ELFa(4 _4 ( DD@cD<  B00 R㸗Р -LR ׾_cc_main() returnedUc   ),@@(LQ 0/_4Vc -0L MR0 40 @, *0"Sp! "00# 0T!oR 0PS 0 $0S`F!0S 0 $*0Xb0 R2p'0S  0T!oR 0PSv 0 $0S`F!0S^ 0 $0SL "00# 0T!oR< 0PS1 0 $0S`F!0S 0 $ 0 R2h)p'0X0S]J082p'0S  0T!oR 0PS 0 $0S`F!0S 0 $0S "00# 0T!oR 0PS 0 $0S`F!0S 0 $082p'XZ0Sh  0T!oRZ 0PSO 0 $0S`F!0S7 0 $0(S"R$ 0 $0S "00# 0T!oR 0PS 0 $0S`F!0S 0 $XZ0  0b, 0Რ qR  0T!oR 0PS 0 $0S`F!0S 0 $0S "00# 0T!oRp 0PSe 0 $0S`F!0SM 0 $0S<  0T!oR. 0PS# 0 $0S`F!0S 0 $40Y:0 ,0 , M 0\0 ,0 ,L2 0'\~0 ,k0 ,TLa 0\:0 ,!0 , L2 0'\0 ,0 ,0 ,L 0\0 ,|0 ,eLr2 0'\J0 ,70 , kL- 0\0 ,0 ,RL2 0'\0 ,0 ,8L 0\n0 ,R0 ,;LH2 0'\ 00 -LMP 0* Qp  / 0p@ 0TGT`P0 T@ 0TPp0 T p-LMP@.. 4\8` #8$ 0 p Xp -LM0@!#P  0 (  -LMP@^ p0`  h  p-LM@P U!! `  U 0 Rp 00p -LMP@\ p0  hp D -LM@`<6V #Xp V * 0 RP: 0Q@-@%Qʔ000SS !0Q  k\`!0Q <\00000 d  -LM`,0KPp0 0PA, $@00K=;0 0P&40K 0(0PT4 (pA Ƞ,Ƞ4 08 X4 ( T  , Z Y4(0 80 4X0 $40, T, $@(, 0T, 40T, $P ,0T `Z -L Mp`, 0 P1<@T  0R PU0 R X 0Z0R0S 400000 R Z$0X 0S ?P0S,0S 0S0@ , -P -PLM,8  Z09c`<0 p10@ 0@@  0 @4@0@0xP 1U] |C$0( 0$0R$ ( $0(0(0(P(00 T0 $@  0 tT0 $pJ0 W p 0 T0 $ 0T0 $08 R <0R~pian0n 0-LM@0 0 0PP$G0 $Q0=;0 0P .0 00(P" R 0)(09 PX QT00P 00< $(,0  R<0Z480夸Lntnn .-n -LM -LM`@]pW0 P  @0h04p @d0T\XT 4K0 , (P 7pPP  aiaiah/`/p/G -SLMp`@P P0  F0@(K 0( 0,`嫋0 0iapia_c_c_c_c0 - L 0$ 0 $ -LM  0@ 0 0T p-LMH$,$HP0`@ 0p p-QLM0@`  `pQP* 0 P(U:p p-QLM0@`  `pQP* 0PXU:p p-QLM0@`  `pQP* 0P\U:p p-QLM0@`  `kpQP* 0 P,U:p -QLM@v0 q\oho -QLM@e boo -(L  -(L  0-" _  P0L @ 00h p-LM@ @P` 0@00PY YR` cUpp p-LMP@`V0 pdx@p0H@ 0S' 000K  c 0H@ 0?' p-LM@` PO@?XP 0s UP(0Sp(00PS 0U 0 0 "@0P 0UPp -LM0S.||#0p#0lC0 0 0C\ 0  "!00 00 3C&  0 "!0"0 R0S 00 7 ?0p`%`K% [)0S ) %0K  ?0@P&PK& [)0S ) &0K 0VS UR Z  p Z7-0pWp12gZ'1,@0pW 00P7 0000S 00  000 \?000 0`P`PDH$ ,0K$H ,K+K*@K12g1, VU000;M_c_ct_c_c0 0- @LP0 00徙P0P0C& R 00#!t000 `0C& X 0 "!04 0 R0;_c_c_c_c0 -|2LM PRh2 J X Ꮠ0SH200h0S 22  > B^h 4$` ,p@dP,` 000S2022/`VOھ21  p,@`0,K  `VOZ`@0S2`VZc00,0K,pK !0(@ *pK+KV r>0< OP202B202" P2$00$0d0 \`<0001P w(a_ppLtj,9oHja p-LM4@PU @$ `00  $ 0!2c1,0  0!2c16`,pXP $ - PLp0@ 0`0.僘p0p0C& R@ 00#!t000 `0C& X 0 "!04 0 R:_c_c_c_c0 0- @P0L00P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00hK:_c_c_c_c0 p-LM$ P0S 0 $p4 `  0DPT0T $0 0$0 0$0 0P$00$0p -LM8@6@ 00S<"Z -0LS0@0p- 0PP00P=WP`U L娮    (垮 囮嘮tjo\oo 0-L@LP= =0( <0( 0h<' -0LM@p <00 ` <00 PZpd3 <# R<00Wڀ0?3S -1LMp@+p`0((0) %0K%[R%0K P )U d0 S pW<0++'0K 'K$0 0((0) &0K&[R &0KP ) -`0VLpP@ 0DPT dT0`0 5<0V D0PT -!圁LMp0P00$`V" 4 $0Q TX0LH1H<勭4刭$0 3000$  $  0@p00C\ 0  "!0 00 0C&  0 "!0 0 Ri8@0D PT$0 0$08_c_cooop_c_c0p -#LM08 ,0 p0 P 4 )3RR 0 A= 0 0   h3 ,0S \,唏0S 00g 0S@0 ŕ0őSS000@0000&2R& $ ` @0S6`V@DZX 0@00  00 `~0S6V`VZ6 `0S61`VZ0S0 00S000 @0 00   p pR00B"0P0 00    ,  R00 0B$`000 0 @0S   60S0 ` 00`(1 MP0 0  0 S   50S0`00`0 LP0 VE00@p x0 LPk40Sh@@j0H 00OK GL,̰P000/0a$pp -08`P@L p0 T P0 0@e0 -08`P@L p0 T P0  0@e0 p-LM`P@2PUOp 0 @|Pܫ00 `0 0Tҫ2 <˫20ǫ1$ë2快4pDp\Xplp|p p-LM@8P@`4  00 00S p  0S > S 00p000 d␫`p 0 00  (000C0 ppp -LM0P10#0@8|PZ 0ha0 0000 H1 ,0<11p  $00$0 R 0$ 0 00  0@ Qp00C& R 00#!000 l0C& d 0 "!0@ 0 Rh3\_c_cHja_c_c0 -LM4@0S @440S -L M$X @R0  l0@ $@$ hLqXq - L  - Lw^P@a0 0Q0p0P0`0C& R@P 00#!x000 d0C& \ 0 "!08 0 R3Dja_c_c_c_c0 p-0LM 0@00 `R0P00 00C& R 00#!|000 h0C& ` 0 "!0< 0 Rph^2_c_c_c_c0 0-0 L@ 0T00 0P @TP 00C\ 0  "!x0 00 d0C& \ 0 "!08 0 R0|2_cDja_c_c_c0 -L M`P@P 0T A/0P T 1T $ 020 T$2 N 1W $5  0T A8 0T QP!0` T b 0T Ac 0T 1 $  p /0 T$ 1W $ 00W T  0T A 0T  0T 1 $G5] -LM@(0SID8 0S p0S`/ 000!PU ”(0S0 . 80S& 0 `0 @0(00C0 h`0 0”(0S 0 00(0 0 <(6u p-LM`JOPPU@Zp -LM$1PS`V 0  ;0!@@ p0 1$# p0  00@ 11`Qw  Ru 0A?00 $0 0<<00 <2•(0ST000( RB$2@7 X!0L T$2 1 $  /0 T 0 T 1 $ $2 1 $ 0 T1 0 `0 @0( 0 0,0(• 婡754v -LM 1p $P` `V00P00S 1b R$ 1@c $\0@1D 0@V'@ 0@#h\v -L4MDpK@l 0 T0qS u1S MS< 6S 1 $  1 $   /0 T 1? $ 1@ R$@ 0 [80 !S 1d $ 0 [80 QSK ASyaS`2S$ 1 $@TT T ŢxK 1 $`1PU ˜(0S,0S Ue T0 `2"   0 `0 @0(.p 1 $ 020 T0 [800 | 1= $ 1`> $ 1PQ $ 1@d $`P@ 0 V 1< $ 1` $ 1P> $ 1= @$@BR 1@e $`P 0 $ 1 $ 1p $ 1` $ 1P $ 1@ $p`P 0 @(  1 $ 1@ $@    1 $ ١ 1` $ ϡa& ? "`|: 0T Si |S S 1 $ $2 d 1 $U 1 $0 <<0 TH  $0d/@T 1 $ 00 TTQ k 1 $@T ˜(0S 0,00[ "4 0 `0 @0( 1 $" 1 $ Q@@? 0T 0 TS40 [80! 1 $@T ˜(0S $p0C!A 1SAB0 ?0  0 `0 @0( 1 $ 1@? $@AP`U ˜(0Su@ 1V @T0 H1 l0 {H 0< $@$<%< 40 ,孠40S @TO: 0 0   ,0,$2 ,2u 1 $ APP0 T  0T A0 TW 1 $ 000 T 1 $ 000 T,!00,, K40@T: 0 `0 @0(hS S  1 $ 1@Q $1@ 0 $:S 1= $ 1`> $ 1PQ $ 1@d $`P@ 0  1< $ 1P $ 1`> $ 1= @$@B 1pe $ 1@d $P` 0 @h趟 1 $ 1` $ 1p $ 1P $ 1@ $`pP @0 p舟 1 $ 1@ $@ , uTvvwXwwwxTxxxxx(y(Xyyyyyy$z0zTzzz{@KLC8E,{l{0P/ 1? $ 1@ R$@ 0 [808s Q 0T 1 $P1`V ˜ P(0S @ 0  ,0,P0 X 0S SX"SD08 1ȡ1  ,H ,P1$0 b!1317!10A0  0H0 R0 ? R2000 $(0Sk #>#[ 000 @  00 0000˜(0S%0 04 0 @0Q T0|0 2h 3 3,!~sh ~1 $, b!1317! b00" 0(˜(0S (0  $0 (˜(0S 1 $0 (H0 W _4  cP @0()D T^ -LM$2`A p 1 $P$2U & 1 $@1@T –(0ST 1< $$2  j @/ 1 $  0   0T 1 $ 0 20T 1 $ A00 T 0T 1? $ 1= $ 1@> $$"p00 #RAp ApBp@|K  0p@$ZF X@ 0 0@ @JE 0@ @?0@pPp1Z PUZ |Kf 1b $ 1@c $@D1 ]  0TP 0 P  2(0 Q000 0 D0`8\\(\ 2 0k 0 P  0 P   |K0p@7|K  0 P  |0p1! ,0 00 0 P |K 0@ 0 PA  |K 0 @ 0T6 1 $ A00 T  0T A0 T 1@ $ p 0T 1 $@1PU –(0SU `PK .0@,@k5 j 0dr! 0 `0 @0( 1? $ 1 p $ 1 P $ @@ 0@ T 1 $`U@ULt 1\  R! 0XP@ 0 @w :0 1 $T 4 $2  PU `2S3   D@K5  0T 1 $   /0 T 0: T 1c $ 1@b $ @0D  0ʛ$2  0  h2嵛x岛p寛h嬛0 fC0 1= $$2p00C2 嗛t  ᒛ Y 1 $ 00#0 T   1 $1@!@ n  0TT@@   0 `0 @0(BRN 1 $ 00#0 T 1 $AZPAB 1 $p 1 $$2B$2{({{c,bqqqqr^Lrrrrrrss4sds -LM 0!00< -D2LSP `p 1b $ 1@c $D•@ Q@" *0S*0S* Q : Q` }WxVp% $2  /0 T  $0.)  0T A 0T 1 $ @0 T 1 $$2    00 T  0T 0 A0` T`V 0  T A0 T8 0` TQl]{ | -LM @0 T 1 $ p0 T 1 $  0T 1 $ - BR0 01AA01LS S+ nPPp T /Ģ,|0A_L P@` 㶝 㲝`V@PZ0q/㧝 RS28| -LM`$P@p!W 0   0S00\3Q 0Q%05  0i 1 $000 1 $0 0@-$@ 0000 00#0P00S 0S( $”  P\ 0S 0R 0SR 0S $2 0S 0000P00000 xl0$ pR  \ 0S  Q 0S0p0QxR $2 0S  0R !Q 0S0 0S0  R  $200Q0R  0S0 0@- PU#>@'  0R # 000#>T0 0R 0P 0QU # 00PRQ $200000 -LM  R  `Y,0 4 , 0 p0 1ȡ  \,  00,   0  5 ,SR Q. $24 M Y@ 0 @@@@0P/@,  0̠0 @0@)X `\ 0 Ld 0\4 r R 0 T$2 0 T 0Y00@ 0 0 000 p0@@00S 1 $@0 0 00 T,bh|l||2 -L M  ȡ1p\P`  0 `R00S 0V00P0` 0̠@@)0 6Tؗ 0y 0 T| p-L M@PK` %(0 ̠P(p -L M QpU`3 @K M@014 3[1   p   @0 #.[ @@   B( R PUW 1 $q 1 $<2p W 0 TZ 1 $  /0 T 0 T 1 $PpU' B@0( R'U  1P$ A0 00 T 0 T A0 T1 Wđ  l ( 0 T 1 $ $2y 1 $r  n(Y2M5 -L M1 @p $$2, 1 1  $ 1= `$ 1P> $$p00#"A AB0$2  1< $ 1 $2$ HR10QP:p-B\ 00  0020 -LM@ 0 @V| 0-LM0 $ p0 CBPP0,BA ? 1SAࠣB࠳ 0P0 -LM$2@   0 T 1$ p-0LM|220@P`3 | / 00|0 =D 1 $ 00 T 1 $ 00 T 0000`"2p 1: $P( 0  0 22  002|2/ /0|2 t=0 1 宕' A0|” @? 0?|"0  0?#   0? |"`偕0 P| 1: $0 0匓},bq(}@}}} -LM0 1` \ 0$0 \, 0$ K(0 0(0 (0Kt 0, SQ< (0 @S@  0^S  $2pW@T  0T,0  ,0KpT ($ ,0M$ ,0  & $0RA-@|p`@SPE όOop| MPrP 0 Ѝp@-P|b@00όOP`0M0|bR ЍpG-M@P`p|Sό@PE `pO_o 0800< 噯 0|2Ѝ -LM0 `2|22@ $ @0 0: T 1W $ 00W T T -L M@K@ 1 $PU ”(0S 1< $ 1p $ 1? $`PhV`  0@,0F 0 ;"00UPPU A 0A  1 $ 00 T : 0TV 0 ;0<0 o ? `b| 1 $0 ;0 ;Γ`edƓ_Pΐ` 0 `0 @0(j}~<~l~~~~ -L M8pKP 1 $@`20CSlش|"RHe T T   @0T5 `" Q 0T40S.Q% 0BQ A 0T• A /0… T Q 0T  @0T2|"  @0T A 0T  0TG`T`V 0T23 R |2S 2S0`2v 1 B$@'NP2@02 |2bST|  0T 1 $  $0 0#20# `$ 00 T 1 B$@'NP@p 2P02 V; 1 $ 000 }|2pSr 0 T 1 $ 000 T0`2r5|2S8^ 1 $ 2S "|2R 1 $ A000  1 $ 00 T  `"0T A02 $ 1@ $ 000 ^DdE-|bPU@p*?0^ 0CSW^ UP:2SPH0H 0SWZ 2SP2SPef -L\M 0!Qp00'.`@L@ #PsDTT<LTTTTTTTTTTTTTTTTTTTTTTTTTT@Y00T00S0|2P50S`0 US ? @"|4 RP/ 4P @0 P, K00K, @4 P@  40KPS40` ,0 ` 06P@ 40P R`0L0 @L0S , 40|]B`` R3 RP3x#P00#h#h0 P00S 0H H0 0DP D0 H0\D @ < \ X0 0< K@ KD0KR@< H0K@` 0P( <\  RH0X R 0L <0 D0 @0 H0 @0@HD @0 @*D0U0@S  0  0ސ<DP@ H0B|BP<Bp1T ZPX!0@8 K8@  ` 0P1 8T 0P8 0PLT \00 @6@B|B1B 0勐T0 L 80 T8 †|†T "T @ L rqswvu -LM1 P $0Z,0  •(0S0 1 A S |$ 0 P@ 0@00 @B|B0,0 B, 0P`  0` 0` 0S B|B,`  0P@| 0 `q Vb LŸHB"V 0 @4@ &@ 1 $ 000 T0:  T,201(!JR (!00000<00 04 $"p0C!A  1SA B 0@?0 @U k 0叏 #@ 0 像W 0 `` 0H 0 `0 @0(T\lĀ4 -LM 1` $pW –(0S 1< $   0; S  1 $ 1 $ 1 $ @ $ 00 @D$ 00 H$ 1P $ @ $ 00 @D$ 00 H$ 1 $  $ 1 $  $0,0l0 Q$ 4R*A 0`$0 0 T A(40 T Q(80 T (< T A0 T *40 T A*80 T *< T 1 $ 0 0#0 T/ 0 `0 @0( -LM 1` $PU –(0S 1 $ @ $ 00 LH$ 00 D$00 00 0b,P00 P$ @ $ 0@0 HD$E0 ,4 phP '< T A'80 T Q'40 T 0 T A( 0T Q(4p 0T P0 T$2   0 T A0 T 0 T 1 $ @@0 T Q00 T 0 T 0 `0 @0(8 -LM` P 0PP p@ 0@Z0 @pp@U0  p}0 S00Z00S  0Fꄁ 0- 2   ?L@  ?Ql0U E 0CPE.   1$?5 p-LM 2P< S a@T +PHBL2L2L"HBPL202pHB0L2 P$2  `@T  0S HBT 0R0S,27,2,"'00,2," 0,2(0 P PHP 0-@PPLR0D p-LM2`S *:@PP@CPUZP 0PphCCC2$"28"8–" 0 0-PL 0T A 0T  0T @  0@TYT0 -`"L A0  T 1 $ $2 20Sv 1 $X" 0@0 TpO@T [ 1$ !0 T 1 $ 2  Q= 6Q $2 0 TX 1 $ Q@00 T 0  T Q@0 TQ$20$2$20崋 1 $ @00 T 1 $ @P0 Th 1 $\5؁ -L`p AP 0T 0 T 1 $P 0 T 1 $pW -!1P,` p@pVL  B 0B 0T A0F0 T  0T 0 @TT6 0 T,2# `0 T  0T A 0T  0T`0 V,  0T` 0@TTM -LMqH >A P_ ! ᘎApA1 RO ˇ"bAAN@P@ P`VP6ˇ  "bB>CNC 0@]@ P`<P 00 0 -XP@g0T SS R00!@w 0r 7MN0L@x p-L MQ`U5 0S|||T,HDT 0H4 0`AHDTC,$ 4@ĕLPA$4$ĕFPpphuAN -L$M0SĚ1c  qz@P "bP@P 0@ P`PBH4 01,  H b,R ^0 P@`0,P$00(2,˜0 0 0,  P\L00 ,1P  1  1p!8p000 oAL -LM` 0p1 !$"P0 0%> 0@e 0 P@ĉ,2P e0 m鶉| 0ep 孉H ,–0X  `AD 埉{,bRȂMS -LM p< 0T AW 0T$",2#5P ' 0 T 1Z $-.08 00 T$2b  0T A 0TP2@T,2 `@@K?TPUP 82 PU—\(0S+P <2 PU$2 1 d0D T A&40E T Q&80F T &<G Tb A0H T &40I T Q&80J T A&O_@ PpPhO2$"02 28?*08"2X X22`V X2:8282"< <24" R P(4A P $2 |4B P < 0T AW 0T44 R,2,255Ã,2$2 1Z $@,˜ ,˜ @0,2 0 娆,2$˜<,2340 00 , , `p3V $2P3 1Q!  L Q,2 $2 003 , 4`?V"00?" 1 $$˜86#(pD 0S8 1p $$˜00Z00Sp   Z000S$2   0S0 $2000 0$" 0000 p0#2p p0@S00 S   R0000000 p0 13 $ 1@2 $@$˜D@@4@ B 11 $ 1@0 $@D@$˜0@ . 1[ $@ ,2 0,2,必 SR4M@x2 0-L1 P@ $` 00T 0 00 0 0T05 0-,2L6@_,2! 0 T 1 $ $2V 1 $ 00 T 1 $5 PU! P-  1 $  } /0 T 1 $PU  1 $h*,26,20$2 $ 1 $ 1 $5ă 0-@L} Q U0 1$   0 0T -LM@2n p-LM`,!40 P 1$ ?0@ T 1%$  $ @P0 PTp 1 $P -`,p!L  0  1$ P?0 T A'$  0T P0 T -LM,2`p!  0   1$ @?0 T Q'$  0T @0 Tp@-Q@P`/ $0p0C#A  1SA B \00 R P?  t00^P u00UP  V00Vpp -LM$"0p0C#0?A  1SA B  0@@  -LMp@P 0<  B 01PU b@0( R $2 @PL   00L TĞ  l (7 -QLMpP9 @  @0 B( R,` <•0B( R    @0 B( R  n( ,(  n( 0T7 0-$2L@ @ 1$ P 0T,0e0 1M $P7 -LMP$ 40 6, 0 @ 1 $  0T0S p8 ,2$10$1 6 09 TZ/ <"01`V •(0S^@VU 40, 00PC 0S? *0,0S ,0 0 I 0pW$2@ % 0 T0SYU 4 RQ <" 01@T •(0ST !0p!00`@ w0 1$# 9 0000`11@p<0 0 0T3<  B01@T b(0S0  1 $ 1@ $pW2  0T 1 $3` Rs1@T^ •(0S`TX 00400, 00PC \? ,:\$ W  0 T400 , 0S,2$10CS$1  p 0,0S 0,00  d  1 $ |x 0 `0 @0(Dہm8 0 `0@0(O 0 Ɓ 0 `0 @0( 0L 封8 8@ <2 |夁x 0 `0 @0( 1M $j7L$<$z|Ȅ -LM 0\, 00 p,","$10$1 4 40z0 00 BS0Yi(QU `@ P UY \,2$10CS$1 40 0  00P , R 0R4 0S4 :S <R0000,1 0  0,0S0,0x -LM APA , 00 $ Rp4 cW6 0 T 1 $1 QW*W[ 1@T b(0S90000@,  0P$ R  Gp0SW^ 4  0 T 1 $p 1 $p 0 `0@0( 1 $4 $刀~ ~L $zT -`L0 !P0 T 1 $ 0@TUp0 T A 0T A 0T -LM @0 T,2B  1$ 00 T 1 $ 00B T -LM1 p`@ $ @P0 T 1 $ 0@TVP0@  0 T A 0T 0 T T 1 $ 00 T -L,Mp, 00 , $10$1 1 $@ @P,  004@  PW zD 8P <  ,08 BS8 8  < 00s0 @  0S= 8< \-@` V$8 2@T R@0( RT ,0 0P` V8 <0 R8 @ , 00 @@5 18 \"0S< QU" 00 @ P0  ,0P D0 0D0 0,0S ,0   U4  0 T,2$10CS$1 D 8 0 T 1 $180@Q080  b@0( R0X0T00ST ,0 0P  18 RĞ  l ( ^đ  l (D,2@ @"M 0- 1@L $ 00 T 1 $ P00 T 1 $  P0 T( 1 $ 0 00 T0 -0LTM0d0 ˆd0DKp P# 0 T 1 $ $2? 1 $$2PA@ A@B@ 1T $d0`T 0% T 1 $ 0 TWf A20 T 0 Tl @0 d @0h $2 0[0@ 1!R Zl0S ^h 1 $  /0 T``pK@Pd  0@A 0P` 0@0 P V 1 $ 0 TW C 20 T0l0  1 $<5 -L0 0$ 0 00b,0 0R$0S4 ( n{봅 -L`MP$ pK$ K X2`KS 00K"?0[R 0 AB0KA1KK0 KKK` ` 0T b 0T Ac 0xTp@ᤐKK 0VP@7T:VDb a f3P@@ LK ᾅ ` 0T2W+ Z LK0 !SpK!R Z KQpK1S0Kp!`T0 RpK1S1p p0K! |  z`=Cԅ -頠@L TpP`*0;#;R @U3#P0@#5;#;00 ""A T*0;#;U C -2LM1(pK0')[1`8 V񟗐,,,,,,2[0[%[1X00 4 @* 0K 40K4Q@Q0d0d@T: Ph&;#;(( 08  $ 20#0V00S  0SE023000 ,0  R0<<0 0a 00dY  0Ǡ0 +0$0,0 \ 0X Ǡ0 +0$ 00$zy/`=0H -ML Mx0Sl1, (K`p@ 0RI*BKHH0!{V PU *A00 R0  PU:Z{Y000,0 S ,^+ȃS Zhh+㾃@+㹃0U*Z(v{0at(\ -LM 1p $  1 $ 1 ? 0 $b 1Pb $ 1@c $@D 04{Y 1d $ 1`e $ 1Pf $ 1@R $P@` 0  { 1 $ 1@ $@  z$2P ,P ,K4 1 $2@ 0d-@ 1 $ 0(-@ 1 $ 0,@ 1? $ ?0,@ 1 $ 0t,@ 1 $ 08,@ 1 $ 0+@ 1` $ `0+@ 1< $ <0+@ 1 $ 0H+@x 1 $ 0 +@h 1 $ 0*@X 1 $ 0*@H 1 $ 0X*@8 1 $ 0*@( 1 $ 0)@ 1 $ 0)@ 1 $ 0h)@,0S L yP 1o $ 1@o $@D yPUZ!8y!0y 19 $yy$2@ 1 $ @ 0Th8PT <2Xy0@T@y<y 1@ $@T P 0 T 1 $  cy 1 $@T0P SڌTyRy 1A $@T P 0 T 1 $  6y 1 $@T0P S'y—(0SP!y68@0S Py 8@0 SP Rh yx y 1B $@T P 0 T x 1 $@T0P Sxx1%PUP<@ 0 Tx 1 $ 0|%@ 1 $ 0@%@ 1 $ 0%@ 1 $ $0@4P Uhxx APT,  Uh<P'0}x0@$00$00#0,2 e\ @TVxTx1P@T  UhP0Hx@THCx$ `(1S' X`(—$," 2</x4-x 00 TY  1 $  /0 Tx(APT  UXP0x@T8w 0T\w 1 $ 0" 1 $ !0wv0 0 <( 1M $@18w 1 $@@,K2P!0@ww8! 0 T 1 $ $29 1 $2꠆D`ltć̇ԇ܇ XL(@T7$\h6؈M 0HЉ(ԉ5 - MLp00 0`P P@  h0@w 0 00 *,P@@0 000 04P@, 0P@0 ,  0 w  80 000 N{0  $v0  v(X -@LP`p$ 80 0-!LM0@: ,2 _”(0Sc18 QPT BU<  T2}S 2T";0T20 1 $@T20T2 $2 0C9 1 $0$2  0T 1 $ 1 $P$0 0 (56 -LBM,0(r("(0 0@00$2 031#!L00D P@30`gt,"@[$2 PP@ $26!0\A00C\ 0  "!L0 00 81C& 0 0 "!0 !0 R(0 S (rX 0\ 0\$2x 0  Bg," Aa,"0`` ~<0 )0a_c_cR|_c_c0S 0-LMBP(0S 0h1 $0( -LM(0PSp- R000    $2 0p0C2#21PJ0000 0<03hU$0S ˜0(  R  $,0S@.@.L1L1L1T1L1L1t1|1@.1L1L1L1L1L1L1L1L11L1L1L1L1L1L1L1\1X00C&S)......T1...............................\10 0,0,Q0tbŸ 0001 11  1P@ 000,2 9,2DRhMU@00C\ 0  "!0 00 1C&  0 "!0!0 R,0 0C\ 0  "!t0 00 `1C& X 0 "!04!0 R000W4@ Tx1, `1317 A$B}0,0s0j0h0 0, 0c0`0^0\  $0 (˜1  $0 (_c_c_c_c0<0 S:<0. - 0L p 岀Q,2,2,Ÿ(2P  !@TS 0a000C\ 0  "!0 00 1C&  0 "!0!0 R)`hl P8T  20R   030 00   0 00   ; :@00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 RSR_c_c_c_c08E -L$M0p X0,0W` P 0Q,@*00 Q @:00 00•0(  R@D010•(0S, 0 0, 00xxJ4p0  0$•0 Sp0"C!ȡ100  0@00   9  0 00•(0S 1S 0 ! 00. a 0 0,2$2p0C!00J/0`0<0(!Ri 0@*X0 0C\ 0  "!p0 00 \8C& T 0 "!00(0 RP-0 7G0 0C\ 0  "!0 00 7C&  0 "!0d'0 R0  ,r0; 0  11`& 0 T 1 $ $2n,2b 0S T 1 $ I 0p 0  /0S* & F0 0C\ 0  "!0 00 5C&  0 "!0%0 RcD@KN  H0@@ 00?@ /0 T 0 T 1 $1@ @pz0 1$# p0  00@ 11`Qe  Rc 0PD?00 $0 0<<00 <2•(0SB000( R0$2@' #0L T$2OF# 0 T 1 $ $2 1 $ 0 ~1 0 `0 @0( 0 0,0(• o2 2hBaQQ1  $0 (;Wm1 1   1 Ÿ  1`1 @000,2 9,2QhQ@00C\ 0  "!0 00 1C&  0 "!0\!0 R)(! 00C\ 0  "!0 00 0C&  0 "!0 0 R)'2 $(0  $0 (g  $0 (W00 p0p__c_c26_c_c0̊574vMb 0-@QLP 3 1 $@T p0T 0؊ -LM0X(,0@ P R` R Vy000$^ 0– 0P  0P0Po s 0001 1PPP1  1@P 000,2 9,2hChPP00C\ 0  "!,0 00 3C&  0 "!0"0 R(00C\ 0  "!0 00 2C& | 0 "!0X"0 RB@ ( ,\ W xo ԁ0,0 0001 11  1@p 000,2 9,2`AhCPp00C\ 0  "!$0 00 1C&  0 "!0 0 R-0 0C\ 0  "!0 00 |0C& t 0 "!0P 0 R000M_c_c_c_c0 -LMa0!@ 0 P00! 0 T 1 $ $2X0  $2Ap 0!RApBp 0,0 AT 0Sh@ @T 1 $ ( @00C\ 0  "!0 00 0C&  0 "!0| 0 RB /0 TmO 1 $_c_c5_c_c008R 00 R Ѽ0006 -L⸢DM 2X  @DK  `rD01Q 8 ?O[q1   0#[000  0H H K0H @R H0 0@0T@ L0 L@ T H0SP P0 ? [ 1 P0P LKP K0@HPT0K @CT^P PL \ 0S0ȅ0ȅPT L0@  @X0@0X 00C\ 0  "!0 00 0C& | 0 "!0X 0 Rf<0[  000x_c_c6_c_c0 0-!LM0@: ,2 _”(0Sc18 QPT BU<  T2}S 2T";0T20 1 $@T20T2 $2 0 1 $?0$2  0T 1 $ 1 $P$0 0 (56 -L,M,2`   0H0 P 00L < D @ 0r80 03K03K03K02KPK02K02KPP %> ".B 0֬PU80S080 U  0T 1 $APA  0T A 0TU' p$2  R U 0 200f" 0 1 $  ,2030,2b$p0R 1 $DP 1 $PP 1 $TPTp 1Pp $ 1qP@ $@T0D@YT0  P,2P3,2PPc g -LM2&P`, Y p 0 p@,29,2 Wp W1@ 87#,00,0 ,2  @0 8#0S $2| 0 00p T0   0 0 pT W$0!000,"@<#4,2" @@@@<,2",27,2$2 ,2 203 S%S( 0Z T,  A002 T,  Q"403 T 0 0 T A)401 T2@ "20@ 0"  0 8 #q2gR -L,M0L0 00PSp` @0  0T$"$"  J, 0 4 8 s i @KD K<0KH@ $"0H0 ,2@ @@W@\T HPO DQA Q P 00S @0L0 00S,0S L 0 000L0 040 S000 0T80SL 00L0 LU0S 0 T1 \0k$"@@ H@ D@ DH `BR` 0- 2L0SP $2 00  T 1 $  $ @ 0T@0%> 0BR 0 0 Q\ # 8#8SR0SS00000 R0 0  0S Q0000S0 -L M8`,0K(pKP00*p` ` ,@T D=.8  ,  4@T <08@0 0`  @TP = 8<D P@ TAi\ȋ -3bLM@1`pmWHPfPy  p!0W@O i, -1aLp P @ @H0H S1H0yyH@1S!( @p00C& R 00#!x000 d0C& \ 0 "!08 0 RhD_c_c_c_c001 p-L M8`@1~0 0 02  P@ U hppX -010LM ` PHpH@0T .@yBP0 0C\ 0  "!0 00 0C&  0 "!0l 0 RQ1101!101_c_c_c_c0 0-1@h0PL 0uH01P 0yτ1@0h`o -PPLU` p1Ah0fwmP h@\111T01 0 PPU@H X0 Ba 1!꼏_c_c\ȏ_c_c0 0-0@LP  0 101HP0P0C& R 00#!p000 \0C& T 0 "!00 0 R00h_c_c_c_c0 -LM`8@QhpD$0S (0S    $0 ($16 0S $S 0,0000i  0S0(0,00 R 0S $00bS $nS 0S0Sq4 l0ciñP 0S P0S -PLM0`pp D2SQ 2SH 2S 2S8ic P ic1# 3cÕ!0?0c0@lT0`@0j 00 @? @?0H405dp0\hPd oJ`0aiC   L Lgfff p-LMb0P  B  0  0 }3 SKvv`v`v`v,v,v`v`vlw  0 0 3 030 3 030  0 0 0 0 3S p 0 b 0  03~ 030@ 00   0 @ 0 0 0 ,( bm b]h 0-P0LLbH0@  < 80@ 00bꤑb -"LM0p, B^ /@T} 0@0\..@  0,0  3蠓Z `\ ``0 , @P\  `0,PU@Z`ZY122 3S  R10 R9!   ? Y @,0S / 00! !00 P P oo/ b ? o00@@Xf 0Y @0ZX0 PL\W00b? (aY' _̑ -LM0` PpD#0̀0  4 ? 0 7\6,6/@#b  A3 S  00 0@ p&?@BcdhP@@g 2We3SS[ R0   00t 3[ @(0K#/Å0/00, [+ [0@+3 S( H0 H%00 %0  5>  0 0$1a$,a0* [3 S0 3 S@ /Hğ0 A D4 0(A,$aIpQ@ 3p@0p@W 0@ =#=,,0J003#10T00Si (0K#Å0/00, [+ [0@>3 S; ß0 ` 1C00 W "0 @00  90 0e"`0 =00 Pd"`<T"`0* [3 S0  FT !0 C YC-.e`b`0W !0 @00T1  F @LF/L`$0 B 5 B@!A`4 @0 0 0 =<.#=<0I 0 0D@30  0  0 fh `L @ ?AcRIJ@/0X0 @`6@BMb~e 0- @P0 00L WP0P0C& R 00#!t000 `0C& X 0 "!04 0 R00h_c_c__c_c0 p-,1LM Ra 1@ 0 003V@0@0C& RP 00#!000 0C&  0 "!0t 0 RUL  c D? 0 0 0p(a_c__c_c_c0 -LMs `0@ P0 3Up,  QP`w ,P@o , 0 0^ 0 0 0D @ S3H `0000p0 @@ 0/0 00S= `00C\ 0  "!0 00 t2C& l 00#!0L"0 R,0 P P   /g0@0 < $0D0 (P` |cx1T 0L1  000 R  0 00U` 0'A00C\ 0  "!0 00 0C&  0 "!0 0 RB @T1 `T01 P0+0 @0f^4c^0_c_c_c_c0a( -pL0@`P#U0P0? R PU08 ,^ %^@` -L M, t0, ?Q,0Xn , 0p3`0 0  @ 00  ! 0 3 00W01 P/PP 30 Q   R R8 0S0  0S0 - 4<#0 0C\ 0 !3 0"C600" 00#!2  QX0QI \u P!0 S P P] 0  0J "0 0C\ 0 !1 0!C600! 00#!1  Q+ R 0S0000P0R00S(0 4A]Q,0000 , 00 0, ȀoPb 0S Pږ 0S PP |ka0O R  0 00WP 01 P8]0[_c_ca_c_c0t -LMP1 `@ #p̀/PⴠF5a / 0 20 4 < 0/@0D  0Z00 1 P /0PS0000@0T 0 S00@@@ 0 0 0/0S ozo\ -LM@P `p0ᴠ3Z̀ 1 P /!0i<H0(S\ ,0S H0X0 0@0E 0,0000\1  (Q6,Q488V\N0U ,0S  Z000o0SPZ 1  R 0 0 0 0 S 00p#\H0>0SD0(0D0(0o%00C0 $\, \̒jܒ -0p L@0P3U`" 0S000I0S J0 R0 0C 0 0 0R 00000 0 T1 0S 0-@P0Lp d d`0@@ 2SS 00h%[[00 -LMQ@r Q"2p\03` S- PU 2@a "0 ,1X((y[0 2PU:p[2j[2PU:0PU`PU0  0  0Pu0PURYn@HX\d -@L0Pp`% @T[@T 0#@ R  T0,@ZTZ0X\ -L M@ P84Pp $4  `0@d@pP3U`1 P P  R 0S  X ?   1Y  ? Ȑ 0 P` p8#?@RceaPP`Pl 2WjPP` W 00  0& R0 2  0h0 @0 0 < "D0240"aZ("\Z0@ Q0 1  00 @0 !?Z !:Z0 0 0EP@a0 L$Z0 1  0 0@ 00 M Z  Z0P Y0 x0  0\ 0@ 00 &8L Y,8 Y0Mb[]jf -LM~0P2S& "R ?0S Y 0"000\n\N0 0  D>  0"2 oY.YQ20) "=  0@00 0 0 00 =  0h h-hYT X-cYP D-^Y0? R••A Q& Q Q0S00Q0  ?0S aSM  8Y0A :|<  0X0 @0 0 ? R 0  <  00 ;  0 0"00 +X +X +X +X02 R | X.> 0SȐ• 03̀"QvxĦȩȩdȩȩȩȩȩȩȩȩȩȩȩȩȩȩȩȩȩȩȩȩȩȩȩ0 2S 0 " 0D (  ? u0 T4 aX02 X0 k0Su S# 0 ? X0 9  0t0 @0 Ed )gX` |)bX0 h \X2 R00 000.0@00 0@# `)?@Bcdv_#P@@! 2V3SS   0 0 0 0D@30 Q,  0 0 0 3S 0S  |R0 s0G W0 00f0 000Y R87  00 @0 0 000 0 @5 ` '?@Bcd^#P@@! 2V3SS   0 0{ 0 0D@3#0&W&W000^04 ^3080 %@4?Abc f 8 AD^0P` f8^0 e 4 dVW0003 R? շ0 ȵS00ȅ0$000 4  ,00 @0 0Zt$+Wp$&W8ğ0 W•W•0 2<0"D TW0 <02D ",W0  000"?R 0< 0V0\C 30@Sz S0 03  0 0 @0 `#V L#V0SB  S0 V0 3 ,2@@ &0@00 0Q1 P/I0S J0 R0 0C 0 0I J 0fL"VDV00 ({V000   0 0@0 gV0 0 1^Vp0 6 XV30  NV0 %  hEV  R.>Q@S0X? 1V00 S R00R00S 2VmVP8\ 8HxMbaa~Е @T|ĖDXl -LMf0@V0@l 2S 0 a`6  0D6 "2S$0a0Ɵ00  PS R0 S Sy 0 @00 223 SV #$0KR ##0/.00( [' [0@)3 S& 0  U00 4   o000 0$`U$[U0& [3 S0 }"0 4  0$4U0 00  03   000wS Sl"00o"0" 0@Sy  S]<0 0\S  SS? R   #T"I00J2 "H”0 0P0"P2"202/000 0 P pX"?@Rce[PPP! 2W3SS   0 0 0 0EP3”0 0P0"002 ? R $,!zT 0<<0 mT2S  eT0 0  0t0 0@ 0 0vTx IT80l` CT0?"L O0 H=  ?H>  00 />D  0/00CS5$̵0,0 P03@P 0S R0S  R 0 0 0 P00S1  ? //00CS񟗯00x  >SmȀ  ? <R+;/ 2 S? xPPgP3Sb24  0WBUH *0<<00 :;  0? AR$4@K2.Z00*0S00 =)C40 -B040 0 0 R<K< 40R  80S 0 R5$ *R3 3S*0<<0 RB0 P@R R030 0S0 0 0 000e0 R0SbX  0庠 P 3@Z <H0  9 082< ?"D  ?X  Q RBT pT[0@U0. 3 S' 7  8  08    8  0025'+R'&R;S `H  2 Q pA 0,R 0  QQ T J0@ BQ6TT  {T0@q jD7  0–,0K P, , 0-.0B 0< 00, [+ [0@13 S. 0 &F00 T5   ,|Q%Q,0SgoS0  00%Q0* [3 S0 $oQkQ00@0 84  x85  03X @$0K#/Æ0/00( [' [0@+3 S( 0  D00 L3  o00 002A<`# Q(P#Q0& [3 S0 @ /0 3  0"P"P/@ Pq0@$3S 2  3 @–,0K P, , 00-.02"PP0@`!0000  T2  0BX!PPN0|!P I0SX 2SH ? Q00 000I Ru 0l d1  00 @0-0 02H PP@B4 `lԘ 8lQ G 1 ' $ +  ԙ: W ? $8V X [ N H| { ܚ 4d l  w<RKTxCADȝD O00  t0  00 @0 $!O8!O00 0  00 @0,0 i!O@!O00 p1  0x0 @0@ 0  %("O@<"O00  &-O3G 3S 00 P@  PP@rO0R )|r@0@ 0   0 0@ 00 6\#KO p#FO0#@O0 3 CT 0@ )O0"O0  3@@ C<$O2S^P O2S 0@ NT@D(ڨ0NT@Dp0 00 ? <"R420 SH 2"0@@S$T 0 " 0D (  ? 