxdreadbstp_received_bpduzombprocin6addr_intfacelocal_allnodeslacp_initlogreadnfs_realign_fixuprn_mpath_capabledead_lockworkq_next_tasktcp_issfc_largedistanceisp_put_ct_hdrzstty_rbuf_sizesrmmu_vcache_flush_pageclock_careset_vifregsnfs_add_tobecommitted_rangesys_setitimerisofntransnd_prefixclear_removevfs_unregisterseminitvndstrategymii_phy_flowstatusdisk_mapsppp_ipcp_RCN_nakselwakeupzstty_rxintffs_reloaddb_set_watchpointspfi_table_updateisp_read_nvramcnwritepfr_clstats_ktablespolloutcompat_43_sys_killpgdb_show_panic_cmduipc_usrreqzstty_txsoftnd6_na_inputrtl80x9_mediastatusdb_next_free_watchpointvflush_vnodeti_free_rx_ring_stdwsmouse_activatein_gif_outputah4_ctlinputrip6_usrreqin6mask96sloutputcoldah_outputdb_clear_watchpointsbutton_eventunp_scanp9100_loadcmap_immediateip6_mrouter_initvlan_clone_destroysbappendaddrbufqs_mtxbpf_maxbufsizesemutotesp4_ctlinputextract_entropywsemul_sun_initufs_islockedcypress_get_syncfltffs_unmountfifo_inactivene2000_detachffs_vopssys_pwriteisohashtblfb_initwsdppp_timeoutsppp_ipcp_RCN_rejwihap_shutdownmmu_install_tablesuvmspace_allocrevarpinputcd_pausesoftdep_setup_directory_changehashinitttstartpf_state_item_ploldpvecnfs_removerpcipsec_keep_invalidsystrace_debuguao_detach_lockedmagma_matchsystrace_prepreplisp_handle_other_responsennpfs_vptofhnexpiretree_idqec_cdsdopentcp_tracesunkbd_rawip_getmoptionsmii_phy_resetdp8390_mediastatusin6mask32__moddi3disk_countpfr_mark_addrsscsi_detach_lundead_opensr_ioctl_inqdb_list_watchpointsuserconf_attrbmtphymatchicmp6_redirect_outputroute_cbreadepcpuset_init_cpupf_print_flagslxtphy_resettcp_slowtimoqematchcd_play_msfdqrelecarp_new_vhosttcp_newtcpcbsbchecklowmemcgsix_intrzsms_stintswapmountffs_mapsearchsys_fhstatfszssoftelf32_load_fileamd7930_commit_settingssunkbd_rawmapnnpfs_has_pagbstp_ioctlmsg_createsys_getpeernamepfkeyv2_sendccdintrhfsc_getqstatschange_sign16_be_mtsudf_rootpfr_validate_tableendrun_nxiddb_eqnamefdc_cascsi_strvistcp_set_iss_tsmbpfwritedoingcachesys_getrusagepf_state_tree_id_RB_INSERTpf_rtlabel_copyoutp9000_accessopsrasops_initipcomp_output_cbauth_hash_hmac_sha2_256_128cryptoioctlbufq_destroylevelhardses_attachnd6_prunenmea_countsl_uncompress_tcp_corem_getffs_truncatelacp_sm_assert_nttmii_attachnfs_replyhfsc_pfattachttylclosepfi_ifhead_RB_FINDxdc_resetpool_allocator_alloctcx_ioctlnnpfs_suserin6_ifremloopchar_typeeeprom_vancr53c9x_debugpagedep_hashvn_closeworkq_createti_stopamd7930_closeexport_addressin6_createmkludgediradd_inode_writtendoclusterwritechange_sign16_be_stmwsdisplay_cfg_ioctlcachestatsffs_writebremfreefilt_sowdetachnd6_initip6_maxfragsexpire_upcalls_chlimfreemachclk_per_tickpfr_set_addrspfr_get_tstatssoftdep_setup_freeblockscarp_master_downbstp_set_timer_tcbuf_shrink_memdb_show_regsetherip_outputpf_osfp_fingerprint_hdraes_ctr_zerokeybstp_notify_rtageuvm_km_free_wakeuprootvnodeifmedia_ioctlzs_read_csricmperrpps_countuserconf_modify__one_cmpldi2nnpfs_fhopenufsdirhash_newblknewblk_poolcd9660_ihashgetsafte_attachnfsrv_writegem_add_rxbufmii_phy_detachwskbd_add_muxzs_disablempe_inputcgsix_cd__muldi3mpls_inputdb_qualify_ambiguous_namesip_mtudisc_timeoutrandomopenin6addr_linklocal_allnodeskevlistbufinitmsts_date_to_nanoskip_char_leftpfi_dynaddr_copyoutscsi_quirk_patternsuserconf_linesnfs_truedeflateInitlimit0ep_mii_setbitrt_if_trackuvm_md_constraintsnfsm_srvpostop_attrtcp_sack_outputif_attach_commonuniqdosnamedb_recovertslot_intr_dispatchpfxrtr_lookuptvtwo_capmap_writetextext2fs_mknodvttoif_tabdb_delete_cmdpfsync_state_importbgetvppgrp_poolsd_cmd_rw12tcx_resetuvm_pmr_addr_RB_INSERT_COLORucred_poolvmel_scanmplsqmaxlenip_insertoptionsswift_get_syncfltnfs_startdes3_setkeyarp_maxtriespf_begin_altqcd9660_bmapax88190_mii_bitbang_writephtree_RB_INSERTacct_processcom_obio_attachufs_dirbadentrypf_get_divertlogioctl_bus_dmamap_load_uiopfr_create_ktablestrlenpf_match_addr_rangedb_machine_initsensor_task_workcs4231_query_encodingendrun_offset_to_nanopfr_ktablesfifo_kqfiltergem_iffconfig_suspendwsfont_initwsdisplayparampool_page_freeespattachwsmouse_inputah4_inputcopystrbridge_broadcastsched_nmigrationsisp_gid_ft_snsfpu_ftosiftxlistwdog_ctl_cb_argsys_pipearp_rtrequesthw_vendorext2fs_reload_vnodesppp_lcp_RCRelf32_check_brandwi_cor_resetnfs_getset_niothreadsudp_initvmes_cdbt_getcmapproc_trampolinesys_rmdirudf_ioctludf_vat_readdp8390_disablecompat_43_sys_gethostnamecd9660_vfsopsin6ifa_ifplocaladdrcpuset_copyinflateInitspec_accesssocantsendmoreproc_zapmainbus_modelpf_set_rt_ifpcdactivatenfs_merge_commit_rangesuvm_vsunlockether_inputzsnull_txintlockstatusquotaoffkernel_pagtable_storep9000_mmapcoredump_note_elf32fs_posix_sysctlaudio_init_ringbufferulinear8_to_linear16_beif_slowtimoep_pcmcia_caudbtablewi_setdefppp_softc_listchange_sign16_le_mtsufs_printfb_unblankfatentryzskbd_cdzskbd_catslot_mem_alloctctrl_attachfdctimeoutnmeainputpppoe_clone_creatennpfs_lookup_commontrunk_initwi_update_statsncr53c9x_abort.umulmf6ctablecarp_startdrop_earlyntp_tick_accsys_statdqgethotplugopenin_baddynamiclineswmsdosfs_symlinksys_symlinkicmp6_sysctlcgfourteenattachclfreeconfig_found_smnfsrv_readdirpluspfi_kif_getrpc_autherrfdreleasedb_line_at_pcisp_get_elsuvm_swapout_threadsknote_attachmax_keylensppp_lcp_tlsiommu_dmamap_load_bufferdp8390_ioctlnnpfs_lockgre_wccp__assertif_congestion_cleardb_put_valueih_insertwsdisplay_emul_matchnd6_dad_ns_outputin6_prefixlen2maskesp_input_cbcompat_43_sys_recvmsgLfsbailpcmcia_megahertz_xjem1144_func0_cfe0tadpole_set_pcmciauvm_pmemrange_use_insertudp6_outputcn_devvpcom_activatewi_get_debugxbox_cdmaxfilesuvm_pagecmpuvm_pageactivateufs_dirhashmaxmemin6_addr2scopeidsystrace_scriptnamegf_mapdma_alloc_bus_dmamap_load_rawffs_mountrootnfs_add_committed_rangetprintfuvm_map_pageable_allesp_initsleep_finishsystrace_injectesp_rdreg1ipqdl10019_media_initmfs_doiomsdosfs_strategycd9660_vopstimeout_deldma_resetnnpfs_devtoname_rm_cltickif_delgroupspec_strategyxdc_startuvm_pglistfreeworklist_printnfs_attrtimeonfs_bufqnum_msgspv_changepte4max88190_media_initnextsiblingext2fs_readsl_compress_setupsoo_statstp4020_calc_speedwskbd_cnpollcpf_altqs_activeesp_glue1pppreadrusage_pooldisk_detachpf_purge_threadsw_0_leftoverstrchrsunkbd_keydesc_ptbufq_disksort_createsi_obio_dma_startscsi_sizescsi_plug_poolsocket_senduvm_pmemrange_use_cmpaes_xts_encryptuvm_pmr_size_RB_INSERT_COLORdb_deleteisp_initbeioctlcrypto_driversauth_hash_gmac_aes_256compat_43_sys_ftruncateiftovt_tabsysctl_int_lowertcp_backoffworkq_task_poolcarp_iamatch6sppp_pap_my_TOsys_chrootavail_startexport_saicmp6_redirtimeoutnnpfs_mount_common_sysbridge_initenc_xform_dessoisconnectingpf_test_state_otherarc4random_bufwsdisplay_pollcpfi_kif_unrefsr_wu_free_divreplaceaobj_pagerpf_tagname2tagstopenchopenuvn_iouvm_tree_RB_REMOVE_COLORpromcninitMD5Transformmld6_inputacct_startcs4231_commit_settingsuvm_objunwirebpf_d_listsr_wu_allocsoftdep_worklist_busysyn_cache_cleanupip_pcboptslacp_fill_markerinfofc_purgeisp_get_hdr__data_startfb_pfour_idfilt_timerattachifmedia_delete_instanceenc_xform_aes_gcmbe_readsoftdep_update_inodeblocksys_acctzs_write_regccddumpep_media_statusuvm_mapent_allocdb_single_stepicmp6statqcopyinflateEndpfr_commit_ktableexec_aout_prep_oldnmagicsppp_update_gw_walkerccdwritewsevent_pollmap_backmergesys_profilvmcmd_map_pagedvnnfsm_disctin6_pcbhashlookupmstsattachsystrace_exitwsdisplay_cdbpf_detachdVOP_UNLOCKuvm_rb_fixupsyn_cache_initlacp_compare_systemidcd9660_wchar2charip_ecn_egressbridge_send_icmp_errether_ipmulticast_maxsr_raid6_createmouse_copy_extend_worduvm_init_limitsukphy_cdp9100_promentropy_input_rotatein_pcbconnectVOP_POLLVOP_IOCTLvlan_clone_createwant_aststatvarsafeprinumccdaudio_init_playcgeight_mmapsys_rforkluphy_cdlenocarrierdma_isintrswift_cache_enableip6_copyexthdruao_swap_offmachinewi_cmd_ioVOP_CLOSEisp_mark_portdbuvm_anallocin_pcbdisconnectpf_kif_setupisp_scsi_initiommu_camgxattachuvm_vnp_terminatennpfs_rmdirbridge_fragmentxdc_cmdz_allocwtab_destroysys_getpidnd6_defifindexunp_dropptscloseipmultipathuvm_map_advicetcp_mtudisctimeout_startupudf_vfsopspppattachsi_capf_normalize_ip6rn_addroutepf_find_or_create_rulesetsdactivatenfsrv_errmapread_dsfielddb_print_sadb_elf_sym_numargswsscrollbackchkiqchgmpls_push_expnull_ip6isp_put_elsdvd_read_manufactconfig_activate_childrenip6_check_rh0hdrzsnull_softintremrunqueuexyc_xyresetsoo_closesystrace_redirectnfs_kqfiltercarp_ifgattr_ioctltcp_recvspaceah_sysctluvm_metertctrl_read_ext_statustcp_ackdrop_ppslimnfs_requestlinear8_to_linear16_le_mtsoldmon_w_cmdnd6_lookupprocess_domemviking_hotfixviftablebridge_bifconfzx_promsys_getppidsr_raid_request_sensescsi_ioh_pendingspif_cdmii_anarVOP_READDIRdomainsrc4_skipses_refresh_sensorsgentbiattachspif_caireplacesys_threxitsys___sysctlaudio_calcwatersd_cmd_rw6ledmatcheeprom_attachnnpfs_quotactlextent_alloc_subregionin4_cksumpf_src_tree_pldb_putcharisp_intrneedbufferaltq_add_queuewsemul_pickin6_ifattachsoftdep_worklist_reqppppktinqewatchdogtcp_rst_ppslim_lastwsdisplaystartisp_get_ct_hdrsi_vme_dma_setupwsmouse_srcopsptmioctluvm_rb_removeahstatptcwrite_filtopstickfixip6_multipathtrunk_lacp_detachcd9660_initccdstartipsec_soft_bytesnselcollemul_elf32msdosfs_lookupspec_pathconfxdc_startbufmountroothook_listpfi_detach_ifnethook_establishqe_ifmedia_updzstty_txinttcptv_keep_initaddrmasksys_chdirktrsetchildrendb_unread_tokenext2fs_diremptymotion_eventsppp_chap_tlduserconf_cntmouse_zaxismfchashisp_wdogsppp_lcp_closeep_default_to_mediaext2fs_inode_freeisp_put_request_t3pcmcia_ccr_writedb_find_variablescsi_io_get_donebuf_objectip6_rr_pruneudpencap_portptmclosebematchsbcompressclk_wenabledirrem_poolsr_crypto_rw2nfsm_reqheadSHA512Lastcdevsw_lookuplogsoftcsys_adjtimewrite_dsfieldnd6_outputrijndael_set_key_enc_onlypfsyncioctlsr_ccb_allocwsmuxreadamap_splitrefspec_open_clonepf_rule_item_plwskbd_do_openktropspf_qname2qidudf_get_vpartmapcryptof_kqfilternclruheadvndwritescsi_move_donerasops_alloc_cattruvm_aio_biodonern_initheadisp_put_rft_iduvm_pmr_printnfsfifo_reclaimvop_generic_unlockesp_glueuvmspace_sharert_timer_addentropy_poolroute_usrreqdeextendspec_vopssr_raid6_openingsu0sbus_matchsched_init_cpurasops_erasecolsnfs_readlinktcp_dropsppp_detachicmpstatnv3tov_typeudpctl_varstunstartfdreaduvmpd_scanip_mrouter_getsys_getrtablem_prependsoftraid_canfsrv_readlinkcd9660_pathconfax88190_stop_cardin_pcbrehashpool_walksyncer_delaynomgx_read_2in_arpinputxdc_capmodsbppcloseudf_vat_getufs_accessin6_embedscopephpoolif_alloc_sadlrfx_initializegetcacheinfo_sun4unix2winfnmsleepgem_rxdrainncr53c9x_get_ecbmpe_newlabelgifattachfpu_divmgx_ras_erasecolswsfont_unlockoclockmatchreassignbufip_freemoptionssr_meta_rwms1_get_syncfltcgfourteen_accessopsenc_ioctlsohasoutofbandddb_initisp_get_ct_ptswift_mmu_enablend6_dad_duplicatedsoftdep_change_linkcntmsdosfs_fhtovpnfs_inactivemaxvnodespim6_inputipsp_spd_lookupether_crc32_behandle_written_inodeblockpgfinddvma_freebeinitnfskevq_locktcp_ackdrop_ppslim_lastpf_scrub_iploadfirmwarerasops_cmapswcr_compdecpf_test_fragmentrasops1_putcharip4_inputtcp_inputsysctl_dumpentrydkcksumpmap_mapwsdisplay_cnattachpfkeyv2_policynd6_gctimerncr53c9x_initiptimerip_inputaudiowrite_filtopswi_set_txpower_mulreplace_endip6_mdqnd6_setmtupf_normalize_tcp_cleanupnfsrv_cleancachedb_last_non_spaceudp_ctlinputmii_detachpool_sethardlimitn6expirennpfs_access_commonip_freefvnd_softcaltq_pfdetachkernel_regmap_storezshardvfs_lookupdb_show_cmdsudbhashsizeicmp6_mtudisc_updatesun_nonamekmeminitnsphyterattachnd6_ns_inputdeflateEnddevice_refffs_syncuvm_