02  <5  04%N NH NN"0N? NE0 X 0 G4N 0 0 0#@0 00,6 xuN 0 pNmN.w00 xD&`N&[N 0VNRN2S 0  7  00 @0 0 $\'5N`p'0N00 7  00 @0 'N'N00p\ 0 P1PF? RB ^ 2S<0X@Dl 0M/2S- B0P@@@ 0 S00Ʒx–B/0 @M0 0 @0@ H \)M0 0 9@@ ? R  M0S2  )M 0 |M y0i?D lMKP K - 0P@0} 00LU@ ? R h2? `R 0V 00B#h~-  ?Accp0 x0  0\ 0@ 00 <8 M0 $ M0@BMb  -L,M` p P03̐00@ D0H 0 ? @ @ 2P0 0" t p!ld $(LT!@000 @- 4L1$Q@00C\ 0  "!0 00 0C&  0 "!0 0 RoL0,0/0V0 2KPL0 0# _c,b_c_c_c0\ -1q!L000_L@`P 0SM0SJ RG0S< R 0 0 0 P`V@@Z@00C\ 0  "!0 00 0C&  0 "!0t 0 Rd00amX,Q00S1 a_c_c_c_c0 -LM0@ #00 R0 00$0S< 002H0H  0K0 -L M@)W   0#P@ $#R 3R:03 0P 0Z0ŸP0 0 0U 0 # P^ 0SI0U0  P\ 0S  0\ S  0^࠱ S `,0K(pK0p0` ` ,PP0 0 ,  :4PP  CK00`0   PPd :A PP40, : 0\CxpDԞ< p-LM` @0T 0T@ 0T 0T@0 T 0T@9 0T@ 0T@A 0TN 0T@O 0TH 0T@60@0 T#P020J T0 0!0; T0; 0O $@0M T0P l R $0  @ 0O TM 0T@0O T0 7 %0R $0 p@?#όL 0 0T0G $00G T00" $0 00" T0dM T0 T0k -L M `, 0p 0 P崠0 #̠#3B(0+)*@ M0PS 0 0 < <0 0P0SQR0 RD R9 0@ #@!@"@,0  0S  hN p(0TP  00h #Ġ##Lh0@0 0, l0"""Ƞl  p(0 PW0 0S0000,  0!0000000000 000 0iP 0S  0 0 S00 00 00 v0 0 l = #=Y -`0 RLᲠp P8 0S ,  ) 0 0 030 0@###Ƞ+)*(0 0T00  @@9 "" ?0 0 030SL S  @ 0 0 @ @0 H 00S@P Q@R@  0 0 030 0# ##Ƞ+)*(0 0T0 000 S000 0 00 03l -LMP0 R @p  H0  S0PQ0R00S0Pʬ0^0^(`0 eH ( 0 0  0`R Z V0 `H P 0 HH00 A 030?0`200>0 0?<0040 000`000X 0 T P 0 T 0 T 0H 0( `0 `s0S0 0 0 4G 0( 0 ]ꨟpD,|Ġ -L M0 p@ 0R , 00 QP X 0Uʨ00CXUP 0\ C Q,0 P 020@ 00 ?@0S @ 0# ##Ƞ+)*(0 0T 0 T0^,0S, P@0U20 0>0ʐ0 010 0 !  0?@?<0 0@0 0X0ʨ0U0U 0?0 \A 0\ Q,000 0PQRS 020010 0?<00 00o0S, P0U20 @0>0ʐ0 010 0 !  0?<0000 000AC0@- PP @ @ P  0 0,,,,S QRP0-  00   00 !-NJτR 00d0 ` 0Q@Q8Q(QL00D 3HQ$Q  000h*x p-LM`09@!0!@TR@0Y> @0T10  @1 @0Th@1 @0T X@1 @0T H?#/Z?B!PP10T!X1RO RO R0000 0 HP@#0SPH11@TPU0)(0S0>, \p0 0:(8e 0P80 # "CZ? 00|P@0!Y>!0@\T0  @h @T0|P".@40|!.@0|ugDKK -LDM0P $@T P 4/000K0S@ 0 ,(TpQ# 0,0P*:P$:QW 4 , (0 L0 H 1D 000 X R X RJ0B ( 0H$Ƞ 8 $8`< /8 !;0 0# W 0 $@0 \04 $0P` P < l \B88 "50 0@ W: 0P0 0 04 , 04 X X0S T ! L001PQ , 0S "T0S0p0, \DH  0p0, \L B8 W 0 # !" B8 7 P Y X R 0, ,00C, \X\ 8l;<d˟W@ 0H  A00 ,@@ W   0SS:@^ c:^E ^ :^ @ A4Q0,0W0 $P5 #P# 40S O0` A00 @0S0P@Q0R0M0?, \ sA0 @K H@I J 50=0 S@ѵ@`ѵ`ѥT_ V00TP , 000D ,000 i 0?Rm0?JV00T  R(TV 0DS4 R TAxAnp ,@0 (00 @0?,00 D4Q @@4\ 5 000$80s 0S00 0 t@4 0p0H7@Q <7Q45 000$080w0#S- @T' T T 00 0@P@ P q V|> k P P ` v<?Q$s@P@ P4  R00C##̠#,IJH0K '0=nQ@5@ Rr W5RR 5Rx4 000$0@@5 D@ $0 6 H $D@10L S,0 & ,H 10S00  L00P 0pF?, \LD H0x@D H0`?X ?HD4@\ 84\@0, ,0c ?4^0,07? 5 000$8@ ?4@ 0 ,0@, ,0c8 `<0?W 0 040 , [Y W 4 [?#000 04 T@0?, \~ "000  0=><b?W 40  gW?BP 0 $`{s =?5 0@+& 3?0, ,0@ @c, D ?W 04! "$# (,?o? ???4\C$Xl{ 4X|Hpܥ$l|Ȧئ(0<T𫪪x0, ,0@ @c, X>w0; $000; T)H ,p 4p D L 0p c0"$"bq U T0T(}> 0T -L M p01 h!X@T T T 0,0 `V    (0S    $0 ( $ `V& V 000     0ppo(0S $ $0 (P,@lB 0X0[YZ,`  0 " 0$ @ $ 4  P(0S81N/S081pp8q  $0 @( =0,0 0S0 0r=,@n 00S0iTh (Tct000 0 000N00 ppT0II0Gꀧ -LM`0p @P h@T0A`(@0S F/G v=̧ -LM4 k=440#0KS80 00 , < <0Su8<00Q8 <0 48QU @T00 4 0<1 0 00 PP0 P6=TP40@QU @T0040D10  00 PP0 =TP0PU+ $0  0$0@, 0X0  x< 0p0CS00 00 , < R0000 0P qTp0 1`V0@00 0 / TʄQU 00 PP0  <@Y<0 0S40#[ 00<48000<0 4#JT(X -5L앟M 0 p0`0 0, 0QU hR0000, 0 4 @ p 䀔X- 0 A0S P @40   ,$ `@ ,E 0"""Ƞ[YZX 0  ğ @  $0P@(0S    $0 (0800000 PP00S000)C0 0C\ 0  "!0 00 3C& x 0 "!0T#0 R@T 0Z 0 R6 T) B0 0C\ 0  "!0 00 2C&  0 "!0p"0 Rw00 ,0S 00`S 0Q0 4 0   00S, {@DTʣ u;lA0 0C\ 0  "!80 00 $1C&  0 "!0 0 R, 00F; <P,  <?䀔000, 8<0dP8, ` 0@@T 0Z,_c_ch  _c_c0@ -L M $q ( P, 0 08Qp$1pU  0 !01 R PY0 R0@Q00  , R  0T0 0S $00` `1S `VV 0(`S 'W ʇ0(@ P@ p'W(W V000S 00  0 "00 `0 SP QR 0 S, 0 S0Z 000SJ R0D1C 000 1QQ@4 !010 ###Ƞ0`7J/) p 0S ( iW{ $qpm@000/ @ QhF/ N R0<1 (3Pp P R8`h -@Lhp0P  0: `0000$00$0@`0`0C^  00#!t000 \0C& T  00#!04 0 R_c_c_c_c0 -LtM<  BPD  +> 9DP !><@80K4PK 0P@ @ 0,P<  \<0D 00 8 :4P<0D00@  0 P<0D : P<  t@ @D0<@0 0  0@  P<@W@ Q< @ . D0 < D 000 D0 @ @ @D 00=D0 ,00D,0 p0 0 !L0 T?00@0EPP F T0G0X M \0 N00Q0R0S0P H 0T 9 : ; A B C 80<DL`0O0dehfl g t0 ]0x0^|` _a0b0c0dX0Y0Z0[0p \@11 RH8 $ #4"( 3#8(0 < d3 \<0L>1D3 /8ß!0S!(\  0D00  00D0  0" 0Ÿ000 @C\ 0  "!|0 00 h2C& ` 0 "!0<"0 RD@ < ^@  1 0<00J D0 0000C\ 0  "!t0 00 `1C& X 0 "!04!0 RMK<  8<D0$<D0 <08 0DHDE<  7<  l7<`7< P7頩ԩKPT_cX\_c_c_c08h̪ p-LMP1T! 0SPO*HaRV R0000 0 p P`! <09P10  P0P 0/!P1 0 P10P1mpP! 0!0@0|80P!@0 !?\p\J  -0L`pFP@4@UP@' PUU1 X1P0X1@1 R 0S @0  R0Z 6PU0m< 4 480 4! +=5  0- 80,#@L(P 80,#(0h -LMP0p @Rh8`P 0Sa:X!30b0C02#1 T1T1$0CRR*D!P0!P!A'P AP10C0  P10P1 0  T!0$ B9T!T10 #PT1 ! T100P0 m{$0!00|J -LM0PpUA00 `0V Sd 4uM80R`08 @08  800X1`0CX1 -0LxL6t0tH6l0lD6d0d@6\0\<6T0T86L0L46D0Dh/60Plث -2L0(@2P00 T(20 $``p(”0 $0D58 huh5:$ 0-(2@0L $2PU02PE88;80hP(2 0$00 0 R 82R@082000UPE82@082000 0-@2@0 L 2P (”00 T8;800(”000$(”000 T -LMoP`p(B00 T(•00 T}(20 $(•00 $0pW`0@"V @0@"@2@20@2 > 0 `  0-(2@L0 $0 (”?00<2<200 T<2PU0(”00 T<2PU -4< BLMR`82 8  (–00 080K4s3@ 000+PP 011 01$0  1 T@00C\ 0  "! 0 00 3C&  0 "!0"0 RU 0S?2@ 000?+$@0@0C\ 0  "!P0 00 <2C& 4 0 "!0"0 Ri$ R 1 0 +10 ,("Tz/^0 " 2^̌ + 22%%p -餢L`BP027P 7V,0q00 2`Vu -cL M┓@ 0P0px0PP `011 01$0  1 (@00C\ 0  "!0 00 2C&  0 "!0"0 RU @ 000$@0@0C\ 0  "!40 00 2C&  0 "!0!0 Rm$ R 1 0 +10 ,( •R| 1叏X`Lp@2 |$@T-0[. [,[+[l x0 0x0l•| 0X2| $X ? R • H0|X? R $04 -L M, p, Ǒ0 0P0P  R`(0PR@?T , 000 0 (@TP V c3@ 0P00PP t1 01$0  1 <@00C\ 0  "!0 00 2C&  0 "!0"0 RXUP  R@@ 000$@0@0C\ 0  "!80 00 $2C&  0 "!0!0 R"$ R 1 0 +10 ,(0 R00 27 0cS5;Ӵ5Q 0 S00001A J0C 1 P  01$R Z 010w00 0 %,0S 40<, P 0/- pb净 -'匧LM0`00 )> LpR  –| ;X+$¯–| 7X@!^– |0@TTP@– |0X@TPZ7Pk 6 Rd –|/ 0Th6B<  T6|X<6 RE –| (6X2| $5@ @@H––@$H9| X5 –9|0 X5 R m–| :X'B,0|8 \–<5 |X 5 R – |5X2S–– : .;||X4 R 2| $–00|@0 T–| :XO00R00| ,4X–| @0XB| *;X–| 3XB| 3X–3| X7S\–| 3XB 0|X–| ;X%–| :XY – 3|X5B@05%+%00C\ 0  "!0 00 2C&  0 "!0l"0 R\24o<5–| $2X[–|- @0TB|1 X'B,0|<$ \–|1 X@–H$H|9–| X1X7< Ad00C\ 0  "!0 00 0C&  0 "!0 0 Ro–| ;Xc-_c_c'<0h~v_c_c000`, -L)> "R / 00C S ((((? C  x -P)>L •R`|1 pX2| (•@| T1X2 |,H$H 0 0 0  0P0 dԇԇԇ#00•| $ 060060 R %0?  R-00•| $$0'0 4W L000,  d -l3LM`3@H`LP0 ZP 3pC'0 0C\ 0  "!0 00 2C&  0 "!0"0 R黩2Tw|2T[*t2TH l2T p88B˜| @2X2| $5) = S =@S 58C8p22  B |9 X˜| 1X2 B9|0@ 505 0S &4Pp5@ 0 R p0T 0T0. @R\0S\0T})> R / 0 pr"._c_c_c_c02i 1i i i 5i i 6i( -t0`0t0L–|0 pX2| (@PH$Hd X+C1S -LM`pR(0S G (0S7$2S,pW`Z!`pT(0S G (0S$4SpW`Z i!\V04$0(GQV02$0(G p-0LML`5P| ;XB| :X•| :XB| 9X •| :XB| .;X2㒫•| x0XB| ;X•:| X7S4i5=5phWh -P9LL$M 0@040`@00C)L\8 <  0  "!0 00 8C&  0 "!0(0 R0@Kp 0pPP h!  l%}Nǖ~>0 @04 p0 *,P ǖ~ '7 4P ǖ}>00p  0 Pǖ'7 P@x\ _ǖ00Pp  0 P@PTǖ>0p 0 PK^@ Pǖp00Pp  0 P@PTǖ>00p  0 P` P7`_O@ 0W04?S 6    ?85%55 ` R8 5500808 (5 080%Od 8 01 $800–|5 X2| (p4K 0p3[#20280CP O%5%)>p"4$t2x"8 X"  0p `"R "0p"2PS ? ? (4 Rq %0XO0aV"RL<L<PDPLP# < )> R! 78 8t#007^–| ;XB| <X"<C2 R %< ?  R-0<0 $ '0 3#< 28 d0'0 0$0 Q 0- 0tp2  ` | 0# 08(2 c 0]`1@ 000@0@0C\ 0  "!0 00 1C&  0 "!0  Q( &"N1 )>P–| 1X2| ('  8–0@9| Xҥ_c_c_c&_c0Ȱ\ L`_ MepG- -LM@Kh 0-XPL@48 $0 PU 0h+U 0'ı  B0-bLPp 4@@8 0X㋨480 Xエ480 Xy` -L804p`H0 X "PB48 0XU408 X $H" 48 0X848 0X/@48 (0@2"T48 0X408 X k"g48 0Xh -@LMTp`P0 @uTU p-0@LMP P  .9(`P00C& R 00#!000 l0C& d 0 "!0@ 0 Rpphf_c_c_c_c0 -L$M480` 0\ ㏧<>P 0ˎ0P P *0,PI<3,6" 4P<> 00P  0 P@<,@6! Pdp@< ? 0   0P11UIR<R02p@ 3Mp]@<@  0 P@#2p0W2pPpW*K 02[ 8#(# ??P"2 $4  4$ > 4@K0 _ @3!h /!d4@p5\$\4 0T$000 @`1O  ,V\2 R 02[$0S\2_0\23@H23L"P2#30r 08"R' ! P!  P ##H#0@020 &> @!0 0 ?2[ [0 Kg[@00CZ PᶣK@#[0xŸPC b 0K6K0 K"[3[8w 0 3[[  BP0U3K@QTRU $0< @$=0C!L=*PPP <0$< <0)8<, 0@0  @  0<0< p 8<0,0<0< 8<, 0<0,0L  $hd h-p| P`в p-LM@_&82S @`_ h2p- -LM48p 0X``FX64P@@8 0X480 Xo480 XfV`48 0X4@80 XS40 8( 0 48X`AV48 0X6b -L M00 00 S40 `, 48 0X@pDY74@ PP8 0X480 X 480 XW@ʌBT#4 ,0pDX74@PP8 0X480 X480 X٤W@4 P @480 XȤ40 8(0 pD7048 0pDX㲤W@4 80X40040 壤40 \x -L M5,=@S\p, ,0}S5;ô5`PV <  0PV`V 0 S00 10C1W N`p`<P=<(0S0 (0 000X4   (0\ 0,  000   (0\<(0S,00,0 \0 0<( $0 (Jꄓ3@ 0x00; Pp \3 !!$ !0 00!0 0$#@00C\ 0  "!0 00 2C&  0 "!"0"0 RWW  RBh2@ 0x00 P"$@0@0C\ 0  "!0 00 2C&  0 "!!0!0 Rd$ R 1 01+00 (0,0, 0<< @<( <@(<(0S 0  0<(`_c_c`aDa_c_c08a -L M@5 @p, 408 $,408 ,0 0T408 $@ 4 80, T 00<(0S3,4,098D0 \ PH<@ (0S?0 PU  U  \2@0\2 (0 0D ?(0 , \2@0\2L 'D 0-LP @L2H @D,T0 0-@LL”H;H \L2HH ,L”0H9H \L2HH ,L”0H0H \L2HH ,L”0H0H \P0S5H L2H,L”0H0H \L2HH ,L”0H0H \L2HH ,L”0H0H \PE|uPL2HH ,L”0H0H \iL2H H,H T L2H,L”0H0H \PP U]0ES0h2hRL”H;H \>L2HH ,L”0H9H \.L2HH ,L”0H0H \L2HH ,L”0H0H \0hL2HH ,L”0H0H \L2HH ,L”0H0K 0-LL@H;H \L2HH ,L”0H9H \L2HH ,L”0H0H \L2HH ,L”0H0H \PL2HH ,L”0H0H \L2HH ,L”0H0H \PUZL2HH ,L”0H0H \~L2HH ,L”0H0H \nL”HH 0\0 -L@`pPW5H x L2H,L”0H0H \LL2HH ,L”0H0H \P \L2HH ,L”`H>P \L2HH ,0H 40L”H,L”0H:H \ -PL@p|L•H;H \bL2HH ,L•0H9H \RL2HH ,L•0H0H \BL2HH ,L•0H0H \2`IL2HH ,L•0H0H \L2HH ,0 8#hL2HH ,L•0H0H \@ ` -LM\ @P`K*pK? \  \ 0  gY2[2[#$0$@ 0T -LMQLL@HHH H "::\L2HH ,L”0H8H \L2HH ,L”0H8H \ -LML@H9H \L2HH ,L”HH ,L”0H8H \L2HH ,L”0H8H \L2HH , 0-LLHPH :\@@TZ0 p- B0LMB`Ppz@ -1夁L ` 0@ P0@    PpI<W3 @E@A0 0C\ 0  "!0 00 0C&  0 "!0l 0 RW骔CP000@;@TZ_c_c_c_c0 -\1LMTq 0 `P@ 00`U c _ [ W S O@00C^  00#!t000 \0C& T  00#!04 0 R<_c_c_c_c0 -LM♏@0LQ`SPP0T0 QppW0 2 R T U U  U Q!1 Q QQ Q' ,pK 0*@KS)PK 0S [L–H 00 \L2H0 ,L–H70 \U$,4<DL𴠠L2H ,0 P 긠꼠ĠȠ̠9L–;2H8 \@L2H ,P@Te -L M0KP@ ᙯ`  T0BS00S0 SppW SK S# S.@K-`K庂K  0S L•H400 \L2H0 ,4 4 L•7H0 \V@LT\dl 4 L•H4 0\ 040 0 0 5;L•02H8 \@L2H ,P@T4 0-? L0BS@_R 0@00x2000S70x20 -LM@ |2   ? ? R 0p 0  0 ^  -LM\ ?B#<0 c {`, <兒,  @ +(2Q ;445  L2H0 ,L–0H@00 \5 jL2H0 ,L–0H00 \ATP @   0SI 1 11PT@50~? `1 ? ̖(0S10̖(0S L–0H \吕050+0 0(0 0 +<(E 1 115<5L2H0 ,L–0H00 \L2H0 ,L–0H@0s@'@ -LML`H1 \LB1H4 \5p p L2H0 ,L–0H@00 \5 S L2H0 ,L–0H00 \L–H 0\LB0H \5 ,QU@ P   0S ? R  P 0@pU@PL–H 0\LBH0 \5<5L2H0 ,L–0H0L2H0 ,L–0H@0 -LMLPH0h \LBH1p \L•Hh 0\LB1H4p \5p`  L2H0 ,L•0H@00 \5 x L2H0 ,L•0H00 \5[ L2H0 ,L•0H<0 \L•Hh 0\LBHp 0\L•Hh 0\LB0Hp \5 -AT @ , =S CcrT@L•Hh 0\LBHp 0\L•Hh 0\LBH0p \L2H0 ,L•0Hp0@0 p )*0,P@&̖>0, )<4P ̖3=0)0p  0 P ̖,)< P@ )P)N̖00@p  0 PP@?U̖> 00p 0 PPIN̖p00@p 0 PP@U̖>0p 0 P@~@|Hx34P4 5h3h#0d3 `#d00 4`1 \400噟 RR Rw 3#<23O@"D2 "2$R0 v 0 SS,–\|29|200"00S00|2;|2p0 Z,–\8 ? R# ? R# /00CS"00T2XL2H ,L–0H0 \ 4020! @ 40W1I H  !1"2!1"2 0\" R03S SV㬂夂$    0T2SL12WP?  ,0 S ,<S @0P=:8>@  -L4MS , 0  LbPr$@@^0  TU !0TM $'!P ,0 S d,N $  "0T @ $0@dt#cT 0T H0T 0T @0TJ  0 @ LK 0  @U(LK P 0T I0T @0T 0TI  0 @j LK 0  @DLK P i 0T0a'(\ -LM0 P2Lp40 0< 08 @ "0T4 @0T<04 T< B404 T0DD4 @T04 T04 T0d3@ SV W+K,K @T%pWZ4 $@ @^@ 00 <.0V<@ R8  ,0K+pKVP Z8 ,0K`008  @D,0K TT"@@VPZ0@,0K@D+KVW \ pW80d8d -LMP8@P#h2@0 TP2L,0 p  0 0 , 0p` .Ϡ@0@nH$Hp@p@dH $h@ -LMCPb sLR@D3T@@  @ -L M `@ ,0 "0PT` 0T&40 T0 TG40 T 0T Z, 0 `oU,` 04 -LMP` p "0@T @0T0 T(40 T0DD @T0 T 0TYd@  0 U $@@T  0d[ Q-L@0 ?-#@?Zc?!NP  ARN`PO_P`` ??CS0cS@  p-LM@ 0PT 0T` $8  `$VpVp p-0LMPU` 00S PU@ 0@s 0s8P<rTplOp(_xDdq_ -1AL` Q p P-p Q) P`00C\ 0  "!0 00 0C&  0 "!0l 0 Rz0@p(R 8S x_c_c_c_c0 - LMHȟ4 4 , P, 0 "((`8 0qW @ 0008PP @00C\ 0  "!0 00 7C&  0 "!`'0h'0 RX7X'p0 ,0 l0   0 Qd 00040_ p0 00/0 0C\ 0  "!0 00 6C& | 0 "!L6X  Qh ,@6Kz 0 0C\ 0  "!0 00 5C&  0 "!5  Q z0  0S 0SpP `pD%D5P@ p  0Sp0 p0 }HQ4Q p 0p00! 00p0 H0S HCp 00  HlK@TPl K0  @TT000  T0Hp0H0a|_c_c_c_c0 0-0L 000p0P@  0p000C& R 00#!t000 `0C& X 0 "!04 0 R0u_c_c_c_c0 -!L M0000x0ppt`p0t000C& R@P 00#!000 0C&  0 "!0l 0 R\\V @@W 0<`@t_c_c_c_c0|,b -PLM@E 0RA 2P 8p `堠 V VJ +<W0  p0 (BP00C\ 0  "!0 00 1C&  0 "!0!0 Roft0 0L \P00C\ 0  "!(0 00 1C&  0 "!0 0 R$ V*АЀP0 x p0 0RTp0x 00 h P`" V:d0at0400 T_c_c_c_c0x/ -LM`84@P㈀ $8 ,   $pR <<30 l P 0S #0 0C\ 0  "!0 00 2C&  0 "!"0"0 R $ 0@~0Uh:x t0 0Rt0x Y  $pP $0PS %P+0  , 0  , p0 0p0| R,0H, h0x!2 $t fh0@ T \0\@PU HPH0 0Q S00 4 0$ka(_(kadq_xD p-LMt`t0lP P0P@HH D0 0S03$0@pf$kakaka ka ,kaĵ -LM℠Pp@0 `V 0 8808 40P( (0pkaԍa$kaka ka 0 ;$kaka0 0 $kaka 0- @0P0L00 4 0 TP0P0C& R 00#!p000 \0C& T 0 "!00 0 R00hp_c_c_c_c0 -@㈠4p@  0LT45 Q8  $  0P T  0T0  T0  Tdt  $ P0 P0000S  0 T R Rm$o,o4o8(0S100B;0&P` *0-@@0*0+) C<0 90- 020  < 0h ?A3c   0 (<0 ~<0  0 B?(8MbH -LMP`p /P@ )0"S S 00)0 l1 ,  (p=P0S $fP -LM0Pp $hQP`> $020 lAT0 L0 T0 !4 0j0 <0@T0 0s  '0s @DfTT -0S 0S2Si i +0S 01 00 (00 $ $000H ! { 0N v i ib ii-00CS񟗻 p-LM0@SP`0 00CS'tԧ$P p P P P \P"Pup -LMPp@`l0 T0S/ 0T*0 T+0S0 !  8p "p T,0 T 0T 0 -@LP`pl!0 T @0 T0  -LMp@P`00CS% 9 -0  d 0p 0S  Wpl! 0 $p p00 p -@L0P; S`p> $0S; 0S꼫ԫP0  ( p :hX ;w 0p0 (0$ 0 p 00 Sp -LM0@` P,0 t$ d 00(0 $CW> $ $p8@g(0S.0) <ŸR0 S@ * @T J000 R:0@0 d 08(0S0  0 B?(0  0 B?($p $0<<0 T $0 l1 3  $p $W 0 0T꺠Z 0p p 0T $  $pJ p-LM@`P0S, pp  o 00   [ -0LSp! 0 T@ *lJ`@P0S PUN000 05p 30S S & -P@ P`L -$0\0'0 A,  X$!p 0 \0 \ 0 T XC00 T00,0R/ 0,  X0aqJ -`L0p 0@P(0l \ 00\ 0p P$ 0T -`L0p 0@P(0l \ 00\0 T 0p P  0T 0T -LM0pPkp@*  `$T)? T $0 P)00S 0  T 0i?? 0@S)00S 0.p P 0 T 00 0  0 p-LM0@P` 0T 0T 0T\ 0S    php -4!4qLM0`0004@P0S8 S 3 PUNZ@PPU @Z@00C\ 0  "!0 00 l0C& d 0 "!0@ 0 Ri-^~_c_c_c_c0 -Lp\P` 0S 00 $0 $@A@0  T0 T0@S  0S  00 S0S  0Np  m 0Bp P0 \ 03p  $ @P 0#p P0 \ 0p $0 `" @ z p-LM`@P $  0T0 \ 0 $#P_ lػػػػػػػػػػػػػػػػػػػػػػػػػػػػ000 0p p 0  T 0pP p M 0X0l!!  0 0H  p-LM0@P`h\ 0 p^p 0 T $ $ 0F -LM`@pP 06P0 k\ 0)p _ $ PR XQ00RP6RQ.0l!P 0S%00  0P  i !  0i 0 i}P 0  0P 0 T @- l1 d0 Q@   \000 S@505 3:S0 04M p-LM@`P0 T 0ph -L@P`0 p B 0qp \ 0 i0s h^ p-LM@P`0  0K\ 0php p-LM0@`P 0T  0  d 0$P 0T 0p@-@l0<000@0@-@l,00P00P0@4M p-LM0lAP0 S 000<0`0 T0 Tp p-LM0PlA`! R 0t000S*Q0 2 0 <00 T0 Tp4M p-LM0P`@ 0T $0 0R}NU^@T $p -LM`VPp@g TV *0 T9 -0  d00PP1 D R0000 0 00C\ 0  "!0 00 0C&  0 "!0 0 R 00@0 TZ1V *0 T+0 T,00_c_c_c_c0 -0LMP@`e $;S $ $0 00G@@p 0   0T 0T0 T0Ȁ00  0T 0T0 T {0 0 i T p-LM<@PT` hC)0X0   8(0S     0 (8 $  8(0S|  $(0Sa (00)00S@$0 (0, 000tph0,00S4 00 v<@000  0 B?(8xx -LM<@T u0 # 0  hM锹 -LM P0 ` 0@ v-0Ss 0S̡(@00C\ 0  "!0 00 1C& x 0 "!H1T  QoY0p4@0 T00P00C\P 0  "!0 00 0C&  0 "!0 0 R  00 0 0 @TX=_c_c_c_c0 -`L@ Pp$0@000 T p- LM 0@S00Pd`p AB1!10d@2@d`0@$T @a2a3c13D@ /&b00B(ph?>괹pʚ;CйT p-L$M8 (0K$`KP0  0.*` ,@Td .< 8  (  4@ T$ p._p -`LT $0 0T Tp @P &0P Up T $0 0T T $0xR'x3S %@ -,LM, P`)p] 0T'[0] T[] $@@G[HpW$Z] 0T [ -LM P@0] ` pTZ] 0TZP P] 0TZ0] TZ0X`Z] 0TiZ0 < 0   Q0--0L@P  Q 008S0@Ҵ  0-8PS@L ⓬L(Ki0.PP- p-L Mh@V PK 0fP ,0"  000(^ `08 00pp80 -L MH`Tr; @ 000X 080$00 @0@0C\ 0  "!0 00 1C&  0 "!P1\  QV0pK 0LfP? 000@0,0 0P00(@T 0XZp0 0C\ 0  "!t0 00 `0C& X 0 "!04 0 R~ V|_c_c_c_c0 - @Lp 0` 0P0I 80Xp0p0C& R 00#!p000 \0C& T 0 "!00 0 RhNV_c_c_c_c0 -LM4 < @@ S!78 ,4p  B8 6P, 0 90>0P`*@D S : R#: ,Jc0 @`p`B0 Xp0C$ 0P8 ,04 0 P@ 0P0PP`  0 0B@$B -L MX`Ur; @ 000X 08U040 0 @0@0C\ 0  "!0 00 1C&  0 "!P1\  QU0@K 0eP?q 0000 ,0#  0P0(0(?^ Xڨ00C\ 0  "!t0 00 `0C& X 0 "!04 0 R~ JU|_c_c_c_c0 - @Lp 0` 0P0' 8 0Xp0p0C& R 00#!p000 \0C& T 0 "!00 0 RhU_c_c_c_c0 -LMp, h— lp2  h2l ,* B: @P0  TU  0\20\2 0``V $0Z0``V &0Z>❟ ($8 06dP@ t2 |,E[03\P @ 090RP @ 090HP@ 0`90>0F?0P!M 0V90"$`0>V 0<`2|"`Vh—`lp2 ` h2l ,h—Plp2 ` h2l4 ,0 h—lp2 ` h2lH ,4 h—lp2 ` h2lL , \8 ,P  T81S h—lp2 ` h2l ,h—lp2@ ` hR@l0 \`Cfh—lp2  h2l ,`cV\\hBlp2  h—l 1\UhBPlp2 P h— ,0l\d fhBlp2 P h—l 0\` Vh—lp2  h2l ,` Vn @`1`z>Vuro ch—lp2  t2hB ,0 0l \h—lp2  hB$0l \h—lp2  hB$0l( \hRlp2  h—l 4\hBlp2  h2l ,PhB, _Plp2 P h—0l \hBlp2  h20l8 I,$I00#N>C 0ChR0l lp20 0, Ȅ 0   h—l004 \@3hbAlp2  h—Q0l@ \hBlp2  h—4 :lH \hBlp2  h—P 8l\ehBlp2  h—lH 40\hBlp2  h—l80L \40#d` Pdh—lp2 P h2lH ,` V P x1@Tp!0040`THPH0L8 rh—lp2 P hR3l1 \&hBlp2  h—l ,0\ddhhBlp2 ` h—l 1\`VJA`V@DZ@4|,bpD@%I$d-0 aEb -LM HTe | H0S 8$T| 8}@ 8H SH0$(  0-LMhR@ lp2  h”l 0\0 -X6XLM P P p{ P( F0 0C\ 0  "!0 00 5C&  0 "!0%0 RoQeh‘0P00lp2 P h2l ,PHT hBlp2 P h—0l \2c00C0h—Plp2 P h2l ,h—Tlp2 P h2l4 , XP$h‘0`00lp2 ` t2hB x—,0 0l \h—lp2 ` hB$0l \h—lp2 ` $hB0l( \T8SP(R hB`lp2 ` h—@0 l\DchBlp2 `倀 h—0l \hBlp2 ` h2l8 ,XH"00N>C 0ChR0l lp2, ` H h—0l4 \hBlp2 ` X(!h—l36@ \hBlp2 ` h2lH ,hBlp2 ` h—l:H \hBlp2 ` h—P 8l\bhBlp2 ` h—0H l\2b 0P(0C0X(T(h—lp2` h2l ,Ah—lp2 ` T(hB@00l \+_c_c_c_c0=%I$P 40 R(0 R0 R(a_= -PLMP |"RpW 0``00VhB lp2  h•a0l \3` T2X"0 T2X"YPJ4@T2V0CT2hB lp2  h•l 0\303 (N@gx p1@`XhB lp2  h•l 0\ mwT`\80\8ZP`\(X0\8h lp2  h2 l,|"`ah lp2   h2l ,`Q |"pL8DX 0- LMQP hB@lp2 h•l @0\0#hB@ # lp2  h•l p- @LM`0P00(3`0`0C& R 00#!p000 \0C& T 0 "!00 0 RpphN_c_c_c_c0 -QpL@P`08S 0 R`,8S  0$ $Rp0S`@` TP$p@pt -L MT20T26 00%0,80H0,0 ,00C\ 0  "!0 00 5C& | 0 "!L%0T%0 RI`T ,$PpU 0SSW`,P 4P$U  R00R\ Y $0ST20CT2003 `4 @0 p0b@0 L @0 倠0 `#> 00ZF 3Z5 0L0#3@ 000V#@0@0C\ 0  "!x0 00 d3C& \ 0 "!,38  Q M0Sp R000R!B6S0 !0^p@P "Q 00c0 C20000#:26K0(2@ 00 "0pV2@0@0C\ 0!!  0!C6000 "!1  Q M$0S`I 04 0hB lp2  h˜0l \Z0 00 0@ 000!V @0@0C\ 0!!  0 C6000 "!L0X  Q ;M@$0S 1M_c_c_c_c0 -LM`@(0 S4p8PP 0$01l00<@ ,0 00 00C 00$@202LP0080004 -LMlhBP p2`   h2lP ,V5 <0 @ ȕ10C S1 !@] T 0 0 m}UTph• lp2  h2 l,?> 0D <@0 Tp -LM`0Vp0P^0 QhBlp2 h2 l,3 `VZ00h0UE0S  -LMh@ lp2  h2 l,3 h$ -L$M`%% 0 0 < p D8PP, @ P@ $4D@08 8 2 00 $0880, T4  ,K4 <0 ,0P @, 4040<0<@  D240<0,  0 0 4 0 22$p<!,\10LP0,0,0, ,0 ,0,Q,0$p 000808hBlp2 hš0l \0S ,1 R) A00C\ 0  "!0 00 0C&  0 "!0 0 RKP@Ạ| ၠt0 l0 ,!}  ,(0_c_c=_c_c0$Mb0 0  Q-L 0S S 0SQ 0 0 *뜻-0#1? $ˀR 4    R 0 0 0 !1?0 P 0SP-(0,#1? &̀R, 6 0 0, R000000 !1?0 P (0S,P0@-@D 0 hPR 0@V0x p0t0@5K 0- @LP 0 00@P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00hJ_c_c_c_c0 -L M0"`@0TP, > ,00@ R :Ppl Y4 cP0 _ 80 0$,S03( 00 0*  Y <t!<00  YP3A!P 000P0P0C\ 0  "!|0 00 h1C& ` 0 "!0WPS  @ $0S U0, 0-HHh@ P 0P00ܝbQP0P0C\ 0  "!x0 00 d0C& \ 0 "!08 0 R }H(a_c_c_c_c0 p-QLM@`PpT 00 @DRT0  0 @DRTʃ0p -LM@}QP 0h -Lڱ 9R 9R9 RR 88R" 8R 8R 8RU 8U!0IPPS񟗉PhB lp2  h—l 0\0ISh— lp2  h2l , hB lp2  h—l 0hB lp2  h—l 00 SN0\< C00By 0( <25(  4p0< ^000P @<0 8@0*Q< `0!< 0"PR < 0A,(0"A 0 P4p <0 @ 000` 0@00( 40 , 84 09000C\ 0  "!0 00 t0C& l 0 "!0H 0 RoA0 $oi_c_c_c_c000 0P  -LM園P  0 @ 0SS* hB00C\ 0  "!40 00 2C&  0 "!0!0 RoOA004p090L`40S_ 00C\l 0  "!\0 00 H1C& @ 0 "!0!0 R6XS@ 000I0( 90 @0@0C\ 0  "!0 00 x0C& p 0 "!0L 0 Ro@@ `40S _c_c_c_c0L p-LM 0@<0`0@`P 0004bP0P0C& R 00#!t000 `0C& X 0 "!04 0 Rp@_c_c_c_c0 0-0L@P80hD -`V`V` pP0UL`p` k@ᏹd 0s0S APP U "hpldpkakat| -LM@{0 00\ hx 0- 8x 8#T0%PLT0AT 0S 0Z 8R(0 4 kapka - 8h LM8#0!P @0 A0T S  {0S  kapka -L M @ 6@m0 -L M@ 0@m0 -LMD0`#((0"t1'ATw T0StȀ40 <8dpp 88#0 p霼WEV0 0-@0P @L ;P 0000P0U -LM0s@S* 00 0000 -LMⴁq`PU @!0@P^PU $00<0$0@T0 P8:00/ P@0T,1pP, a00/TU# 9T0pD UA DA Da0DSR `TWpD@T7pD0s" @00DR Sa0D_TS7ToPOPP tPTP P xPXPP@(0Ppaqaa da0 -LM||`P0Ulp@ᱭ0T UPe + PUP0U00 P 0-@PLP  0S cP  P h 00C0\@P 0SU00h_0 qPPdp 0-L1L0@S8!0CQG!0D]S' T T T T 00h 00000P@?00 0 0 0hm p@x0 0 S 0CRL000 (00  x0 0 0 lQ 𠱯\ -LMS@ \00S SL L0L L0P 0^0?l 0 0 p-LMP@PLU` ph鈥8`入0 ,$0|Pp`_(,bL -L MP@0T(*$K(pK,`K$$0 N $f , @Q h0( \$0T\ 9(0DS<30T:,0H+\_[_0\DUc -PL`i Hp:P@ 00CS 0} @TR@0Sq Sf SZ 0S 0S 00 m4 S 1!0S 2!8S  Z1Q- 2!8S( 1 RT T U h1Q 2\!8S UP!000@1@忤,1@@DT$@DⷤTC 層 00CS0 00CS0ڸ0 R囤)嗤00  0 00Sv h00S 0So P00S 0Sh Hpfxa|ahataDb\pa0 -LMp0@SSHP S 0S iX 0  nPti T`0 Q00 28 6S Q 000xata 0S00lxaP0pQr  8 80, ,0 0pa|alavaxataaD0<08 pQ(0 0xala|avataa-L0H D0pQ, ,0 0xa|alavahataa 80cR   (0 0 0xalavataa p-LMHP@ # D T h0\ `` T` T0V D0\ P00pP 0 0-@@L08PS0S00000 - 0L@TT xP\ lp`bXd0 4P 0S<00h]p hVcc a48H 0-\L@P 2S P(+0P2 00\ p-LM`P`@2S@T<phPT0"2 000p -LM@ K;40S0:00A0 R0  d_ p-LM`@PP  0S  pݧP   -LM@ P0K  0 -0 SLP` :S0 `0SZ @ p2bS@TP t0`0`p0@2S @T:0T0 P0$ꍧPa -LMP`@V 0FS \oiP odתp0S  SP逆 -L M0PS` :S0 `0SY @0P , 0`K p R2S@TP- xW0`p0@2S @T:0T0 P0(NPx -0LM pR K >TP@`2S@PT P Wp ( -0L Mt`, p0 @–R\ ,0K@T00 ,0 S1051P5ꄇa -PLPM`\p 0K@  0SV 000鄇a -L1L`MD0 PP(0 `pl KpKt KpP 1l R*t0S@hK 0@@ (0S (l RW xK| K0P x| P@hK0@@ ,0a0d 0-LM(P@ 0@?0鄇a-00 Cꄇa -L\ 鈇a - 0L0S 鈇a -L\   鈇a -L\ꈇa -LM$@T鈇a -L\ 鈇a -0L0Sꈇa -L@PMK!P 0Q0SH 0 90 RX7PT因P噠H喠@哠<<0 4占DUctavaal\laa p-LM`P pP@0T:tPt@0T*doP 0 @T:@p0bP 0 @T:p4\_[_pa -LM@KP -LM KPK -0 SL 0  -L \   00 -L MaPhBKP Y PS@KCP QP,2,)X( -T LM@HT 00  (0R ԟ|x̍a4 0 0| P-PL` @T pP 0S @TP@ 0P0`0 000 $m靟0SLtXԼ -p`L@PTp ^P 0S0W: ` @Thx 00h 0-LMl@0S`0hfXdPU I@P@D ,, @T PU0pDg -LM@0h 0-LMPKP@@&  h0 0-pPL0S`00S @.0 . 0 @T0(000t0 t -0LM@`TPp P 0.S 0U:R0>0>0Up1 @TW 0@t -LM0PhS` /S+ bS` `$pK 0S 1@x $ h属$ BPX @ @0f0P,`lSvava 0-LMQ@<00CS  0 q0-0P0K0,0 qPT Q 0QP0 R000(P$0.a . -40LM @R hf b(a_ 00Cs0 -@L`0 SpP 00L S0 @0V0 0S0 S@P 0 a0CSa0RS-P@a@0a S_R@ zTh`80S @SX S 0 SR@ RP` @` P@K0KP0 `KP | tp ` P x ;P0@``0 R` Pa(a -LMO, ,00 !05!h]4 -LMr@W,1R2p U8`40: ?