map_submapsr_hotplug_callbacksnfsm_srvfattrvndopencnioctlpfsync_q_insses_temp2sensornnpfs_accessufs_vinitsr_ccb_getvmel_cdtcx_s24_resetnnpfs_inactivepool_primedevid_allocpgrphashtblsystraceattachktrwritepfi_clear_flagsinodedep_lookupcarp_hashifmedia_matchstatclocktcx_do_cursordvd_read_physicalnnpfs_getnewvnoderw_enter_writemaxcleanpagesuvm_mlk_hintsppp_lcp_scruserconf_argbuflacp_aggregator_addrefMD5Update_intvetherioctlm_tag_copyqe_mcresetst_readpflowstatssbus_cddb_value_of_nametrunk_port_getprobegettun_clonerrt_xaddrsmsdosfs_getattrdb_find_breakpointcounterreg_4mip6_maxifdefrouterscarpstatsntp_tick_permanentwritedisklabelsr_raid0_intrm_devgetses_read_statusgettdbbysrcmsdosfs_printkernel_pmap_storepfsync_bulk_failsttyattachxyc_submit_iorqin6_ifattach_loopbackstartprofclockpf_modulate_sackcs4231_freeleattachnsphymatchsys_getresgidprocinitrmc_update_class_utilgem_startmsdosfs_readdirdead_ebadfpfsync_clonersun4_vcache_flush_segmentobio_cambpp_matchnfs_symlinkcd9660_fifovopspf_frag_plopenpromioctluvm_map_unreference_amapsoo_ioctlred_getqamd7930swintrswap_offnumdquoticmp_redirect_timeoutforkstatpf_state_tree_RB_NFINDwi_card_identzx_ioctldl10019_mii_statchgnull_setkeyigmp_sysctlisp_dump_portdbin6mask64db_lbuf_startqec_getsoftclockaudio_initbufsvigra_accessopsdivert6_sysctlmfs_openupdate_modifierreaddir_with_callbackffs1_compat_writedb_breakpoints_insertedblf_decryptswdevtdisk_lockpfsync_in_clrah_attacharc4random_uniformieioctlsppp_chap_closesbwaitudf_transnamehotplug_device_attachufs_reclaimdivert_recvspacepf_tag_unrefscsi_xsh_setsdwriteauxio_regvalshm_deallocate_segmentmemnamezsms_accessopswsmouse_cafpu_ftoxp9000_setcolorfilt_logreadsysctl_rdquadcarp_optsuvm_vnp_setsizevmcmdset_extendsr_sensors_refreshsys_lkmnosyscarp_rewrite_lladdrip6_use_deprecatedpflog_clonerimport_keynfs_setattrrpcuserconf_hist_intextent_alloc_regionsys_mknodraiseext2fs_mountfskill_vmcmdsppp_clone_destroyesp_dma_isactiveufs_mknodsbinsertoobin_lifaddr_ioctlknotesunkbd5_keydesc_jplf_advlockpffinddomainwsmux_do_openfreeah_enablepf_src_tree_remove_statewi_ioctlnfsrv_rcvprotection_codesnnpfs_readdirffs_hashallocpfr_insert_ktableswstrategylacp_sm_rx_update_selected_from_peerinfouserconf_pnumget_sa_requirescsibusprintnamecache_rb_cache_RB_NEXTrtl80x9_init_cardstp4020_attach_socketsched_cost_prioritysys_getpgrpccddevsdqhashtblnfsm_fhtomaudio_defaulttvtwo_burnersonewconnsb_auxio_regufs_direnterpffindprotocom_obio_cabold8x16_iso1zsops_kbdbridge_clone_destroyuvm_pageallocuvm_swap_initcrypt_alltcp_saveti6HMAC_SHA256_Updatetun_wakeupnchrdevfrag6_freefuvm_pmr_use_incvetherattachvlan_ether_resetmultisppp_phase_namepfsync_in_eofnfsrv_lookupaf2rtafidxnamecache_rb_cache_RB_INSERT_COLORmplsdomainshm_find_segment_by_keyqsphy_ca#!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet $old_ip_address delete $medium route $rdomain delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } ip6_delete_old_address() { if [ -n "$old_ip6_address" ]; then ifconfig $interface inet6 $old_ip6_address delete $medium fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route $rdomain add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } ip6_add_new_address() { ifconfig $interface \ inet6 $new_ip6_address \ prefixlen $new_ip6_prefixlen \ $medium } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface \ inet $alias_ip_address delete > /dev/null 2>&1 route $rdomain delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address alias netmask \ $alias_subnet_mask route $rdomain add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route $rdomain -n flush -inet -iface $interface >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route $rdomain delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route $rdomain -n flush -inet -iface $interface >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route $rdomain add default -iface $router >/dev/null 2>&1 else route $rdomain add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route $rdomain add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } ip6_add_new_resolv_conf() { rm -f /etc/resolv.conf.std6 if [ -n "$new_dhcp6_domain_search" ]; then echo "search $new_dhcp6_domain_search" >>/etc/resolv.conf.std6 fi if [ -n "$new_dhcp6_name_servers" ]; then for nameserver in $new_dhcp6_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std6 done fi if [ -f /etc/resolv.conf.std6 ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std6 fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std6 > /etc/resolv.conf rm -f /etc/resolv.conf.std6 chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } case $reason in MEDIUM) ifconfig $interface $medium sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface up ;; PREINIT6) ifconfig $interface up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || [ "$reason" = REBOOT ] || [ -z "$old_ip_address" ] || [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; BOUND6|RENEW6|REBIND6) if [ -n "$old_ip6_address" ]; then if [ "$old_ip6_address" != "$new_ip6_address" ]; then ip6_delete_old_address fi fi if [ "$reason" = BOUND6 ] || [ -z "$old_ip6_address" ] || [ "$old_ip6_address" != "$new_ip6_address" ]; then ip6_add_new_address fi ip6_add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; EXPIRE6|RELEASE6|STOP6) if [ -n "$old_ip6_address" ]; then ip6_delete_old_address fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet $new_ip_address delete $medium delete_old_routes exit 1 ;; esac exit 0  x(9``@!` #``"Ф" $@```d@#XbВ@2`"` H*/+"b 0 " @`?"cX? Đ`IJ@` @ ?㿘#X& c (1?@+!1?㿘 #@!#X㿘@ " ݒ㿘 @Ӓx  ?`a"`8"쀣  "@a `$ "c\  "`"d  [aa |`#!#ah@} @* 㿘7സ?\ 73c`?c`. ư &@ d1? dƮ` ?d1? dƶ`??$#d <7@Ħ @ `?`??7@"#d   Ԃ6  ?*("@ P#h#\ @@@ p ؖ   ؘ@@Ԑ `   * &@ 㿘#l` @e "a #@ #l $#l㿘cl ? "cl@ca㿐%@?4!('@@!@q 2'a0@"1#b(!$@ҖbP 2!$@'bP@"0!$'@bP  # 2 !㿘` 2"#p"`"`"`"` "`"`" @E`  "c?   ? 㿘  ; < 㿘  @@ @   @"&  ?  㿘@  `  @cc`Ȕ<%` %`#" `( $ b€ c c `h%` %`%@ b@E"X0Ub@ %`&`   ``"`" ` " `" `" " "  +b@"p0/  `a `'#a` " ` "``$ " " "  " " " """ ""`! %% 㿘#b`   ``*  `b   '@`2`0`,6 * '@ 㿘  & `& $& (   € " '@ 㿘 ` @ " `( ( @0@ 㿘   2 i @ $ ?`$ *㿘"` `0`4 㿘"` `?`8 ? 㿘  ,`@L"?@ `?㿘 ,`€㿐 ` "    "O! #?  `$ *`P `/`$*O O /O㿘㿐" `      O ? X/O O /O㿐"/  0T@㿘  㿘"`t€㿘@@y@㿐b    "X" p@     Ċ@@*`#X `# .@ .` .` .` .` .`b` `€0  @@b|@㿘"` !`@@c@c ' c(@  @c0   !D`!DN@J@2J`N` " 2 㿘 " !#8@O@Ē @V #8 㿘# 2 &#@G 2&#@#@㿘"`€㿘"` € 0#X@˘ 㿘"`€㿘!#Ֆ ??" #.㿘"@€㿘"  8 |@ϐ |€0@㿘@# `  ?` $$   $ X "  "   #02  ?  : $$ $   / #@QSb9cȢ @B## u@N .`M*  @'  @" 0㿀`  @nb  )   c"%""L' ) L`  -2*@"@ (*`J@ @ *` c""%')L  *@L` ) *@b `""``+`J@ -& @ *:  c` d a "J@ s "J@  "$"#b @ #"J@  @`  A$ܒ`PL ``@K  h@2ߐ@2   $@z x $ $``@,   `@$   $`$ @\ *@% $ଁ㿘' ?M  @`"`$ $ $ $ $ $ $ $ $$ ($ ,$ 0$ 4$ $ $ $ ` @. + @" ``+  `@7 $ 0` "`$ 4` " @$  @ 2&  $ @ ذ 㿘#a  @ 4 "$a & 4$a㿘 *`@  @! !        !@ɒ` ` @  8 <?*   آ&@  `  @㿘?(,1\&" H L` T ` X P d l$ p  t @ .@㿘   , @*  6? ? /+  *  2$? & ?`&   8"@ "b "@ "@ @?ږ?㿘@(  +#  "P,  #/)>(!&@  @ ? ?@ _  @  ?2@2@R#`" "@ b  P 8$b b "l?b ?44 @ #4*`Y?# !8@֒!! 2 "@   !  &@@@ߐ㿀!@!`Pa €" "@!x@""#@b2 * `"bL@ 5!5%3-+1)/79@y $ @pab@ )Mb 2%@g!#8@ M#8 2@] ݔ਀ "b1   "P.  @   ("c)  "c?#2   @i  :d뀤   ? ?@  `@J 4? 4@!#`"""@Pc@>@" #`""!@;#@Ր O'$#b8@   OĀ   O @ 4 "c   ?@`"@@"  #㿈,,'D'T@>@ dD P ?' ? 2Dސ"HD@єӐ"X,@E   19 2 z `2 2A`= "p"x"@W   @dD  ?2 2  @E"# "D@@ @3"# b"@ E   a2  2a"  􀢀8'@* ` "@ @"  " @ @ ,h" @* ~ @ @'4 @Š   @dD  ?2020@ϐ"#`""@% @0,* @UD@"@#`_`"0@ E '7   `@ " `( ] ? R I G """@t   @dD % ?22 @bb D@@@O# "b@  @@@06@ E $  ?@ 0(  @  2@ #@`   4& &6*6,@ 4 T """""  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*H J2 "/*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@J@   J@J`  @@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  㿐`@<0@ `:` @9 *  x` * d`, `0 200@"x ߐ*  @4?