㳀Ϡ@4/00 000E ->PP( 0 S|0 0t0@0l05\!u$ U? ? ꜭ" -L3 S   -0L"R"0 03S p- @LM`0P001``0`0C& R 00#!p000 \0C& T 0 "!00 0 Rpph%_c_c_c_c0 -*.0PrLR`L\"0H@Tx"$@T2S -LM@  000h -H3L M 80LbP5(3, /003 *.0 \"0T2   0""H0T" 0T" 0T"  0T0" T2SHB0h" T0`" T-.0d" T" 0Tx" 0T*.0\"A0 TP@`"0 PTU@4pK 2P@|"0 PTU@4!40*N000x" T0\"0 T0   PP"0 T0" T2S0\"0 T% @ %5;5H0 ,0S P,:|" 0To0a$ -LM5=@S 2/0Q{ @T 0S0000! B!1p <Pf? ˜2 \$Z  Pb0᭟0 (<U!<3?"PH1    Q $q*.LBPb0P\"0T 0 0Xl"0T%8p"0%\Tt"0T*.0\"0T00("Q 0 80 %(l5;5'0 -LMLbP@*^0B0\" Tx" $1 )Rc 0\"0 Tp1p!”0"c\TM , K 4+[0[^0'0c "*1-.0a0` 0 A S0AĀ \!p0^:-0^* L("(P+ [ 00C0Q0ԇh"0C0 T0)S 0< 000, KNP -LMLrPP8`*N0\"0 Tx" $  0x" T40  x"$ 0 x"Tx"  0T  2 R; 1l00l02S' *.0\"0 T x" $" $" $" $l00l0p" $@Z l" $ T@t00t0x 5 x ;D %500C(0 $1*.0P"LB, P\"0,T0 0 0Xl"0,T%8p"0,%\Tt"0,T*.0\"0,TX0?("P< 00 %`l" $p00p0 -2吂LM|2Q`@PpzX"Q]*P2QH H2Q* 0L”PP\"0`PTL2Ph"$$0 0L”\"P0Tp#00L”Pt"$@ 06 -8*.P@0LB``LP\"0TL•P`"0TL2p"P$ ?00S SL•0Pp"TL2Pt"$ 0L•@0Pt"TLBP`"0TL•\"P0T -LLPP0 TL2P $L2@P @$@T# T pL• P0_Th h0噀d`@ 0@⛀ThT T$p0@#pp4# -@LMA/0000(1$@00 ` 00 @ p0@,@ P0C@0 P`Y@ 00#!0 00 t0C& l 0 "!8H 0,0 R갤a_c_c_c(a_c0 -LCM0KoK,0 A!1IK ȡAT@#!1 A00! 0 0 B␑0 p@P000V   0 0 0 P0U 00! 0`P0oC@0 0\ 1` 0  "!0 00 0C&  0 "!hx 00 R [/PU$0 ,0S @,lu0aaa_c_c_c8a_c0 -< L0S h0ahr긥aa0 ḥa -LM@LHD@ 0-@PLT:0T: p-LM`PU p@ r r 00 0   PP͖PʖH0   R00܍aaaa80aa0aa 88#PG-Ax= p0 0C`[%[0 bvb3. P+pg "+!U! ˠ  @ 0,ˠ . 0# 0# 0#0#0#0&, H!0x aM -84LM RpdBP0K 0 ,0v4 0ca bP`\lQa P P!88S Q4  40@040 4`@`4`  4 @ 4 40040 4C0 04`0b`C24` S0c0S 4  R2P@ b2`8` b0 0Ÿ0 Q00L"Q2Qc pP40|Ÿ04`0q-cpP(2 @2 bB&! 02 S41b1 R0PP00P!@00C\ 0!!h1l 0P!C6000 "!1(  Q& $?R >P$@X A<40 S:<04p<@P`40\ 0L 00x0K0P@> L\ ` d Fȥa_c_ca_c_c0aaa -LMPp` @ၐ (K0P@ X( H0 (00(00 -00L9$0 mV0 aaa -0LM||p@P!f0  P 0T P0U$  kP (aaa - L| .601 R 0S R R @ :0Saa0S R00  -PPp Lp(Q  )  -PL@ PRT1TAP1 `D1 lB&! 02 S:ʂ1b R0 0000 p`00C\ 0  "!0 00 0C&  0 "!0d 0 RH:`>0 0a_c_caa_c_c0 0-LM0@99 90:RP9 HP0SP U P09P[?09P 09<9 0@9@0909 09090909090@909 040 0$ 0 PR0a/K -0LMR`(0 P1 HP0SP U (PsP5 ||=P @ pP  @yP   @q0 PR(Ka/0/( G-M1vΌ \0000 0c?0cll0 Lb1a/"ba0l A ?#όO$/LNpBNa|P0PP 12c!b  <`C<2c2c!dV!B0 Ѝ*Q989QA0!0Q0CZ 0-LMP@0l0C0K00K00K0 0K0 0K 0K0K Kz0@-0 @  0@- 049 0@ 48<0 0@ 4 8<0 0 $*000 0-PL@ᇅ 0h -L M, 0@000 0 $0T` p,?*Z2V/00Ǵ`0㸑 P Sa $$$$$$$$$$$$$$$$$$$$$$$$$$82P`V  0p0@00T:$0 p`,, 0S000  $0,0  00a 0 P22P2pf`0pf `㜐 fP2 2P0P[ aa -0L@dap SLP$0  ("Q *0$00 0 e0b 000  s 0W0 00000`PCpP 嚄2P0`P[<aa p-L M$0P" ` a d庎!0S$0  S! 0@0  $0dp$0 p[0@-0 @P $0(,# 0000CP 0$ 0x00 p-LM0@S`P0- P$ P00 |00 0 0000p|PlP P0 0 |00  |PH O@- @ 0p`P$4@(8, 0U`00C\ 0  "!0 00 4C&  0 "!0$0 RC 0@$0,0p,  'PP ,U  R0   @0 S@0t`0@0 0t`93@0P00K P00PH00d0 /0  0P 48<@lP0O, 8X1Sl 0 0 R[040 4 4 4PL0PG9#6!,8 R       2, 4P1d @_R ,0<00S, <00<0,C(28 ,04,IP@ ,0 ,0!,04,,,@ @ 0a4K/ P,BX09AT40 ` !PU( A 0K0PP0 H@00S(,0P0 |F,0| ,y|,s|  :;3p<@a_c_ca_c_c02aaLb 8\ 0000t   0-@ P L@P00 4 0 0 D0s 0s 0s(0s00s0s0 s 800CSTdddd0s -LM @  @p -LDM`p(P0|@0  90:#:0* 0 0 8 l P 0H0l 0 80S 0@0D0L $ 8002@ 00"Q0d 00 2@00C\ 0  "!X0 00 D2C& < 0 "! "0"0 Rr 0P Kh0 `0KX0 @0h@0d @0 8KX0K< H 00 4 ,@ ` \ T D PH0;c@`1x! P0d @0c\!,!C610# R841c1 Rd 0d d 00 0@00C\ 0  "!0 00 0C&  0 "!X0d  QN Ld2  1d \_c_ca_c_c0aaa -L4Mp4 0 0 S8 o 400D0 0S*80 004lL D0 0ᭃ40  H 0b`VpX01W@ P<0 OTS<` Lp00S= ,K0H 0pLP,H @0<@0cS@1W'@0H4 H@ 0Sp 48 l0R ,W4 0STD0 R, 000002@ 00\00 `0 Ÿ@00C\ 0  "!0 00 2C&  0 "!P\"00 R|0 3R@n @0T  0 3R8 l0SH 0@,@K0 @31p 1@ 1 bB&! 02 S4X1b1 R0``00` @00C\ 0  "!0 00 0C&  0 "!0  Q# l!18 l0S` 0`SV_c_ca_c_c0aaa -LM00Q   0ZzfE -PL0@ Qp`:@#R D3S`D3@#0CD30  GP?< p-<1LM@\`0=S`L RB?   BR R3 P0S&0S V0/0000 ?2΄ !B00Xp?` `! P2 BP~P  -LDM4 00 080 8ȟ8@P 00H 4(P`00D L0 P0 00 \HdȟP00C\ 0  "!00 00 8C&  0 "!'00 R7'70c40S@3H 0#2 PL0 P P'P80BD'D70^ l0 4 Po ^PU \d*!lD2!X0  @00@04   00U \F*!l1!e@X0P @00@04 000  , 0 0 0>.0 N^@PT \*l,1 @e00  0000   \*!l0!X0  @00@04 00,00S0c,00,i0CFGH p-L$M@P0`   K0`P0Sp -LsM , `Dܡ  ! 1 儀 |` KpPPȁ ́ @80S P104 ,0S p,V0 0PPT0@ 0 0PP`@K 40PPoP  KPPC[B \*D 0@xPP#[@P2S@ Tw С 0J0C p Dq@!TpAkK1 0 jK! . . R l>K! \33 5 Ƞ P!>Km kK1.0Q@ pb 00Cpp!@Dq1T#[@T; 20CS0D555555ȑY: 01 bpnKoK  m?KPH\5 :0\*  b 0 0b$10#[1 @T0 0X *ܡ  P PipH0!>0kK1 ̑  c. . j?K!#[ ̑ -0a -L,M 0 D 0 ) K3S`@ gP1D RBBX)p  0@tP@01 1PP"0PS@ UH3 410  03@ 0 @!P P) [R0 0S2 @ TD 00KP00T00ST)0[002PU52 0C4 < 8 @S%8d9d9d9\::8K 40K 0>0Q`P 1.*!a!00`G/ 0B!0b0!P PPP0Q*!a!00` 10G?  B0 P P0PpH -h5hL$MGNSGPPnPTXu=(-땈]ş00S 0 0D 0 `8 R08 P<0 < D0嬔0S0 0$@`D0|4 ,0p4 1 1d4 l`\ ` vH N@ NP@/ 0P744 $0q5 0O0`V000#3@p@A QY@Q0@00 K30K@cFF_Pp00 0rTP@`0*`2880`d ,3 >0L!C))uRB`0S P0SB"P 000EGP0P0C\ 0  "!p0 00 \2C& T 0 "!00"0 R  tO Ÿ|0  nP@#0S P0 !@G0S;10S@Pa @09@00 PPX 00 8A@04q0@0/0  P 0 @00@0 0 Pq E(aaM4aaa,a a0aTa!2Xoa a caaħa8XcVc _c_c_c_c00a,aRda,!Db<b aaaa4$0@UHT U\lTtPa -aZ 0000Z#0 P0 P0 P0 P0 P pjF@;0PK0K30PK! Zv,1@0@ ;<1@Hs -@ LHM0, X 00 TK0P0 T ( P0 S$ llD -LK/K KT1 l < dQ 0P 8P XQ HP Ppd-H0P @` D P P R   R?0@SD䌟< P 0 b0#60`00\ 0. "&0 P0>0#60X  T00Ppe42OK2cX2 T2( 2 KX"P2<$PU  PO R & |1S0# 42 ^x42  0> Pp p@00@0, p0) 1,   R ,07,02 ,0<,00  0  ,0b&P'>ML"p 0@Gy G<,0S KP:<X"H2 K( <P.,0 '?l 1S H R < S <H0 3  @0S@0[30@0S,06,0K < l?  ),06,0%@(00050 00000 0  0\T@00C\ 0  "!h0 00 T4C& L 0 "!0($0 RW _U PC ,0@7<,0Lw2` 0" 2 0 " 082 @0S/KK 82 3VPpH:( KPpD 0@ Pp#H@"D00D082帀8"82@"82$ 8(00(08",00C,08(0,`VŻ0<p 8@vt"0Q]8\F 2 @ 0 b2B&! 02 SC1b1 R08008  Q@00C\ 0  "!x0 00 d1C& \ 0 "!08!0 R (:LL"p 0'P  'L< 80Rg 0Rc0R,07^_0H,0!0SF00C j ? a!a__ca_caa_c_c0Db,Z3 -LMp$K4 ,@P  `@ PT4(  01 B10R,0 P@( ,K Q'00K@8,zP4( 0,0 B0RP,0 ( 4K  ǫP@"`V@J,K ἫQ'00K@,UP0 ,0`V0P,0 Z  㦫@P  -LM40H<`N@~VpNP0p p@ H<. <0@R p` @@0SS< *됐<(KL <0x !0 `` `V D 0,+\(00, 0HYSU -L  -LM40`S  ,0 0I,0\*;,00 (1!333D @0S  8 0R10<0<0<0 Q 0 0 0S0 0 0`T@ T Pr.LP,0 + UU@,0"[V? \H [\0 F\H50Gv|0 G, H@H@,0 1gT0S' , H@(0S B H@.,0f$1@@\1@H0Sh`.., P |0S P0000DmExPwP  A >H,0Z.B6A$ P`aa,a(a$ 0-\P@LTF08 S8008< @@P` @@.00 000$0 04 0700700- R  P0ES,h 0 0S  0  0X]0d} 00 * \Lm 0 0CQ 00#!000 =C&  0 "!0,0 R4\ 00C` 0t< 0000000 h<0 S- 0& $,8L00C\ 0  "!0 00 ;C&  0 "!0+0 R0 0S 0S090(0` V 00 0 0@& 0P0C` 0 0 M``0000 0S J1S 1 8C( !!090 000~ 0S{ G(x0 S0 S$00 wJ) J00C\ 0  "!0 00 9C&  0 "!0)0 R f0 0S  0 0S%, 0 Y0y 00 * \i 0 0CQ 00#!000 8C&  0 "!0(0 R!\ 00C` 0(8 00000, :R0\ 0g0w 00S0 * \W 0 0CQ 00#!000 7C& | 0 "!0X'0 R\ 00C` 06 00000V:0090   1S01 10S0  00 0 0@Y% 0P0C` 0 M`0S0 0,` Vgv 00 0 0@9% 0P0C` 0W 0 M`@1S `G101@ 1S1 ;0 S0 0SL0S00C0 0 0S0 e0:0F 0T0t 0P* \d 0 0CQ 00#!000 T4C& L 0 "!0($0 R \ 00C` 03 00000V:20`S 00 0 0@$ 0P0C` 0 M`0S0Sr0o 0Sl |&i0 Sv0 n 0`0C1S 0 0S 0   H!1S !10C1!R0 S0S00C00 0Sl  0 0S 0SO qa0 0S P* Q Q00C\ 0!!  0!C6000 "!0T!0 RTQ`10   090 00 !!0`  P090 0@#P`  0 0S 0SVM`0S 0S0 Su(a_c_cpp@ _c_c0@ 0Pp -LM0@S0  !p(B(I0XTI0 0S 4hI(I I 0@H\h -P3LMP< PP PPpp3 !g 3!0B0^0`4 \>0NÃ0G@ă. B&, "00 0, ŸL YPPG "0 0cC61 Tp,@ @ 0 d R0 d 0S P00B00C\ 0  "!0 00 1C&  0 "!0!0 RF* L1\A00C\ 0  "!(0 00 1C&  0 "!0 0 RF@PppZ P P ppT P p pP P  P P p pH PppDPPpp>Ppp:_ca_c0, caa_c_c0 -P1Pq L1 bB&!<1`LP 01Aa  S 00S0PP@00`0P0C\ 0  "!0 00 0C&  0 "!0h 0 Rh H0& @`0a_ca_ca_c_c00,h0@-0`S\PX0 Q?#/0 IS0B!@R !R %504,8,<,_ p-LM`xPL 0K !`6 KPH0@@<0 @00@ 0pU4,|_0,aaa -L0à PP PP @P@ P P   P   P  P P   P  PPP0000( 0 S000(a 0 0 c-  R 00K0S00 00 -0 11LM@ `q P00`c Q 00`p|0 P  \0D  0 P  #N(a" -L$M00 `5P00Qp6 Q< , 4 00 F$$%`0  00 4@005000$@ 00000004`00C\ 0  "!0 00 |4C& t 0 "!D$0L$0 R0Dp40,p0 80 S 08 a R 0007 0D @0 @000$;T0 H 0S8<01<0S1 D HR00  CP4 004;00L",0#p0  00  4@0"@ 00  000002p00C\ 0  "!|0 00 h2C& ` 0 "!02<  QuH  10C10   4 R 4 <0 C 0l   40 l\S 0Sl 800S80 UPH!0@ < 01Q 007000400+ !@00C\ 0  "!0 00 0C&  0 "!0  Q400500d!',0/ , P(a_c_c_c_c0 -LM;t@I 000a!Ce -LM\0@Sh=Q0a<0S8<0 p-L MQ/|A`"t1) ``@TA?#)H1 @0Q?# $1@)0!S 0S0CP @ 0Y@@t: 0H@@l: 0P@@d: 0@@\: 00@@T:t p0@`K:paaaaa,aaa-a`aaaaHa -1L 1 !@PT 0S[ @TpAp1pp  0 S `00D Dp00C\ 0  "!0 00 0C&  0 "!0 0 R@T 0S @THP0S00``T ) )`Taa_c_ca_c_c0 -LM@ 00S 0,00P 4 RHP(a<0 40 P 40 S8Paa<0 40 P 0 SPa,a -LPp@P`$ D1P   D@ RD0D0D0 D0S Da0S@0 @0D00PD0^4P P f:T` D1 000p00! R00!`00a 0 10P?: 0  (D1@ ^L,00,0 @aa,aa -LM@ @RD0D0D0 D0S 0D1 -LM 0@ `R x0S0x0 R000 00CS0 h,; *;aa -H0PDLQ@p ` 0S T@T DQ 0S L@T100CSW00000CS0 R00000CS0 -LM@T  10S @@T@R ) & @@T -LM1`NP,@Kp0 @9,4 0> 0L | @ t2Lx p@000P<BN<21$DhQ -LM0Sn0Hb0 R 0R  R RmPPw 2nP@g ^aPT T 10HPS 14 T *gB0nS& aS @0(T00S1@TL1 h MBwS0S! P$$D1 1U4pP,0p0 R 0S΄ 0 !B 0BwP 0d 0B|BxBtApiAa(aa,b08HPt<``400H400D00 0-LQ@P 40Q P DD1 R 000D 0-LQ@P 40Q P DD1  Q 0 0P 40000D000,0700 000 0-L0\0P   0@\!:[P@0 p-LMD14@ Q ` APU  p4K400p p-LMP`U6P1 40P. P@ PpDD1  Q p,0  0 R U4P 40U phP D1  Q pD@p -0P` QL@p pT  `X  ژWV  -LMPup@`S 0UP u 0U 0 U 0U P>v 0V 0 V 0V P-w 0W 0 W 0W Pu U SPPv 0V `w 0Wp,0<,0v 0 Vw 0W -0P`QL  @p WpT  O`X  HWV  -LMPup@`D 0UA u 0U 0 U 0U fP/v 0V 0 V 0V UPw 0W 0 W 0W DP u Pv i`wp,0<,0v 0 Vw 0W -L M|   0\   Kq@ T00 0 T -L M|   0\   Kq@ T00 0 T p-LMP`@0S ( T 0T 0T P0T P T DA@@@,0<,0p R0Sp p-LMP@ `0S 0T 0T P @,0<,0p p-LMP`@0S ! T 0T 0T oP0T fP @@@,0<,0p R0Sp p-LMP@ `0S 0T 0T <P d@,0<,0p -Lp`@'PPUK!XP P,0<,00 R*0SR:0 0S 000 ZP -LMP5P@ C00a 00CS0t6a 0-0LSP P @aG000 0-L@P PRG000 0R0 D1 g 0-LP@P0 0D ?P,0  0"R   0-L0QP)@1 Q 0P P0@ )T 0D000Q^0 0P |0 Q P 0T@PD P ( 0@T@PP2a -LM0SP`p5 S P@ T  <@S0S0 0@T 0 0 S @TW pPD @T   @@TpPa p-LM`0PQ \ 0 0Q \ p !UP0UP0PUP40@ PP0000"P0P0C\ 0  "!0 00 l0C& d 0 "!0@ 0 Rp p2_c_c_c_c0 p-LM0(@KP `ᲔP0  p0 -QLMp@G P0 S  0R`0S  0REP,` Rڐ0V 0GSH  (((4HL10S0S0P 0R W   Q0 PQ0ba>0>0  00ab0PP0<@0 /000B04 PD,L, 0S   -L8C8$M`,PPKS``@KC\, 0 40  0  "!0 00 2C&  0 "!0x"0 RPK@K 0 @0@0 ,@4 00pR000 00 2H@K\1 pǏLpPKM20S@#-Q QPn`3% AP KW/ A0@PpK- A"M2 0S @##mSPU`!q p0奎 @K3' A A,@  A4pW 8<@K  P à ]C@TPa`~ pà&A@K0 A4@@pK sAl@B_c_c_c_c0̪a 0-LP| 0\@ H 0h靓00H@0@- @P0P=9@ =C 0 0P=9@ =C0 0 S  0 \00Z0?B p-L Mp`@PT 0X L2@ ,D0 0 pP0000_0a - 00CS030a@-H1HAHQ0 `0Q000(!00q`00 C \  0  "!0 00 0C&  0 "!0 0 R@Ed0^  00lS R00_c_cT,X,_c_c0p@- A 1 a0P0 0C ^0 00 0 S0  0S00`P00C\ 0  "!x0 00 d0C& \ 0 "!08 0 Rpp@T,_c_cX,_c_c0,0 P 0SPX, -LMP`p P@@ 0R,0 jXW\,(0 R0S R\, - L0 Pu8  -LM0S7 䀟` PRp@ f  *P` RU@ 0PSU00000  \rU@0S\, a@-x0 p \ @ 0S \00  0  0@ a\,0@-P@Q9 P7 SM ,0 4 ^-DDD||||||D||||DD|DD||DD|||||||DD Q \ 0 Q \ 00 0Q Q \ \ 0 Q \ 0D!D 0S -L M$$@ O 0@.0-a 0-LP 0$O/@4B0810a$0$0$ 81081 0-$0L8!PR @$@0$ 810CS810$01a -L M@PD^`$P T T,pKX* !, 0 $ (0 1 $ 1$00$0 1$00$0  1$0@0$0 T  0000 0PP iP , $00$0 $0 0$0 A-P2Pr0@$01 0PAa0!000U8<0b 0110 010@ 1 10 0 10110 010110 01Q d1!4 Q21U 01(10(1,1 0,1(A00C\ 0  "!0 00 0C&  0 "!0 0 RA(1 0(1 R,100,0,000,040S 0 0S ,07,0,07_c_cd,_c_c0D- 1B#20R00S(1 1(1Rd, p-LM@,$PP `B @,1 0,1! P(1 0(1101 !,1S0 1,07,0P RPpd, 0-L$((10 0P000S; 3S* P@00C\ 0  "!0 00 0C&  0 "!0| 0 R00$!8< $!S08<$1 $10_c_c_c_c010 0-LM$@$!1!010P8<$1 J0PP 08 0-LM$@P1 10 1Q#P0 K P0 1101  !00 S 101 !01  ! 01 K 0 ! 1 0 AP 0-LM$@P1 10 1Q"P0 PK 㨎P0 1101  !0 S1%Fτ"0#1%( 3(F P -@LQPp% RP` @ 0PTr 0 R0 b0h -LMPS`p$ $1@T 40S@TX, Ġ T\0P V RD@T 40S@@T,  0P V 100CS|Pa P-Lp`P# #` lP @T U 0 V  V 00V U U U @@T7P@ U 0 V V 00V U U Uhi -PLM@' P h p-PLM`P @T U,0 ,0  @@Tp@ -L M,A P`p$@,10(,q$ai%0$!<  < $!@ !$10$1! ,1V0,1 0!(10(101d, -LM@,`ZmGt G, 0F s(1\$1,10  "0S00ć D1 RF 1381P1%711, 0Z1 HH20  10S] S. 2 T2  B0 0C\ 0  "!0 00 1C&  0 "!0!0 Ro,   V! ^ U 1010S  5,0H0Z101Z 0S010P.02S200ć,   20Z00S,10Z00S H1,0V/`1 5^ 10Smd,2_c_c(a]a_c_c0 -L`$!,13P & >!(0@ !, , $!> S_ $0" 1 S S  |41 0140SB  D1 RHV?, 1 B"P0000JP0P0C\ 0  "!0 00 1C&  0 "!0|!0 R 0A01V0 P000, =HpC P00C\ 0  "!0 00 0C&  0 "!0| 0 R, _ P\ 0@$!@101Wq$W2d,@_c_c_c_c0L, H*010,  -1LMP@0! p$@ !$1S0,0 ,1(00 0100 ,0 Y`a 10  101$1$  $!1  ,1V0,1 01!(1 0(101q00C\ 0  "!0 00 0C&  0 "!0 0 R0 <  < $ Q001$1(1,1000,00 0 ޾o(a_c_cd,_c_c0 0-P@L4 0$14 3 0h`x 0-LX, 0*00D0, !@P 0h&$0$PPZd, -#LIM0,  ,0 `  006:D R @0S pß,0 S `,N00A  D@K 0Q0P0Q  01#p30K- 0 @ ` Pp o괐JK  0Pp80S p T0 @TW \, $164d JK;P@CK0 0 JK 0 !L000Y/;L]0 pK|p =$tp $1|@K\0 (!Tp X 06P0 &L  Ơ0H בPp|0S'T@L0TJT@ P ,0  Ppp P`;Pp L0T@&@,H0P "b 0 pp`&p  0!Ppx, P@7[0  pPPp*,  (0 R"0abZ, - LN -LM@P`p6T0EP@ST:\:\:\:T:\:T:T:\:\:\:\:\:\:\:\:\:\:\:\:\:\:p $ 1 01410(a4 1S01 Q0 0 0S00 0S 00 0 P -QLp`0S @PU 0 0C W0SUP!P P 0 e00 0@epe0 S1P 0 0S ᧉ $ 0-LM0PS- 0SC)@ 0R0 0S S 0 B0 0@0@ 00 K` lP 00 P0-LP@T*@T:P 0S* !0S:0D00|/ -L@`p PP0 Vp P  00 00S0@ R0000 0  p-LMP @T @Tpp@T ` R0000 0 V@TT 0- L@PcP( 0 S600- $0R0000 0 0- -(1(qLM0 P P 3a@T @T@00C\ 0  "!0 00 0C&  0 "!0d 0 Riѻ0`@T @T_c_c-_c_c0 -@ML0(( I@ 0I@aa -LDM0`SP\` p} 0B Sw!XKˇP@BX00C SeA@CHCPChCXC`ChCpCxCT0圡 S PC\ | P@`!X)\`0 \KA0TK 0 @Q X T  Q  @ \ 0 P@  \K kP@`\XTP-D@P@{Cap  tL` -LGM<\, P`p @ 0B9S9 ED EDDDDDDDDDDDDDDDDDDDDDD EDDDD EDDDD ED EDDD EDDDDD E E E E E ED EDD E,0 S , 0BES񟗳HF`FhFFFFFFFTGGGGKHLHHHHH<:04,4 0ğ0 L@nP00W00SP 3 0u 0p3cßqßoßm3 ̠|ße 0[ 0V0 S<0U KOKԛ `PP3Q 2R  04L 0@^2 2 (2 "0L 0^X"T"P"(2^ 2R  0kL 0*ANK 08 PP8!0BSR L 0@wx!t!p!l1 Ϡ7L 0{eL 0^L 0W  0R 0PPdL 0E?-= A0alll aaa aa aaal113a,aa0ԪabXa8aH-0,,.aa4bDa$2 -L M@ \QP@@ 0L S,MLMTMpM|MMMMM8N@N\NN1 -1!0 1!06!0 0b6 :PD10S<1 P$1$!l0   A 0@@00S $KP $0-阀0S p0 pP0dSd00SV ,a_Vc!_ c -,ba$-$aa- p-LMP@`  0STRPPP  ̄0T0\00S p @p p -PLM0 @ 0 SR0 \K  0 @0@-RM@P 0-P\ \Ѝ0Ѝ0@ p-LMP@`  0STRPPP  j0T0\00S p ރp p M-PL0@ 0 SR0 \  0 <@ -LMP  -LMP -LPp` @4U  0S*T S 0Z030#WQ$U T 0S: 0W0P00S m0 00@SC 00@C -L@`pPI4T 0 S:U T   p-LMP@`P  0S:T\P P ᤃ 0T0R00Sp  p p 0-PL@P 0 S:R 0\  wP -LMP@p`& V00P _P P`FU@ /V0 0`F PP0@PU0h00h  002y?괬aa -L$MR, 4 00 8 p04pS,H0 D Q ^0S`@0  P4 2< @T 10S UfPXV`XpXXXXlW40S$ @T< R < 82 ,0S D  0cR0  080S M4 R G D00 R= 0H0S @0WSD00D0 4X 1/#4 ƂP@  Bph@ BW*D B.D 8L Y/㰂PY8/㩂PBB~G,0 D1 RD1 0S 40,0 D1 0Sl00 Q0 Q Q0 SSPS ``@ 8 T0aa p-LMPD1`   @P 0.31 0BRSo1 @0S1c 0($0$!018,C/S3 X"10C1H0S40\2D1 ?`"D, ?  R; l0h2x0S0 1l2|0p20@SD1  Q020Q.0 @@ =/@@ |B.0 @-0/@P P0p0h2,0x@S$A,A0A8ACA.XB,b{ -LM 0.  0 @( 00@ 8 $0@ @DH 0PP@\1X@ ` (0@d0, h 40l0H0S40p0D1 0S40t0D1 |@x 0 @ 000 00040J20 -D11=, , D1 R' l00x0S00|0|0@t00 @ 00x ̊ |0B0 n  .0t@! !$1$1(!(!,1,11 3 V/ M? 3 j3 Ne3D1 -1 0BRS01111D 0 R`00`0D 0 R`00`0 R P  =100CS> @0.10S1t 00K z_!08 K0 I, 84001! 0nO 0rϊO 0vO 0~oO Ί 0O  $0冏O !(0O ,0O 00O 40O 80O <0O @0O D0O HP00 TL0@!0S,0 =9C =C0 ,0 , 00 2$"0 10C1,0  0($P!01 !0@ L1@1  00 00!!00  Q0V/@1 20023Z6?B1 -QLTMQ0DSP Y 100CS,0   V 0 00  80K`0 \ H D T P0K p`KX @P <  XK^P`T   40 T T4,0p p0 8 0px x t 1p  0APd l 0xSv*dKt P`sxP K0@@ h0K `0 `0KH \ X0 T D <  XKP`[h0SS  PK:#:Zc0 `KX `p \P T HP D @ <0 XKP`@P@*0S @T:0l00S0*d |P`* d0 T h0d 0h0   `jP` pd0A0 d0 p x0t0Qx0 t lR:0l S: ` 0dKt d0 A`,0  TT070- -LM@ Py0S| b PU ,/PUPhPa2x"@`@  @xL2  rP@U`@ p ,0"S0f"8'V/,0 @ `#14 8  @ 0H $ P ,0X 4 ` <0h D p0L PTpUV00PC 00 A  T 0PU ` ,0 @04 8 0@ 0H$0P ,0X40` <0hD0p0L PT`Uaaa -$-a,b -LM p-LMQP`@ \0  Pph p p-L M\@` Q 0 rppQ0 \"\ 0 1PU P P 80K00,0 &0080pp 0$pp`!H! -LM ğ4^P`@|3^Y 3C03`  S 00C\ 0  "!0 00 3C&  0 "!0d#0 R(`00C\ 0  "!0 00 2C&  0 "!0"0 R۰ٰꌢ20 >  `P0 S0@@0X@0WP ,0!0R,0w  $10r rPUd0Sp  1 @00@0 a0 0C\ 0  "!0 00 l1C& d 0 "!0@!0 R1414!, 0 ,0# =U,0 W U !R ,0 $10 "PU $ E00P#X G0S010\P>x(a_(aa_c_c(a_c_c0(a1\a p- PLM`00@00 R 10S, 4,0;,0@`00C& R 00#!x000 d0C& \ 0 "!08 0 Rpph _c_c_c_c00-SL 2?\ 00S00 0R0(a -1唡LM0 0P0t!0p`@T 0S+ @T4A0 0C\ 0  "!0 00 0C&  0 "!0 0 Ro遯 倀 0`FS10S0S,0夀010 ݊P P000V8_c_c(a_c_c0]a,^_a -L -LM 1r1/AbP( $ (@Kʨ1 RQژQ0P\ 0P1 xb#hh!`(000 b0 0<cQ=9 @ =0 , ,0 0 ,01 Q=9A@ =C`00 0 C\ 0  "!0 00 0C&  0 "!0h 0 RԮ0QMb~aaa_c_ca?B_c_c0 0-LM0PKS@ S e{00޺ 0-LM@P 0PK zPQ Q0C0 0-LM0PSX@ S0 D0  *0QK 0 00'{Pʚ; p-L,M `K@ zP p 81(PK 0@a(0 $ PA0S;иP0˸0P Pp0#PS 8K►4 ,08c00Pc0 A00 , 0 ,0  ,0 c00PcX0 A@ 0@ < <0 @0@KS@P 0Sx x000hhd,0  V?Q1A 11\a]a,^_aD t0< 0 0S0#0(0 R0 21\a]a,^_ p-LMt0@0$S$0# t0P00`00P0P0C& R 00#!000 t0C& l 0 "!0H 0 R01S,0 և Ƈp醥_c_c_c_c01@-@@@@@@0 00 00@L-haxapaa -LM0@S`p>0S,0S00S7  0PS0U 0S PPpU0SiL0h 0T0S <4sp0X- (<@ -QLMp0 4 ( ,  0  Q0$ ` V P0S 0 S 0B8S$P0S`V0 R ,Q $0S PP0,`@08JC8 1!Q4K 08SVhaX-l Q-Lp 0  Q0`V @0S 0 S 0B8S$@0S`VP08JC8 1 !Q 08SZ00ha -LM|P04 H0( 0 `00 ,0 $0 JPp0CHAA0P4K 08S,  -@Pp L4`V 0 h$W  0\- p-LM @`PU 0 php -PLMp 0 QP @@YP` Q0S00C $@@00 PW2  X  0P @0S S $@0SP e 0R0 S0 0R,|0 S00paha -LM`@/PpU PPN 0 S0 (0 @00B 0\! P7$` 0\V@@Tʄ@T@ P fAV 0 !R0,0 < h0V|t, 2S00S   1S Q$DLTx -L P@p0`SZ 0S-QP V`0S S1 $0S R 0(10  0@ & 0A  T1S RR 0000S Q0 0Q B 0 R00$P  pa 0- 0L 0PS-(@ 0 0(0P (@ 0- 0L 0PS-(@ 00(0P (@ 0-$0@SPL @ P4  0@ P0 0h'Lxa -xpL@`T 0P$ R U@U00000 \xa 000da0  B Qda -`pL PR`@ $0S@ P PTpa p-p0LM PR` $0@S T pV V -P Y=pa -QLM@0Q 0AT (00@T,00,0,00CS,0 -0LM@ 00  0@@a-$ R$ $@@0^*$0S $@ @0S:$0S$$$@0^:T T0S$0S$0S$ $@0@ R:^:T T0R$0S82P *0P ": -LM@D 88#| , `0 aPDq <8q004!01`  ,0 0< T` R6Z `T<  B?+$X Z 2 8`0 0,8,@`P P< (0R0(ODlLdlt0  0 aaa P0-LP P0 RD0@T ,P @T000aa -LM@ @000000 -LM00@S(  e  0 Se Rd ` H00< @0 00 0@ ,aaa -LM@ LR 0@00  0 $0 BR  Paaa 400Sh40Ƭ -LM40@0CsP40B ,K⸬h(0, 0ahS00  `=94 = B4 00 p004 0pQ=9A =Cpp 000K Z UPX8@` p@0ʏ 40K*҂H0P@ ,?B T P -1Qp  80PXLH`@ @`P0p0t0p0p0C& R 00#!p000 \0C& T 0 "!00 0 Rk鹟_c_c_c_c0 -LgMℑ 0,0 *$ D!(0("4400@$04 T` 0$q$[@0B*  P0 200-K0P$0*K?K "R .K 2 S0 S |,x0L0 ,0S \,SL00< 644x_0a(adq_0edAX<  -LM ZjP@Z/ 0 00  t|<, R  00SS Z2 0 R$0t$0\t-  0h_a -LM`@pPP  x pP0D 000 0  0@h-h_8 0S00 R0 00  0 p_h_ -LM@PP `Vt QpPk1 ^ 0S^ ^0FS 괵Ե 0 -^6 PP!00D000 0C\ 0  "!0 00 0C&  0 "!0 0 R0 pR^ 0 "^ 0S 0\h_a_c_c_c_c0@@ R4 000 S00 t_|_ -L M8@4^ 0 P>00x_a -(0LM@T @T|_ -L MV, 0 XP. ,PG@0U 0(p$`,` 0 S0 0PE U `, 0 0 X0000  0000 0  #  P@ 0-@LTP  @T000@T R000   00h -SL`P@p0 0+ 00S00C 0pQ  0S W 00CQ 00@@hRW 0R 0000 F0Q 0 R  B 0S00@@P -LM Q @Pp`B: 0VP+  R 0S 0S * R 0  0004 0P  #  -L4M@, `gP0 @`aT@ P T P 0Pp0C08 @8 T@ < 4 H :P 0S*P\ 0S: 0aPP00@P ppLp D ,Q 9*R7 0S# P0@p P0iE0Pe0W 00CB SX 805 :XpW@  0*R8S0#03 BR0SbD0 dR0S f|@R0#03Q0S@ <@ 4  Pp0eP00@TG:P BQ?:,Q< 0S$ p @P00iHh00U 00C SH05 :Q @ B ^X 0 :,^HPS0#03 BR0S8pL0d0f s  *@R0#03^0S@ <@ 4 L@0 0Q\<@4  000 0 P"  0#0P 0 Ph0@8 L 0  -L @`PBpF PI \*PB R?T+ 0T! T U *0DQ 00 pp000R0D 0W  U*00 U R000 Pp  JgD -LM0@`p& PPpU \!0W PP  P @R000 P0`  W p`00C\@ 0  "!0 00 t0C& l 0 "!0H 0 RT00_c_ca_c_c0 p-LM `S 00F  00 R 0  000phA!P 0 00{P0P0C\ 0  "!p0 00 \1C& T 0 "!00!0 R0 p鶚0 0S0 0  @ P 0 00;P0P0C\ 0  "!p0 00 \0C& T 0 "!00 0 R phz_c_ca_c_c0 -PL M@ L 0@@T  @T > d Q0-L@0PA 0R ex0 0 PR0 R P P0000 0S0SS RRaa0aa-0x0 R0  0^0\\00 0RP00aa0 R00a0 aa -3LM0 3P p\`쒟O B00C\ 0  "!0 00 2C&  0 "!0t"0 R'000\  AQ 0 `\ @1@!T ]P` 0Q 0Q`0S釙@0T✑!6@4P` 0R XA00C\ 0 !$1 0!C600! 00#!0 0 RI@00C\ 0 !| 0h C600\  00#!0< 0 R#_c_caa_c_c0 -0@LP0A p 0 Sp) `P00C& R 00#!000 p0C& h 0 "!0D 0 R՘!_c_caa_c_c0 p-LM1@sP` p0800 0< 00 00 0@0C& R 00#!000 l0C& d 0 "!0@ 0 Rꆘ_ca_cl-a_c_c0@-0@0 00Q000 0 S0  0S00@00C\ 0  "!t0 00 `0C& X 0 "!04 0 R@9_c_ca_c_c0<0 A P 0-0@ LRPD0Y!0u 0h00000 <0aaa1 -QL@X F1Q |1Q l1 \\10 Pq 0 Da $PB0 0C\ 0  "!0 00 0C&  0 "!0 0 RU0 PP겗0Q 0Q T 0  0 0S$  00000}ff@wt@a_c_ca_c_c0~fvt00  -0L S@dpD 000000  xx dd PP << (( ( ," _c_c@-0 S@ &  00C& R  0 0#!l000 X0C& P 0 "!0, 0 R@_c_c_c0 0-0LS@P00 > 0R03:00S 00 0 0P000 0 0 p-LM0PS`  0R:0S00p@00@0@-,M@ 0P000^03:0S#\ 0^ *00  0S   @00 00 00 0000,Ѝ0\ 0^ : 00  0S   P0@-0(M @00 Q \ 00  0S  0000 00 0000(Ѝ \ 00  0S@0 -0pS0`0C0D0< L0bD0 R000Q  0S00``80 0C 80 hM@h0p)@0P0  P0P0C\ 0  "!p0 00 \0C& T 0 "!00 0 R Е_c_c__c_c0 -LM `@|V`Pp0S:000 0`0i0@0 0WpUP@ 0  40 Ph 0 `0L 8,0d$pT`DH000P0 RS 0 /">CXh05|%03h05 5P%(PB2|P5p% L`(G`R0<0`LPlP t0RxPPPPPPPPPP 0PP00 X@@XP0\0 @X (0 Pc<<L 0 P[ -a_a|-P_ -LMX @R\0T \0\00X \0 P PQ  Q4Q0 (00  0S00L_|-  p-LMh0|0P` p0@0 0000@0@0C& R` 00#!p000 \0C& T 0 "!00 0 R _c__c_c_c0 -LM`L HpP~ PU2fP@  PUT  L0HL 00T P d0` 0 d0l0HL 000@Tg R0000 0 D H0 B0D H0 R00C0 R000  R 0PP0 00 S  R000 R 0P 0 P0b0D, 0Q0:.0S"0Sd0` 0 0S0P 4+HL P*]`44 0-L(MT0h @ |0Pp0 Spa\h 0 0S0PPP 00C0D00 HD0d0P A H 0d0 R000[0P!04 0S0T0  l0 R000  R 000<00CP 0 R000  R000<Kp 0 S:`PPz -<@LAPPMP`@-P@  gpWT  00V000`F400 R0"40%T i -LM0$(S00pP 0@`p `@ h0) xt 0Q0xxZ0@ 0j@<D00@pD0 0@0 p@@ 0@0 S80p0S800p -D ,0LR@p:PP  `VU  0D, 0Q0:U p0S000 Q0-LP, <@@D ,0R0:0 Q0-PL <@@40 p-LMPH`Q`3:Qq 0L`` <@@gd4p -LM0`S~@0T80  @T,K žPU 8 00R8 K @,1 d@4 $0pLc^=9 =4p 0 00 40SKPX8P LqP R000 bh0p 8PUF @0000@0@0C& R 00#!000 0C&  0 "!0h 0 R D0<,0lS:{-_c_c__c_c0 p-0@LM P0Q00 0S0 00`PP00C& R 00#!x000 d0C& \ 0 "!08 0 Rpph镑_c_cL_|-_c_c0 0-@LP 000DP0P0C& R 00#!p000 \0C& T 0 "!00 0 R00hX_c_c_c_c0 0-LM@PT $ 0@T0t -LM0SPp` cSlSpS0`S(h@ $0`@T,L<D H0V 0Sh 0SL 0S00S7X h0( Z% X"  0,`V  @P PU@Z`VXXHHl\Php| -L MT@0`VP  h0 Q I` 0`BpW 0`V R @3` 00p`*pW{ p-LM@PT`  P@T @T  P@T@T  P@Tp-$00 (0,04800  0-L@PG R0000 0 0 p-LM@`P ,08 0 B8 ,00C ! \0 0pP 0SP00000=PP 0Sp( P `p -LM`pV 80080 0 1R 0 0`V 0SK`V,A,1P    P0P0C\` 0  "!0 00 0C&  0 "!0 0 RViL 40 040 00 ``0S`X_c_cP__c_c0 0-$0LS@P0h( -LMP`Upb 0S 800C80 0B! @P 00S$0SM0SY> 400C40 R000 0 0  R000@ @0@0C\ 0  "!0 00 |0C& t 0 "!0P 0 RZ PЎ(_c_cP__c_c0 d |T -LMR@p R0,0 v nR 0Z0QQP1! 