ഐ"? 6"?  =%0@㿘 `  .` 8@ ^&  @   @`&@``@@6``,`G D& h`?  ,` @@!  @0$@     d ,  0 2 0 2 %@` ,`Ő,`& 㿐   <P @u 40*:  8  20 @8 0<D @L@ @  Ȁ)n 2; @Q0$  " @  d  *  0 @$ $  $@&@&    b 8   @   " & 㿐`  <@`@-5 2& :@ "   2    " *@B<@@` ڐ2 ``@Ӑ 㻀@Ր Ц @) &`@@$`   `  @2 %\F!T@  0@@eg0    t,   $@  'Y L@  @5<`/2L@`L@ /"`L@"y   נ  / ``4k `L@  /`,@P谒 \,@$ W(  2LL@ $H  E;@~%( 8@v"@< 0 K䰒 *@x`  d*  0` @UO / ' 'Ւ L@  @   0@5 @/@, Ё㿘 &     . @ "  @0  .  "  @0 @ @  а 㿐 @ @&B<@@`@@ ``@0 2&     ":?"   ? @ : ` :?  "`"`"`:`8㿐`  8 `@@2.@``@.@+?) @ " " ""@@C <@  @ @ @ B <@   @(*`  p j!(1a"'А $  $ $ ''X@Ғ 2V?b,??"b,4` $@!#`"#@ #\ @  !@a#;?##c@#*`4c' @2 `@H#@"?'ܠ a0"@~܀ ?"H`H@t܀  ?b0@܀ ? ? J M!a0?@G 2B?A@> 29?b,?"b,6 "&#`a#@b#\ @     H"c''@( ?@I ?#'@ ? ?㿘`&"@  &@  㿘 &   ? @&@ .@&  @""#d d " e" f" g"#" ?  +d +e +f +gd"@# @ ` J@(8(8    `J/`? `2A ` `!J@(8(8  . ` J J#   J@;..2J`;2 , `J@; @Є 8 <` 㿐@ ( ( @ `  -``( ( #h@     2` * @h *`  * +` **` +   h  (@ g@ o@ `-`  ` րϰ    *` *   *  M `/  M /" M MJL *  2D     !*  *` * @*@  @  @ L  *  "M  !   L  *  2 M  : L  *    g2 @ 2``  `-`( U(  gh 8  *   *` *   @ @@ ˀg@+ @    >>>&`>  * *`   * & +` * +   :>@ 0  @  @ 㿘  @ &  㷐^  [ @4 U  @P2 *@    @ ,`  ( 6h" 1  '"@@''   b 4  @   " 'w@ X@B< 22&     ":?"   ? @ : ` :?  $"`"`"` :`8   㿘  ,  ". /.".+."&  "!".._ 0Z X ?U 0R @͠LL *L0F 0C 0pؒ  @ ( 8 'p@ t    $ #`a#\b` @  ?  H "c؀`@   "#?㽠P  x@   'P $` $` $`  $$` ($` ,$`$` 8 @ wt$`     h #`ab`$#\ @ ? # x 0  &,& &&& D& &(&$@ E㺈 ` ($ a b????#\#`  @ ? # `  dh@ d .@  ?0  '  $  $  (  ,     $$L#`a $b (#\  @L ,? L `" H"#?@T@ߔ0 #p@  H"c?㿘@(  "c","",6 & 2?c"c0 "!"0" ?㷈##` @ ѐ# N  m `/2N N /" N a  0 ] @R x  <$N O  N  /  .ؔ A.0 0㘢" 2; $+  (@M;@IO`/ 㘀@9 x@5 x  @. x N  &`  @ x@ x㿘  "& @  x&  㿘' #!%@    ? c2  " @ !  ; B& > @ 2&     D  "; ?  ?  @ ;   `; ?  0 ( 4 "`8"` <"`@"`D :`8 㿐\@?<6   '?'?@ ? '?` '?`@""?'?Đ #`#` #`#`#\ #`xvc|$ #@? ` @``2"@# H"c?㿘!$#@P  @ 2?`2 ?`` $##@r ??"@?2( 2  2 2 *?  #  ("# " " " 㾐a"@2 o'Ô?'' "p #\#` ""   C   p'–0 !#@k?@  H$#9 9,9t9t9\99t9P9t9t9t9t9t9t9t9t9t9t9t9t9t9h9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t9t989t9t9t9t9t9t9t9t9D9t9t9t9t9t9t9t9t9t9t9t9t999999㿘``1w"*` €10 (1- @1* X1' p1$ 1! 1 1 1 1 1!1!81 !P1 !h1!@ @!X\@**@X"X㿘#!"a`$a\x P'P'T'X@Z$!Xa\!X *`2*X&] @-!J?  .@ 7Ɛ(   , 4 , 4 ` 44 `~4 `x4 `x4 `b4 `4 #\"Đ .@U @!? 2a( a(2  a( @ 0 ? @ ??"b( $`㿘 H@k 5㿐@!"#  5@2?@ 2?`(2?`&2?` 2 ? `@  ??x&$`$` $`$`$`$`<* @ *@@ &  ,`,` 4` $`  $`@4`  6 4 4 `'`'` '`'&$`,` '@4` 4 쀣?&$`$`$`  $` "Ѐ    `'"0'ܐ@Nܖ@ژ( @?!@:x@ް yހ( (  s?@Ēn?2l?2` 2g? 2c?2``<`]@l 2Y? &U?``  2M?` &@ʐ  4 & ` 2>?` "6`` %@!0? ,  $ $ ' '`'''4 @.  ?$$ $ $ $ $$ $ $ $ ` ??㿘\   ) <+`%#(?@ @b@,`4 2 #   $$@Ӧ` l J` Є * (Ж  (8. 53 ".?" 8" ?#  0 `(?`d((  `d(h(*  ?#㿘@㿘!y,@  .   0,@% "  0,@  0,@,@6 ` "@(* 8("@ Є (@ 㿐 "< N ,N`$* `.! ؒN*`? @ . ɒ?N*`# @ .   J `   `&     ,` ` `   ( `߀` ܗ(2 ?# : :* 㿘 3` 3` 3`  .+`+`+`+`3` +` ??㿘汒  @,   bH@%  "` ?` ?70ဘ :  0 *@ `  *@`*@`*!" @ ` ?  2  㿘a'H'L'P'T 'X @"a@H@"@9㿘"H㿘"P , @` @ , 㿘R@q㿘@ 㿘 D " ? 2  H1 L&#@h  $ # `$ D?$ @ L$ ?$  @`$㿘אԐ* А* ̐?. ?$`@㿘"ؠ  , @     & &"   & T`?& & S`?   2?  ?B& @     `* ??w?2? o  e  "  D Z   D  ?& @㿘@k?7`5@ X!. `%"   >`P>@>`>`>`>` >`(>`0>`8>`@>`HP?@! @ `@ &`L&@Z&`H0 @ ѐ`@ X@̐?㿘  "c?"P. @!.   @  L@@ X@㿘!.   @?? ?2%  ?% @%   T "<   8 @a    "@"% %% %  "  @* 4 #`% D " %   &   B @ B = = % DW  D  L!$#@ % # % D L%@ '% @  P@ " % P  P ?% @ @   @  = =   @  % P @ 2   D 2   2x T  P@ "  % P&㾘  "P- @@8!-  `T @?2*$`(&$`" ` o lk @ F`2.``)  @ ?V @`L  <`P<@<`<`<`<` <`(<`0<`8<`@<`HP?@Ԗ @$@$`L$`H`4 `5`@1`@ f )`' a !ɒ: @  bd 4 `0 b"c?? ? * `:```? b "b"    ?"  @ @   @ *0   @ *`㿘. "P @  @   $"c2  " @      @ $"#` "#?㿘. "P@ @   "    b :@B: b"c? ?   ` 㿐"P @  `  `  D"c$@$`$` ' 8@`` / "`J `)$@&$` ! @  ! € ` `!  `" ` @"#$@?