0P00 ,00,0 P U Pxa00C\ 0  "!D0 00 01C& ( 0 "!0!0 R%Y00U00SP P ,K [P `u 0 S %`%!* <RZQPZ00Q0S _c_c|-_c_c0 -LQTpL`0S C3 1@ 0 00@0@0C& R 00#!000 0C&  0 "!0| 0 RZލ0S P _c_c_c_c0 -LTP q 1`   0@ @T d0 .X@T00@0`00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 Rh~d (_c_c_c_c0 -pLP`@XX^\0\0\00X\ 0X0 \\ 0  `\ VV000᥌0 L }0, c0廋0,0  pUHc0宋U -LM@ 0@  IT --LMxP0Sp`A \LH0 R O/\(@ 0@ah\._ -LM@0 HD00S S (S \htOh\p. --!LM AP00`00C 0ppP0P0C& R 00#!000 0C&  0 "!0` 0 R P0\ 0 `pꄌ_c_c_c_c0a p-LM`0@< 4PK0 o0\ u40[S  c0S >\ 0S p0a --1LAMP0` 0ppwP0P0C& R 00#!000 0C&  0 "!0d 0 R T0\ 0 pD_c_c_c_c0a -<1`@P,1Pp  U00SL 10S@Pp00U00S&$10V00S VV 0 RW 0V0Q00Sh]ZT0Q/PW  0U00aa. --L0LM,  D!0 \ (a,0 D1  R000D!  P 00CS0 a -p-LM@TP` 0S 02p )P P` --LM 0 --00LM Q0r -p-LM@XXP 0`@^00@ R `p-.a p-LM@\PX`  0PP=00@ R Pp-.a --0 L M@T@ K ( T0   -L M@@T ( 0 K T0   -L\Mϟt  Y  0R p h P l , 0 h p H X H0 %PP p H0W0H0 X0 0  X0  pX00Y00S 0 H0 0%SSRO HT \  pH d ` H L H L  0BZS1H0X@\hL0LDthh`0 x P`\  \ \  h`d `0V`S`T`T| \ @fT@Dp PX0W0  X0 p X00Y00SP } T@D`Q X  X p X00Y00S` e |\r dh @bT@Dp 0PX0W00  X0 ` p X00Y00SP F T@DhAqh  p P0W P0 X0 0X0 > pX00Y00S & h  Brh T0 \ @fT@Dp PX0W0  X0  p X00Y00SP  T@Dʯ:X ,0S ,MKI\@fT@Dp 0PX0W00  X0  p X00Y00SP  T@Dm(`  #cT ` X0p 0W@0X0  p X00Y00S  XTX p X00Y00SL009L  D@Kx(0`x D0[ Sx  p X0W0  @X0 pX00Y00S v 0S ! x0@Tx0  D !0O0Y XPp <,WX L pX00Y00S O x 0@ TX0W0  X0 1 p X00Y00S@ 6 x0@ Tx x@Tx P X  >X p X00Y00S   jh  dx 0 Sx0 Sx XD@K &bD@K&_`\H 0  H0 `0 HT T 0 0 SH\0 ܥ0c\0 H0T T H+0 H*QH L  L@00L S H L1H 0 L0 RL 0@C0Tpp0 @0Tpp000 HT0 0T0 @HL 10L 0 B0@C RH \@ }TT T  m 0`00 Vb WT0dp 0ãT0 d00Q0S-0KP0  R0 :R 3P0 h l% >P &B`PbP P(K 0a0Ch0 1!`PP0aP T  00S000aP V0 P00cP0 0 `PV PP000lP  U- Pu`` TT @ 0 Po0  PoTT T  0` ` wT00   T@0 00  0 P`P`T00T0 T  0`  T T@ 0 P`0 0 P`Xl T   0`00 T 0 00S T TT @ 0 P`0  P`0DK P 0 h0 ` D KH0T @H lR H  TT0 0/T  0X0/ +0a T 0X 0 T@ 0X 0 0 X0 0x0Px0L0 8 PuoL 30 T0P` l 0x T0 L 8H  V 0S# T   0`00 V0 S -Pu`` TT@ 0 Po0 0 PoR, T!x0 l L0  0` T000S T Vn-0Pu``0 iTT@ 0 Po0 0 PoL R D0KD KP0 h ` /t0Y00S00P0 P 2R W P  P PaPh hp ` P6h l  w -L4 -@LM4 0- @LT0TP000@, 000  0 0 00僐@0@0C& R 00#!t000 `0C& X 0 "!04 0 R0ꣅ_c_c_c_c00@- 0P^c: 2#80S$H*,0 9,00 0]a -LM,0P20#0R0Sp` 0Qc : <"K#80S $H:@@Q0S 2[02KRP \E-Ƞ@0Sp0 p `P@ 0@s  0R0 s$0@S$P10 R$0 @$0@S 00C0 ..$. p-LMh`@qP T0T Q 0QUqU@@0ps]0@P(.,.|,0, 0$ Q 0÷0.8.4. a -LM0(h h`\@\ 0 0S<:80 P000a4.8. a000 Q 004.8. a0. 0 S-L< 800( S $S ZhV.̅ -t0@LMA \E0S4P\4\,h8$6h2dD -LMA0@Q!ڀ!0Qx @ ^d!00^G@HTHi >@>@@@>@@@@?@?4?@$@PH 0KP0 04  ?P  0K* K,0K3P"[2[0CP 0KP0  RR R 3P 0PKP0* K,0K P"[2[0c0P 0PK3P0d  P0|* K,0KP"[2[0dVP 0PKP0e P0* K,0KP~"[2[0eP 0PKtP[k* K,0KPf"[2[0f\P\hXqMPOLPlQhE0KFPB0S 004Q0 0B RS R  0B RSR P P P P Pt%#I0KP0000 R@@R@t0 Sd S"P<.<,.XP`.tX- -Lz<84(?0S JP h,a4N-  0`1f_  02dq_-T0 $\ <0 \ 00  Ƞ 0 Ƞq (__4_-l0 $ RT00QD1R  Q (04($__4_ -LM`@PpPP  0 P  ,00,0 p-L,M`PV@0 @0K$P P 80 4  @<` (` P08 KPP(0 (0S pP #P  c 0 ,0( 0C,0p,P -LM`@PpP  0 P  ,00,0 -LdM` VpPㆁS VO @0  40 , H@ D` 00 FPP'P8 08  8 0@S,R*QH K08@PP8  8 R pP #P 0@b@Y 㮦,0( 0C,0,4PPPV@K -LM`@PprP  0 P  ,00,0 -L(M`PVD0 D0K(P p<0 $ @@` 8 ,` P0< KPP ,0S pP #P U  c 0 ,0( 0C,0,  ,0P -LM`@PpP  0 P  ,00,0 -LdM` VpPㆁZ VV @000 0  4 H@ D` ,0 FPP(P8 08  8 0@S2R0Q0H K8@PP 8 R pP #P U 0@b@Y ǥ,0( 0C,0,M ㅸ8 PPPV@K -LMl#@0p,0 儆P` 0 P03U (3U %8II T9,0T0,000 嬐KU%?0T00S 002Ue D2U/  0 P%?0T00S,0( 0C,0 R S2 ,0S ,,  E0S$ <0 0 00c01U 1U00 S00000 K 00D0 S00@0@0 0S 0Q0cҰ0 ჩP D1 $<0 @ 0 D sTo   EPj   U 000 00 x0af f |f{f@Dwt@}f~fvt -LdM0t tP!0⣒ Px |  7Q`p ᾣ@ 2  P` 0H DP X` T0 P L@ tPt P t0 PtP\ ` pt,0`@0LX ,0 x|0Pnx0Sjt0S T 4@0  , @ 0S' c@00C\ 0  "!0 00 3C&  0 "!0l#0 R x@0,0 0DD#Fc@00C\ 0  "!0 00 2C&  0 "!0"0 R.X x,0#X@0X,0 tQtQt  QL@0KPP |DPT vDPX pDwh@K5h`0\ `0K pK l 0pcPl=9 A =p p l p l0 p1Rh!002c2cEA\ d0S`K CP`KPhK\ d0` h0P=9@ =C` \ ` \0 D CP H CP yL CP r@Kx<0K8 KH0 40KD X0 0 K,0K@KT P0 L 8a_c_c_c_c04aPQ?B -L$M, ,@ p8 0 4 < H H 040ZD 6D2a0S0CP8c% U#P@,  ,<0,0 R,  1@ 1 @ 1,0( 0C,0  Z<0H0S<0 H 0@  OE 0-04PLS@ SP0iP 0R00004a p-LM@P< 0CR0P04 A !P0000 1R, ,0@@0,0`P00C\ 0  "!0 00 0C&  0 "!0| 0 Rpphzv10S MD0(  _c_c4a_c_c08a -LpMW,0 P`*0 S0!MP@  ,00,0 ,0( 0C,,0 0Sp`VP:,0pp 00 -LTM0d Pp0dS0!h XH0Kp0  Pl dl pDBPP *p0 R0:z 3 PKBa2a11J"c11L0 P *PXKlL T0PX0`#PP L =9@ =CP L0 t ,0,#@0`,0h0p nh0Sz# X@KGXP0\ P K`K\ 0`cPl=9 A =` ` \ ` \0 2Rڄ"002c2c3t0 lRl2@0  , @ 80S' W0SD00CSD0@0 (0+Q @0$Q0S WpW Q @@  81P/t 㸍@0@0@(~0@0H<@0Be Tp@ < @0^ <@02Y*0#p@@ 80Pt |@00@0|| 0 Pp@0 p@0@0@0@0<@0|0 Q>x  0,0CS0 p||a -LM`lpQ0 O XIX9夠 P000J8P00C\ 0  "!0 00 8C&  0 "!0(0 R"  0@D  D @0言 $P ";p05_  R @SF0SW 0S F9)W}p ^W~p\W; A0GS p  @ p p  pWpW p 0Wm0D"0p" vW Z6x 㓫W Z'0xW W W|Wu 05 0}  (0r05WZ   ^DAp09`(0S.@20W0S 6    y0ph 0@$  $ l_c_c_c_c0 a(aOdq_ a -LM p0Pğ 0@d 0 d HP X X X X D a0HS H@ > 0; `0HS8<<<<<<<<<<<<<<<<<<<<<<<<<<|'A0H\XS X #@0`HP``d0\0d0wP "30 X00S =S  0@d 0 d HYPP"0?0STH@\pHhQA0 0(!)^  so  0@d 0 d  0=`H PPT JO  L-0c Z0 =P0`H j̐0Od  d `00C\ 0  "!0 00 l0C& d 0 "!0@ 0 R-ikaO_c_cd_c_c0 -`LlMVpP I\=VX=BT=VP=5>:D| 0S , x0\ (1$1F0S ,<@:P@ <V S<V <V G<V8 <V ||,0pL00p +p 00C\ 0  "!(0 00 Pdq_ -LM0@  (0 P0S0 -1aLMp @ P H0Spp% 0  0S H0Spp 0  0S p 0H PP @p00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 R}e_c_cP/_c_c0 0-L@PP 0 -1aLp  P @ (QRQLp0 >;-p0.(Ap00C\ 0  "!0 00 0C&  0 "!0 0 Rhep0m < p0ŒHQHP᷵FHP  ( _c_c_c_c0dq_ / 0-0(  SL@P* Up0@0  (0Sژ0  P H/ P 0 0S0Pp0@0p0p0@0p0DUp0@0p0 0-0@P L p00p0/P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00hd_c_c_c_c0 -0LS0 -L  -LMp@  0 Q   m0 ̌0p"'P00C\  0  "!0 00 6C&  0 "!6  Q0S  0006 ,0S D,`P00C\ 0  "!0 00 5C&  0 "!5  Q0#  t``P00C\ 0  "!,0 00 5C&  0 "!4  QI`$P00C\ 0  "!0 00 l4C& d 0 "!44@  Q0$|0D R 0 XRd 0U 00aH0 S/X X!ڜ0PH /=P`0ß=p0Od P d eʤ0H0 SXi0 XR,H0C_"P0 B H0 S;ژ p"2HpP00C\ 0  "!t0 00 `2C& X 0 "!(24  Q 00S#0_P00C\ 0  "!0 00 1C&  0 "!`1l  Qv k_td!?0PX_]P0pH|H0 SmxdR1d#pK P ?  , ' x0P$ 0! (1$1F0S  㻝x0@ t@9P0  q0_0a_c_c8/_c_c0(aaP/O@/`a -LM 2P0S@ 50 -R" B?D0CST@0?0S d00000-0B= ?  8CRԡ!0p000p 50>*,Kmp =P@ , hP@0p 5*DA0p 0 0C\ 0  "!0 00 0C&  0 "!0 0 R-=`b0V``V=J`VZt^0@   p0  :p0\O_c_c_c_c0 Q0-L@PA  UPE0 -LMPPc ``1 (`(pK  P@ (N P@`P@ (= P@p0@:p00 0C\ 0  "!0 00 l0C& d 0 "!0@ 0 R0>0=]_c_c_c_c0 0-p0@ 0L50 "20#0 P0S @P 0P0PU00S P ^%U?@0hU0 -LM@p0 Bt hxx0s S0s-t0 A!`?̠0 S S \h\ !h3 3#2 11>gfffON -LM`P,"0$"111;/"b111A|0St xQo @TPi zPP@@T10S4 S1 1R0 0l$K0, K> HAN=0S 0 $00!0 $0 q?B6c$ (N=0S(0 ,0 0 ,0 ( (0?B6c, |01c1 @R  1P2;P 0 <0(/0"bTz uDtcQ$?BHh8DP\P0@-0 1@1P0 SR0C BSRP 2P# 0DS00 ER  R R 0R0S,  ,00 4 40R0,0 R4 40R0Pt t0RS -!qL`0@ 00p P( (R3 P. `A`00C\ 0  "!(0 00 1C&  0 "!0 0 R#\ @`00C\ 0  "!t0 00 `0C& X 0 "!04 0 R[_c_c_c_c0 0-LMP  0NᚪP>T00  0aa -p1pQp`L 0 S@ 0> 0H 4q`00C& R 00#!000 0C&  0 "!0 0 R  ( H t00 h @0T0 0@yu[ꨆ@_c_ca_c_c00aa  p-!LM0@0C0 hQR 0\10  0 (H010 ` 0 b1B&! 02 S41b1 R0@@00@@`00C\ 0  "!0 00 0C& x 0 "!0T 0 Rpph[>a_c0aa_caa_c_c0 -0  L 0 Q l00  (00H >1>1=1p00|  x0S0 0h0$0(Qa0a8a -LMQP`/00CS 8dlt|000 Pi-p0l0h0PpT0T@ 0 嶣 p婆(aa a aa8a -P@pL >㫅0E/>1 `W>p 0 0P0  钅} -LM0@S0S000A?f>\`>V p-<1<LMP ` @T Q` 0 0c/.!1CQl 0S0000DS00 0@P00C\ 0  "!t0 00 `0C& X 0 "!04 0 RpY_c_c_c_c0 -p1pLMR`PpL0S 0\@l0% @l T@ N00S 00`d d0Vp /0SS@0 00 0C\ 0  "!|0 00 h0C& ` 0 "!0< 0 RiY0_c_c_c_c0 -1qLM @ `^ QU 0P e= ^N ?>1L 0S10`\A00C\ 0  "!0 00 0C&  0 "!0 0 R$Y^N 0\` ^N 0 0H`F V0`bк_c_c_c_c0p@-H1HQ` Q000 0 QR @0Scc \ 0S00 ll 0Q  RR  @`00C\ 0  "!p0 00 \0C& T 0 "!00 0 Rpp@X_c_c_c_c0 -P"PrLP0@ 00 `R^ R0SP 0 0 0` 0 @\   ; ?>1 @  0 0Q00  0AP00C\ 0  "!`0 00 L1C& D 0 "!0 !0 RIX?>1 @  P0 @P00C\ 0  "!t0 00 `0C& X 0 "!04 0 RX_c_c_c_c0|Rp@-@) 0/.PaCPL  10C00&0b 0R000 Rp0a # B0!00p?>1 A! p Q-L`Pppā!000 R- R0SW 0 0V$ R! 0 @cR@cT@ 2`dPp 9 00S 00 0V  R@0 0C\ 0  "!0 00 0C&  0 "!0x 0 RdW 0 AYD& P0_c_c_c_c0@-0@S 0 00\S Ch0P 0\Q 0 0c/.!1CQ<0  _@- `0R   00\ La/.!0AS1@  _ p-@1LM8@ ` R 0S00C0 00B 0Q` 0n/.!1CQl0S0 0P@00C\ 0  "!t0 00 `0C& X 0 "!04 0 RpV_c_c_c_c0 -!LM0p 00 RAI 0S 0R/ A0 0C\ 0  "!t0 00 `1C& X 0 "!04!0 R,p _V@D`KPDK@0 0C\ 0  "!l0 00 X0C& P 0 "!0, 0 R %V_c_c_c_c0 -`,0pD1P LP@U @ i 0sj @l -LM`,0pD1P HP@U i 0j @k -LM`,0pD1P HP@U i 0j @k 0-LM@,PD1 P \0Q T0Q  0Pj0D1 Q 0,0000at qt @-,0@D1 00S   @j@ 0-1!LPS 0 0S-@ T* 04@S!T:PU R0 0Ո0@0@d@ Mll ILKP0hG  0S 5`1P1l0:@ 00c|0 S01W01R@1@! 7 00 0 d dR0 0pd0 UX XPO!000PXhAh1p  \ ۹P` 100A00C\ 0  "!0 00 0C&  0 "!0 0 RD0  0Wp Pp $ݶ_c_cP_c_c0< -LM0  0  -$1$ALMP ` 0; 00    0 5`` 0`pP00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 RCz_c_c_c_c0P -LM0@EQ!` 000 1 0 * 8p@`00C\ 0  "!0 00 0C&  0 "!0p 0 RHCYP  0p-_c_c_c_c0 p- @LMP 0 000 P0P0C& R` 00#!t000 `0C& X 0 "!04 0 RpB_c_c_c_c0 -1ALMP  9p 0  0%p p`P00C& R 00#!t000 `0C& X 0 "!04 0 RB_c_c_c_c0 -L,M0 00 , 04 0P0R8 H0 @ 00`p`W50 0S. D  0 000D0 80S 0S 40040P @ 0 :00: 0  0倐0:0,,,<$ P 000000 P0 0   @ 00R0S0000  C 0C0S H0 SL  0@WvVs@Pp@0/ 0ORQ8Q00S H R0@0ZZ: P0 0CP  0 0#!: 0 C60 0t: 00#!L:X Q@,0K<0 `8Q ,@Tk: 000 ")PP 9 !!$ !0@@1@ @) 0 0CP  0 0#!d9 0P C60 0@9 00#!9$ Q&܀@@W00 Z00SHX00Z @@P d , T00R00S 0d0  8 )8 P @<0P, `p000dW4;70770L `00C\ 0  "!0 00 1C&  0 "!@1@  QZ :0x7k#|@L 0@@4 0   @Pp Q! Y}pZ00W00S@ PT E p-LMQ@P ` Q p T  0pQ -L4ML@2 @022P02[tat!p 000X2022GPPK0]2[02,0$0@p00C\ 0  "!0 00 0C&  0 "!0 0 R 0 00S<90,2ᦊ)_c_c_c_c0 -LMX`p,0 P \ 0 S*U* ,0K0 0R ,R "R RU 0S0 R00000 \ 0S ,0K0 0 P R R@R1R: R R  R RU 0S :G@0CT@SJ8JXJlJd1)P| 7 P01PL0T@0P0T\@\00RU 0S@000 00U04  ` NQ!i401#8S#00Sl0W  P0W}S 0S 0S S b11 -LM^P@p \ 0S*p 0L0 T` 0 &T T T B0 00`T@T  TT  T 0 0000T8 0T  T0T 0T 0 P 0T 0T 0T0xP 0᭴@ᐴT0 3 003\  -LM@@ D0<vl@h p-LM!40r$@ r p0L@0080 0`00$ P 2$0200C\ 0  "!0 00 t0C& l 0 "!0H 0 Rp38(0|@P1`1_c_c_c_c0p10@-14 @0$00p0S0p0  Q0 0 0S00p0PS707@00C\ 0  "!p0 00 \0C& T 0 "!00 0 R00@7_c_c_c_c040$ L 0  191# 3S,000\0Q0@-14 @0$000S00  Q0 0 0S000PS:0:@00C\ 0  "!p0 00 \0C& T 0 "!00 0 R00@q7_c_c_c_c040$0  C0LS 0 Ŷ  191# 3S 0 ,0 0 0S 0R40$# P0 00   0-0P; 00  UL@  0S 6Ld0S |0h[LS0S 60h/ -LM0@00 68 ᒇ|6L30S  -LM0@00 6. u|L0S  -L ML0H 2cC0Q0^, 00 m3#0 SfʤPD 㻯0 @P@0@ <`0 3 @pDP@P0A3 <` @pD#PP`P@P@ @ 0 0 @ 0P, R L 0S60,@00  0 # Ԣ8aQa11R33  00330(0 (, 0 Q 0\30C3( Q,0,0,00(,0   0\30C3 | F -LM0@ 00L<0S  -LM"2 " @F剄 P p-LM2@  ,P`02@ @F0`qP2 02p(P 00-@LP202"00 $t$ 0hP0< s27 p-LM|`@PP LP \0 S0\00S;0S p$7pQ@-L  0@Q  0$R @ S1P0H L07R8a -LM@00 0Q R 10S \  -LM @R00Q  0,0 0100000S0Q0 ! !101 -Q-Q 1S( S  0,0 01000000 0R0Q ! !101 0Q -LMR`P  10 @X 0R@ B 0CS0Q\䑟1 ,   Pp 012 02!  ,!00C\ 0  "!T0 00 @1C& 8 0 "!!00 R4W0 0 0 T`X@  0,0 010000@0S  0,0 0100000Spp@p,4$_c_c`aDa_c_c0d R0-L@A 0R PQ 0\  C 0LS0^00S  0,0 0100000S  0,0 0100000S@@@0弦t Q-L@`Pp 1 0\pW0S00 @TW U 101hhw0SP !1R U. 1 \  00c<;  80S/ \!1R U@ @ 0   1P00001010@0@0   0  0 00$00 00a\U0 -LM0@S0S -LM@PT0`,0  VYT Q 0,B0a 0100 0c0p 0`a00!3 10C1 8P<0<0< 8 0 10 唣@土p00C\ 0  "!X0 00 D3C& < 0 "!0#0 RVTi QWȂȒТ 0,B0a 01000c0` 000!2 10C1c 8P<0<0< 8F 0 10 ,@C`00C\ 0  "!0 00 1C&  0 "!1  QT Q T@,00 @T 0S@@@,00l2 (0S $0, $4x^$Q2q (0S $0, 7$4]^$֞!0 f0 0  f Q,0S,@0,0 I,@ ( _c_cDa`a_c_c08a -LM0PS@[ 0qܑܡ܁0  0,B0a 01000c0` 000! 10C1U 8P<0<0< 88 0 10 <@x`00C\ 0  "!0 00 0C&  0 "!0  QT0S 001 (0S $0, $4]$<4_c_cDa_c`a_c08a -L @M Tp,0 ^P`Q TAdAd1P  X МH$P0P0C\ 0  "!0 00 0C&  0 "!0 0 R#$ R 1 0 +10 ,(<`8`1@ @  ⾮0 0 0 ,00u 1(_c_c8a_c_c0 -LMp`(P^(K, KYBP@0K (0 ( 00(0 @T0 (0$ ((00(0( ,00C,0((0,,00^酁,L@(bD/ 0-LM@ KPUK0 0vPP  ,00C,0(0, ^0$APm 0-LMP KP@ 00$p @,00C,0(0, 8 -LM0`S  ,KPP0 KPP#0 < # #000$@0PT   3S#PM 3S0P3G p8 P@ 00 ( 8 ]0K4 KAPP40pt0 pFK80 00 0 00" 00$pw@HPP QN ,  0R,0  PP? 4?0CB(]< 1 00C\ 0  "!0 00 1C&  0 "!0!0 R ,0( 0C,0,ↀ/,K PU0 (00(00,00C,00(0 ,n@@0603 0R3( @  (00(0,00p , 3SI3SG x 6F 0 V~PP3S83S 45 50#0$t_c_c/_c_c0P -LM0@( K,0 PPo( $`0A?AS ,K0 PPQ,PPK0A?AS` 聟! 000  3Sp6@!F0p~PP 0 3S U0S3lA0 0C\ 0  "!80 00 $1C&  0 "!0 0 R000( ,00C,0((0,Pu,.(0,  B, ((0,$,,00C,0((0%,_c_cP_c_c0 -LM `P ,KpP@  0KP@t( 8KK\4K @P@d804 D0 0040 4 弑<K, 40$  ?P@G<0 < 00<0DK<00 $ 80,0@0 _P@+0SF  =P@!4 (00(04,00C,04(0< (00(0<,00C,0<(0 \,,=<A000 D=4A0,0 0P [,P~0,P@ / -L(M 0@` @Kp8 0 8 K4@ , ( @P <` p9 -LdM0DK`p  NP@8 P#PPKP !<>P@0 0HŸC& 0S0 0000@00"R 0 0SAŸP 1!0Q100(Ap00C\ 0  "!0 00 1C&  0 "!0`!0 Rh!00500ir0@ 0q`r00!000z00 .0 B600 p08 . `B000000 @\08 . L_c_caa baabb_c_c0(aaaba-l0 `0!X0 P P0 S P\0S00 5H4 bb -LM, < <@PC 8 0 40 #<ß#10aV  P0SJ `V4P` 8lC00S08P3`TPPPP 0,00$P0P0C\ 0  "!0 00 2C&  0 "!0"0 R0 \0,@`rS`T2@ 0000 R00 " @0 0CP   "!0A00 1C&    00#!0! 0 R ~000000@0 0CP   "!000 @1C& 41  00#!0! 0 RVW u 0050040 #o@0 0`CP   "!000 p0C&  `  00#!0H 0 RV @ 5H4 bb_c_c_c_c0L 0-LPP@ 000:00 R0@0b ->0~pLMW`80Su +*PP 00dŸ:00 R 0P8 80H@bHT@!d |800808 <0 dS< 8 80S:SFЁ1!P@0U00? N00夡000@00C\ 0  "!h0 00 T1C& L 0 "!0(!0 RH8 H g08000g 80< 8p0N<P@00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 R j$Pb_c_ca_c_c0T -`3LMXsT#T3P 0\00`,3,#0Q 3#0Q 3 Q3@TI 00\ 0R00>bP00C\ 0  "!0 00 2C&  0 "!0`"0 R0\h0P0T0X040@0<0d0`0l00 000 D 0!a@mP00C\ 0  "!t0 00 `1C& X 0 "!04!0 R0` @`gmP00C\ 0  "!0 00 0C&  0 "!0` 0 RL.o6_c_cba bb(a@b,aa_c_c0abb -2LM 2b̒̂r  0R0K* 0@0T0P t00|"000P00C\ 0!! < 00"C6000 "!"00 Rg00 [p0S1 00.\ KP' 00300 0008 h1. Bt!80 P>0C8100 @00000@T 0R8Ke*, 408b00Pc A=9 =@ @ < <0 @0So0 P   }0 P 0L H 0olW(a,a_c_ca_cba_c0aabbT -4!4aLMp0@000 < P0 PGl00  Pp00C\ 0  "!0 00 0C&  0 "!0p 0 R00 00  40S00;00S_c_c_c_c0 -LM00@ +00p <R00 00S00 00@ 00 h00500hm00@000X00\400a -|4L Mph4PQ` 0SP A2q 4 $00 AT 0S @T#000 P0R(0)Q  PT    YF0S l#000\ 0P0 00 @#000\00000 R000 R 0S  0 0S0 20 0 @$, P0QT" 00 0Y@00@0 *0 b  20 60 P@0!0 R? Z8P0, R ! 00 00Z0Y0S0!0 R  $0P060D0 @0L0$^, 0 P0L0, @\ 0 (80@S  HQ nT0 ,00 ,, 0 00^ 06000 0A ڛ00:00|,^^ , 00L @0 00X +D -LMPQ@p`0  0008 0@0TpX 00@H00@ Tp -LMpL00  L H0AP4q ` @ H80Y080004;00 r07 SRX 00S*0S$R"*r X00St0 0 0SRr sus0suu0sXR0S0 uq000 0scg -LM 0R ) 0 `R 0 4 P`p`0@  ( P0S@ 0R 0@ 0 R@0  0-L @\ P( ^,0,0,00(, 00a \0 -L,M,0$ 000 `P 0S 0+P@ R@@T }000 0pCW :0S/S W0g 0c #0% %0 0 R2  0 /R @00@0T0S P@s f 020("S\ 0S0 0U0SpLP0K P@KH0 @00HK00 4 ,P Pp L D 8 &P@380[c  R?@# *\0× 000\0/Ss @0 z}pR z}`A00o} 4|p>@ & ;0 pW}dS}PO}pGWc:0/S Y0+6 |)Db<b -LM$P$ 0 0#40 @ Rp8  Q R 4 00  ( @0 < Z$, 0 /S L  , 5R  /R  2R0 /R, KR, ,0 lR ?Ó00b0 /R07 00S09940S009900900S 0:00  0T 4 T <0 0  0@ T0@@00@0X #00@060 H$P R R0 j7ã000b0 0 j00 0 R090@8 Rd RR R  00bk00CS<< R;T0@ 780S2 T0@   3 #0S F@0S$00; %P  @00@08Q   % d20S 0 0 j 0 ( |`V   "0S  8 R|`V   %00K X0@@ @ p<QT0@   @00@0<@@@00@0V 0.S0.S0:, 0/S  0b0j007, 0/S 0 b0b080SU0S8 0Q0R00SG@090$<b @ -LM80@0 p,0  " `0SdV 0 R #PP p =00ZT0@  P0  @00@00`0CS ZT0@ ,0S T0@ 0 @00@0,0S 0  $"0@ < RP  $ x, -@ MLll 0dPxX0X @T0@P@LLL L0@@@@hD -H`bLb@b\_Pb,bDbXb8b Q-0L Q00 \ 085P 5K5 - 1LM`@Vp P $`VV }^9P@}H0 P 5 P ` 0@0 P0 00@0$(0@0 Ɔ/Y 0.@|2P -|0LM0Sh0@T 0S$@TP0 $ _|2XH- P h0S Pl 0RDb p-L M 0@004h0l0 S000t ` 044 P 0  PK P 0 0 0 0h0p$_T_Db0S  0"S  L00 \ @0D0<0804000,0(0H0$0000 00 -L M|||S00 x3@0T40 ,0Xs0P3`,  T (C RJC R 0SC C`00C\ 0  "!0 00 2C&  0 "!0"0 R|wxP3 000@8@3널4,00P0@0@@ PR  !P0 XPUA`00C\ 0  "!0 00 1C&  0 "!0\!0 RP00P U XQ\0\0\00X\ @H00H0`00C\ 0  "!0 00 0C&  0 "!0l 0 R 80S 40|0<0w 4bX_(a_c_c,bPb_c_c0`btT0S ` Rd0d0d0 QT0` S`00d d  -PL`Mu 0Kp d P0@0  P8p 0P 0 P PLb -LM800CSL2L"p2?0P`@T | 0VW @Tr2  0 S |000@ ܑ00C\ 0  "!0 00 1C&  0 "!0h!0 R|0p `| T0|0| p|0pP < +< <0;<0+  6|8 80S@0S  ,PT Y80S  !  40 840 %)u(aPb_ca_c_c_c0 -LM@<0PX p   <<00!'ZH @00Q00S< !000L RR X R\ X1J \0\0\0Ha H0 0H000C\ 0  "!0 00 0C&  0 "!0 0 R@0@0 PP @ 0X0 BR00S@   X X R\ $0|_c_cPb_c_c0,bp@-8!8AP000H L81P \H 0 0X0 X\ 0`P00C\ 0  "!0 00 0C&  0 "!0d 0 Rpp@ 0SX0 X0X0\00\_c_c,bPb_c_c0 -LM@0T 0CS@@0  h n @0SH0 h(a 0-h0@ P BR@ L@L 0O0SN @0SH00hj(a-H0 L R@0SXP^\0\ D0\0 X\ 0X0 X\ 0L 0L0Pb,b -`LPp @T T0S`@P T -LM 0P@  <0 D0S 80S @0S 000 800CS0 4 }(aLb -L M@0 K  0 @ Px -L M@P@U0@0<0`p48<,<0@`<U5 V-P#U @00CS@0L0S0t 4  @$<0, 0< <<0i?Z\z| 0   0 Db -L@\ 0(a -LM<0PL` <<0$0X yT0S800CS|\ 0S00 S | 0S S"|0Q0 <@ | |p0Q | 0S QW Q<0;<0<@;<0@T  P0 |b2 @ 0 b2B&! 02 Sʂ1b R|0 |000|0 |lr@00C\ 0  "!80 00 $2C&  0 "!0!0 RV0|0@0 S8 JH0G a!000L R@0S X R\0\0\00\0X  RX T1X0X \0 P\$A00C\ 0  "!0 00 0C&  0 "!0 0 Rhq4n|4| t Sl'8 80R7W:p3_ca_caa_c_c0,b@-2@H?0\ | 0T \80QPb -QLMp@`P$K40 P@T$: -LM@<0  | 0P |0  R Q8 80R@ 0P0R00S |@ -LMQpp5^ 0\ 0S $\-\ Ap0,0S SQ|0\ 0S $\\  0( hP- 0 hO|2x2 -PL M0 `M 0 0D!X 4!)P@ 1T0 0j04` \,  T0S ,KP! U`p"P@ ` ,P@W,p @ 0 0j0 @0 R4`,|$ 012=0Db@bX34b-|0S<0  0 R | 0 S  R8 80R0S -LM\0PS@p@0  0`004P 㔄 4 @0<@0Sld RiSgRe0@ 1 2`ᄠ X\ P@( \0R\0ń0d R>@!T@0\ 0   0V0P@@T@ 0004P N040120 R 0S  R0\7@ \ $ \` P@d0 Rd0 0Dz 1娑@00C\ 0  "!l0 00 \1C& T 0 "!00!0 R@0 P@0 0@00p Rl0S u@00C\ 0  "!t0 00 d0C& \ 0 "!008  Q _c_c_c_c0 -LMr園P 000l@T 00 \ @RZ/ 0H"P@p*PF@ 0@K K P@p 80S-@ 20S 80S@  P@ 0i P@   0  @Kl  `d Vvp`K 0j P@i 0 P@` D0p0D000 p0! 0$3  X0K``K0 $K4K DK @0@0 @P@  a,0 S ,O K 090 v @ (00(0 ,00C,0(0%,H0S%  P  0 P@D0ab3 -LMԀ0p$0 `.P@ $0 S $jO@PK GP@4PF 08K K P@PK  @p 0a -LsMp0`$0 P-P $0 S $.OzOK PP@F 0K{/K PsKT@$0 P@048j/1 f0a -LMP`-P@0 RK 0K@ 0 夀 ` P@pW@ K` P Wd K u 20:#: Q0 <   Q @T0 0E K K0K @00  Q㄀ 0b p-LM0P@0  0K 0  @ P0|`KSd t 0|0 00:#:x0 0 K K0{ pK 0R ypb -LHMd@Kp `@0<0 ` d @ 8` uPU%T@80Q0 `P @ <0 d 8` dPPT R0P 0 0 @ KP. PT@KP P T0R +TPEC -LMP`bp0+@TK&0 @  ` 0 P@0@KSd ,t 20;;|0 0p 0K Kp% @LcKT 0R @Dbb p-LLM@ 0 `K`80 \ ` <` 4@ PPP<K<0a10 L03 0 0- LP< K pL L0S p -LhM`0@,PPJ 0SE$8 RA 0RppS, S W0SSK 0 PWlKlK0@T0@W0@T  -LLM0 `pP/00  0pK0 D0H0 l p L Dp 8P@`Q `l`@` P@0 4 @ -LM` PD0K0  P pKP@ 0 @T0s+0S<@ p *0 -LM` P0K0  P pKP@ 0 r@T0G+0S<@ p 0 p-LLMD0``K@80 \ ` 4 < PP  pPp PP -LtM`0Kh0  l d` PP pHK80SP o08 0b00K @@KH0 D 0 4P 0P ,` 8 P -LM` P@0K0  P XP@ p0 0  T0@ @0s# *P㄀K|d Qr0@0 0f @0儀K 0J P@00CS@b -LlMP` K6P@  0$p 0l  eT0S @0@0s/ p*P㄀Kd r0@0 0 @ w 0,  B, (0 ,E0儀K 0P@00CS@b -LM0P#Q` K  @00   ` P@0  p  p T0儀K@@Pd  z q0:#:0 0@b -LhM0`#88SP; KP@  0$p 0 T0S @0@@Kd mq0:#:|0 0@  0,  B, (0,kDb -LM` P@0K0  P "P@ p0 0 zT0@ @)0s, )P0 R 0儀K 0!P@0KT@hd  q 0x0 @ t 0@@㄀K0sT3b -LM 0PK`0 0 0 P P@ p0 0& T0@ @)0s, ,)P0 R 0儀K 0P@0KT@hd p 0x0 @ t 0@r@㄀K0sT3b -LlMP` KP@ 0$p 0 T0@ @)0s8 (P0 R, 0儀K 0oP@0KT@d Xp 0x0 @ t 0j@ 0,  B, (0 ,WC@㄀K0sT3b -LMpKP`Td (pP@,@KG 0K40040  @0K0  ` P@ P0 0V OT0@ @ (0 "c1, ah $ 1d0 \ ` 0@,K ㆾP@,0s0,0 $0s0$0 b -LxMpK`Ptd oPH,@K 0K40040  KP@  0$` 0 T0S @0@(0 "c1, ah $ 1d0 \ ` 0@ 0,  B, (0 ,B,K P@,0s0,0 $0s0$0 b -LMpP @0K0  P @P@0 `  80@S @T0 匀K 3@T@d 1o p0K 0D@b -LlM`P K&P@,0  X "00  @$P0 0R K80S@ P@  q,00C,0(0,A@K4d nh0K0 0@b -LM` KPPx p  0$@  0 \ P3 ,00C,0 (0, A -LM0"P`D0 hK0@ d0 h <` {P@AX18!Q K0@ 0 ` iP@]PpU 80SQ 80S@ X@X@T$ KW :U7DKTTOMK |`]`P4Z]t=:0 0TP 0 0U +0 0@KTXD K0@@80S@DKTcT  ,,Db p-LM0 `P0 K0 0  P P@@T|@Kd m0|0   ++x =0K KP@ pK P pb -LHM0`@0 0dK< `0 d 8` P@ TP8pWP@ @KPP PP@ <0@@T0 00 0PT@ K@ -L, -LM$`@8 RpP. PT0S @0 P0    0 p,   ,000c P$ -LtM0 K@xP@x0t 0 800C S6| } } } } } } ) @ K@$;DL  p@K8P|`DphHd K \0K(T K0@ P@`pHL P  090 @J@   *09@J -LpM$@P8`ApQX~ X~ ~ ~ ~ ~ ~ 1U 1U 00S 0 pF0 K0P l00b0 0 p-T0PU D! 0P @@00@0D!f@zfat $( -LM@`@@p< H 0X <p:H P-$ 0 8$  -`0@`XL pPU0@  iP (a -$ LM  40K4 -L(M    40 K@4 -L,M   0 40 Kl4 -L,M   0 40 K4 -L,M   0 40 K4 -L,M   0 40 K4 -L,M   0 40 K5 -L,M   0 40 KH5 -L,M   0 40 Kt5 -L,M   0 40 K5 -L,M   0 40 K5 -L,M   0 40 K5 -L M8 0  0 $  0 ( 40 (K$6 -L(M    40 KP6 -L$M   40 K|6 -L$M   40 K6 -L,M   0 40 K6 -L(M    40 K7 -L(M    40 K47 -L M8 0  0 $  0 ( 40 (Kl7 -L,M   0 40 K7 -L(M    40 K7 -LM00 0  0 $ 40 $K7 -L M8 0  0 $  0 ( 40 (K 8 -L(M    40 KL8 -L$M   40 Kx8 -L$M   40 K8 -L$M   40 K8 -L(M    40 K8 -L(M    40 K(9 -LM00 0  0 $ 40 $KT9 -$ LM  40K9 -L(M    40 K9 -LM00 0  0 $ 40 $K9 -L$M   40 K: -LM \  40K,: -LM \  40KT: 00 -LM@P0< <\ -LP0\ -LM@P 0 04 0$6 p-LM P\0`S {P5 00;00 @000@0@0C& R 00#!000 l0C& d 0 "!0@ 0 Rpph__c_c_c_c0 0-0@(P0 L 0)0S 04 08 -LM@P  - L}]  -L[  p-LM<0@ ` P`<<00 PO7<0 p  -0 L Hb 00 -L M`|@Td  00S0R  00 0 0SP" 0S8   PU  PU  ^0"F P6 P U 0  F0x"FP6`P U0 Q80  Q 8Q1p  0 S @00g ȡp00C\ 0  "!0 00 1C& x 0 "!0T!0 R?|@,K 0㰡PPp 0|0,000K0 ឡPP ,:|p0000,PP  00, ,0 0000 ,| @,4_c_ca_c_c0 -LMP@0| S`p 0 0<0  0' PLF 0 0#U<0 00| R#PP -LM 0| `P0<p0  R  0啤 @  00<0 -L4M0@^ 0 0| @K vP0 |0@K ~vP0~f p-L4M@P A|0HK0 `|0 R$ |0 `A 0HK| \$ p vP vP - L  Q00Q00 -`|PLU@ps 0 00CS0h 0 00CS 0] 0S 0S Wp TAT1T 0 b<1`B&! 02 S61b1 R0PP00PP0 0C\ 0  "!0 00 0C&  0 "!0t 0 R0|0F^KC_ca_caa_c_c0 -pL|@TJ 墡堡4Q414 ` 0 b1B&! 02 S71b1 R0@@00@@`00C\ 0  "!0 00 0C& | 0 "!0X 0 R0|0_ca_caa_c_c0 -LM@Z Z<\|0 ZH0S S  (00S 0 < - -LXp@-| q  qL@H0 800@< $  2 02$ 0|l=|= P  R8 Vdq_$_f_hd - L -L,M80@S`P S |@Ÿ 0 0 Œ   P bX < 0Su|0! +8 \L 1!l1 \ `0 K0 P ,  0SQ 00(0S@8W_/P0K@H 8@ K<P@K \@K HP@ @\8 `04K @f咿P48@0X@10cS@1U H%8 0SP 4]U0ST4 0S  R80 Udq_$_f_hd p-LM0|8@ d0dbT aR  T p pUdq_f_ - L80S 0E|0 0 2dq_ -0L| 0 0 02(,dq_ -LM, 80S; P 000l@T a00 6 R@,  0S) AP00C\ 0  "!X0 00 H1C& @ 0 "!0!0 R[ 000. ν00p000P00C\ 0!!  0l C6000 "!0@ 0 R̿# U_c_c_c_c0 0-@Lp0EPS 800S(0!e10af_  Q00Q00 R00 -LM@P8|0Q p) QRP P<0  '$ 1 2*0 0S D1 T@0D!0 0<0 " 0 :<0` V P<0  '$ @0!b1*  o uTdq_f_ -0L| "88 #$EV00CST h h t h 400 0 < 0 -L M@|  0 P@o  -L)TG-p堑`aN`M\0[ xx1&V1d1后ETX1""ᓆ L"b l A N AD%X$1U`; P ! 10UPc "*0P  00U: QPc0 20\00{.L B40Zx000\ | 0Q0Sd00@a00Ѝ8PbųE.Xb\bnm0PHPTbk_k P-LPp>;T!52c~HaȀ2ca10 0\რ+ <@4TP *[O[O @@R: 0``( AP*0 P@:00@C "b"b0#l00X d2111H"c#b1 `130$)UQdb`bHP0P@-0PSpU0 0 000@ S  p`U 0 0R0@0 Sb0 S .000@ S  LpL`U 0 0R0@0 S00`Q`RE-` M@p 0 0 \0 0.\T.0V0 Ѝ.\ D\ 0 S.S\Z\RP J0 S .S RP \ZUv R0`@e@c\ 0  0S Wpp0S 00Np ^\\pPEP*0  0S Wpp0S 00Np^00P0#02SPp3^_000S00W V @V^P 6!10F000nR^`VL 0 S 0n0 lS0d~0^ 0*0^ 0:bP0u S .S PR y0.STWVM`P0@-P| U@B .U@ 01 c0 C  0 R0Z  0  01 PJ0 R0Z PJ0 R0Z P J0 R0ZP0@0000  0@000|@ S .S A-@pP@  0Xx= ?0 1 C@nT0 7#30 T00SP-@T`,J 0P$0S!^Z@TJ 0P0S^Z@TJ 0P0S^Z0S0S `Rp@-@?\00\0AS`P?@01 P0 0RPu2 0?0 1#0C0 R0; /R0 0S"QZ0 R0( /R" ^ 0SQZ@0 R0 /R 0SQZpp@Np00a0C0p00Np00a0C00a 0C 03  QZQ p R .RAQQ 0Ғ?AcON -,0L;0 U!0lbhb -0LM0吐pP`,0 ࢂx 0  AT 0U @ 0V0W,0S  , RP(ahblb@- @  0 201 R 0\ R R  0^0T,0S lbhb0S R00  -LMt<0 L4Qp0@0 <  PP4 ,0KP@C3`  0 S P00 s`00C\ 0  "!0 00 |3C& t 0 "!0P#0 R@gV08(#@+,0P, @ @4@00 *@ , YP@ ,T 0 0Z ,0t t0sn 4K  00K P@ \4 Z40 h 40 i 4 0464 0464 0464 0474 0474 0t4 04 84K,0 0[P140PH@ `0T*^ 0p ^ ?J0S 0P4 H0 @0T `: ጮ,JP40P 4僮4{P$0 -L M$ ( h0 pe h0b t t0RpF R` 0`t0sY h0S t@\ T0D0bD` $K0Pp,$H0 P >  IP7t0 qD0 4Ht0T$p T q! (0$# (0K$p Pp( $\ W (0SDE <0T$p<0R0< -LMQ@p``#T\P 0@30e^X05< 070 0`公PP X 0X H ̭00\T D a0N 0-LM P0@0  @0 -LM,0$P0C0`p,0 P(K,KT PE5 0P@40K(, 0=P@-0X0H0 R $0U  P 0 PE AX0 0S 0偬P@ 0X 00U00Sc0` -LM00<0 8 @ 80 @0PG 0K , K0uPp9<04K,0 0Pp*40H@ `0T*PU  0 @ H0 `0T: W@ HP 404p 4P@\ -LM0p`P(K,K 0 P@(0K(, 0厫P00,H 0R *@T T 0S H0 0R:ˬPȬ Ĭ -LM⤐Kp  | P2P@@  0S   @T8@0@-@T2PQ @0(0$ ,GP@|`80S|0" 0Q}0 Q @0 LM0  0=P@  @0U 0V@ T40 08  0,0000 05t0s/ KP@  0@*P000@KY 0壝ZaG0Y 噝ZawG | K00 03@ KZ 0 Q10R`\ 0  0P@  .o )$_ -LDM|` p< PPH P8 V5 0@ 0@@wP U @00D0  0EPPx04 8 5 @0 K0pPP0 ,0(H  P 0崠 OP|0@@4PD 0R ,80S P8;A<X ZS4K,0PP4 00;00040H@8 F8 P0 $@ ! 041   042 0 $" 04400 $" 042 $ x0 1QS 2S2?S8 "QL  0488<,0 0$(,0 8Q8P 020%L Rc840S_0 4SZ82 t0  048<840 048 00020x08 t \ 6 8tp\ 5 @Q? 0A<8 H0P70@40\T 0 HH@T,0X P&@8,0!4@  8L0HX,024 80\p8 84 0@` $QP08<@@H8@D@@8 @D00cH`08 p0HL x0 3P Z Z 83 \0 8 t0h3\@Q8 808h0h08h~H8 lBK8@ 1@\0BX0` 7K8@` 0RT4*08 40 xQ 4K+0ȨPP40H@ EP2 80x04040 8 <L 80<`8PP@08010DQ8 80010d08 0<h l |0y EP yEP sEP{/l0h!d 4 88<|020C8Sa81 \0 t0a\0S^1R80 \0 t0R80  t0\0 I8" 4!0` 4` #,$ 88<<0D& %0Q4x0P 0 840,0Pahddl`S00 -@L pP`0 A|`PQ`<;@0 :@0! -LM0K"@P0   p-LM@`0P0` ` H0 0P T P0Z 0H0T` HZ HB| H D  Dp p-LM80@SP0 0<l0S 0\S 孿`V p 0`0S0 5 -LMQ`0(  $0 ,` d0@Sph, K 0STL  04P$   $= t -LM0@ 0KHP0 00  0000   0-@P L@P00 4 0 0 -LM䑟0 ,0 @`t0 pS$ x0RP#N*K C\ KPPC00 K0 !P0 PK  DP @P 0  < 0 0/&00  K0]PP0  ѿ0  ,0 S ,!6p6廿LKN KO0KJK0 0FKH KP0[ 0P0K0aDb -LM 0@6啿Db p-L M@0@SpLPP `K[0 000 0  0 00lj i000n00rp h0 0h0 -LM 0hh0`0  0 $  10 !   0m -L M00PKp00 000 0 00000h t` Pt0s<h0($200 h0 0 !1@00#!  "  000 ` 000 0PH` x0 @000 (8 Dh0@ 8D000L` $ 0x0X 00@ 800(0 i 80x0S1\T \D<0L aP` 1 E,$P` lj i00r0n0j0rp h0 0h0Zm -LMP@0S` p0s 0s0s$0sH0sL0L s0s@0s 0s0s80St 0ql  0P(0s] 0 0R P \00 NP 00 (0s (n0r00s 0rp 0jh0 0 h0 p 00 Q Ph0h000h00 00Dp 00 Q PDh0h0 0 0h00 00h00s0s -L,M@D 0刀S0`e 0Sh0إ0<0 x0 R0S}*T E, P@X0` 0@0 @ lx0Q1!< 0`Z!RR\ T00b380   RT2 \` a4KD0僤,0@04`0@ 0b SP1 P!T@0H @4ĥT0SU<\D T0@  000鱥Tx0 S\` a` 4KD80K c0K, K0P@4K,0 04@ -L HP.\ K P'@ PK K 0@ PKD @ P SP0  Ǹ0  0 ,0S ,/ /嬸;[0 [ 740w 5 <0QLKN KO0K0O0 JK0F0FKH KP0[ 0P0K60a>XDb -LMP` V$ P 0@ B`TmkP`)_ 0 3@`nO -LM@ C- -hLWMH 0 ,0 `! `A L! h0\! 0d h! l! p  KK;d!0t1 P 0@ 0 7 ,0S ,dA `H0T SI 20 Pl1 P P\'P80BPWP7`   Rh! 00 w`00C\ 0  "!0 00 6C&  0 "!0&0 R{H!hA0@Hl `1t 1R2X1  t0s dpW \=K/=KT X|?`\A`PXd`0x a0`Wp!\P E\ p1K`N/KO?KPL 9QK8@!0~PL D@1@ H0bP!S0!Px1 0U*0S S0p1  Q @pA 8 H Px1  @ 0 PU:ᦟdA0SpHA R0l0l0t!d0TA00`MKx XxQH0 0LPH0 t0 pĂ0 4ȌD \p<3 (K 4 zp\- KK MA?(KA/(@K0K0000d0 Sp! :MK QPL h1S lAh@D 0lA T0h DD4A?( K K?K 0 48<S<1ST \D a0C<X1`p 1HF,`$`d2 (@K 0Kp!MKp Dr\/=KQ<0R0@ @@ S\A RrWnKA_t0 s<041 14 (KW 3 W) (K00000d!0S:MKPL @ 0h1S lA@DlA Th1 pWڬ @0@ MK 0(KKK,0?@(0KKK,@h W @PD P  P?  P< P Pp  P5h  P2PX P-P P*0aha_c_c_c_c0[xpaaPaa0aaa  8 8 08 0-LM0 P\0@ 0  ^ \  \ T bQ Pd 0 -LM`P\ p80@0CS\TP0\@ | | 0L!D0400A0!P000P0P0C\ 0  "!0 00 0C&  0 "!0 0 R#00T \T0`\pP0T0T|pH<09T@ 2,:_c_c_c_c0| 0-0L@Pt 0@4 0"P  0 0.$40,b 0-LM 0Px @ 4000  B00R@1 81 81 1 $1 81 @1 L1 0     ;0 0 0-預@0 @$0 @ M! "Y lpb"`0%&&/@&0O% & "!! @!0P @`! ЍCCX8^n좙N - QLM, 0 40 Q :Q Q 08 4 0, p Wc3@ 0t0"0*PP X1 01$0  1 @00C\ 0  "!0 00 2C&  0 "!0"0 R80aW0?`2@ 0p0"0n*$@0@0C \ 0  "!0 00 2C&  0 "!0!0 RH$ R 1 0+10 ,( @R `52 P(0 S P(,JK K/K 0Pp,\ 0S<@0AS0 $K  P 0 000P0P0C\p 0  "!0 00 |0C& t 0 "!0P 0 Ri(0a$_c_c_c_c00 S 0 4   0  - 8L8M#@Pp;0S`6T 6T 6T0;0 s6TC 6T 0S F&P 0008 R' fP00C\ 0  "!T0 00 @6C& 8 0 "!0&0 R q0P080E%P 000P0P0C\ 0  "!l0 00 X5C& P 0 "!0,%0$5T 5T005T000P 0{4T' 4T 4Tq<0@04T 4TfL04T0004  xD 6 6\4 Q$ 0 00 @R0c@00C\ 0  "!0 00 3C&  0 "!0h#0 R@ĺH0l3T .`3T& T3T0:0 D3TQH(3T 3T00S0<03T0D0o0S 00S0@02TO *2T" 2T0L0 0P0 0Tt2T82 02s6@T @0S0 0 2T 2T1T0S y0S1 0R R   Q  0P =Ph 0Te 0Ta 0T] 00TY 0TT 0%:0SN80T t0TG :00TA h00kB @sB@vB hB iB _c_c_c_c0jB@fB@qB@f@tB@xB@nB@wt@oB@~fuBpBrBzByB}fwBgBvtmBfBlB {Bp@ -LMP0R,(Sp?P:|Q|1@  Z ,(Xa@00C\ 0  "! 0 00 1C&  0 "!0 0 RY 鉹` VA  ᱅PKP 8P80@  Z ,(_c_c_c_c0 -1L@pTP`Y 0S( 3PV 0R`@TVE 0S= A1P   0V S.`PP00C\ 0  "!0 00 0C&  0 "!0` 0 RP b_c_c_c_c0( y6 -APLp 88#A!` 000 R:0S 0S  0Ps $0S0 $ \Ap`00C\ 0  "!x0 00 d0C& \ 0 "!08 0 R阸_c_ca_c_c0 8-8@#LP|1`sp 0<@800 0@00`  `P00C& R  0 0#!x000 d0C& \ 0 "!08 0 RI_c_ct@_c_c0 -LM@< 88#, 000`0S0`0  Q0 0 0S00@00C\ 0  "!p0 00 \0C& T 0 "!00 0 Rh_c_c_c_c0 -LM@< 88# :0S00 0 P -LM@`TPp 00000 0(\0 @Ts<0Sp<& R-L`Pp U @V@1 .5`VPp*0 p-QLMP ` 0 `R@T 00000 0(\0 @Tp.<0S101 `0Kq:070A4 p0.0 c+0\ 0@$0  g\ 000S 08< 4 Ud Kd0S 0 0\0S0 āUh K \P*U 0 P: cR 0P*0 /0\*W \*0 RUil K>l000} 0 RUUp Klp0w x0P:UD 0 P: cR 0P:0 ~ | `0Kx `0Kqt0àqǠo0<àl<ǠjhpfldbP07*0q[U 0 P: cR 0P* 00A S@-@**\ *!00S c c PgU; 0S8 U0S6 0@T +0S  @T,PT UP\ x 1`?Bc00L` S g0 U R0PC\XP0S @gfff, ,00S0 000@b Q00 00C0b -LM܀`0 V$0  % P"0 @PPPTU 4pKM' )- zP`PU@00T00S$0 S $b0ab@ -LM0@S  0P,  00ahXx Q 00 p-0LM`PV @T 0  R @T`Vp "'P 5 0S 0 S 'Ppb p-0LM`PV 5 @T 0 R @T`Vp0S &Ppb -LMX- 0pW @T 0S @TpW PU 0`\ *0 0#\:Z #P  P 00 P$0  Q 0 b@@@H0Q P 0 RPQb -pL W`4 @T 0S @T XR 5 h&P Q `&P0PP*0 0#P:P P-L`Pp @@T Q P P@ @ 0S0C 0 @@ 00\ 0 $0\   L| 0-5P0L5l @T X@TQ 0 S00 10C1aZ0h># -LM5@05H2#h  -LM@)# h 0-@PTL @:ZT00000 -(1(Q(! `@0T0L0p %5R0C/@T@`00C\ 0  "!0 00 0C&  0 "!0l 0 R\0h3,(50S _c_cb_c_c0 0-@0L@PT (%P @T00b -LTM⤙`V, Pp@[ 9VX x9t VQ Jh90SPD9V t,0 S $ ,+ttP 8%Vx 8V 8V 8VW 8VI \D  0 x 0, \5 \H\(P000@P0P0C\ 0  "! 0 00 7C&  0 "!0'0 R q-cPt0 `  XPtz t1E  <'q< 00\5   F&P 000P0P0C\ 0  "!0 00 6C& x 0 "!0T&0 RtF&P 000HP0P0C\ 0  "!0 00 5C&  0 "!0%0 Rt1 ٪X50SP0SZ  P$5ATy @Tv t0 Sq0nX0S cS Sq 0(t )( 4D4$` 0tPK00% % 5 05`0`0C\ 0  "!0 00 3C&  0 "!0h#0 R @T 0S 0S @T'G#S SS_2VJ 52V 2Vz(POt0lPKp0K@ fyPu@ @ "@ )k\@ P40S  \0SX AU2V2 VD'PPB P 1V1V*1V 1V 1Vt0!$p1Vl1t0D Xv` t0 @1V 41V ,1Vl@K@ (t0@ p0Ky\ 0V 0V0VO(0ai$ixi zi FixIi i i i _c_c_c_c0qϖ@i$i i i$Fi@Hi Gi i Jii i 5i i$~i i 6i(KiŠi$ -L,M!P P0U,0  1 X 0S P @0@ 0RPCT PXP0Pl1 ,0S `,P0pD1XU.LK(  & 0S7 U@` 0S<Kc$ PU uZ 00pZ@ PETUXUP0 0eP  0 u& pu<K" uP PE p 0ab -LM@Q 0 S00 10C1V -0LS`_PU "PU PU  PPC  PpB L@T g"P5 @T( P@#  '000 0 $ 0@000@00 pp  0P T%0P/S%0P9Sb p-LM@`TP  "P @TpT  R0000 0 P 0S P00CS00 R$ $0l0$0  $063pP R0000 0 $ b -LMȀ 0R$0 0@T 00@T$0 S |$?@`TP 4pKV`F  & tPP@T0a -1LM@ T$ P }!P @T$0 S $T  R0 @T 00@T@`TP 4pKV`F  (& >tPP@Tb0a -LM0@S SL  PT(  P h0SW -1L0Mq@ T  !PU @TaPUG 0@Kf 0 / K00K  P@ <(P8>0S@.T`PU' L@K $  P@ <P!0S@ T 0 S | Z@1 @*T @T @Tb0abX -L$M@0Q0  %2 800S80 0 S h <55P2K4 K 800CS80ʴ5<55 0ai -QM 0P P -Ѝ0 ЍP0  Ѝ^ -L$M@APAU@@ D@ p`2@ X:T@S 40# 40 \0S @40   TQ |4 R*TA@@@ R d ( d d d d d d d d d d d d d d d d d d d d d 4 d d d d d d | 4PK  0P P 1  5 D0S02K D 0 p1  80S $00c~  FTXu 1000@*K  # #@0 S<Kq#b2P    1QC000S0 0000!005  !@) HrP00C\ 0  "!0 00 2C&  0 "!0!0 R騥 dS1q01P00C\7@7@ S~ 0 B0 0 }  0g0g$0C0C !0+TD T@4PK #@BKU 04PK  PwGP02KJ (,/@0<K @0 @"@0W\@PA@ 40NP80@0C`80@a_c_c_c_c0ʚ; p-LM@`P V ph -LM`p@ 0$   R \ 0S  R\  ^Pq  XP11<<1000 |000|0 "48<#X 5 86U5  UO $6U00SF0SA0S> 5R: R1 00C B 0 !  80S$00c  R@T 1000 8" S0 0C 0 0d0d$0C0CbsU iNR$t000d?4P0   0Sn P00C\ 0  "!x0 00 d4C& \ 0 "!08$0 RF(T `000 0R1000S@0@0@0`00C\ 0  "!0 00 3C& x 0 "!H3T  Qr i000Q0S 000 00 兤2UK 2U"r040b嫆2P0   0S) \P00C\ 0  "!(0 00 2C&  0 "!0!0 RQj꺣000 00 65i 5T!Tq070@aY<1P0   0S) P00C\ 0  "!0 00 0C&  0 "!0 0 RPh000 00 q Pt iP@`c_c_c`c_c_c0 b5݆6c#!^ ",!1 #: SS 0-0LSP@/ S /0 +  ' 0S0S 0S0S0S 3000  00 00l  d0ST L 0^ 0 000  0 @@@@ -t4LpM P00`K8K0p 0P@) 0dP00C\ 0  "!0 00 3C&  0 "!0#0 R00[ 80[A)lCP00C\ 0  "!80 00 $3C&  0 "!0"0 RT 9 >0S   @5P0xb00P00C\ 0  "!<0 00 (2C&  0 "!0!0 R 骡7 P@@  -  )00 p10S!00s?A0!TA !P00C\ 0  "!0 00 1C&  0 "!0 0 R4b@P00C\ 0  "!t0 00 `0C& X 0 "!04 0 R78_c_c_c_c0 -t3LpsM P00`K8K0 0pP@A) ,cP00C\ 0  "!0 00 2C&  0 "!0"0 RT q F0S  @=P00CS0) (BP00C\ 0  "!0 00 1C&  0 "!0!0 R 鰠 R0700dA 10C1P00C\ 0  "!0 00 1C&  0 "!0 0 R4z@P00C\ 0  "!t0 00 `0C& X 0 "!04 0 RP_c_c_c_c0 -@LMh@ -1A`L 0 S P00W |q`00C\ 0  "!H0 00 41C& , 0 "!0!0 R/U+ q! 0(0 \0%0 0 0 XX0Z Y@P< 07= ҟq P_c_ca_c_c0 ȁ P b -40LM @P0 t0b -LM`Pp@ <P 5TP 4 30Sp00p0  Q QXßTCTs 000 0R~000$#S`0`00`010%20p   0SW Bp00C\ 0  "!0 00 |2C& t 0 "!0P"0 R/h0| 0h0 | 00C\ 0  "!0 00 1C&  0 "!0!0 R000  傟000,QL00C\ 0  "!0 00 0C&  0 "!0 0 R7̞ (L/x<L40 3A [46c_c_c`c`c_c_c0 bQ0P0ȁ0Qx0Q *p0Q  5RA05L00R  R R / 0Q0\02i 1i i x i -  0@  -@L`p  PP @  0` pP0 90 p-RLM`@PPU@p 0-L P@\p 0  0P \ 0 ~PPx -QPLMpP` J WH 1RG 1RB 0S?0@S000000@ PU P@U 0S @T1!  P UR*01P UR:$ j0U0P00S @ P ` `T @P` P5i 6i( \ 00S \P p-LM0 PP `@u  0#U TpT0000 0  @ 0S 1 \1S@0S 0  0S -0S 0 00Sp@-0 PbUe Q@ * 0`R@ Q:Q*0SQ:?T00S eP*0SP:Tppp p-QLM`P@ 0 P @4PT P 0S P 0Sp0@- @0PS1!^d0 0S1\@ *0 0#@\:00_ -LMPp0 S,P 0  0PP0S 0 0 ^0 R*0P  R: 0 0SP0 0S0SA^@PgU 0 9 0YPUPP`V 0 0Y`V,0U 0 Z 1!P@ 0 S @T 0ST  ]P XP @-0S<@ 00  @ 0 -pL` P@ 0\* 0S\:0000Q0\ f03 0@@ 0  P@@0P  0   P 0@@  -L MP@`0UPR` U0 V|Ք fQ p@T0TS@DT0TS $P`U"0WP 2 ,AWkPP0DUpZZW ! 0Pp8 |10@0 d1, K0X,0pS0@ T*0S! T 0 0P0P0P 00P Q 0`0^00 00 00LT@ T*0S |t[  PpgW 00 Fab_BbB_ 0R P* 0R P: p-LM0P@S0` 0 T\ 00 00 0P0`@pp@b -LM0 @ pQ8 Pl@ 80080l0S 40  0p0  Z h@K@Ep 0 d` , 00 0_cb_c_c_c0b -LM@ R <0S 40 -LLMV; 1 0    0; 0Z00 0@P0C@ 0P00P=0 0C 0  0|KK {PKP@ @ 00 0T}_c_c`aDa_c_c04a|b|0 R p0Q ,0( 0S <Q00Q 400 0S <QC| b0S  S  0 S   0 R010`0 BS RA* 0S RR0Q 0Sڂ 0-@LP >1P P .  bP0T R000 R 0@@G-SMⰡ(<"4( T 0@ T@d @T 00 0 "4 40i8#8#$ 0$  0!0i 00 0i0  BD1 <1.X0 ,0S ,0  00 0P  0 0@, T00T0 Tz`0a| b b -L M 0@p@A`0d` 0p0#!dPi+0 0d0  0pp  -LMKmX? B8c0@ 2c2c@2`ϠAl  8 #, E.Mb -L MQ@`*0S S 0`*xp0 p媲``P PU&PPEEE p-L M@PP 40`00 @K@0SL LAP808 ZPp5p2pF܆ 0- L"48<P#HP1 T P"48<#HTQ00ADT@Q<0\@| 00 T@ RL 0hJT:<0\ T0L0P0SSP@0E F -LMp0P4`K$0 ) 4P0S L00P0 $0S $ 0@P  0)D0<0. 10 S 0ah bC - 0L 忾PEE b - LMR 40 S 0 0  -(!XL"x H` P  hU H -LK!!Q#7011A!1 ȠK1 K0A0 x!0hp00 cT1(0000 c( K ! a c0#7%c!c1c X@0c08 #HT 00 0 R 900T| ?A7c%c!c1cW XEن_____y_&,Ta>F_F 0-LM0P [[@[0[ P@0_ -L(M,`KD 4pKm4 i@$Ÿ$ 0@ Px Q eB!2b2c621b1c \ڼ0P*0 RP 04P:1!1!@P @@8hQ2[S@ ` B1 2P13[@S `,@"!@00Q@0 o k g00\ eB!2b2c621b1c1\ 0T52TBT\ bCh bpEF,G| b b(bb$ b(4 b4h bFF< -qLMQa@0 T00 0 S00 00C000CQ 0 "!000 t0C& l 0 "!<0H  QT g b_c_c_c_c0 -LMY0@S y000 R^` "2SX00X0 o0X000 0X>0S3 0S0 ' t 0 00t 'P000 "48<#Q000 R000 0S  bpt8X~ P["P 0%0S q Q 8 R(00(0  oQ00S 1ȗǟ 0  Q  00C\ 0  "!t0 00 `7C& X 0 "!('00'0 R^ 7PU 0QI PUP0#$0$ h("( "4 4Z0< "48<#8 4 p6 0hƟ00 00` C \` 000 0  "!0 00 6C&  0 "!5  Q f!$)-"("4 4Z00S 5  Q hP 000 @`P@U $@00@0` "4 408#8#$0$ 4 0ğ00 00C0\0 0  "!d0 00 P4C& H 0 "!4$  Q40$040 ğ0 10 Yf3 0ß00 00C|\ 0  "!\0 00 H3C& @ 0 "!3  Qo&f"  0P00 00d C d "^ 0  "!000 p2C& h 0 "!82D  "Ÿ  000 0d 0C \d UD A 0S 0S 0Se00Cl0\0sP@`Y 00 0 R 0S < R 0SR t R 0S  R 0SR1|00|0 $R(00(0 t00t00%p00p0P@`000P@| b b0GpF_c_c0 b_c_c0(bFF\ bh bC@-0@P H0^ 0%0S" 0 R T 0\ <P5 X0^ 80^ 00^ (0^T 1<1400 0R| b F -L M 0p 01 cQ  0  0 R~ 0Q0R  Rh P, U  "48<#0!$(,"P:,P PU, R3 0 "48 <,$#8(!8 ,"hCV ڲ "48<#V7  "4 408#8#$0$  "4 40f8#8#$0$ UA 0@ $(,.4,8 <"(!(#8R`c-ڲ0#$04V `W R000P #|%00C00f8#8#$0$  "4 408#8#$0$ Q,0S , 0S00p,00p PU,  ,P "48<#X P"48<U#, `V0P00 001S Tt@ `4`0V0C0P   @`00C 0VP8#8#$0$00S 00  000  R000 3@ 0 b|3B&! 02 SNX1b1 R000,c@00C\ 0  "!0 00 2C&  0 "!0"0 R0 0 0! 0 0 0!B Z @ 0@ T c Ə$" h00h0 0S0 0p 0 p02! 000S&!00C0Q Q00z\Q\1@  t P00B 8a@00C\ 0  "!0 00 0C&  0 "!0 0 RY 00S0<0 0 0 0 0 0  00 001c a\ bF_c_caaa_c_c0 ba(b - @LTp a P R0p00@ 0U0C0 DAR0<00 01P 0 b1B&! 02 S41b1 R0pp00p`P00C\ 0  "!0 00 0C& x 0 "!0T 0 Rhb̎F\ b_c_caaa_c_c0 -brLM 0ܢ00 0 0R0 00C\ 0  "!0 00 l2C& d 0 "!0@"0 Rx02 R $R00C0@g T  000 00C0\0 0  "!0 00 1C& x 0 "!H1T  Q5HAP 80S0C80*000 0C\ 0  "!0 00 0C&  0 "!0  Qoaa 00 0a000C0\0[_c_c0 b_c_c0(b bH b -dbddr 0  QL ( @00C\ 0  "! 0 00 1C&  0 "!0!0 Ra霁00C0\0 0  "!`0 00 L1C& D 0 "!0 !0 R;A0S Q000S0S 000 00C0\0 0  "!|0 00 h0C& ` 0 "!00<  Q m=a X T 0S p@T 3R ,0 S ,R5@0 R  3Q H0S <Q H0SQ P U 5SP1pP-pT 0S0  T 0S0 R ƕT 0S00S R; 2Q5 H0S <Q/ H0SQ P) U 5S@ T  0S @T T0pT;p 1P7pw 000s 0RP@ 0 <0K; K0@K80 b@Q TP, Y 尠ᲡpX 0S06SPU  0S00L100 @ 0Tp0000 0 V  |P h0  HP%0 0  )TTP 0 R  00 0S   0S00`0 a!0 0 X  0R X 0Q" ,H ,000C R0000 0 b(b -L1  '\ 0& --|LM͟x0 0, x0t K 1     0#2S S00  l͟,0 S \ , 0R p } :W  0lR C R ""!R00R0SL  000 bR 0 0R%0% p :W  A Q   0S D<R `0<,4$<,!4 $,. $<%, 0 P P{ PX DXJ 6S 00 R? !  @0r8 S,!bʌ R tK 0 Pt\ lQ X P!0 b0b S0l l0 P7 P@PLXTa0l!S0S0 eR 0@P % P t0S  L!R p00bS0`cV0ڸ\ !0R00B1ǁ ɓ`F0Vt0ɟ0t0`$: 0O ʟ 00 0 f 1S0fӲ1 Ӷ0 6Sڀ^r0 0`bVX| V000^L9@_0 6 S0 0bS30S 0R*  Đ QMt00t0\X |0@  t1S S 8A @@0 7At0L0t0  f>0 f t0S pL1 0cSX0`S00   X1R 0R60CS, 0 0 0 =' 00 0`%00 t0 6S3 S0lSڼ&6S 1$!S ! & 10cSƟ000H6H D嶤Pis6 l Pot tƟR` l RL 0!R 410cS 6bf1P 40y A$1TR? h52S 1 X |P h0  HPY| 0SK0|@0b0|eP:<t 0h!0bS5t0Ř`1S`5 0 0bS6 0CS ( 8 U 0  0S  0bSQ  P 6 S$L00S Ƀǁ 0 0cS L0 b00CSH00 @00Q/0008[P0  0Sx 6 SuʀCc 000t07hSdSt000C\ 0  "! 0 00 3C&  0 "!0"0 RA 0R  0K 0  t07t000C\ 0  "!80 00 $2C&  0 "!1  Q^t00t0 6S SI8C80CS    0 t1S S \t0 ! @0A 80@0 {0PaᏣ 0Paᄣ t0 0 t0 rN0a bbGbG1GbbbGbH?bb_c_c_c_c0bKJIG b(b0SB6S? 0  t07t000C\ 0  "!0 00 0C&  0 "!0  QMtD1 R= ; 0t0 0h0!00| @_81X|0 |P h0  HP0  L@ >0S   L@ 70P"t0ԢMM 0'x 0A S q 0bSQ:0\60S 0R @ 000 S @1 "0P000 D#\0 ?0P⍢U &j3Pa~ U E3Pao |@0P0l0 ,$0?0 T|⁢ wPU  0R @1 0c0cST000 Q V0 R *000  6%06 8CR 6S 1'0 10 GP!P$1`;0Q0'@0 !\@0< l<$!0, 0cS `c 000&0&?08ݡt0`0`Sl 0F0f 000t07HVLVt000C\ 0  "!0 00 6C&  0 "!0&0 R8 0K 0  t07t000C\ 0  "!X0 00 l7C& t 0 "!7  Q00C0PiLgL7''R?6'0  000cS0(LL10T108@_0z8 00 0 R000 0 0 Y0 0c0O(? T!0P0bSL`0(0/D)k R 00cS10cS 0 0  1 01 Q @  00cS10cS  Œ0SF \  0 0bS 00[6t S7 10T01t 0 0 0bSڤ 0 00u &+0+?08❠t0`0`S 0K0k 000t07H[L[t000C\ 0  "!0 00 ;C&  0 "!0+0 Rb 0KH 0  t07t000C\ 0  "!X0 00 l<C& t 0 "!<  Q-0!R$ 1'0 10000S00C0 `af0O-0 0 8=bJJl=l-t-R?_ Rh = 70 S\ L!p00bS P0Q0R00S 0S P@0S\ X10cSD0T1p L!Հ`Vw 00cS0nS 1S:6St 0R00 l R> 0!R 410cSb# l ? X  |P h0  HP2|@2t 0h!0bS5t0`1 S`500( 1R 40 :|0S  (0?0 Q~  0RpQ lLP a0lS0V 8 ȟ  0000|  @_X| 0 |P h0  HP40 ' L@ `0Stt7 R  0t0O0@'t0t   0L@ >&0 ?08ڞHPKd`K R R0 0 D0@ @KGKH@KN0 \K4Kd@KcKDK0 &Q Qw ! 0 S- 00 %0 S   0-P p  DX P58P101;   R $5@T2 0R #3Rʌ tK 0n P P P  Ppğ1010 SH1010vP 0 ? (  0} 0H0KGK D d0KKcK0`0 &K]3 ÝP  ~` 0R00 R P41010 D0  $00 0 y 0u `N0t0 0<4(<"4!_c_c_c_c0Pbbb -LkM PX@LP@@N@\ ß X ! Up`D@ \#t0D SD K1nK `P 0S o/KPP` b@0a Y Pl0L0Pd @0 0@0d PPP  ! 墷㟷 T1p i᠐00y U 1.@ l0L0D= S909D`0`S5 000  @[P P P 80S0C80 (;=1P@ ѩ}80d@  @ dm0[ 0 " 000  QlP0S0 000  QP0SY NFDQ @G(bb b -LMU0pS4 `0  S(0 80 , 0)0S8  0VPVP6@ 0D00)P` (1 01$0  1 @00C\ 0  "!0 00 5C&  0 "!0|%0 RGV d0 0SV H%0  U0S S P <4(<"4!<0<4(<"4!<  0 4#$0$ 0 0 :#40  0 R \40(,!$#, 9sU 0S` SI 0S? S' 0S|0S S /, Q<40 ,  0#0S;0, P48 \ 0`40  4!4 8<#` #8 0U 0 4 #0008  0b!$(,4" "( !8 偍U 80" c 0"4 40  l2@0`2P <47!t00 0CP   "!p!000 \1C& P1  00#!(!00! 0 R?P 1P@ 0 000t 't 0 0CP   "! 000 x0C& l0  00#!D 0L 0 R0ZW3U3b_c_c_c_c0b44 0\0!0000 SQJ -LMD@@6S S6St0 R`06σLs0S|hl 3QAQ @QF -L,M0@S`P(r 0S R 0S0S0S R 0S0s VV 0FSqgV Vc 1 R UY @ \H @ 0R:W00Ø S i%L0 ᫾aP ' p-LMDP@`UUP 40phꐾp- P y̌ Ƞ,8 0  ( "(4R! ,Ƞb -LLQ@@0 9 Q+(0 0  bbabb -LMh@ d0R\0\ 0Q00040@ @H@b/uabb0@-dd0`@S =0RHP00Q=0P(0$0/ b 0bbbbgfff p- 1 QLM@ 0 a00t0& @0 0C\ 00#!0 00 0C&  0 "!0 0 Rppht0tL`H@00C& R 00#!00_c_c_c_c00@-0 0P00 @0 C& 0R 00#!|000 h0C& ` 0 "!0< 0 R00@0_c_c_cGbb_c0 0-L@PDPU@Z0 -L4M0#,0 p 0`00tv |\ h 0bS700cS60(R6ʀN/(0x0(00O/\#9C1 S 01&6 SƱֱS0ü6#0@?0„2 R |PU 6S6S@0| R ĽP 40 L0t1S\0 V 8SFʰ0 G P!P 0QၫPV$1 A@10@1X Bp00C\ 0  "!0 00 1C&  0 "!0!0 R ,0S x,婆R/|匼4N0 8)0 0<@Kd\0;0K0<0K( 8 zP@ L0 ՚0L0ᐼ 06$0 0$0Q<00P [ [/ 5t0%K>`PKdK(0`@XK0P( L00a_c_c(b:HF_c_c04FrEb8j -!a P0L00t @0XqN/,0P0,008O/Ɍ0L^1 Q0 30r00r0@P00C\ 0  "!0 00 0C&  0 "!0 0 Rh.h0,`0 a \*P0 \:00<000_c_c(b:_c_c0Gb X DP @0 2 @Rp00C\ 0  "!0 00 2C& | 0 "!0X"0 R  2 ,0S 0,)5X: @ 0 2 000 @ 040 Ap00C\ 0  "!0 00 1C& | 0 "!0X!0 R/ KV)040 00 0(K 0 S S X pZ. °,0A804 h 00!00 00C\ 0  "!0 00 x1C& p 0 "!0L!0 RY 5$Sh 0 B0 0g  0f0f$0C0C0 P 00C\ 0  "!0 00 0C& x 0 "!0T 0 R#(0S9p_c_cH b_c_c0MЍ -LM Qp` 0Q0V00SQ񟗅 \ h P ܥ 0 Ц ( 0 8 d V Y xZ uE5P  ƭxP0P0C\ 0  "!@0 00 ,5C& $ 0 "!0%0 RX4 Ph0 44  s t i#*hTh$@ 000h  +  _@d@00C\ 0  "!0 00 3C&  0 "!0#0 Rx 0#v 'h0 E 0S 0S$0S(0S 8a,%b _c_c`aDa_c_c0F-QM 0*\Ѝ(dЍH00@- 0@00 00 vT2#Egܺ -LM1^0@!N?P1p@`eZp:U?ZZ o鬙 @Jy?Z@p ៙ m fpP -L?0@0c80 !<\ P!TP 8PtU"\@P P<p 00"0fPT   !202T PT0PT00T Qp00C\ 0  "!\0 00 H6C& @ 0 "!0&0 RsT0@ @PP@`TLTPTU`ş` 00"0P@ 5" "PPQ`00C\ 0  "!,0 00 5C&  0 "!0$0 R"0 PL0 PP\ l 0l@ 0 Pp0<0 ~mH`0P h@`d0d , Ġ `P̌$Hh, 8#$X`0.$%Čd@S&,#4`$ 0(̌4#Y 0 84`T @ 0@`TT@  0X`0p0 ? 0# 0P@T L 0laPPpT \p ՏppWPPTP~hLPKH KT0KX@K8` , X @#PPpG P 80hcVW Q RP0@K00` ?` 0@0CO0 @ JNğ 0@@K r @;4 @ 0hR !   0P` <0<@_0 S:0S* 2N d0S Xʨ` 0S,y)PH UP@jd R`@d@ڨ`0@S`0`Rd %d@5l0Sd ` `Sd dh ^Dhl T0! 00000' 0T @0S\pʔz ^00-00,000Қ,!)P@ K_"@00 #*2@00 000|*QhhPl%l0500;00200 Sm0Sj@@ gH00K  0&P@0 @@  0P;P@  01b -LMTAP0p@` <P  \0 0P  0 -LM, Tp0 P@,0pW4 @̠0h18 80  `<`  €0<4!0`0SW  << 0<8,04 0] P W  5P,04 0`K P<0<<0<]b<0<<0<PbP l -p1L `RD \X @1S>Q004qpW4(A(!P000'/P0P0C\ 0  "!0 00 0C&  0 "!0 0 RQ00@0040000 0`0AaOcPb_c_c_c_c0 -L017 A 0*1:TPU U U\ 0xPU* 0 0 33.PP':@ @0:'9)i: l0P|xtpPPPP|Pm 괈8   "tP@ 012 02!  `0 0C\ 0  "!,0 00 8C&  0 "!0'0 R 0  0 ꈇ7  | "^tP@ ` !2 02!  40 0C\ 0  "!0 00 6C&  0 "!0&0 R 0 P 0 <0 R 1 /90 R 1ee/1`PPL%@ 000  #R60%0CWh ,#0Q0R00SX R R'`U@00C\ 0  "!,0 00 5C&  0 "!0$0 R O #@00C\P 0  "!0 00 l4C& d 0 "!0@$0 R $< PP#000@00C\#ꬓ 00"0gsP@ 3 !" "PPQ\0 0C\ 0  "!(0 00 3C&  0 "!"0"0 R0 0 PPn2 0x0"0sP@ \2" "PPQ4"0 0C\ 0  "!0 00 1C&  0 "!!00 R[0 PP P:U!P1 0D0"0rP@ (1" "PPQ!00C\ 0  "!0 00 0C&  0 "! 00 R 0 P0 >PP )'%U4 z<c_c_c`aDa_c_c008 0-LM@P(U\|x |00\0\U0@0 R 0S$0,@0$0 R0`a0Xc -LMP@ T0P0ThO p-SL M`PA $0: PPU@0$0\0- 0 @\ 0P@ V  00 y$0@0@$0Tt #T T@p@ y@0$0QpMp 00Hl -l5LDM0d0 `T R` ) PP 0S$0PpW @ 줟0$ 0@$080$`0uPP$0@`0Se l4dP80 ,P L0 XK\K@H K0X@ P\PO0V0#U00S $0C#U U0S\0SX03 U0S PPL08 0bL0 UU u ų0 U0  00\)yzPPPP U 婳00z霳L0KT0 P@@0K0T K`PH d 8 P DP 4P 0 , XK 0@ H KX w0V0#P00SP $00,h Q,2 P@0 B#U U8 R9UL<4(<"4!<!1RL 8 @@H K0X >P#PP p Pp8Qm  L0 aLx Pb 0((!xPW0 b0x PpP <PP jPpW 0 0d 80 , L0 XK@ H K0X@ #PP$0 NL08 0bL0 ; (abʚ;b@B -LM`PP@Z 0S$K( K@T Tt #T \0P0S$0 $P(0,0 0  a^0 00 Ů0"S Ÿ@0( 蔲$0 2@T 0S 0P @TŸ@0( y$0 (0 0,  00D"00S9 440(!014 p1Sd S]h x0 B100 0 $ 411h  411x  0h0p$080x1000/, 0b0p0Wj P:Ð0$00$0 ,B $0 40 8!h0N0h04 ^n!x0CN0x0T~ T 0S1h x 04K,K0K P(S4 C4, wHcbXcbITbI@B -LM0˟d dT, h q@l P 0 bo`hPp <@pd0l 4 x0 | 倀   p 0^p  t 0D0 @ p 0PS010H0 HDLTKPKht0l  @ p DPLT0S p੟T0ؙ 00 h0e0(0, 8 l 1S0$0Ŝ9$ P @0 lɟ `00 ``P0 S T0S 0 P00C\ 0  "!0 00 8C&  0 "!8  Q\0yXZ XXS l8 0d00 R00@ȟ00 0 00C\ 0  "!0 00 7C&  0 "!7  Q$  $ 0dX0\ P00 /o`KXK\K P0` +`KXK\K P0`uXK\KRP0XdXK\K@0KPPP 4 \- 0  3 \0S P 00 6P `KXK\K wP0`<l#U0D#p媰0 `P#\0 X$0@0<0$  $ g{0 Q 0RMhP00C\ 0  "!40 00 2C&  0 "!1  Q080Op1*  80S $00c p ӯp p^ 1000p  B!<4<!4"<0Sp B 0 0 0p0p  0c0a$0C0C-@K0L0 zPPDK<@KHK LK 0@K  @ P} DmhLDKHK 0oPl 0apc_caIb_cXc_c_c0hc'`a$xI0Lc`c<ʚ; -Lę MɟP , @" 0 }lP` 1 01$0  1 PɟP00C\ 0!!)0 009C)0 "!(00 R(8@ pT(0000 0,@X<4<("4!kP@  !1 01!  P$\ğP00C\ 0!!($0 004C $0 "!3  Q 0@ 0p  @ 4$ 0 $0 00a Sʤ 0 0c<4,<0 S 0P U 43 3 01 00c<d  80SX p 00"0jP@ x !1 01!  <"HŸp00C\ 0!!"0 002C!0 "!1  Q0p 0@ 0@ 0 0<4<("4!< @0$00  00a Sʜ1 8 @ 0D0"0Tj $@0@0C\ 0!! 0 000C 0 "!p| 00 R$ R 1 0 +10 ,(C&  0 "!.00 R8(0SS800 `0004p 0 0!44 0h<  80S$00 00h =]@ 0͟0 "0cPP 1 01!  l- @00C\ 0  "!d0 00 P=C& H 0 "!(=(  QX0P 0p 0L 0 0 `R \0SA R P 000<4(<"4 !<0T,0`H<  004<0 440`0`Q < 4( <"4)< `08P, <$4 ,< !$ 4*,%<Z = Z` 1V  80SF \\;@ 0H[00D "OcPP 0 1 01!  *0@00C\ 0  "!0 00 :C&  0 "!:  Q0P 0p 0P 0` <4(<"4 `"<V# m  80S @ 0 0"0bPPሉ 9! !岑)@00C\ 0!!L9P 04)C6000 "!0)0 RVIP p 00c,  80S0 R@1@! t 0`d0 0 V   P00`eV @T0@@T0 00 0 08 40(0 0 0p40 $00 a7@ 000"\b$@0@0C\ 0!!`d 0H'C6000 "!0$'0 R $ R 1 0+10 (,$/p 0ScM ` -LM@P`0p1000p!3< P0`10<0 20 R. 00 0 00520Ȁp00 3< j`20 P1P`0V  02201050 0  hbht -LMl`LP" a@pT 0 S @T T !h0S Q00000 00@@t<4(<"4!<  ,K0l ,0Sp  p (0S 0PKl000p000p0kLa -LMPP R@80 , 0 p` P@   0 0n S000 P000@,K0KQP0,@0  00n S 000 x<4(<"4&l<4(<"4!'|, $ ,8 fQa#$,̂KQ< ʜ1 QOPࠈ R 0 0 0 R0000 0 @@ 4 0l<0h0<xt 8a@  0PP 00 c!0S0 !0"0c0 0"0cP 00 c! 00|3 ࠈP4K,K0KP0q4|a|MkL -LDML q@8 L 0P  L,0KX@ -P ,00T0 X@\ T㼠 09 ɟX`P@0 D P`0K`T 0XPQ4  T !<00 00c<  80S X < 4KwP8K\P0<@K@PKT @ P5P X^ T<0H  @0aS0@0 0,$,!$#<Z<0X@ ^0a 3SXP400@0 00 0R 0X Rv <0<4<, 4$!< , !$@,,@0p; 0 <4<, 4$!< , !$@,,@0p;0 <4414(PP< q@t ET0 ,0S ,6鸠K 0lP  5oK@918!0P`  !1 01!  pP00C\ 0  "!0 00 1C&  0 "!0,!0 R00`00` 000,0 0,`0 0, 4 , 0$00  00aSʢ01@00c<[  80SO B2P   ">P` 8 !1 01!  drP00C\ 0  "!0 00 2C&  0 "!0"0 R00`00` 000,0 0,`0 0, 0p$00  00aSʥd$00 @00a SO01@00c<^  80SR C3P   "=P`  !1 01!  4tP00C\ 0  "!h0 00 |4C&  0 "!0$0 R00`00` 000,0 0,`0 0, 4 , 0P$00  00aSʢ01@00c<[  80SO E5P   ":=P`  !1 01!  uP00C\ 0  "!0 00 (6C& 0 0 "!0T&0 R00`00` 000,0 0,`0 0, 0$00  00aSʥB$00 @00a SA0s01@00c<_  80SS hGh7P  t "<P`  !1 01!  wP00C\ 0  "!0 00 8C&  0 "!00(0 R00`00` 000,0 0,`0 0,  , 00$00  00aSʡ \$00 @00aS[01@00c<^  80SR HIH9P  T  "K<P` p  !1 01!  yP00C\ 0  "!0 00 9C&  0 "!0*0 R00`00` 000,0 0,`0 0, | , 0 $00  00aSʢ{$00  00aSz201@00c<^  80SR $K$;P  0  ";P` L  !1 01!  x{P00C\ 0  "!0 00 ;C&  0 "!0+0 R00`00` 000,0 0,`0 0, X , 0+($00  00aSʢ$00  00aSQ01@00c<_  80SS M=P   "];P` (  !1 01!  T}P00C\ 0  "!0 00 =C&  0 "!0-0 R00`00` 000,0 0,`0 0,00,0 <> J$00  00aSʡ01  00c<  80S N>P   ":P` 011 01!  P00C\ 0  "!80 00 L?C& T 0 "!0x/0 Rt00`00` 000,0 0, 0 0,0q 0,0 5   L8 R55 !<4<("4!<0 q<4<5<( "4!<0 q<4 5<( "4!< 0<4(<"4!< 0(<4(<"4!<0, r  4Ba<4<("4!<000,$,!$#, 4 r  D4Ba<4<("4!<0 $00 @00aS?1@0 0c<v  80 Sj THڬS3p   "":P`  !1 01!  Xp00C\ 0  "!$0 00 3C&  0 "!0"0 R'T00`00` 000,0 0,`0 0L0 ,0`0,0 <4(<"4!< 0 L0,K`$00  00aT$00 @00aTo1   0 0c<`  80 ST A1P  | "9P` `011 01!  4qP00C\ 0  "!0 00 0C&  0 "!0 0 R00`00` 000,0 0, 0 0,0L 0 ,0 $00 @00aSʠ0@Pc(3Mb_c_c`aDa_c_c0 -LM pT0! 0 < 0 ` ` T0@  00CSn80Si0 0 啰 0 0P` 0 M00P@@T 000 $ mP0P60 @ 0@ PP VP 00V 0K00 0PT 0R 兲0S 00( `P 0@ ^H $   0K `R O !<00P 00c<@  80S4 U< KK4PP Yʔ!0P 00c<  80S U KK 0PP 0K✠K⠐K  P`j ag 0娀  aP00 P0,$,!$#< K  0jP㨀>zV( V( Q ? R  QQ 70V00S T0@ ``Q  0;0000  0S 0SX00 `0K  P R @  0aP00 Y0,$,!$#LT@TژH`#z0@ l P0 P0 3 0P0R00S   <S T 0KξP`x0 0R0 f 0 @ aP00 N0,$,!$#<<0崀  aP00 %0,$,!$#<y0 ;R0   060K  0P㴀 b0K  KPYK  0{PP 0K  6PDK  0 dP9 y EPtxy <S( 0   060T 0K1P`00\0 0  aP00 k0,$,!$#0@K [P@@P80@K NP@@P80 HKH {P@Hw$00  00aSg01@00c<m  80Sa U5p   "-P@ t5! !Hp00C\ 0  "!0 00 5C&  0 "!0$0 R 00 @0@ 00,0 0,P0 0L0<,$,!$,4 ,<, 4  (<0l[$00  00aSʓ1@00c<w  80Sk WIڤS3   ",P@ |3! !P#0 0C\ 0  "!0 00 3C&  0 "!Ÿ"00 R'W#00@0@ 00,0 0,P0 0,00,0 P<4(<"4!<00,h>d43$00  00aW$00 @00aWE1@00c<_  80SS Q1p  t ",P@ X1! !,p00C\ 0  "!0 00 0C&  0 "!0 0 R00 @0@ 00,0 0, 0 0,0 0,0 b$00  00aSʡpb_c_c`aDa_c_c0\c -LTMT T10NP S`P X \ l dP H0,$,!$#<h0  0@\l l0  QT 0 S<  T ,0Kwl@T0 4 T!<00P@00c<$  80S U< 0K,KPP\\00!0P 00c<v  80Sj U\00K ,K 0PPl@T+ 01@00c<  80S ^>`   "+P@ 1 01!  }`00C\ 0  "!0 00 |=C& t 0 "!0P-0 R00@00@ 000,0 0,0 0 <,<4(<"4!<, 0 rJ 01 00c<>  80S2 t\t<`  h  "*P@ L 1 01!  |`00C\ 0  "!0 00 ;C&  0 "!0+0 R00@00@ 000,0 0,0 0@+,00,0 (<4<("4!<001 00c<  80S Z:`   "J*P@ 1 01!  z`00C\ 0  "!L0 00 8:C& 0 0 "!0 *0 R}00@00@ 000,0 0,0 0,  , 0001 00c<`  80ST \Y\9`  P  ")P@ 4 1 01!  y`00C\ 0  "!0 00 8C&  0 "!0(0 R00@00@ 000,0 0,0 0,  , 0001 00c<  80S W7`   ")P@ 1 01!  w`00C\ 0  "!\0 00 H7C& @ 0 "!0'0 R00@00@ 000,0 0,0 0,  , 00(q- 6 Q 01 00c<  80S PVP6`  D "))P@ (1 01!  u`00C\ 0  "!0 00 5C&  0 "!0%0 Re00@00@ 000,0 , ,0$ 0,0 (<4(<"4!<0,<4<("4!<00q 4 Qj 01 00c<^  80SR |T|4`  p "(P@ T1 01!  (t`00C\ 0  "!0 00 3C&  0 "!0#0 R00@00@ 000,0 , ,0$ 0,0 0<4(<"4!<04<4<("4!<000CSh01 00c<  80S R2`   "B(P@ 1 01!  `r`00C\ 0  "!,0 00 2C&  0 "!0!0 R00@00@ 000,0 0,0 0I ,0,0,0 H0#((0"4(,8#$ \0 4K8pK$00 @00aSʠ2$00 @00aS~6& $00 @00aS 01 00c<_  80SS \<`   "g$P@ 1 01!  }`00C\ 0  "!@0 00 T=C& \ 0 "!0-0 R00@00@ 000,0 0,0 0,00,0 꺸$00 @00aSʡꮸ*$00  00aS)01 00c<  80S ^>`   "#P@ 1 01!  ~`00C\ 0  "! 0 00 4?C& < 0 "!0`/0 RV00@00@ 000,0 0, 0 0,0Q 0//,0 00<4(<"4!1 00c<t  80Sh UHf6p   "<#P@ 1 01!  嬕p00C\ 0  "!x0 00 d5C& \ 0 "!08%0 R%U<00@00@ 000,0 0,0 0\,$8,#$,00,0 !,0 0\  5|$00 @00aU$00 @00aU*e?P 1 00c<v  80Sj UHc3p   ""P@ 1 01!  |p00C\ 0  "!H0 00 43C& , 0 "!0#0 R'U00@00@ 000,0 0,0 0,0T0,0 <4(<"4!< 0 T 0,4$00 @00aU$00 @00aU1 00c<`  80ST Q1`   "("P@ 1 01!  \q`00C\ 0  "!(0 00 1C&  0 "!0 0 R00@00@ 000,0 0, 0 0,0T 0,0 z$00 @00aSʠ0NS$00<\>Tʫ-,K)PcMb_c_c`aDa_c_c0 0-LM@ 0KPP 0sP0 -LTMT TT X L  T0\ !\0T@0Q<` l0 `d h \\0h $ 0@ ll0  QL ( S<  X,0Kjl@T0 i X!<00P@00c<Y  80SM U< 0K,KPP5\00!0P 00c<  80S U! 0K 0,KPPlP] 01 00c<Q  80SE Y9`   "!P@ 1 01!  @y`00C\ 0  "! 0 00 8C&  0 "!0(0 R00@00@ 000,0 0,0 0,0h0+,0 " 4001 00c<  80S 4X48`  ( " P@ 1 01!  w`00C\ 0  "!0 00 t7C& l 0 "!0H'0 R00@00@ 000,0 0&0, 0 ,0R0&,0 H00&00000 04K8pK X0<P0  0aP0<0 '0,$,!$#LdP@d@ 4aVRl\b h _ 0\``XPK 0PPX  `0@K LP@@0<aP0<0 dP X <4<("4!<PPP0@K &P@8@0@K P@8@`HK 0H GPH` n 0,$,!$# 0@K P@)0@KP@0@K P{@0@K Pp@^F$00 @00aSExb| b_'Db\cTca_c_c0_c_c`aDa \0s^ 01 00c<R  80SF dPd0`  p "P@ 1 01!  p`00C\ 0  "!0 00 $1C& , 0 "!0P!0 R00@00@ 000,0 0,0 0!,00,0 \ȡ<4<("4!<001 00c<  80S R2`   " P@ 01 01!  r`00C\ 0  "!0 00 2C&  0 "!0"0 R00@00@ 000,0 0,0 0,  , 0001 00c<s  80Sg S3`   "P@ 1 01!  s`00C\ 0  "!,0 00 @4C& H 0 "!0l$0 R&00@00@ 000,0 0,0 0,  , 0001 00c<   80S T4`   "dP@ 1 01!  pu`00C\ 0  "!0 00 5C&  0 "!0%0 R00@00@ 000,0 0,0 0,  , 00\(q? `6 Q 01 00c<  80S V6`   "P@ 1 01!  w`00C\ 0  "!<0 00 P7C& X 0 "!0|'0 Rw00@00@ 000,0 , ,0$ 0,0 \(<4(<"4!<0,<4<("4!<0\0q <8 Q{ 01 00c<o  80Sc lXl8`  x "P@ 1 01!  x`00C\ 0  "!0 00 ,9C& 4 0 "!0X)0 R"00@00@ 000,0 , ,0$ 0,0 \0<4(<"4!<04<4<("4!<0ʰ$00 @00a Sʑ01 00c<]  80SQ \Z\:`  h  " P@ 1 01!  z`00C\ 0  "!0 00 ;C& $ 0 "!0H+0 R00@00@ 000,0 0,0 0, 4 , d`$00 @00aSʣ01 00c<[  80SO \<`    "P@ , 1 01!  ||`00C\ 0  "!0 00 <C&  0 "!0,0 R00@00@ 000,0 0,0 0, 0$00 @00aSʥ$00 @00a S<01 00c<^  80SR ]=`   "-P@ 1 01!  L~`00C\ 0  "!0 00 >C&  0 "!0.0 R00@00@ 000,0 0,0 0, 4 , 0>ꁯ$00 @00aSʢ01 00c<[  80SO _?`   "P@ 1 01!  |`00C\ 0  "!l0 00 XP@8@1  0 0c<r  80 Sf VIu5   "P@ 011 01!  pş0 0C\ 0  "!<0 00 (5C&  0 "!$0$0 R"V,00@00@ 000,0 0, 0$, , 08 #$,00,0 *,0 0H '_$00 @00aV$00 @00aV X?`31@00c<u  80Si VIڜs3   "P@ t !1 01!  Hß0 0C\ 0  "!0 00 3C&  0 "!"0"0 R%V00@00@ 000,0 0,0 0,00,0 <4(<"4!< 0 0,c'eҩ$00  00aV$00 @00aVH1@00c<_  80SS a1p  t " P@ X !1 01!  ,p00C\ 0  "!0 00 0C&  0 "!0 0 R00@00@ 000,0 0, 0 0,0 0,0 _$00  00aSʡ,;b\c_c_c`aDa_c_c0 -LM` P0 @p 0 lT T0R PW ᏞT ᧞UP៞T T0R@0S0 R80S  (Pt ၞ @ 00 0 ,zP w 80ST 80S 8 p-LMP` @ 0P@ `p -LLMTP@`p \  `  d d@ P0 000 H L ,0KT X \p\0  !<00` 00c<  80S VX< ,K0K⚶P`:Z0`  0!`@0 0c<3  80 S' V0KL  0,K|P`\^0 P0!<00` 0 0c<  80 S V< ,K0KZP`0S0d@!0` 0 0c<q  80 Se V0K,K <P` 4K08`KAXP8 80D  <aP0<0 ő0,$,!$#`   " PP 1 01!  ~`00C\ 0  "!,0 00 @?C& H 0 "!0l/0 R00P00P 000,0 0,0 0,0尟0,0 _$00 P"00aSʡ1@00c<t  80Sh THڴe5p   "PP 1 01!  `p00C\ 0  "!,0 00 5C&  0 "!0$0 R%T+00P00P 000,0 0,0 0,0X 0,0 <4(<"4!< 0 X0 pߗ$00 P"00aT$00 P"00aT1 00c<t  80Sh THڔc3p   "PP l !1 01!  @p00C\ 0  "! 0 00 2C&  0 "!0"0 R%T00P00P 000,0 0,0 0,00,0 <4(<"4!< 0 0,[W$00 00aT$00 P"00aT>1@00c<_  80SS xAx1`  l "PP P1 01!  $q`00C\ 0  "!0 00 0C&  0 "!0 0 R00P00P 000,0 0, 0 0,0 0,0 $00 P"00aSʡ$ _c_c`aDa_c_c0 -L\MT P T0\ \!` @0`0 P d 0Tt0 p tp0H $ Q<   ,0KX hP lP p R0 P !<00P 00c<A  80S5 U< 0K,K⚤PP` R0t!0P 00c<  80S U \00K ,K`0zPPp\L X0s 01@00c<  80S ]=`   "P@ 1 01!  }`00C\ 0  "!\0 00 H=C& @ 0 "!0-0 R00@00@ 000,0 0,0 0,,00,0 X 匜<4<("4!<001@00c<[  80SO @\@<`  4  "8P@  1 01!  {`00C\ 0  "!0 00 ;C&  0 "!0x+0 R00@00@ 000,0 0,0 0,  , 0001@00c<  80S Z:`   "P@ 1 01!  tz`00C\ 0  "!@0 00 ,:C& $ 0 "!0*0 R00@00@ 000,0 0,0 0,  , 0001@00c<  80S{ PYP9`  D  "|P@ ( 1 01!  x`00C\ 0  "!0 00 8C&  0 "!0(0 R:00@00@ 000,0 0,0 0,  , 00X (q 7 QN 01@00c<B  80S6 W7`   "P@ 1 01!  dw`00C\ 0  "!00 00 7C&  0 "!0&0 R00@00@ 000,0 , ,0$ 0,0 X (<4(<"4!<0X0,<4<("4!<0X 0qf 6 Q 01@00c<  80S U5`   "P@ 1 01!  u`00C\ 0  "!P0 00 <5C& 4 0 "!0%0 R00@00@ 000,0 , ,0$ 0,0 X 0<4(<"4!<0X04<4<("4!<0\4K0 8`Kp   "P@ 4 !1 01!  `p00C\ 0  "!0 00 >C&  0 "!0.0 R$U-00@00@ 000,0 ` 0, 0$, , 08 #$,00,0 ,,0 0\` w $00 @00aU$00 @00aUlΟ@0 Z D   P40KЎZ`8  P!<00p 00c<~  80Sr W< 8K4KkpPlp Zr 81@00c<f  80SZ ]=p  |  "P@ `=! !@-p00C\ 0  "!0 00 \`L Ke9 P%@0 0@0 )0K KюP@H0K K ÎP0 KK 巎P0 KT RP@@ 0a^00 @<4(<"4!̃0 a^00 0 K,P ]0K K |PS@0K K oPFZ@ 0 a ^00 D0 KP1@;H -0 KK KP"0K K ?PK  K0nP  q0K K (P]꽀 $00  00aSP b(3_c_c`aDa_c_c01@00c<x  80Sl UHlpl0  x "P@ 0! !00C\ 0  "!0 00 1C&  0 "!04!0 R)U%0 @@ 0|0 0|0 0|00|0 0 <4(<"4!<00,+($00  00aU$00 @00aU -LM@`p8e0#0 0P  \, 0 @0 P00C\ 0  "!0 00 2C&  0 "!0"0 R @08 0R@0000   P40<"Pv 0``PW000 zR 0 .uƵ1P 1 1 bB&! 02 S5ʌ1b1 R0@@00@P00C\ 0  "! 0 00 0C&  0 "!0  Q0d| P0 0 ,K,0@vFm v@A_c_ca_c_c0aaa -LLMTPP@`p ` d T0 P  X  \ H $ ,0Kt`0PS0 H !<00` 00c<9  80S- V< 0K,KP`Z0d!0` 00c<  80S V0K,KP  0P`T04K8KP <0@1$G/c8 00,400\80 0 00P400T ύ;vQ((a_c_c_c_c01u4 -LlM0@tK T0@  80S:S S 0BP   0d phzp E -LM @<<<ǂ0 05Lb -LM @<<<᱂0 05Lb -LdM@`P< + ,@0S 0 0TpK@0hd <   \0K<  0T0K0 04Lbb -LM @<<0`S 0!0 Sm @,Ÿ  0PpQ `0 V!P0V P`80 VP 0 (0R- Q0S& P T0S P` VP d00 TQ0 d03T0`80 VP9P6P P000Q 0 T 0 (0RQ Q  @`0 0K@OP0H00 @A 00 KOP0 @DPH0c PO xO -L M0p00 00 P0, S j V@ 0,T@# V L#0S 0C0Ÿ 0P 0 T 0P@q0p` 0S  0  0Sh0 0S 0Sh0Po0`0 ` 0 R 0h0 0 0 ` 0S00d0X0 0S``l0P0S 0S' P00SP0 ` 0S TP 0S``l0P0S 0Sl0P0s  0S0l0P0Tll00Sl0  ,0`@ 0PDL#0S0__@Lzh -LM P@,`[0 W4 S0<  D 9D@/">C2"/P!008BS@ C9?#404p$@WDtCY8 ,0 <  004,  `!T@,P@1@#W<P@1T@XP2@p"S 0 S08 SL3 R2PPP2@p"S 0 S08 SL3 RPX P"00 SPPP#00@ SPDpS,@PD `P"‘\00pS04pS ࠡ`P PP ‘\00@S04pS ࠡ`P  - PL\`@pmP 10SBt0 0Zh8 0 T 1P-[@ g`,@J`^VP3"0 SPPP#0 SP8 0>`X8 T`0l!`!R @ R D0| 2a #@`& -LMPp  P,P ,@`VPUPa 0 P` ,@V,0`VP 0 PP`,0UPV -LM @PP4  T 0cSP\q8 0 B0C0 Y0 0 0! d ,K0MP`,8"HPQ@ 8  3S UN2  0 T0XP<0 0!8?\>`0 0/ ?> 00cR#`[ P80iW00\!8?\>`0 0/ ?> 00cR#i P<PX!@!400C40 g!40040T0XP%0 @?Q>`0 0?>0 0c$00C$0 P B 40P 00C 00@0 00,cM ,|,MXU a -LM @Pp4 PP0 00Uz 0 0 ! 0d 0,KTLPh,"H`0S 3S MY00U 2  00U T08 UZ P !40 SPUUA 0 0QPp7 ^!?Q>`0 0ς?>00c  ^$00j$0 P j 40  0Z0j 0 40 j0C40!400400,x$L,Y,9M 0 ,?pd0 8 Z00 ?Q>`0 0ς?>0 0c8 ^$0j0$0 P 4  00 0 40040,L0 ,pU a -LMR pH @2 0Pd ( 80P(X`0ZC 4R`0  0400C0 P B 00C0| P @P0 0` PE3 RX0  200000C0 l3 RT000T0 0C0 0員 800c 3 R`0` Z"^PXQ0 P%R4 |080 <  2@ @!QT000T000Sj \28Q4 X0 20 0<,0 , r@P0 h0` d4 x40@P`,P0S4 @T40TX P, 0S30 G` 0`<`80WLq4 T52000?00s2 q4 T52000@0@ PR`0  0PV.L5sX50 0S`0 RQ0@@0 0 lh`00 DD@T,P0S@TPU @\ -LM `Tp 1S0 0 ! 0d 0,K:JP, 8 80"H@0S 3S 8Kh$% 0WP0SPU 0PG0UC0SPEUT3 Q, 8 Uʼ000  P@ l?p >14 PHX P0 ^ 0 S40\4 \` 0n0rP02U8(@8  /P80PU,080 , 8 8J80`D`0P,080 8U  -LM P`P@P00 0 0 0! d ,K0IP, ,倂HpZ4  3S J 0S H2T  080  8 @>Z!\000/ > 00cR#= 081 a4 ^Ϡ\0.A00/ kP  l1@R\0/ ^PI <1 Z\0`000?0A0@ P@0.Z\0!00> 00c# 00 0C 0  P B 0 P0C0 ,I0F Y0 00 P 2 020 0RU a -LM p`0PR 0O0  02O8T 0A0U2Sʼ@`0 $0X: 8 00ş R00p  0x00 00 ! 0d  ,K0HP,,$H@T 3S I4   00U 80A040 ?80 @448T`0.!48000?.a 0 bS1P4 0< m T0USZ% #@?T>`0 0/ ?>1LQ p3T`0 0?>0 0cZ$00 0$0 P R  0 0 0480 24R`008008?.a 0 bS1P< 0 2 `R4 `0RA F P00,H$08 0a$08Pl 0l  000 P 000| 4@PvZ@Pn0 P0` LPE`\1 RX0  2000000 1 RT000T000 00` T`0PB f P 0 R`0 -  0B000 P 0 000| P0 $$0`xhU a -LM @p,0 Ws*4 0 0 4 ! 0d 0,K 00cR#0@g0P 0 S P Q,0` X, 0@ 8,0, @/>QU OTTx    G-M$PP0gl0h `Qpb?>1 E   @$?p > 1^ࠡD T! 0  S \ d@E? >j1^࠱D T!@  LP \l0 \ 1 Q0 110b1X10l1$5S!0SL\ T3Ѝ?>1 E -LM P@P 0 85 0 00 0 @ R@  PU00\pP@ A` VV V 0 4R@_i 0SE:0SA:0 @T00 T00S  Rʠp0(`VP@PZ P@P  0S:0S: 0S @0 0@YEPPFV8 8%0@P0L 0`@V \  09EPP (0 > P0@ xK P`@ wPP 0x0(     0S:20S/*@5L 0`(0 @ xK 0PP \  0P?G 0d x02T0 0<H @0@P0`|0Kd KPP | 0` B| 1X`tKV P    pd0G0 0@K@DPPO`@K|0H \a V pQ @00xK  ~PP3x`0` dG0 PF d03 T0 d0KH<@>0@PDPPP ?\00Sa@  DEEEt`K V@ *0 r00V@:Q00 TkD 0 ih00dh0   R0ad0F0 K0,DP `0KH DD 0' sjE RV? P0! 0xK 00  PP x`P` 0 0P@F d0 3T00 P00!a ;DD0<H0@P#E Rt 0 0 K0CPPZ0 @0b0 0F d03T0 0 @ 00xK  PP;x`0t` 0 XPE d0pK3 T0 H<J0@PCPP"` 01X` X0 0  (0 xK00 @  @PPP @@00$0x1( P U  C DS>00K L0R-PK ?@K 00 KKK K0P00@0S:0     -LMPT`@ 80  000    0 08 00R00S 0pKr  0 R 0U 000O 0 R U0D  0 R 0V( 000O 0 Ry V0  @ H0P@   0 R 00 0 000 O 0 R  00$ H  0 0\%1RC P` 0p"0 0 0$@ x`0dCA0 4K0xBP@@0Qx40 H 8 R T0@ @ 4>C4B4C,5Sʠ0' 70V0   V 0000uU0aU 0000RT,  -pLM`X =8 0BRS5 0S00S' R 2P@   Ҡ 0@(@,@4@ 0 PSP  0K000 X@W= 45S:05S*0 00K 00P@ 0 R0000 ᒠ l "B000 0B  z@8500  0 R0000̐@00P r 0@40 t @0b00 t P0b,0 0\%:R |@K|@Kp(< 4K1SPUZ0 PU 0 R01( 0 1p0 PEU000 00\%9R K(< v(< q 0 R 0K0X}\)0  Z` 0@0 0 t 00b@<0 t 0a0C80 P 0S11X000 ȠZ'1SiPUZ@ PU 0S11(0p00 ȐY PEU0SR 0S@P11(0p00 ȐYF Ġ Z P0 #Q/ 0S{:0Sw:0P 0S00  R0 @P 01R[ 0S;:0S7:̐0Q @aT ՠ PT0QS P ؐ Ĕؐ 0S00 0 R a /000 0 ؠh00jh0̠ S>0LR-K NK ?  K 0 0 0S:0 @KS>0 LR-LK ?  K0 0Pp^K0 0 Pg 0S:0^ _ 0S!0(0 1p0 U 0P 1R // 0S:0S :00@ 3  @KS>0 L R-LK ?  K0 0@ 0S:0 @0Kd K1" @0!T R 0 R0 1X  0100  0  W~}0PK000tKp< p` 0 R01X 010 "PP oP@ 0K 00PP@r 0 R0000 U 0P 1R @_= 0S:0S:00@ 80S 0Pc0HB ?@@ S>0LR-0K0 PK ?@K ^K 0K0@ 0S:0 0 K0&T 0D S/& 0S :0S:D0Sh0S 0S 0(pS  2 0 R 0P@0050 0/ 0S:0 0SgT(aH  -L4M0 P0 80 P T 4 0\ D H0 t0@H@T H 8XH`00@ 04D@ L@ A< 00 m85 ,00,0<0<0 <80&Q0 >< TPx<DPP08<|HT 0 PP  P$P80Bd4 P  QD 00 ttP00C\ 0  "!@0 00 ,4C& $ 0 "!0$0 R0 DzthA@ T0@ @<>PPT Dt H0@B4T 0cpa@DVHTp 80SRHaV]D0SS b3 @ 0D2 bB&! 02 S;1b1 RD 0D D 00 xR@00C\ 0  "!D0 00 02C& ( 0 "!0"0 RP  Tja ろ<00 :00?d "L0,K0P P,0TU T P  0R0d ",KT0P0PT0 ,0PP P0L0 00P0 \<>K%a4 VD @P P  P  P P P  P  PPt Pl P<>0`L(aa_c_c_c_c0aaapaaPaa0aaa`  -LM @0KPP0 K 80  P 0 5R/8 0S#:0S:0 00  ,K0=P@8Q,854H 0 80, ,_> LRS>-0`pǏ00  0S:0 A-P8@T`p T ?>00c0Q3@T TX0X  0S  R1 018ĠOTT -80L0CS%(d<ddd0S0 #Q00 L0 R0S  -80L0CS!ܯ000 10B0  2 R0  00  -80L0CS!x԰԰԰԰l000 10B0  2 R0  00  -80L0CS!8Pp$0S1 S20#B1  0S 00  -L}  -Lt  -Ln  -Lh  -Lb<  -L\d  -LV  -LP  -LJ  -LD  -L>  -L80  -L2X  -L,x  -L&  -L  -h1LM`Q`!00pRP@<10`@K Q ? 0P K` O4 PKP05SPKP R0 0 <@@0000@< 0 PP P㳆L㰆,P ą,LPxPQ`IOP009004\ /8\4 vPahd(WTTc (  E-0 LS03R %5p00P5,5S ڬ4S9Ӭ4հ4S@0Ӱ400tA/SpPo5@"p%$\ZH0L0SO/͎ -L M@0Qp `; {P@ҍ X00#00' PP@р L|  0U 0Q hn@iOP@0:@0  -@0L Pp  OP@`@0 S@`V OP@P @ m0 0n@ o1 -p`P\LP0d -40( 8$@<( @`@, T0C0H0VZ  Z Bl  D $JT  p-LM80@SP0 0hl0S  M`V p  0yn0S0 NoN -LMa@@ -RPp =SAT8 K8 4P , 0@  N8p @0 #=0T00S<K <0PpST 0@ @ l  0/n0S  po@ =SPp  -LM4 q8  8 PU4,0KPŸ \K@T!`0T"0 p@00@0, `,002 0P@ ,NT P0 0 0$@rx~`0dCA0 0K04P@ ,M0068  @xQ00 H 060x00p1 4,0KP@A 0S@@l0P0S 0S1 Z:P 0S@@l0P0S 0Sl0P0s ,0T @000\%0R ,08 0,5Sʠ 0p00t0 0S0l0P0(:l,tM80080PccxP0cccT@-@1T0, T:F@ 0000 0S00l0P00 -L MP, 40@0 PPp#8  R4 g0@d 0 p6 H`D,QE V580p W 0\'d0T   c@000h 0O6`00h HL5H sP5,5S,>QS. &50@40P0 SHŒp011pGW-400P000 a p-L Mp@P0Td``  pH@`< 80`@|ph _-c0c@-QM@ 00CS X P0 Ѝ@-@Ѝ $  dRhROO -LTM8 @ 0< P0 @D@  45R 05R@P @@,@ 0S <P0  0S<< 0000`PU`VP0D@P  PH 0 < d P` 0 S/ <@0S:0S:D 0\ @D@08%\0pcWp!L0 0OTSp0@` h rd h 0S 0SF0SC 3 R9 d@< 0H@S00 $,K8Q <P@&H<$,@0cXX pL H@ /P@, 4@,@ 0SvP<<0004,<H$ 0AS ,K8H 02 Td0 0`@R4* 0S:0S:\4 4K,@K8H 00K @2dD D@RS>L-0`ɯ00  0S:0 0St0p D@ S>L0R-P@K ?  0D0X00\0 0 040D0X0 0\ *<0 0S:0 <D <d P` yUvdR -L\M0 08  4 00PL 0UT0 p4@80S S T8l  8 0l R0000  0S|6d t6X 0S 0lS00S 0 Sl 0< S"4%R:05S:8408 0P0R00S l  R:0S*= X 0SD 0@K0T`\ ^P <0l P z<8@850  lX!RPPl00@P P H P0,KB0P8`Pkl0 Po 0 S 0S:0S* 0S l 0@ 04 R0000#L 4, Z` @0P`<  P0  #Q 0S:0S:<@00e`XHH8 ᎗P`\0S<@H0 0Sf ,2X00V0S8P0008PUkXQ0 0S 0S 0 R? 0;08@PXY4z L^oV T0@0K@\0@8@l X b0P@88X0Q\ R  0` 0;080P1 R 0, $R0000 <,1,1,0H H_r< S>0LR-pK`@K ?  pK0 0@ @`K eI 0S:0; L@DK 0 `@_]P*D0S'\ P P`XW0T DQ  R 0.SR 0.SH0P 0PW -L8M0`\@ p@: \@7 P@0< K8\08 pPP]P@@T0D R)0[*0[S""[0R0 0R@ R ?@00T@ K0P@ @P T @P?G@..0- -LM@ KP 0 0 0-@DP L@DP00 4 0 0 -( L0S 00#_ 0-LMP@ KP  0S 0Sl0P0S w?F0000 0- D0@L PP0se0(3 p-LMP0 @B 0  P 0sd 000Hp @_ 0S0( 0p00.?0@8@W@@p(30 0S00D d< X R  0S 000 p-L M0@ `Rp KU0 R= 0 00 0 R  00 0 O0 0 R  00 0( OH0P@ 0 0 R 0  00O0000 00 0 00 H  0@0 0 a -LM`P@2 80S t t   t    T0@ $PV 0Sh0d `0X 0S  0S 0pSt   0B  -LMp0P$K`T0 R 0 00 0 R $00 $0 OH 0 R $00 $0( OH@0  0 R"0  "00O0000  0 * 00 0S00p00 0 0 R00t000 0 R00(0p0H0 0S0000 0 R000 0(0 0 R000D0,0 0 R000(000 0 R000@040 0 R00 00080 0 R00$0H0<0 0 R00d0X0D0 0 R00l0P0@080S; ST0P $  L 0S 00[D080T 00h/4[8$0Hl0 00 $00H $0H0@0  0 KKa -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s3 T0@   0Sp00R }P R 0Sd0X0 x3 R 0SD0D0d0X00H00D Q  0 R00#d#X R q T0@ } 0Pt0s4  00K R000080Sp mSf 40p0PT4,0S:00 S*(qI T0@ C  0S00p  P J}P \0  0[P(q00000(s00 000Pq T0@   0Bu b 00sT0@  S0s|0sgr 0Sd0X0?D 8#8S: 0Sd0X0#8#888d0X0  0S  d0X000d0X0+a -@P 0` R00p  LQp |P,Q 80S  % 0 R00t|P   0!:0 000000<  0   O -L M`q@p  w 0 Sp00R z|PP   0St 0, ,0  0, S 0pShZR0 PP  00   0 R00tpp 0 R00p@@PP00 0PP( PPPa,0SZ000Z 0S 0;0, R 0S 0;00 0 0 R0, 0, t   0 R00pwP J00 o og 0Sp00Tc 0St00We {P^W 0StppK 0Sp@@A姸PE p-LM080S 0 R00 d X R  0 R00 d X R `T ::p ; 0  0u` `t ` -$"LEM0`,0 8 Rpy T T0RpW   0H1 HQ9 H1L 0RD0R TŶDH!0S< L 0S L10   R 0S 0R H!  0SH1  p00S@( HP9L9,9YD!000@!8WPD0 0C0 RD  00C0D!0000880: S Y@D 0 RD00L H"6T!R \  P@Y6 T1SL00C0HT!0R0C0 L 0 RL  00C0L!000H 0 RH  00C0H!H0 00<1 0P@~u :^8KPpP1P 0S 0 0  p   0 R  0S00t000 Pp  Pp  0 P6 62 ,0S ,廘0000@P1800 00000000 0PpdT0D 2RSOK0L1  0@! U/K  < PpE 0 R0000 0 00 PR0000?