㿐. "P @@   ,"c" @% * 2`       "c B< '  "c&?999:::::::9::::`::9::<:::t㿘c'H'L'P'T'X#@ H㿘c#@ N@`N@`%` N@``!*` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @N N@ @E N@ @< N@ 0 x   ?"X0(  @ 0,  ?L?hN@@ `N@ % X lT㿈"X릒 @,?  ?L?㿘"耢` ! bpJ@ Q#!O  (#L@ "쀢@  'h@@B`@ ` L  $L"xƒ  .א 7Ɛ(  , 4 , 4  ~4   44  4  4  4 hc4 j4 h#$@#\ . ? hl'l" ` `4` L4`  $L4`㿘H/(㿐E-"#(2*?@ 2&?`(2"?`&2?`  @??#L*@ *`@ `S  ??㿘@ /`(+`&'` # `7   `6`6`` ` 6``6``6`6` 6` 6`   .6`  `6` (6`: ::::::::: : `: : : : : |: :::<::4::t:::::: ?$2"0    888 0 "L"""" " "(","0"8"<"l"P "? $  `4? <   ?(  8 * " <" 8 㿘 N 12:?@ 5?2 (1? $ {"$ ($ 0 , 2 ({"$ , (  0 0 `?$ $"` >` "` 8 ,"`$"`4?€ 0$ $㿘 ⸒b  " X" L" T" P㿘 $ 4 2 ( $ *@ (  0 $ 4>  ( 2   $ * $ ($ 0$ ,  (&@@    4)"@  ($ 0%$ , 0" @8 4  "@@   4"@ ($ 0$ , 0 ( $ 0$ 0 , (@@$ , 㿈 ɺ $ Ŧ  "? 2  2? 2  $   8< `!l*` € ` $"&  @?*``` * 4 a  y  u4 $  m * $  @! $& 8  $ ¢ "k&  @?*``` ?c4 4 *` , $& 8   $   & & & &$<$8  @ $& 8 $`";&   `$@4 $"0&  @?*``` $4      4 $  $ $#`&  $4[ `$@` 4 "&  @?*```?c4  $@   $@ Ā88 ܒ @%"@$@@%'@"&  @?*```  a$`4  $d4  $\4a򀢠 $$hh\@#8 p"&  @?*``` h *@*`3 $h4\ hp0lT#8(*`0  $h $T$L$l @   c#`#`&  $ $$h`dh :pT * ?L * @@7`񀢀7  "N&  @?*``T*?L * @@7`񀢀7  @   ".&  @?*`@ ` $@4h*`3`i$h !  @   "&  @?*`@ ` $@4h` *   45 @   "&  @?*`@ ` $@4  4h @   "&  @?*`@ ` $@4  4h`d Q?? ph?*`2`?$h`dh *QT "0 $L$T$ll` pT@ ` l*``p$P$Xd  @X y $T * ?L * @@7`񀢀7  "t&  @?*``T*?L * @@7`񀢀7 - + 7*@* 7 2` "H&  @?*`` 2 L* @@7`7$@4$@4$@   z$ @ u$2  $H$H @   "&  @?*`@ ` * @? @$@4 $@  $X * ?P * @@7`񀢀7  "&  @?*``X*?P * @@7`񀢀7 ` , 7*@* 7 2` "&  @?*`` 2 P* @@7`7$@4$@`@4 $D `$H$H @   "&  @?*`@ ` * D? @$D4 $@ ,D"@i $u&D"0 4($ ""@@ @&@8"$@% @?.@``@ 2 $H  C.@$` 6`8  ":&  @?*``` &@B > $@Β&@$& 8?c4 4 *` , #`&  b$   $ ?M?& & && $8$<(   8   ђ  $3?  '  B& @B > >   $ @z"@$& 8 <@ " & 4`"?㿘 ? $` ,2`40 `" ,€ 0 ,  0€ $$ $㿘 ";? $ "7?  ` .?`   @. @+  ?[   $? ( @ 4"@  ( $ , 4 "$ , $   " ? $ " ? "?" "`0  @  @0#   ( @#@㿐 P?`$ 2`0J 2 < D?   h <  8 " * % <%% 8  ;*  8  <2`?% 8 % <  % h@```@ @B  " %`%@=` h?` `3  =`=`  % "? $ 2 ?   <`?㿘 `"h?`$ "d?`("`?`, 2`0Z? 0  2 4Q?   $ * `( `0 2 @`0`,€?0=@' >`> `> `0> ` > `(> (`0> 0`8> 8 L%0@ ,@zА" ?%0@$`L PzВ"@ e0@ $`P l:А" ?%0@$`l $ * 4$`4& $ 㿘?4`c @@c@@ ? @ ? ` " ?@@`?c@? @c* @! F?"P  ![@@`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ ϲ`㶒#㲒#񀦀ðL(7@@`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ β`" !?@@`!?g#c#. @@'X'D'H'P'T /```0 TH) @ ( 6T  ?, "?8 2P @ // 70 0P&@00P T:     + "  *   /`.  b``(/`  D X 2?7   ``0@`  DH) @ (@(0@X6 0  HD X 'ֲ!}'?T' P( D'      ?e ° ? 'X) '@ /67/. @/7 `/7, , /`7 @(3`0,626  ( 5@FX*`H(@ X" '@ @ + ,(& *.``@ . & 4`D, @eE P- (P(P#8z0 @//+` '7  P  /7 (3.0626 ߀P  T&@T% T     "@(   ( 00? #  P0P㿘#P`1!㿘`_ #P`G8!@6  * `@@  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * 6  ` !@6  * `@ 8`  `2`` 㿘  $ 㾘;;n # '  x*`"``*ߒܐ`ɐ.6 > ʐ`.6 > ޒ 2@ : :*:   㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ߩߥdvma_mapindvma_mapoutobmem %lx L!%lx %x %lx %lx map-pages%lx pgmap@ %lx L!boot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s promprom0Can't open device `%s' Can't open network device `%s' xmit: not a network device %x mac-address drop swap 6 cmoveielefdxyxdstsddevice_typeblocknetworkbytenameno PROM root devicenode %x property %s length %d > %d makememarrmakememarr: hope version %d PROM is like version 2 memorymakememarr: cannot find "memory" nodeavailableregmakememarr: cannot get propertymakememarr: no memory foundcompatiblesun4cpagesize %x l! sun4msun4dUnknown CPU type (compatible=`%s')Invalid controller number prom_iopen: "%s" error=%d prom_mapin: length=%dprom_mapin: invalid maptype %d2.6Loading at physical address %lx >> OpenBSD BOOT %s can't figure out where we have been loadedbsddevice[%s]: boot: Booting %s Cannot load %s: error=%d read header failed: %s read header shortELF=0x%lx lseek