|T1H 㚾 0Pp3TWPpMOK 2TP 0GpW y [ P10{o0 0C000C00000000P26TPW  0S00t00t070aDbRpR -LMPp@` Vv |0S 6 600S Bu [55 iP 0 R00D!drPj\:.> ^i` @TL T  TG  TD T Th  T=`  T:TP T5H T2 a_c_c_c_c0paaPaa0aaaaaa -LM 0ST0@@D0TS 0Sh0  0S 0 hR 0S(p Ꮐ  Te T e0Td -LM`@\80P0CSTP0QA q 0|0 2D 4 A!P000F P0P0C\ 0  "!0 00 1C&  0 "!0d!0 Rh=T0 SPpTq<H{T@p00@;0004P 000P0P0C\ 0  "!0 00 l0C& d 0 "!0@ 0 R= ,:_c_c_c_c0( - L 0000 5Lb - L 0000 5Lb -LM0p@ `R1!0$KH0 R= 0 00 0 R $00 $0 O0 0 R $00 $0( OH0P@ 0 0 R 0  00O0000 00$0 00 $ H  0@0 0 4Lba - L 0000 5Hb - L 0000 5Hb -LM0p@ `R1!0$K9H0 R= 0 00 0 R $00 $0 O0 0 R $00 $0( OH0P@ 0 0 R 0  00O0000 00$0 00 $ H  0@0 0 4Hba00CS @@@@@@@@ @00 0 ; < 0 0-LM0@  0PPS00000P@&0 -LMP@p 0!#61080S#1 1@R#P P; j᭴!0bR0S- PP0S$ P ]PP?>1!E , B 0H 0C0,$0"Q ,B -L M P,劂@BP00  0ƕ&0,KP^,0TH(` (`H>1 1@R#@  d> aq ԰P/ 0lA0 P@$.!1D0,0C000*  R0C 0,& 101,e(0J"p `ᛰP;  $ج , -L M @`P`$ U0: 幬 , &$KCP$0$`Hp忳?> 1@PR#  0,0 00D 00$$v; 偬垪 -L M @PA \00\0SC(味,6倢0 Ɣ&0,K0S-,0(H`nQp Q ;  ' 0,&0 00 00 Q,& 10C1X0,,< R,; > <8d -RLp`$P@ $P`(A0Qd `P 0l1 P0PLP @᤯P;    -0LM ; 6 -L|M0   0 Q0p  0 Q0 Jʠ a0(@T &0xKDPPx00x(0 v|K 0 PP  | p(0000&0Pnx &|02T0x0 0x0<Hɯx0@P0Kd KPP 0` B1 X@t0KT0   d0H& xK0PPNx``K H0QA T  + 0 |K  0BPP/ |@dH@ |   0&P  6d K3T0` H<l0@P PP0SL 0A xxxx0t@KTpL:Q! *0P ʀ0dKA`0&0`x 00: 00x0 @PW 04C0 00 000Ad0D& xK0QPx `0KH xx$ 6Tp:T;0! 0 o|K 0 PP |@@0| 0 pA xx0P&0Pa 63T000<H忮0@PxN0 &K0PPT& 03 63T0 0 |K  0HPP|@X@t@ &0Px p0K&0 |02T0x H<ux0@PxPP`0| X 0X0 0 #  -L M @^ 0    Q -LDMT@d ` d0 h P`P刀 P@h pTXpKU\PK  0gP@sQ\ #0(1( `!R0 0  R` Vh 0S ,!$0(0Q0` 0 A1QXP\ p; X@i T3 U{00d0P  0 n00P @  H\@0X0T00S 0S $0`V * h0^1 ,1 S 0DS\0 pUG(0` 30000$ `V*h SH,!0 0Q (00 3&T00 JL0 ,00,0P@  P(a@-0 : S l0@@0p-`P : S R0V@l0 u L0S d@0  dPpVu -LMPp@` 0S 0S1ST0@ $$K=@$  000 @0 I0 R f* 0 0 p -LM@TP@  0`K?0" 00 T00 0 U00 H 0@0K0\ LrPd l1ğS t@t Pl1 xU:h!2 2@ 2 b2B&! 02 Scʈ1b1 R0pp00p48@00C\ 0  "!0 00 1C&  0 "!1  Q-0@h!P0S:`!0S:PP R d1Spt0a0 d 1 ,0S <,_0![ 0.[$t  (Zl 0t!p! <.7 Zp @T T  T  T T Tp  Th  TTX TP T0aa_c_c_c_c0aaapaaPaa0aaa -LlM0 ` 06t0  h 0` d0 @l@ , p @4 0d `#Ch@h0@ PP<0 X@ \ h x  4T0@  00CS4` fPPl 0@RR@0 8@ H0 D0 x\ 0 008 H0 4 l0TS1 PA0S-p@L@ pP t t0 BOK|  @K ¨ 0 `@X0 S0;04p B06x Rc 04d )APP!0|@Px0lx00S, 400 KT0PP 0   d@Q 0Q 00 R !X`\ 4Xp yB060044@00@0` , }8\RD<pD D0H<  SG00< 8 0b@0 ?4 /P#  $|t0 0c p ? @_UT pL ,K/0 PPlR  0-LM0 \P&@tl  00\\ 0SP 0S<P00 $@嫠Ȟ @Tx -LSMh! #hA0  ,0 6(@Kp1 34  L0S㈀ `0 0#60C ST$L,L4L<LDLT A?(K h1KK  3hAx 0R 00l1 Lp@pLEh_SK 00LKGTK@l`X WKT lUK MOK \A @a 8 D Pa K?P@`Qx0 0R@`pd0S0@ 0Pp@d ` p๨x0V`0MKS >K>Kp @Pl!ᨨdA0P0@0|0S |0`P/VUh1 0@ J H F D B @ > A?(K <0a 0 -L M@0Kx RK/P 0MA000Kb0K/P(0008A000 -LM@$K_` 0K pP$0 0 L0S, `0) 0#60C S@ @(@0@8@H00$A0000000000 0  -LkTP^N8D&0SE ,V00U0S:4 000pWP0S 0S 0S4` 0;0U Lp@KT04X0P` Xp b0P@`0P\T^  40^Pp,,0S X 0S 4pXp T`X` L0 pXp $X< -LM Pp`&@400&(K0OP@ X(&H0 (00( -LMPp@00!1S80:S S40$KS<00<0>4H$@  0P40(|`V 0 $ 0040.P`2Lb p-@ MLPPP` 0DP4 00P@巑ph=-hct c p-1LMt1t`Pd1dA P PKLL KPPC IPP200 R 0000  1PKb0 gL0S  H0=p@@K? 0P  00C03Sp0_(aax_PaDb -LtMp Kl @5PP@< < R  -PP  0P3 U < @< R @0 0 Q3 S< 032#  Q @0(0$ ,(PPc`80Sz|0" 0Qp0 Q @0x LMv:0 0;PP  <@0J 0VP U0K! a⎟L0S`"Z @0KY Za{\!0S 3PSP1 0  ,@`? 0Kk@a\ &PD K` :0 0:PP  &<- ! -0#LRL R0SR T0 S5S L*`0 Qd0 S@- 0(3 p-LMPt0!` 0 wP@ 000Hq0(08@@p(30   0 0S  -LM       -L Mp0P(K`,0H 00 (00H (0H0@0 H!0 0000@ 0:#:0 10 00 (0H0^0 ,( 0 40 0 <8 0  D  0100D0 d0@080S; ST0P $  L0T@$K48 8$0a -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s" T0@  0R TVPM 000 0D0 100 0 0000D Q 0 0  qk T0@ T 0P"0sX 80SS PSI 0pP(q; T0@ 5 0R  VP \0 04P (q T0@  00000(s00 000Pq T0@  000sT0@  S0s0s -@P0 LRp` UP$ R 80S   UP    0:0000   <0 0   ZO -Pq@p@`0  v`SL uUP  QR0`00R@ 0S 0;0Q 0S 0;0TV 2UP -@L80SpP` 0 00   U  DPp0! B! -P p80LS`P T T0RGV  2P:@1!R/ 00' !000 0P 0! B!{V  4> P 44444Db -L\MP@H D `T T0RpX \ `  r4H0T HP g4 D \ T0R0 0"0   P X R2PD L 0T0 8!R 00T0 0 0d0  X l40: S H0 T P S0LP0 0L! !L L0 0iPh 0 D2hX D?4T` 0\Q ` R  R XEP RH~ TLPA0 H HK P6H0P ST  0P0 P R P T0RL0R ڐP0L 0R T 0  . 0 R* T0R& P0S! P0S8T@5YL000X D1P L 0! B!L0DD8P0 0: S YTL P` R00 S T0! B!T P0Y 10C1 P@ 10C10 P 01P 000H00 0 0y DK  oDPY pL@P 0PT0 YTQ P RD`Q00 S hPP 0! B!P0P@000T 1@@K0C1T0    0 0 D 0y/P.0[S L d#"[X3R`  04  0 D 0Y/ %T P P P0!RBY 4T0L 0R` R00 S T0P2!R !T000P0 PL P? ` R00 S T@0! B! 0DX 20 *1H0P0X00S*X"0S TL Q 0 0 0 X D2TL 0\ 00 .RdDX }2 00X r280S -2H D00 0 0P 0DK 0 D D 1h.. -LC@0 cc_ -࡟LM|0x 0PbU|0`2,0 1, Pp` a1  0 S @00L l00C\ 0  "!80 00 $1C&  0 "!0 0 R$ P p0S00@@ , 徍x 0 0Q0x  p0Q0p   bA@@8щ4 cU_c_ca_c_c0_Hc( |00`|0 c-8p0P0 0Cp  0  Hc c 0-@LTP 00ST 0S 00 0C 00TTp  0pP0002 020n6@Hc c -LM 0@SG0 S p00Cp0 cP0 R0S2B "0 -0L@pT` PU  PR00R00SU@TP_ p-LMP nP` P p@ KG `202! 0 -(0AL0$1@TPop 0S @TP \0@S000@`p@ 㮌0SX c p-LM0P@ R*p0@S 0a!p R P 01U`P V000V00C00S R000 t 塈徆X c8T -LM @R)(0 Z$$ aV p@P0S@PUZ0`JV$ Zc?|o>Fp00Cp0@T  P   ҋh#p @ DP0SL00<~0Pp0`@U_U_$ c 0-LMl@hP0TdT 0LL@H@@P>}8 440P@5}_-X c__8D$ c0 0S  - L0SP+ BR ',pQ000000@T  0`p2 V@Wh000x 0!64 M-LM0 00@K, @ K ,@00 K6pǏ8  r 8 R,0Po `80U00S <8X 0!@@W Y 8\B $ 0`RP 04S:R 0S* @ 00CSll00SQ .,0S00S2S2 02 0,!6o 4@ K@:XW@0K,A-`U0@K0@K0@PK,3-P0,P0 @0K&0p?@PX0 Wˆ,06pǏ0K,P0W@#&: DFɯ#oZQ8 NYK8 H˄L -L$M0@a p W`P8 ,p 1s@:Pp` W80,S  ,P@ 2! 0W  8 02A,  , 0%& < %0@S 0< ^0  P1P@ 2"A0 2"T 3P<01 \ p`P 1S @:Pp` W W 0 %&:40   i,P@0  !L!0Q _ @@@,1@T= 2 02Q0 0@S 04$Pb-2@02A 4DP0 2  4 C20220a 4P40 17 p-LM@`P 0!6V0020  @T  p - LPhC -d0L@pT`  PU,0@T_ -L@@\p`#(^$PP 1Q  Q R \P^Z0P P U 0!R00R0SP UP 0-L MP@0K K/@@ @ @@mP0  S /:C 2I02+0 000__ -L Mߌ pWP@`, 3W 3W UV  , 0p @ PjVP@T 0, R @T(c((@ 00Q00P0 r@00C\ 0  "!0 00 2C&  0 "!0"0 Rk@T 0, R @TP2 00@ 0@,0@0@0S 0  0$0P$T 1 @1 bB&! 02 S3ʴ1b1 R0PP00P@00C\ 0  "!40 00 1C&  0 "!0  Q[ ZYr;T (:PeTU  0 00 000_0d0X 0]/dq_4A\A__c_c8a_c_c0DUaaa_000 p-LM@\!0` |] R$0$0$0  KHQH1H ` 0 b01B&! 02 S4 1b1 R0@@00@@`00C\ 0  "!0 00 0C&  0 "!0l 0 Rpph:W_0L0p__ca_caa_c_c0M0Ѝ -LMp4, 00 (^,00 14  b2 0 `P<0 0 ^8 p0#20# W@@ T @:0Pp`WZ 50$4, 08|  < p& 08 0 P Z  50<44 Z u5dq_ 0-LMP@ P0 4 U 0  00hU5@ ;40 U 0   4@5 -xL M0p00 RP L3 L01001@T 00ST "!  "000\x U  5"0p\U` 000 4  0pR0`00  4`X "GC "2 /YX)V U  0HcvP000 4 b@0 0?/V U  4~V U 4000]"U  4 ` 0```.-P@ U  }4000  G@kU  m40H003^x@?0 L410411 c(a -LMxϟ@ϟ R/0 *0P < D @ 0 D DKP5 0@8P0 S280 , D0P  4S R0 0 0  (0S   4DKΟ000( L Q00RP  0SP @ $0  0l ` #6P`1`!0CLS00 p P   0Ka0  H 00@P 0V0R00S0 ^ PUPPU R 0, 0 0cp @_0 P P   fp XP@ĐKT? D0 KP07 1@ TZ0(Q00S  0S0(\00S0 7 0@000̠ ,00 @0K40 b 000P0@ `K 0 0 0S  P@P1sS@ TZD0X aDK P@ P00 0R0 P 0P  0S U 0SAʠ000 0R0  D00 Œ4 @0wP 8 2(ʟp h0R  02 ^ '8@ 2D0X&202)@101P` 0d+ 0SVV8 2V ɟh0p R000 000' 2A020@ 0Hc0W00C0 0,+P  x'^ 000C000@ 202!'2"0A 2"`M8 `2o T R`  0` 004 ``@T" \7 L01001VTǟ0 10140  00S    R04 D0 Œ0@P 2 C028 2p h0Rtb[2Q &2 C028@ 1D0lF[2& 2  00!6 0```u*P " &2H02'22020 p+0 k+ [2202R&8 1ğ000ZMP` @| 0@@'* Q00V@@T' p 2"& 2028 g1V 3Cp h0R ,000iß 000Zp 10 1 x101:&022@ 02%0@ 0 cH0Z2 L4104181Ÿ00 00 ,0 0K P0@0@0l4 p000P0 0 0K P@ P 0"QX800 00840 S000  0 0^0P00 @%ST~22  <0000 $r`% 202lZ0@ 0HcBP T@8 0T0 R A%0 00040 D04 0Q 00!2025UlU(a(4@L`a c_c_cc_c_c0@0  00ĐK p 0DK P@^0S 1S0T01 aP 00S2! D0$000D0 00RD4 \ 00@TZ 2W00ST2SPq$L@` p$08 /1!0P 0U00D`K L0Q:P0Q:PUB 00C\ 0  "!H0 00 \2C& d 0 "!0"0 RU|  Pc Q-Lp@`: 0KPPJT: T    -pL@P` /  h/ -L M, K@P F TP8*0K P; , $0U %, %D0S/ 00 "Q4pK` @/1l1 0^:0A^`:?0sd c!401P#Z U:W0b0 0 zXUc -LM0 P 0 XU @p`6  ZP 0$  cR 540 X(@ 0  @.  00U X 0  .  ` 0 X .P000 `.V  .pW" -L0P>@0T~n@@ p`.0 @ .L 0T0Q00S ,0V 08W@3UUddaa_- ^  0>0>0 S   -L MRPLA`  |*00΄S D ㇄ 0oB0 0yU p-LM@ LQ8,00`0,0**0L1pU0 00@- @58 0  0 @2(  0P 6O c -bLMr, 0@00,0( tB00C\ 0  "!@0 00 ,2C& $ 0 "!0"0 Riv4́,000C\ 0  "!0 00 1C& x 0 "!0T!0 RFL@1*0PP?00p  10S0 ,0P04,0p00C\ 0  "!0 00 0C&  0 "!0` 0 RT 000 y$x_c_c_c_c0U c 0-LM@P Q 10S Q\ 0Slt, - 0P PT,0 0 1C0Sa c2a -0P@LT`p , 00S @TV 0 R@W m!@U1S10S SL0 Q* Qp `0SPa" cU -1a0@ L , P(Q@00C\ 0  "!p0 00 \1C& T 0 "!00!0 RhI10 S, 8 0p0@00C\ 0  "!0 00 0C&  0 "!0p 0 R` 000LH0* 0h _c_c_c_c0 cU -|0LM\ d }\0+ KKa! Z1U(U#Y w cHcc -L$M8 04 S8p0CP~:wp 0`ZC%Z0>0>0S1#  ~0Z@ p<0  40,K@  P<   X00 P00S 0 X3ZP<@e, T @!8 HG< P d0p` @000 `*S0  +P0000,h 00K ~ L00  0P<\ +UpW" -2LM ,0 0`p,@p娐PLA P 0r,p^,K 0  n TP@ 0 P00(vccHc___ c8Xc'U8 -LM>\0ǠȠŇ@`P'0 ` p P` P000U 0 0 #00 0P(v PP h -0ap #6RL`QP: P@ 2% " ZU:d%@T  P PU@  0S:P 0S*2 "!6=% -0a #6RLP Q@: pPJ'% T: R p$`QV  @P 0S:Q 0S* % -LM.0 L (0K^ #̌P@# 0p` @@+ PD ,1, UL0`pc!  0 "@T  ~0 04 jzZEUd,4H0 h p0S n),0 0U8Xc c 0.  0| -LM0@`p P000 `gQ0 )P0000 . . (0KPP >S0  (PU )pW" -L$M>L0℡~(K0p!p@0 `P `@@zPJ<1, WL04 c P` q0P@  4 `QW00S,,4P `z0 @@@*"@Th40 44 4 zG(uHc'U p-LM΁TL0K! 0@`P `@ PpHc' -LMPNPA@Tp`Lp,K, X0   \$ 0,PLHc'@0 p-0@LM P S00*vP0P0C& R` 00#!t000 `0C& X 0 "!04 0 Rp_c_c_c_c0 0- @LP 0* 00P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00hF_c_c_c_c0 -`L0S0 !,B$R0 00@T \p\P 0@0 T0,  S(<@0h'c_Ucc+0 w'+L -LMXXqXXX 0RF@ rT@P`TP P1 0000@0C 0 ^  0!!  0 C6000 "!d0l  Q,bQ 0(4 fOcU_c_cc_cc_c0X -414qLM  a  P@0T!6U @AOP00C\ 0  "!0 00 0C&  0 "!0x 0 R h 0S,QU0 0C 0_c_ccc+_c_c0cp@- 0@ 00`000 C \P  00#!x0 00 d0C& \ 0 "!08 0 Rpp@ _c_cc_cc_c0 -L$AM1, `  0 SP000 p`00C\ 0  "!0 00 0C&  0 "!0h 0 R0  ,00 *P_c_ca_c_c0 -`@LM,P00LP (@DH@@P@!0@|&@@@0@00 00R 0PP`@0p0C& R  0 0#!t000 `0C& X 0 "!04 0 R iQ`_c_cc_c_c0 -L M@`p0 P000 `M0t z&P000 ,0K ?0  ,Pa&pW"000 p-LM0@0CS0pLP 0!$Q$1$ ` 0 b 1B&! 02 S31b1 R0@@00@@`00C\ 0  "!0 00 t0C& l 0 "!0H 0 R ph*_ca_caa_c_c0 -LMPU 0S 0 0`0UpU @S 0SK 0S' @0 R 0` 0S0@  0V@@@`vPUPU 0S i0SP0a0S0  0UPR@T@PH 0@T 0S 0S  0R ` 0 /0@S0@  0V@@p`@T 0SP00S0  0UP@T@pP -LpR 0Sc0R` @T` PRd R 0S 0S 0S p0 0Q 0S!@ T0 0R0 0P 0S0@  0U@@@PPU*@ P 0R 00  Sp00S0@  0W@@@pPU R0 0}0Q 0p r0S0@  0W@@p`c@T@P{ZP `R[ R 0SR@Tu 0Sr T 0S  X0 0R0 0P 60S0  0UP'@T%P@` 0 00T Sp00S0`  0W```p@Tx t@0Q 0p 0S0P  0WPPpP@TP` -LM `R 0SPXPU  0SY   @pT p@TPXPU  0S@\PTp 0Spp 0RppU @~@T p-LM`@PP  0@Q : RP T0 0P \PPRpP  0 Q: RP0S 0S0SQ  0PR 0P  R 0P P0 Q0P ,0RP $0 $0cc0S  0R 1P 0R 1 0-LP@@T0 0-L@P(0Z0,PS 0h0 p-LMP@(`,0QV php -LM01PUT Q1嘁 `x@0T001 xq`0l0T!C \xT! 0  "!00 00 1C&  0 "!0 0 R0T0bP  X0,P0 0? @OP |pt0 P hf@TPTf0@@ n(a__c_cHc_c c_c0EaUhU ccA-T0p`3 0 0x00 0P0T!C B\@xT! 00#!0 00 0C& x 0 "!0T 0 RA00A{g_cHc_c c_c_c0c c -<0 P0000XHP,@U pD0S PU0 00 c $ Dp000@ 0  NHP,pU 80S D0S$  0CPUd2 H &RZ ,46 S\ P 80SbPU000  HPU= D0SG PUX4  000(U@ 80SD00CD0PUHPU 80S PU0   D00CSD0 0 $ D0^6@000  (@ $ 80P D^4   0(\ $@@D0D00  pW" c -L$M@ 00 @ P L0Z!Y1 Y !, K P ,P 0 S*,40 $ ZQ 0\ 0P S:  QP< [*L080 ( S4 + 00 ( 2 R$ $0 a Spi piW HD DP` @T 0 00CSd\t\tuudu\t00S3 zW $0 Spi pi 0`4, P 0 , <0 404 00@ @4<P< P  Q:@ <Q2 `p 8 0Sʼ2SD00CS0@@ paU` -LMp KP`@PT  *,R 0T :800S$@ T: -LM`p$@Y 0P@c -LpP @`f00S0 W 0p0p 0 0 000 p-LM `P0S @ @wphup -LM P`0S   @ @]m[`p0 @000(!`<0 :P0000 01 LP 0`p0 @000 `<0t P000D,0QLP0  mppW" -LM0@0CS0&0`p P000 `D<0 P00000S00@ ZLP P 0KP P 2pW"c -L M `Pp @00d#0P<  @P 0 00P L( jHP, U0 4 p 0S @0SE "S 8v@T jLDpP&(P 00S0D00D0  @0@-P U0 0   G$0  CH"&0Z 0pp5@T njLPU(P 00SK40p 040Dp0D00D0  @0@L R 0D0S  0ppL D0S R uR 4 <004080$ 0O_4 <0 80 $ 0 B$0  CH"&0 a_pW"| -LM`LpP0 P@@($U, H@,PT( ( $0,L H8040<  @0FT0D  PF T F0T0(@T<T -LM@0`p P0S+W@T   ?C00cSP @TP ?C00cS <$VUUU\, -LCM,0p,0 `KŸ2"K_K`2!`4@2 @ 000 0P  W( " ? Q Q5 P "0% 0!00B@@T  R R R ,0S ,BR0 "0"2@@ @T   R R  RXRP0a8|WDWHxc(ThhcHc -X0X L1?0c1Q< 8 80 ?Rh;agfffcUa0@-0 @R 100CS ```0S RHP  +a51"% !\00SaU -L R0ԑ00đ\0 0R010201<0 0R*000000a cUNN -L$M0 0 4 S@P` 0QT, K_P`>,0 $@0\A 0 S:2\7*Z`!>20K0  0 @P 00 >2Q2^:40`, R ,00C,0,(0,&:Z ``0K ~0 0,0 @p` -L$M`4 :#:S @>0. Q< "&0D P@  H @ H0 KP 0@0 8 0,@PL@  1 0<S-*$<0Q*0 S` 0S]$04 <S1& (0 $Q!0V)0K*)K jŵVp:00L00 S  0<S: HN4D @L V8 (*80S0)0K 00 HaP 0S)KZ )0[ S  )KjpV:0 , 000c P ) K @  -LM 0  S 0` p @ 40S0@0S0 (PU`p >0~pW  0h:#:S P:SQ:Q:J q   `PS7 5  0 &P 0SR  R ,0( 0C,0  ,8  0 @`` 0K P000 3P q ,0 0R,0 $ 80SS SPS P9 QS@@S- 0   000  : 0K  0PH  10S     0@ |0 0P80 J,0( 0C,0 : O,s8 VʦU^  R  1 0R-*  (  -LM`P@1/ 0S, *"*@S>0NPb@` *T p  006  , KP,0$ @D P Z  -L Mp0*"*0>0>0SpbFZ@ W>: W< @0` P000 `50 P0000 0P ,0KG0  ,Ph0  _pW" -LM ! ^>0.@  aR0@  P@ P @@ -LM*"*>0b^@0  NP@ P@ -L0 *"*0>0>0S b^ @@@`h 0   0R  0 -LM*"*>0b * 0H ,6S# `p0d,$#&@PQ : 0`\:P   c -LM!>0 a 0* P   -0LS   0 ` P P # -L  -L,M00 R0, P8 < 0@00 0S ,0>0>000  #20#0 Y030"<Sʠ < p`4 080 $&0,< 0, 40 P@X0Q9 `p0 @000x"`|40d P000@- 42 H)&R R ,46 S  @ ,  0Q ,0 0P@, 4Q 0 80S  @ vT4  0  l 4 R Tnl 80S  |0@ 0  P4  8 0  T|0 0  4 , :#:S <0%pW" c 0 00_c_c @-@00C& R 00#!l000 X0C& P 0 "!0, 0 R@_c_c_c0 -,1,L(`P ! p:h 0`0 AT 0 S, @TP0 0C\ 0  "!0 00 0C& x 0 "!0T 0 R 0S0S_c_cHc_c_c02S,2 R 000  0 " "00C02 0 R l0 000 202  B 00 0202 R  0 chcpcxc2-0C22HSD000   202  B hc c -LM2@ P0 00  202  B 2 0h0h0   @@2402   " @002 chcpcxc2 03 R 0+ 000 202  B 2S2 R00|00 0h 00  0<02 0   R  0pc chcxc2022020@-04 "QP h@?!l!0 ^:0A^P 01:?01c10@Uc -LM , 0 "X00 ZY"0@0ŸT0d0l h`x ^ `Y0  a0<"6AB4  8 [0YCQ< <0 b40Zi8 1P0@8 04j Xf4 "*p@0&04`  8pj0>00 00>0 0 0P  P00( ,0d 0 @\00`T@@0DPXL@L  00 0 c8W4UHchcUEa cB}Ea cEacU0 \  -PL R: 00B 0 0 P U cl  -LM,a> 0R^PA0 pW 0gS*oU@`0S:>0 N@ T *$PK0S J $fT:7|Ph5*DD@0>0>0 0UEaEa c8Xc   -LMℒ0SP&J1l `!db@0SP> 0p`S@`0A8 PNLZ0S J1` @ 0R:P@DLZ60 0 R    R  B1PP @P0UTT 0R( 0R0S*0B60 0 B0CR0  R  B0PP @P0U 0R*60 0 0R0  R  B@0PP @P0UUcHc!H! 0-LP@KP@ T0 -LM,  \00 4 W 40SbX%Q*!p WN `Vx!0S`VT!0VZ: R`4A (A0!X:`V!0P0fUq څ1eAD PEU @, Z 00  00O0 0040t 00Z00 oX TTU @P 0<0U4oU(S cl!!Ucc!!("\"x" -2L M0X" 0CX PUPUxbd1h">0> ,0 `Y,0P0,0 X!0X010 1 X 0E ` h0dP3q PU,  Q 0 0 00   #&h:` !0 0h `01 P#&:h`  P!UDF X00 P0000C\ 0  "!0 00 0C&  0 "!0p 0 R `0Z 4,  oS4oUUcHcU_c_c_c_c0Ea" - LM U0\ , 0` @,pP 000 pT8 00\,T(T$0$doTU"c#4#@#HcL# -LM,0 `@S <00 R4 @0R D0R0Z 00S, 0 Q00S(0QP X3T3L Q H3 Q 0`8` p8pT TR 0!`V R0000 0   B 2 $00C$08 R 2 00 @004@ 04 00t,0"S 0",@I @`" 8Q 24 0R2\ZO 1P 1(&Ah :` ,0 0!0 0|`P0P0C\ 0  "!@0 00 ,1C& $ 0 "!0!0 R,0 0 0` " "000@B1`VbT@EL0!`V0TaVPQ3 cc(aHc@bd#_c_c_c_c0 -LMp^U R2`  Ÿ#&h:0` 0P! 0 0 00 0dB`00C\ 0  "!,0 00 2C&  0 "!0!0 Rn R 000 0 0 " "00C0"0 0"ZS " 0PT H1"(`h P :0`0 @ @0 0 p`0`0C\ 0  "!0 00 0C&  0 "!0 0 R @ 0p " "00086_c_cHc_c_c0 -LM2P 0` V022p  䂟#&:h\` 0 0! 00 0Bp00C\ 0  "!h0 00 T2C& L 0 "!0("0 Rr R 000 0 0V " "00C0"0 0" 2A AR 010  0 " "00C02 0: R H12 000 202  B 2S02 00C 02<2p0`0000P0P20$ 0R00 D i\ R d0lV( 2 0 2_c_cHc_c_c0 chcpcUxc -`LMVp At00TPPU `V2  "  0S 0$"I-2 -XaXqL0$ R0D0 2@ TPR1D@h R0000 0   B P 2<20 0S0@@@ 0$ 0 0$ \0 R 00S0@@@P 0 00 cHcXa p-L M KM0 "Q `KP @/1l1 0^:0A^P :?0s8 c! 01pV0b0 08XcUc p-L MP`@ 5@@@t0l l0@@eX0X ET`@@1@0STpcUXcPc\cEaEaU -L$Mp0 0 4 00 P4,P Ǡ,K 0 PPR\`0 젟 @L T 0  @@*\x0  , X,@ 0P4D 04 4 00PjVJ0,Xc#EaEa(aHc#Pc\c -D!L M0PC (@0`p P000 `*0 &P0000 ,0K@@ 0S 0  | ,P`~@V,,0@@P,,@ EaXcpW"\c8XcEa -L U00R0S 0̠ W0U0V00S 2T 0  TV U0P0UA  V  0!6 uP0 U00R0S  0 0  0 0 -`0@LTpPP P W* 2$"  2 021Z0@T0 $C02 !202*2  0 p   0!6 000 X0 0,A0 0 0* c -LM800CV!   bp ` 4Z00@#:0#T7H@T 0Z0!02 02 @TyX 00 \P[F Р22@ Z00S |!2022@02H@T0a$P,<<<<$<<<<<<<<<<,<<<<<4<<<<<<<<<<<<DL -1qL!MQL 0Q 0@0`1 H* 0P@(00C& R 00#!000 0C& x 0 "!0T 0 Ri$M40 a_c_c(aHc# c_c_c0pp 0@-d@0/C2b,S03S0#S<0<<0bQ/BR@ H@0 cVUUU -1LM|!xQ000d!C`A0\L0 0  "!80 00 $1C&  0 "!0 0 R0PPp `@ 0Gpo'101F 0V`0  @ ?CSD00D SD0\4 ,0PR0S<)_c_c_c(aHc_c0 c#VUUU c -L MDrDDDD <00\0@y P\"001 @00C\ 0!!  0!C6000 "!|1  QLU, 8 0 08 @0B6C Wp  402"  Q  &  Rg 2d0 `0K$ T  T202'08! W8!  2  0a h0K @0 0@0!6 k K 9 P 202 @@ T  K 0 !6D 0 P  ' 0!6} 0P P~@ @@ 2(10(1o,10,1# c -8RL1019@A@0T1A d0SsqP1d0Sf@D 0 ^pc@dlh0PN 1@T ZW ڸ X@ ZW"0S00 0C00"`Zھ" 0 P  W<1pG0<1 0!6 P 2J02 J `2"02p T00R00 S n8,P101z cxchcpc - Y3 LM>A0 0 QQQ:34 (0  0aS < 8 00`VԢ'PQ B/ 1b10 ^:0A^P:?Pu &Q` TB?!l!0 ^:0A^` 01:?0S p,1c(f1P12" Q4 0*R0#  R <P, P\ , 4pABP2#40,!0Q!0000 00C0" $00C$0" rppp" 000 PP,00S ,0 8 l0 < RP@0RD 0S@%48,KP0lP,0 e cUcHcc -LMp@T' P`Q0000 0002000@0$ 0R@0$0 D @TiHc cU -@0LM@T 0( T  jI@U# p-DB MLP8  $ `  0`\TP`PXL `0`0<Ta 0`|t`` 0`<( a`($a! 1`<0!,148!t0dx |0hxph0L!`p c## $\$$$%0%p%%%%4&t&&&'('`''Hc' 0-L@M 0@d@@ P0 S@0yP!\0PPP5@Tx 0@ d P=X Tx0 P=0hC8F cEa',cac0_'(Ea`c((Pc( - L@T`P 0U- @T 0PQ @00 0S 0  00 00 @0D4P H$!Q0`Dd`d00d00\S 0  00@T 0S,q,1, 0 b1B&! 02 S31b1 R000Ġ00C\ 0  "!0 00 |0C& t 0 "!0P 0 R  \4Ea c_ca_caa_c_c0@-0\ P p@@4S DP \Q DQH4H40H4H4DSDd00Cd0Ea c -X0LM\  0R \ @ TT000@Ea p-d0ML` @P0 K@ @5P0,d(4pEEa<(-X0^ P ($\,40\DP ^Ea -EMLPM0|$ ,0  p0S S nP@,P `V FK@0D @P4 L$ p t H P@dd00C@S񟗖p80S|0# @ 3 ,0S |,)p(PP@ @ \@_ P\Z#J00@d80S|00 0080S+  lx\ @BK@$@01PP@ 80S \ \ <D0PP@ 0 Q@\ pPP@   Tx @tB~KpGpGG>K0C+P@D hT1` #P@_0SGBKAG>KA0C+ɠP; 1` Y( PU! WpG 4 O#J6; 04P@An2$,P`@*DTU WpG Y|@<0@d |4 0a,c|_L(X(Pa)l(Ea c -L|M@0XpP 0 0P@80S S @0X 0 0%$ d2!b10S pP 0OP$K8 4#RZ 0`E` 0 VP @QCN@ 0 ! F0P C@\0PP@3 0R50X @00@0f 0X!000dh00h04!T0H0 $4>0CFT0 03P`dEEC0 3P 0K 0KP@qp KT$;H PP@cT0P H0L$4 R00P4qPaf_U( c<b(((( ),c p-LM0@( +($00PᲿP(0; (P` 0 00p@80S$ 0@ P0  [t$h00bh0@?P eL0(,$0b402\YpT@ CPa cEa4) -L M @ 6@ -L M@ 0@  -LMT0O$K4#&:@YPI ($@@b0O&8#J6$Qkt7 QoA!P000@T`P0P0C\ 0  "!h0 00 T1C& L 0 "!0(!0 Ri1 @0 040@+00 P 000\P0P0C\ 0  "!t0 00 `0C& X 0 "!04 0 R ifB_c_c_c_c0T) -L6LH$M@08 0(Ɵ< 0$P: @ @0@0C\ 0  "!0 00 5C&  0 "!%00 RW@ 00  <0O8僄< RH @ H D 壛 80L$@D ?4 ZH4K 00K, K6P"00s, 8  LD ?G4`Pp40D, 0 ` PeY:T\$p0p0CH0UP\@ 0!! 0$C6000 "!3  Q<_)(a))* -LM0 `>0^$ P0l$ R(: 0S$:06>0. U$ & @0 b$Kp @@P$0 0c#& $ a81?  e$0 0e#&B*A- p0Q:>a2 &#l"b0QPop*H00p "F!V: U p -L0D 000@ oEa(aUf_hd**000 0-LM0@C^/<0 0P<0 0 0h鶾000  0S 00000  ( R,0,0,0 0 00 0 0-LM0P. 00@H000 X0S @0000t P0S0 Sj0    (Q,0,0,00 000h;** p-LM`@P僴V00  0S0S  ( R,0,0,0  00pYp;* M-LM t KP00K @@ P P *?0@PKp0@@0pKt0S@#&: pKPo`DF᠀#oጐXQᐐ \ t0 R Y PU Q$ x0RPUYtPw @@ l@ 0U0Y00S@`Y  Tp嘀W0; Y% `V$ xpRPP P 0|S: R 0S* "5 0 S Y   0R@`TpKt  2Q᫳ 2 02៳0+l++  2 @002"02"10# 02{뺂 `✀ p 倀KhKtl l Kp0KP@ P| p`0V` 0{pWWl0P` TK 2D022 8021   2Q p 0 R 0S1A T T%>  0<.< 2 02$P20t SY` 2ᜀS  t  Qʚ0pSKtG Y 2ᜀSt P 0R@Kt- Ȳ"72 `K@: UpWXKt\ t0S @t0#00tP0P0St`0 tp=00 K @K 0KtP} 0|@Sq:`Rm 0pSi*202eK K Q_0@S[PKtP2K02@:`p\HPD p-LM P 0R 0Rpk9@8 @0`<P` P0Sp+ -LM -LM@8 000 p S0`P40 1 s @:Pp` W400SLP,  W 0 040 2! "0,00 1p P`P 1S @:Pp` W0W 0   \0  ,  0!,0 @1\ B,\, # \ ,K 0P@,0"@ ",吱,01,2202, b,H++ -L4M@00# T p` Ẁ"0 @P0 0S 0S RT "P00SX 0X 0R0t T 0 SX0pP0 0 0S*pe0嬡@@0K`P KH  4 Lp D 0 8p , `PI 0S>0HK 0 0P@/ U8 W00W00SbP R00Q0#02SXT20 0C0 S UX0 a= #0HK 0 <PP TX +(a p-LM0 PU@ p0 S@`@0P0@0    (a -L M0 p` 0S 0S0000P 0-LMP 1@0T0 U* T0S' (@T@T 01 P0S >0@T 0h0  (Q,0,0, 0<0000S @0 0@0000S0@cEaEa0S@-*@,  0 000@9+VU RQ-L 0P0000 P 00S0007, RQ-L P P 00S00000S60, -L@M\TK K < 4 <#:0K [0*":("0006X, 0-PLMU^ KK @<4 Ġ<̌,ʠ#:0KK@ P 0[S*0":(0"$0006, -LMT2@P H2R@p 3S,0S00S}40Sz80Sw 0  QV 0`Sh0Sg 0  0P\ 0R,0  0S0sJ 0SI R 0S0S0S P5 02,\ ,48 <#R: VP, 00PP @0  0,\,, P , #Q010く/(6c(a@c -LM0@,0 @0  0  000 h01!p 1!pZW.PW&UPE!00C0PP*p 48<#hL\ ,,00@UPP cQ1>`PX UPE000P:Pp 48<#hL\ d,,00@&PPĤ>P p CCCC@c -L0M∢ 0 ( L H SP`0S/50S 0S 0S0s ,0S00S40s{ DKD`K<@KH0K qPk H0, ,pLKP L0S10L0 (0 S h(H0S<0H0 HA,0sS$[ 00S40S80S0 0@@OP0,0S 00S 40S80SQ  l0` x0cl RP0<4< 4l :0 l 310a,X_ -L4Mß Ƞ, 0(,Y`P\0 "P 0S PŸ,0 S ,& R 0S0S0S R P0s ^ HK ID0YRX T0 Ÿ@KY2\\ 1@ 0TL0 h0p W@X YR,0S00S 40S80SH0S 40G 0T00\00S @0S l0:0\/  :P@0S X 3S@0S<0S80S40S ,@K :PZ 3 SP0\ 0RP0 L,@K :PT :P(HKs0a,We XZ_X p-LM`P@ P;:00P3,@0 lp p-LM`P@ P!:00P3@0 Rp -LLM☁0\PKp`@K|A$0 ` :98KX@TKD@0`KP ?@K[@K@PKP\PK-P@3W `\ $0S $  07W` 800C80` 80S080`G,`\ @V 0S0C 0 0` 0 0@`n,0 4W0,  $@30aXX,,,, 0-@Ly+PP 40 <0%wU800C800 p-0LM@PT` 0 9PPUʜ@TU pJ+P 40 <0% 800C80phE(6cQ@- 0`SP*0SP:P *0SB  RP *R 0S2 P*0SP: -LMᐈ@ppT, P` `8T VX P8T D8T 88T48 T (8T$8 8T*8T8 T 8T 7T 7T7T*7T 7T7 T Q 0Sl 7TB7T<*7T .