phdrread program headers%s%lu+lseek textread text+%lulseek section headersread section headers%s%ld [lseek symbolsread symbols]bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d CD001nfsread: short packet, %d < %ld nfs_open: must mount first. nfs_read: hit EOF unexpectantlycallrpc: error = %d recvrpc: reject, astat=%d, errno=%d getport: %sbad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentUnknown error: code %drarp: bad socket. %d No response for RARP request sendudp: bad write (%d != %d)readudp: huge packet, udp len %ld sendrecv: short write! (%d < %d) exit1.2.30123456789abcdef|/-\arpwhohas: overflowed arp_list! arp: no response for %s`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     error inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@ 9,990999d9ɘ9΄9Π9<9D9м9֨99 999d:.P990998:.H9d909x98:/:/:.:.:.:.:.   :10@` 0123456789abcdef/:N9:@X:CX99:CX99%983:C`;:C\F:CdN9|]9p:Ch9 v:Cl9:Cp90:E9:C:AD:C:C:C:C9d:E9h:A:A,:B8:D99I9T99Z9b9L9g9g99u9989999(99T9999 9999&9t-9P49D;9hB9I9P9u9`99\9p9L99999D9 9 989t9h9&9-949;9B9(I9P9@u9949999$99P9999 9999&9p-9L49@;9dB9I9P9u9t99p99`99999X949( 9L99|9&9 -949;9B9<I90P9T9V9a9k9|y9 9Ô9999Ȁ999999T999499ߠ:E99:EX:E\:E`9@ 999|:Eh%9<99`,:B03:E999 ?:E9p9J:BS9\9d9q:E9t:B9X999p99x:E::::::$:p:D:":(:CP:CT:(:E:+:+D:,p:,:-99$9/9<9A98L :LW:c9<p9 y99Π9 :M :J` :M9x9`:B,9ߠ:B9$ :L99t:A@99\,9ڼ8 :J?9@Q:A] :Ji9мu9ɘ9 :K9999: d :K:B99h999:@ :M 9X:@9@9D'9h- :M$49`>9M :LU:]9Hb9Tj:A<p99 :M(9Ō:@ :M0 :J:B 9t:BP9d :J909 99<:CL9$9.:@6:DG:@N :K\:0m:@9 :J9:9֨99<99 999:D:B9%9@/9H79T@9J:BW9t`9pi9s9|9p :J :M:,p:)|9d:d99@ :N099P:@:A 9\ 9Ô 9 9 :I (9 1:B : :NP @9 F :K U9| ]: j9 q9 w9h : :I 90 : 9L : 9, 9 9 9 :N8 94 9 9΄ 9< 9 9 $9 /9 A9 L:+t Z :NH h90 r9 x9 } :I :L 9 9Ǵ 9h 9 98 9 9 :J :J 9 9 9 9 &9h .9` 39H 89 B9 H:@ X:BH ]9$ p: z9d :, 9@ :4 9 9 9 9 9h :@ : :A 9 9x : 9 % :I .9 4 :J B:)P P :K8 U:" c:B l9 ~9@ gcc2_compiled.base_vapmap_map4pmap_extract4rcookiesun4_mmu3lscookiepmap_map_srmmupmap_extract_srmmuobmemopen_countnetif_promsaveechopv_putcharsun4_idprom.81dtabrootnode.94stringbuf.107filestore.120bootstore.121prom0_fakepromdev_inuseprom_mapinprom_mapinfoprom_mapinfo_cntprom_devmappromvecstore.134getphysmemloadkrelseekLstdLmul_shortwayLgot_resultLnot_really_bigLnot_too_bigLdo_single_divLend_regular_divideLend_single_divloopLsingle_divloopLdivloopL.1.16L.2.17L.3.19L.4.23L.4.21L.3.17L.4.19L.4.17L.2.15L.3.15L.4.15L.4.13L.3.13L.4.11L.4.9read_inodeblock_mapbuf_read_filesearch_directorypnmatchdirmatchnfs_getrootfhnfs_lookupfhnfs_readlinknfs_readdatarpc_getportrecvrpcebuf.24sputcharsbufsbuf_endsbuf_lenrarpsendrarprecvbuf.39numberdigitsetherbuf.30paniced.24gz_magicget_bytegetLongcheck_headersstoppos.36arpsendarprecvfixedtablesupdatewindowsyncsearchLetextcrc_table_emptyfirst.24make_crc_tablecrc_tablegf2_matrix_timesgf2_matrix_squareputcharprom_getpropdvma_allocprom0_iclose_remprom_ioctldomainnameinflateCopycd9660_writenet_openalloccd9660_readprintfnameipprom_sihostnamelenelf32_execrpc_fromaddrrpc_portstrerrorcompatprom_findrootrpc_pmap_listsnprintfrpc_pmap_getcachehznodevether_sprintfnfs_readdirbstartrarp_getipaddressnetdev_socknetif_debugcd9660_statcd9660_openprom_getidpromerrno.mulocloseintoagetsinflatebp_server_addrversionnetif_open_udivbp_whoaminfs_closeolseekpgshiftswapipmemcpynbpgdevopencd9660_seek.udivrootipsendethercd9660_readdirrpc_xidtwiddle.divgetsecsndevsprom_makememarrip_convertaddrmyipbp_getfilekprintnhostnameprom_bootdevicenfs_stat_typesdvma_mapoutrootpathobp_strategydebugprom_getetheroreadlseek_rttarp_numbzeroufs_closepgofsetinflateSyncPointcputypnfs_root_nodeinflateGetHeaderfile_system_cd9660fdloadfilepromvecxdr_string_decodeinflateInit_nfs_opennet_mountrootprom0_recvprom_interpretnfs_readnfs_writeprom0_strategyrpc_calladler32netmaskzcfreeinet_addrvprintfsendrecvdvma_initdonottwiddlegetticks