|7T" l7T{ p7T d7T uD7T V 0S-,0 S $, d0lY Pp P; K`P8 ` 84K40[S/ Kd@KxK 1P 0 1\@0[d 0@0K@["tp0  K@ KT0 P rP 0S \00\0tK KrPpQZ2d5T T5T5` (K`P28 ` K0[ pS (K@K K  1 0 1\KOrPp 0P WY r\00CS\0`4T? !T4T L4T8 r 10aR001#0p 10bP001#000|3T 3TV @71.8<jVy @71 qP#0000q4#0000L|g!3R/W2TO 2TZ1Z2T 2T2T |2TW Z p d2  R): p @2  R*0S  00SP 5#$0$  R 5R00%"48<#P g1T X1\1^d1Tt1T*81Vd1T T:X10SPW  0n$1T3-1e [aWu 0T0 T 0T0T*00T 0H6F0aku$juPliHLi0UiViiileiHgildiHfiHii"i !i i ixFixi %i i $-0-Ri Ii Qi Si Ti ai Gi Mi >i\-Ni0WiHPi Oi Ji(Ki -\9LAM`VP0p, P 1  5 -0S S/cH0S U8 Q1 HPTP,蜠K E 0[S -0S h@ 0 SRh8 RU5 H0S |0SH|0[S\ q'0000q'00 00 0@P  =d00d 7@ 0 0Y0  p7 ,0S h, P0005S Y  P d0 hK465$#Ġ0Č6xK7K4p0 0K0K0 .Kl 倀KlKt0 P 0FS0 000$1 0dK 6\K0HKc0KdK6@Ɵ.D@KD0HKCKHKG0K'P@  ;P 80S0C80Ų@T 80S0C80Œ0 .K00 P@ 00S 00$10h5 H0K P[ 5} DşHK'P@7  ;P 80S0C80@@T( 80S0C80 .K xP 0S0 00$10Pp4 R(6 (0  `/(GOK@|5H0K1 d0K1 (4(  0  )P  ' .K<P 0S0 00$103 R   (0|Z/'i@K@C5T3(0 H0K0 d0K 0 })P  U 'I2 R a(0 Y hK T5P 000 ` ^+P0 82 R 08L  /Pp 1 R0 1 0% . .RUS  PP7 400( 0 )0 X1(  5 p0`00|00 RP 0S  0SP00 0PR X 0 R .0 R 0[S0[0S[Q5#$0$)K%"48<#Q $S0a[_a-PX XaaX--,..(6c.. p-LM@ PAg0 `0S R Q000C Rph *P0`00 0p(0 `A.D/ p-1QLM` @  R0000 0 T00 0S S 0S SS008/0SD0@ R9 \00C\0 0@ 0 xp 0S0C 0( @`00C\ 0  "!0 00 0C&  0 "!0d 0 Rpph顺}&8 -_c_c(6c/_c_c0/ 0- LQP 0 @R T0hc 5 -LMM$0YZ,0 0P X1  4Q x4Q -`4 ,0S X,0S^0S[F/0SSV0SSRQO3XS O3X0P p@/`KxV3  7 K7U00  3  R0TK\0KPhP 0@ X !xK 7U0h0  d  .P` 0@QP@0pS0S 12XKOK 30)v2Xq  SK k70T1 `V OK0 S `VT\ V7T< PU p ` 0S0C 0 00 R 0PV PpP8$0ST PU p ` 0S0C 0 00 0@0S00PVPpP$+DGa$0@-|0\ 0S \ Q @ 0 0R 0 0^@0 0DGa p-LMp`@PT 0S @T 62@10 0P0 S00@@ pDGa -p0LM@T 0S @T P ] P R0600 hDGa -LKMğ0ğ,0 0P! 00P1 \` 0S\,6 Pp 0 0 PU 0S:PU6DD0 0C\ 0  "! 0 00 3C&  0 "!0#0 R P1003 ,0S ,b0SU P 0 0 0R 0OOKp0p0o0 T! T\MK00 3 (K P!00jP0S+KB0 0C\ 0  "!0 00 t2C& l 0 "!0H"0 R R0600  0S0C 0) A0 0C\ 0  "!0 00 1C&  0 "!0h!0 RhԶ"DS/KT1PA0 0C\ 0  "!0 00 0C&  0 "!0 0 RP700/꛶0S\p W /P 00 0S p0a_c_c_c_c0H01i -LIM✁0a!$0 0p P 00CS 0/ hAp00C\ 0  "!40 00 1C&  0 "!0 0 R $0S $ 9J R000 P 0S0C 0 MOKH/KK00X0 K LQ/K 6.!0a_c_c_c_c0X02i -pL@P 6 /`V70 0 #@T6@  -LM@P6Y P RP0S0S 00S0 0- @LTP 0S@T00S /P@-`p000 @0:P^0) S^0S \PP\00A000P0#" 00  0#" 00  P0S\V_EaV_ -LM0@S S  .PP P 0P P P0P PX -LM@P P P 0-P0L@T P0 l.P0@T00(6c-P* 003P: 00 ? >-RALQBp`L( 6.PUe 0 S\D@ @\P0 S 0aX00 -L M`0 X, 0 2PU8 O@KT1 PU0 R) 0 P@ 0X0Ÿ,Ÿ 0 0>> Y 0 0>>P@ 0 0 0>P@ 01 @T p0S @T00 R YDJ P?J8 $1 R 0 0 \ P00Q00Si"QPW,p 0@ 000, PʿP, p0bSʳX0 0 R PZ(0b)cp3cY_0 -LMw, @pT`P 0S$ @TW  @T 0 R @TU0 0 R`0 h0 RP6,0SW y  Pp0Y_ -LM@  @0T0  0 R @T0K ^%X0SA  AR 0 RQ R\0500S\ \S:00S S* S00S S:00S S* PbV_ 0- LP  N @9, G2, @+,J0 -LM@J   h -LpMpxPK0@X 0 ,ᐖx0 p`K✖і f00 00   00#0 Q   0aaa1 p-LM P\ 0S \pQ  R X00G\`@\ \Z %P QP ;PTT@ +P , +P T# T 00#0  p  +P00 0  00  0 00   /#PT0S w+000   P GPT@# V_(V_ -LM@pPvPT T oPD P1@T T dP, @T+Pa0S( D%0S 0 @ `( PpP@ P`p/%(&0 h`0S h(0( %@`0S(0( < `0S(   b[_(1`11112 -LM\`0@KP(x(0 * ~*5%#000K 2 8K4 KK |0 h qPPK< @0 X0KWK,@ < 0@ PF@,P 50 000K`*a M@K@KKKK 1 !0 1\ڴ0[00K [ K  dP (0 S ( dP/P t0 R0 Tv$ KP ,0 R  g$0a`X<2[_T22 -L|MPK0`x@(p$0 B* )LKhKK8@0 @P 0KKT0KSKp0KoK,P (P 8@ OP $0S D$K80 0\0$0aXX2[_2 -LM⸁QR Q$ p`]\ 0 l R .R Q 0ll RL .RJ Q?QDKPK [ q) [000[S  A0BS 000S |@KX)HK V [PKQᆔ)00l0 0 %"4 4  0 .$0 S $l0a,3 p-LM(aX 0R@0 P 0BS \0 S*0 R(  0S p{#6X0S 58J0 R (  x0 R ZPYH,KePP0a[_83p33V_X -L(MĢ0p(0 *iJ PU 0` RP U PU `0S4 VPDPKMJ)0Ÿ.D pp 048<@x 0  @(( (0@0D@0 0$L@ 00L@0 @  0L40`(0QD0 0@ D0 0S"@ R@T 0 00SZ @@$ PP9 $$ 048<00 <$ 0\0  0@4<2DL   800,0#2P,6  0R0P00S@T  0S@T Q  0cPT  0cPP000D ` VD @ 0SX0@T 0"R@ 8 }T8P w0S P0SD[{Z @0`Cs0(0C8#88#$(," @"(  '( '8 0Vw* '80 0 B0 8UBD 00b'0>00C080! S P 0P U8 X'H0@\ 1 0@80Ɵ4 6` 000 00C0\0 0  "!|0 00 h6C& ` 0 "!06<  Qũ8 x]PP Z8qZ%ş0D 0b0%00C0H R 1 0@ş@08 VW4ş45 0,00 00C0\0 0  "!0 00 4C&  0 "!4  Q_d$ X4Tğ 0T00 00C,0\0 0  "! 0 00 3C&  0 "!3  Q)#3  0tß0x0 0@0CT0\0 0!! 8 0$#C6000 "!2  LR R:07`P@ @v&PE( q&0 0@8 8 s@ D 0SL0@ 8e("0S( p"PmWm괨O!00C0\0 0  "!|0 00 h1C& ` 0 "!00#08 HQW 1 0@M80HP1D!0  0% !P E,0K8 ^P<080 { , 0R0% t*L0LGaHGa)c_c_chGa_c_c0X_cPcX_c)c)c -PLUp `2X !@@%( %0 >.Z P$4D 00b0! 00C0Ucc0 0   00 80<808 8<<80808 < -`sLM T0, Hß00 0 0R0 #00C\ 0  "!0 00 2C&  0 "!Ÿ"00 Rb8PU U 00C08P<0 Ry U\\ 0RSKpA @a0@RSD0SA La0LRS00L S:WA @a0@RS `A@0@ \-P+^pG`PP@W Y @*0.S@00U* T:4 00 S*40S0C40  40 S400C40 00c 0XI040 0 v0 , ko 1@ 0 006$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0 +10 ,(<81ꙛꗛ_c_c`aDa_c_c08a -QLMP`pd V00UPT0 SRJ00SSFPES`FLSH0SBj0S>0S:0 S6?Q3 ?R0Q0E\) R0FP$ Q$ @R" Q 00S00S P0pi0\0jS\ 0jSg vP -L Mp, 0p  4p 0SAR0 > 0`V @ T 0 R @T40S` pV,0 `Y0P P P  0   P  000P #P040 b -LPRM40 020 pP 0$< 0 W8 `x U @T 0 R @TWPU0X0`P`80#2   X0#00 "PK EP<  0 <  4 R- R0' 0R0"00c,$,!$#,,  ,K  00S 48 A 4 8 100S00,0 08 04<#$ 0P<0 <  <0 ba -|#L4M0Pp,0 Pp 0R0% :Z- HK60 H0KG K0c HKT0 i@T: h0 A@TW2 h 20S'J@HKLP0 $ePGPP |2 ,0S t,4G@L,d@0S  PK 0g G2P@ r0:S,0S00S40S80S , P0S 0S$0S(0S T PQ 0"0 # W (!06HPX  h 00S!X_J@P0LHKX dP X6GPP0P0 pi.G@Lc@0S  PK X0 L0K OPP7 L 0R0% 0*0 0a(Uc? @5)cʚ; -$(LM0'Q,0   (\ 00S:p:00(L00 (( 0@℠K 0  K5P` K`KPK Kg 0K@K K`KPK  U 0 6@T 0  CP0 @T0[Sp RE  h` 0: 0000@S1\6   0:( @@c 401K<1 0P Q 1 0@Q 1 0C0@\ 񟗗t4Ld|0S 1 0@\ 3 ,0S ,E0S1  0@0S10S10S10S10S10S10S1 0S1B0S10S10S10S10S 1t@K KK0  tP 80S0C80 R01 R9E|K0  0[0S1@  TȠ }0HP+^TPK(@L0( G1H 00@S*uHPL ( @0 R 4@40(0@e 0a(6cX_T5[_d555, -LM@P|`ypv @0  lGa5 -&LAM0p,0 `@0PK Z - H6 R<6 R 0R0%P r:Uh  KwK s0[ST 0[SH 0[S 5 Rş@0 D5 ,0S ,Kx  0[0S0S <5 R K0 , H@K0@K KG0KHK*P` 0P 0S 4 R80S0C80Ų(K KKV  @K P80S0C80ž0[`S 0[@S KK P00  3 R K KK*NK(H( Q..Pz!R0 ! 僑Q Y0 00 S T3 Ra KK@ KKY0PI 0PW P !@! 0K@6 !R3삟! 20SPBdPK@K+`K'$0KxK c0KdK0K0KKK\KK KK |FK !0@P@KKK0 0KKf'A q1 R K KK 0[0S@@RT1 R K KKdQ= 1 R K@ KKx 0 0 R K KKj0[0S5#$0$.K0[0S5#$0$-K0P@ E?K KP p P  0R0%P |*LN0aX_ Y_[_(c 6$6d666<7TY_XY_778H8c - (L0R@1 !0 0 h 000 DPUA0P0 0Sl P 0Sa 0SW 0SM !@( B("("48<##80@@ 0:4( 40 0@@P Y 1 0@Y 1`P 0@ 0@1P@ 1 ,0S ,00S000 00S0 0 000S000P  00S0 0 0abD kbA\Dg00SR\P 0SM 1 0( Y *`h@W#AU AP000 L0 L@00S L HFv0a'cX__c_c`aDa_c_c08ac8 -LM`@PT :Rp/U U S*` T @ \(`P Q` `S*`0S` L? @`0T0U00S>@ - 0L P0Y_@Y_lKa p-L M@PP 40`00 @K@0SL L_P808 xPpSpPpHY_\ - LMR 40 S L00P00 0 w8 - LMR 40 S 0 0 _8 p-L MQPPP 0@S0 `ph4P 0<Pop*p 0 phop`Y_c -LM@00K p" 0@ 00 "@0P ,` U0@K!!  0K  ?@0@K   p0 -LM`t 4t0@!0c48t0!0c4<t0 0c4 D t0 0c4 D@!390Q 00R D s pZP, @0 PP A0 R ~p0H, 00 S0 L 0C # 0 0 R  Yp@ꫪa -LM, 0PR* L0Qڂs, 0S*@Dp`@40x m @T4<@0 ,0H 4 800 _,aY_ -LZ_ -LM Q<P4 @ dB!2b2c621b1c00Sڜ0P*0 R 04P:l0l  (Jh\ dB!2b2c621b1c1\ 0 0V_(cX_TZ_6c8 -4@LM7  0hTc, -qLMQa@0 T00 0 S00 00C000CQ 0 "!000 t0C& l 0 "!<0H  QT 6c_c_c_c_c0 - LM(080 0 4 !  0 S'='=P@ 0S ! 0@4`P0@ 'R`00`S x+0@0S1  6>0@4 ! 0@@T  R0S 0S$0S *0@0S 1 Q 0S0s R0S 0s Q 0S0S0SJ R0S 0S$0S? 0%  R2 R'  R R  R R R R 5 \ \p ty0S 40ZP L9P@ 80S0C80H00  0  0n Q 400S 8 R  04,0 PU 4, (0AS:(Q 0S a(@40Sb Y\ `0S 0S0sN 0S0S 0sE ȟ0@Z 1 @ 0@7@U wgHL0 S4K8K @T480\ ǟ011 X7PP0@0S1 0 $@04 & E6 RY =  P4 Ɵ@04  ,04 (00yp&0@,K0K4 K80KP4` 04%,0S"&0@0S 1 8 0@40S 1  0@4 0 0)S0(P 00Ps" 05 R@5P@ <0K( cEP4  < 0R0% *'$40@0S1 8 H<0X R@04 1910 l4 R; @ 0D0B  P4P@ 0S 1 0@40 P 0S)P3 R ß0@ R p L0@0S 1 80@00S0SP@ T  P@T400S6xP04 8 40]00S  !48<#,#80 400S 00S !48<#,#8 0 4 00S00S 04 d1P@ ~00S 00S 04 00S 5+(p?P4 K!0@WX 1  0@00Sl> @ 0T  # 0@05S1#=#=`)c *c0*c06c6c46c<6cX_)cX_0V_(ch3c[_)c)c*c[_95c8*c)cb -L MPp 0)S0`(4P 0 0A( Q0%(":P `@D 02P`P @0 00K( CPP 0 0R0% *,0K( CPP , 0R0% *)c -RL M`p40 @0S SP V g* }pP P`eV@1P@ :SN SVZAP 0/0K  00(<4<"4!<^00 S: 00g0 @P,0  00g0 @P,0  0g0 @P*0  0g+0 V R*K: "[P"48<4 #8V0Pˆʎ)c*c -0L0@Sp S Q:S S 0@ 0S 1  9:0 @0`P``0*c -LMh@, P{l 0 RM 1 0(@3T CT +T'  PP0 p3T0000aa 0V#3T T +T  )0ZP@99,0 S ,d<T 91P@ <T (YPP  00Q  )0`Z0S9hDK )0D QZPhh@`K a @ [R R Y 0S )00 4ZPhhf?0[0S03K?0[0S )0ZPhhM0a89)c -L M,0K@ 0 ;3T+0[+0[b弢00@ 000PP 011 01!  Xr@00C\ 0  "!$0 00 2C&  0 "!0!0 RkUX#U !0 00l<  80S 8$00 00lX* 0 0 b; @ 0,00$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0 +10 ,( <P!50505PP5S- $P 0800,MK@(K @S/KԐP0P0C\@ 0  "!0 00 0C&  0 "!0` 0 RTd0a8c@@&[_P6c_c_c_c_c0$[_:x6c :W1i -LIM ᤡ夑01bQ1R, p\*@TY tap1 000A \P 01`1D @R!A00C\ 0  "!0 00 0C&  0 "!0 0 R,0 S x,udMKX0 (K S/KD$[_0a8c_c_c_c_c0:W2i -L$M` 0  $0#0#(,0#0 0#0#0#0Q@0 UH   0S$$  PUZ8 @F@&P 0<00c00S8 00S/" 0410  00S   RA@0 1<Q<1 2   000S0 U 0S Q1  0S U 0s00^ P Q 1 P0@ R 1 0@5S 0@\ 1 X 0@3l P 0S/P0 R U 0SY 5U| P M0a)c*c:_c_c`aDa_c_c04a*c)c)c@X_[_b0*c:0SP@ T wP@Q 0S  C R X0<0 X0s0 P:00S^0S 5 000 T `P0@3 X 0@~ 0P   LKLK  g-\K  Q0S@ H " B>\K B@D,li#hg#de#`c#8#8#$(,""(  pK Pppp `K ! P  dK !P  hK !Pv  lK !Pj N - RLM, LbL@ 0@00PP $011 01!  q@00C\ 0  "!0 00 1C&  0 "!0!0 RSUM X Z    ,0P@ 0,00j$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0 +10 ,(c*a0  [ʚ;X -L`P@\ )R1S*P 0\0T00S T T PP0p 0 :RpW 0 :Rpp 0 0pT \  -@0`TLpP) P$`U` 0S{㖜UX hP P`@{| @{㎛@(a -L4MT0pP,0 D5\P W`@8 0FSA opTpprT R 0\0 0S$0S \,0 S ,z0S@T57@PKPP` d4 R X4 P 5`S10`0-0T RTKT 0 Sr3T0[ 0 T RXKqX0SX0[0ǕT 0SP0S0S0S Qd 0SQS0SI 0HKL0 0 H0KG K@KLKL0S <`QV 5S0S$ @T 0\  @T\ K⏹P@[ 0S0 000@0QPT00J00S5#$0$ 00S1`1 Rj1 Pe `[P 0(T% 0S"P0S0S0S Q; 0SP 81 RA,1 P< 0`S @T1 V 0S @T' PT  R000 800S1#$0$ P  5=Pp7 $0P 0 0P0a(aX_:@@b p-LMP`@6 U  U U -p0 0V0 0pL0 0 0V00V 0 Q50X_ -PLM@  R Q000ʸ R5hĚ -L$ML0QPp,0  @00 Rp 0S ` Rv Rs0)S     0000cS 0,0 S ,00CSYlvww xTxx RO 0S 0S> ,2 Q6*Q 2 Q/ 0S0S0S 0S HPK`@0 H0KG K@KOP Q 0%R 00S  100S1#$0$ *R  00 SY R 0 0R 0" 0%* R  0 10R f R0S 00j < R 0 10R0S0S0a;@@ 0-0LP@ nP4 1 0'S(P)  P P P P  00h00S00000S 00S0 0 0 00S0ʚ; -LM 0@(S@a1p    PP l012 02$0  1 4p00C\ 0  "!0 00 0C&  0 "!0 0 R"U 1:)0100 0( B(0 0( @ @7m_c_c`aDa_c_c0P0 S00!0S00!0<S00!P00! -LM`P 0R@ K:T 0S20 0q Q0%@ :T   MP000 @0 ,0K @#P@` , 0R0%@ *#0S00q 0j0 @P0 0(0K #P@` ( 0R0%@ * m)c*c -LMᤢ 0\(0 ` 6 0p00 S0l B 0@S 0S0S0S 0S 0S  R0s RS 0S S 1P@ (0 S (0S  R0S 0S$0S R R  0s RS$0S S8PKp 0S  0S 00S !48<#,#8 000S00\0a0 @P0 0(0a0 @P0 0a*c; p-\0\@LMK` `00P`F 00@pKaKaKa -X!Xa p0L00 PpH ßC0 0 0< $P V0a0 0140X#;40p0p <!P@) `00V01 Y YY002 Rq 2@ T< k 0S0C 0 00 0@@a40 \ `Y0@15SR  -PL MP@` Q 0S0S0S 0S  P` 40;V 4 t20 SHpW 0@T 0S 0SX00 S,0 lX Y00Y ZY[0X0 S ,0SP @01Q8 Q3 000CS 괱T`H0S Y T 1S @1 R41 R!10YX 00SYX  0 00 ( R 0`0 0@X00@Y P,  ``;\>X_X_x[_|> -p1LMhq \X =L1@aa;41PU 1@ R 0"%>CSd0+PU@00C\ 0  "!0 00 0C&  0 "!0x 0 Ri^\0  A0L ?0#3 0_c_cTcвb_c_c0[_Mb -L Mp0`S, P@F PC V 40 40T 40 } PqTZ!1  ,  0  0 0 4@@Y [ 5G 1!S:R+ 8C8Sڴs 01P0 S @T 00!1 1 Ba  0@% 004!410 !01!1 0 ! P@ H0PA@tP\0S @40c@0(\@P\! P@` 80< 0CR80H>Mbh[_x[_X0GS S S#S 5SS ʇSS S p-LM@!`\ XP P  p3000  00  00p#P00pQ 0 0S X pPU( ( >p>? -SLMpP@` R00Q00S3R`U-  ĈP$ W W *`X 㞉 0X0P00S` U $*`   -1L M0P40 1, 1`000 101`PpU0 @W(0 S(:PV(`(@U(W ,0X 0 4 0A 00C\ 0  "!0 00 0C&  0 "!0 0 R0]"0 0D D U00!!00 %!_c_cTc_c_c0 -3LM0P@0 34 2, 080 20 028 pW<  ,0S < ZMT@PT @08T#X1e< 1< < pXW,0S< 00  < 40R00 8 @ 2B 00C\ 0  "!0 00 1C&  0 "!0!0 R8p\< @ ¯P?L00X 80$0< ( 0538 r0 H10aR001#,0\040P !0 T@PT 1e 0( S`"X@TS|0 0  ℯ08#Xx, K_c_c[__c_c04? -LMX0@,0 `p XK hK 0R60帐 0 弐 Đ 0% P@ h:T^ `xK y0S@ u0S.0Sş@0  |,0 S x, XK#d 0S hKD $50S xK   P @(0X0ST0SP0SL0S&[4R t0S d0S`0S\0[Sx0[S S pG@K |P R010 0S  0S 0S 0Y0R00Sh0[ xKSppP`z K0P@BY Y0 00 S 4s0S[ xK┥ Y0@0cPXK PL T;X0ST0SP0SL0S 0XK@ @002Q0@0 XKx Kg-dŸXK%P"Ġ0 0Č2 XKx KKX0ST0SP0SL0S(XK6  H@KxK@K0 H0KG KP@ 40  00 R T^Vf ޤP` 0  p0S 0 R w0[0S5#$0$'Kp0S0P@ 0K PĀ@  0R0%@ *H[0aX_[_`(cX?h?????@ XX@@@@c -LM`K  0 , t 0S VY0@  0 0 @Pp  !1 01$0  1 l@00C\ 0  "!80 00 $6C&  0 "!0%0 RoW 0 0S"W V 0S @00 0     0@00 :0` dK0HK@  0V H0Kc KG Kd0K\PK  \ R0S R 0(S@@K  E 0KK ֫P @@K 9(` x0(0     0 , Rr Rh ^H 0@#$(,""( :( @@) K0R0 $  K@\Z 1`P 0@ 0@\@0 \ 80S0C802 ,0S ,塰 P Y@ 0 @@ 0P 0Y1 0 Y @ @  00S0 0 0 00SP2 R P 80S0C80f0 8TG  BPP@@@@KJ5#$0 $<5K4P %KX` T0 P@K\PK1 <1 KK吠 1@ 0D008$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0 +10 ,( L _c[__c_c_c0[_I -LMP0 P< 8 F\0ST1Ta p   R000 TP @|wTAp00C\ 0  "!0 00 0C&  0 "!0 0 R|whVKP@ T0 R X0 (,@ʾ_c_c_c_c0[_ J -<4L84M @@@ Rp`@D  1 ; S00D0 PP L0L00L0L0L00L0L0 80< D@H80< D@HL0 P0 T P L0 @T3 0 R= @T@Q) C0 0C\ 0  "!0 00 2C&  0 "!0"0 R K80S P1 \00\0P0pɊX0 P0 P @0^@@ 8K0q  00bS៕00bc8 RQ:Q0 DP 0 <08K,0 L C8KL@00q3PH f 1 Rb X0(H ܽU80< Sh L0e < KP<P0 RW <X0 (h麽JL0 P58<0<<<_c_c_c_c0a [_`JJ -LMT@T  ,P HP 1S@T p-LMS@T L0@T2 R @T 0S L0t@T@T 0Sf L04@TtR@T 0@ @T@T 0@00@Tp0S P T @T 0@@Tp0S P00000P PU L0 dP` x1 R @X0 \`P` 01 RP ,X0 `00SP  PPP00P0IPP0P 0 P0v 00Snp@T| 0S L0@TfP0 P 00S#PF TKF[_Tc(6c[_J -LG0`V5 #0p (@00C& R 00#!X000 D0C& < 0 "!0_c_cb_c_c0 -L M0 @R 0S  QP4 0 0 PPl0 RP X0 Q H 0S P00 ,0$0  @@Tc(La(Uc -L4M4`@0P, `p`PLP 0P ST  0S0s 0S0S 0s HK㸿0 H0KG K  HK X ` VB h0 m` VU: h 30S/P0X@HKLL0 P/LPx3P@ P,0 TS L,宝@L@0S  LK 0`P0@!   0@T;\ PU0S 1 ( 0@00c FX2P@r0S TS,0S00S40S80S , \Py0S 0S$0S(0S X JPg0s T0@P 0 0a ‖P  0@JU& !0vP@ h 00S)P @L0LHK PuLP 0P@ 0L0 Pf@L@0S  LK 0-Q*Tc0a(Uc? UcMUc)cTcʚ; -LM0PS`@p 0SP0@S6P4 P 0 R T p # V00R00S@ 0xP\0\ ,P rP Pҥ p @XZ_e (UcX --((LlM0` ,0 0t p |0 0 P   Yp@ lKkPl Kt h 0 :R 1  80S $00c ( 4`V 10(00@  @p0K  P;H0 0 @,tK0P  dH0S <0&0p l  000 !̠` !4! 0r00p字 0 :R_ q9 |0\"*0t0 Ve l0KR Y ^ş,0 tS ,T0S PP 80S0C80)x0K( P70t0  Px@ |0 ( h000 pKLt 0 :R5 P@ p0S 1 B 0@\ 񟗗!!!!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!@!!!""0"H"`"x"""p0S 1 0@0S <210Jp0S1  0@p0S1p0S1p0S1p0S1p0S1p0S1p0S1 p0S1Bp0S1p0S1p0S1p0S1p0S 1t0S10 70'SC 0( B(0 0B  0f0f$0C0C 0S0 00 !VP`00 0a@N Ucc p-LM)RP`@ :R@phׯP pP WiS$eS S  0@ph_@phU UP p >P PP 0k0CS -L,M@, PPL ^`p ^@%`(),*,,+\+,d+, ,,,,$,4,,XU 0 L0 Y hL6 ,0S ,ЦV@ 6  PL ' V@00C\ 0  "!l0 00 X6C& P 0 "!0,&0 R dBPL %@00C\ 0  "!0 00 5C&  0 "!ht%00 RL0rp0@ 0H000S0006 %@00C\ 0  "!0 00 4C&  0 "!4  Q  R0 0SLl 0GA  mAX( $4 VV PJ أ4 @ 0 b3B&! 02 S<ʂ1b R0 0000 \S@00C\ 0  "!(0 00 3C&  0 "!0"0 R00 Am 0@S 02 R 0S 10 R 0S0s R 0S0S0S ~P 0, 0@S1 R 0S /0 LKH0,P jP  L0S p00090~. } S80wH@K@0@K G0KHK夾  0L hS 0SHKH@KG0[S& S-0LIE 0C0a NN_c_cY_Y__c_c0(Uca$N[_aaabWN -L|MğPp, @ @S 3  l`K  P `T 0@S 00 hX  bT3 ,0S D,0S/00S 0S 0S$0S(`V 80K0K@K0 [0 wP ,H0@K@匒P 3Sv 1k  80S $00c[ 0 pWR 10000#0Y"(`0#0 81#81#$102$1 1 ! l@  000 !40! ` 0! 0HQ<0 㬽 ⨽ 0( ᷐8,0h 0,000H  T70O0S: 00 B00 0  0g0g$0C0C |P 90S61030S  0S$0S(0S90& #,0 0 h0a(a0N bO- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPbMin4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484<   0 pX -RLM@ 6 -RLM@ 5 -RLM@ 5 -pLMDaDqP P 010 RDL 91@0 0 0 0:5@0@0 C B\  00#!0 00 0C&  0 "!0\ 0 R,L f>V_c\_vaNDUc_c_c_c0 -\0L0TS 0S p00R0S (P(a8Xc -LpP`P@U U UPEP PE0R0@hҲpp00N -LMpQ < 4 8 < P, K00Kv.PP ,  XO XI;0t1%j 4R6Fcj,8L10 T @!8T d 0@T0X X 00Y4< 8,00 R, H0080 R 0h HXm0 :n#:RJc` 0 80 U>0 R 08Xc4XcUcN -0LMPp`:0P:X@PH  P PE 0R08@8iiUDUcN -SLM@2~s H00H0( (0 -L0 h0La:]_ -LP/x;;;;;;;;;;;;;;;;  $(,04@DHO 0- <LM00CP@ SN<t=t=t=t=t=<<<d<d<1? ?0 0 01 K"0 0 ,1  ,x; ,$0 SL=<=X=d=0 L  K20C0 10 副UU33(O -LM\@  t\ u\\Q10` R`` J@`z, 0 V. @   | l,0q6S P Q q0` QJz Q sY QPF @04  @TZ00e/C1"/ 0bl SxlPd ,0TL1D,`DUc0~n0`pf8PP( 0f0V@0*` $Vx( K,0K JTZ:T(N+ P, 0 00( 0S 0H U8Xc4XcUc -L⠭P -L♭Q00-@P 6 018#811  R R  -0L9P -LM`pEPQ 0 0S @QP|%> p02SN H%%>!D @A0AS= R ;%4 0 , %00 #0BWS 4IlKlKlKlKlKlKlKlKlKlKlKlKlKlKHlKlKlKlKlKlKlKlKlKlKlKlKlKlKlKDIlK\IlKpIlKlKlKlKlKIlKlKlKIHIJlKlKlKJ J4JlKlKlKlKlKlKlKHJ\JJJJJJJlKlKJJKKK$KlKlK4K@KlKXKlKxKKK 0ts0A0CS Q X@@0S $% , R|2xl2D PL4 8<40$ 1?3?3  0  0x0!pn x ell%10?30 @U0P%  0?200  024PX_SSSg0\S,xS|5s `d`ؖ__hOPTS`SbS `Sl h0 $$ à 0 < 0 $00PT(T_0Tx p 00eᆮ! R ,0 $10 s\ t1,^_\aa 0-0 L@  ,0P   H0 RH 0h0,K c(a,^_ P dKP8\00S 0L!X0T  P L  HD  @<  8$4 ( 0,, 0 (4$ 8 < D H\  d 1 100 1`08<$100g p-LM0 @P0 "!HN 0L`L @000ph m Hph (a c -L,M \`p V\ H0C 0l H$&R   R  R0RႡ0僡0# XL P P KpH00CH0 p 020P0LP 2 HPK A ᒫ@ i8!1P \$6BS@-L!@0 H@ -1A `L0 SP0 0- p`00C& R 00#!000 0C& x 0 "!0T 0 R-XP_c_ca_c_c0$ 0S00@Vc p-LM R00A00( $1P 0 b 1B&! 02 S41b1 R000`P00C\ 0  "!0 00 t0C& l 0 "!0H 0 Rpph4-NY_c_caaa_c_c0 -` LMT ^LL @Q Q\ 0 @k(aa (1 R 00f@VcPU K0@ @ P_02>P00P0GH 0-tPtL0n@Q011!!PLP@0L!0*4  40L0C0l劝d凝Vc_VcaUcVc|ac8Xc$al_UUUa_ddaU a_a_a_ cVQ&p؋xT T @Xp 0@D@@T@H|寝x̛t 0@ 0@@ 0 Q 0XpVUc,VcW4WHWpW -LMPpU' `V @ `\  0V PPP  @ @N@@P@ LL@N @@ @xacac -0LM0KSp8 <0 00 , ? `00V1* P&Q @Ϡ/ 1b10P:0APPϠ$:?0s1c4 1!00  0j 00V:< 80 R< >S40KS0n40 0Uc ->0LMnd`p4 %P@L 40 R08 &8 P00U* V 08    0Z UJjF:804 0S80 @X, K00K`QP 0 0 00< 0SH 姚UUc8Xc4XcW>0 >0 $UM0@- 0@^0 0@T 0 P^0@ЍS0@P ! -LM8 \` 0p 0P0c <0  \V@ i 0@2Z, K00K , 0Sv 00 R!(8.:(#8 #: 4  08080S 4\@>0. T:00R \ RC 0 0c4 :#:  cP!\4 4<  000aP0S Q @ 0 R@ ,040`VP@0V 00 ^\ <,0 0S0":$:&4 0  4 Ko8Xc 0-LMP 0 .@K PP@ PPP*40 0\ @4:Q0 : @0 \0 0 0@-P@P`p. ^  R00\:\*R:^ >00 0 bS0!>0>00>000 0S0l0l -L@㬀TPp`  (0@T -L@, TPp` ,@ T -L@㬀TPp` 0  @XT -L@, TPp`1 @\ T@-^@>0.  Q:00R^  -LM@`TSp R a :@TVPbUP!W W `e L 0D@WHUc,Vc -LM`0VPp R a :VP@bT@!W W `d L 0D@WHUc,Vc 0-`@L\0P 0  ,0R 0 0S0h:VcUcDW -LM`PV r @0S  2S @2S2S lphd0JS $0  00@0 P1`VAA0S 1 R$ 1 ?#+0AB%@ә Z 11@T !mǙtę h81\ ?# $1H1@Q1@!+B%0@ P壙堙00 0X ҙu" 0|  Ùcm} cVc7|\\\ ]] ]\(Vc VcVcVc0VcXf80K0@<  0 P Uc c(afaUcU]ad```` p-LM( \@SP`8 0 E A (<950$+4(00S8@< D Hxh5dH T L $a,af4aTaa$Ptaaaaa b b0b 0S2  0S'P U ,1P R0S  0S@T00S p1 ,X!HD!@ 0S  P 0S  0S D 0S 0P 4$0C 4$U 0S  0 S  R L0@p4H 0S  PXc8Xc4XcUc -P@LM`pg 10S 0QPP 0SK SI \W- 0S! 10#VR0 Q S 1D0@S0H 0S 0PT 0S 0S|0< p 0S \0Lp `V  Tp@p(a8XcUc -LM8PU` 1L D H 0S 0ppUB X@ Ta !T^  *(":1("(Q 001 R``(40C(4 :#%,40C,40 01p R T, 0 R( 0R%  w0PU@X8@ 0S 0S| l0,@0S L @, 0S $0H(a8Xc4Xc$XcYaUc -LMlL0 @000 ( 0 0$,4( C0S0404@4$|YaYa -L,Mph P4 @# P9",KQP 8i/ 1b10 ^:0A^P8:?0sh1c, 1! 8WL   8 8Q 804P : #5 @ QH D H@( >0S @# # 8@Q h/ 1b10 ^:0A^@:?0s'c!001@ZH @0 L 40RP @0 U^H7Z P T  `< 4S44SSD0 SH0H0S S 6!aV@0`0ó @0` W  @0`00@0< D `00Q00SH  0S H  H 10#R0 S 5D<  0%W 5 Y^D0S8000($ ($D U` |5W} 5 Ry 0R0u @SP XE0Sg@5 YU  8$0 )2 Q  0SKH 0S? H0 0S4Z+ 4S44SSD0 SH0H0S S X4!AT@0`0ó @0` $W  @0`00@0 7 300S 3 3H@3H0 t3@\ 0SY P3PS *<P< H  2W 8< v l0  uH 0S6 `4D U1 L0S. 2H(L4 h2QPU^W `2 YH2 PT  "< 4S44SSD0 SH0H0S S 1!aV@0`0ó @0` W:  @0`00@0< D `00Q00SH  0S H  H 10#R0 S 1D<堄 0@ 0S 0P c00KS0l00 0+ `b)*(":1("(Q 001 0RX0l00XcUc8XcXcgUcUc$Xc4XcYabb -L0S7<K1 Q V$ 5 R 0R P0@T:TPP  0 SP 00dX (HW:4L000S < KH P 0S0S 0@(4$0C(4 0Q\ `0 (DKP C/ 1b10 ^:0A^P:?0s#c!D01B@TA  4S44SSD0 SH0H0S S 2!QU@0`0ó @0` V  g@0`00@0Y 0S 0 0S00 \0 ` `8X<0S V 2 R 0R X0z0X0 0S !HPP \@0K !< K‡P XzX P0S$ 0p0 R0S\0S 0S 8 ` R 0S  10  H 0S!0S@ <K1@T 0SP00P0 00 x Hh 00PL aY0l00$ P d8Xc$Xc4XcUcUcgYa - :8PLM#ʠ (Pp#8 001 0R0*"%`Q000p0 U\0 R@0H0@@08XcXc4XcUc -LM PP/*%:8#*!%( f V `!R#8 001 0R :#U@p*0SZU@:00g0l0 R U:Xh<0H,0@00p08Xc4XcUc@-0$,@0S!*4*6 ,<1(P 001P : #P 0S ( 8. :(#8 #:T -LMP0 ` 00S@e00 T # 3U8 4` *%:8#*%!( 0#8Z!R 001 0R  R Pt : U#o*@Th Uf 2$pQ b/ 1b10 ^:0A^p:?0st"c!,01bUNX2@ `R{Vp2 @0  @4pS44S@SD0 @SH0H0S S 1!AT@0`0ó @0` YH   _@0`00@08 R(40 040 8 Z U:0Um:8 R 40S 40 0S1,  0S 0 0S  0S 000S 0   T0H},0KS0l,0 0h$0HUc4Xcg8XcUc A-LQ  $  $hX -LM@0@0@ -LM@00@@ -LPM!(`Q%F 0 010 P40 > :#5p W8 7 \ 3 >0 U#F3 Q pϠ/ 1b10T:0ATϠ:?0s#c!,01" R 8\ 0V \ 0U\ 0 @00@0 U  8 2 RxI $4  0 2R  82 R2Z  2 R   0SW a0 18@ @>0 :@ 10HH8H,0KS0n,0 0{ #F0Q Ϡ/ 1b10T:0ATϠ%:?0s c!001" Rg 8\d 0V \]0U\X @00@0  b00KS0n00 0Uc4XcUcVcD4a_(ab4cdc -,0L ^  08(aUc -!*(":LM1p(Q"( 001 R0*"5P#F(K` PϠ/1n10T:0@T`Ϡ:?0sT c!(01P  0Z0a00Uc - 0LQp@Lt1 T ?= ?0SN HH!00`00  "! AR00  00#!0S  S0@ 00 0C\ 0  "!0 00 t0C& l 0 "!0H 0 R m@0Q(a_c_cUc$Xc_c_c0 0-0LS@P 0SP200T* 00S 0 R 0T 0 R 0S 0S  R00h00 0T   0 0 0P00Uc8Xc(a]a\a -LM 0@S000L00Uc -PLM` 0S 0Sz00$00CS$0. V( 10S 0 R V 1 R 0S 0S  R00x00 0d   0 0 040s1$!VLq& 10S 0 R *I0  0 0$R444444 i鞁@00#!0 hP0 0  "!0000~8Xc(a]a\aUca0d 00\PSPP L@0 @0HXc\a4XcUc\a p- LM400U>0 00PS`@0tt 0 SPR0Up@`HXc\a4XcUc\aXa - 0L84@4`N0@ @Ā@0pSp$00U>00 @RP00 D@HHXc\a4XcUc\a\a\a0 0 WcWc -LqMXX||1 0, P `% *XTP1P@T @a 0$"*>!00\:@T060pS:<,, @ 00C\ 0  "!0 00 0C& x 0 "!0T 0 RHWc_c_cUc8Xc\a4Xc_c_c0 0-0 L"*("1("(P  \! 0 SP0:#%0;U>0H0 @@R4@ 000HUc8Xc4XcUc@- 0 0 0 21 0 0s#0@$ ! 0#:8#*!(#800Q! 0 S@ 020000Uc@-`Pp !:H$$X 00S (| $:1(P 001P:#50 000!S$010 0-0@P$L 00 0S0ڀ0 R pP ` `000@0  0@0$0)$峌Xc8Xc\a\ac -3崓LM00p 00P$0, 0 ppp p0S P U:YZ @:4s4C<,c00#S$ 0" "0"0"00a3C?6C#Z!"00#Rea!\"0T2@P"@L2  @@U4Ÿ4 0,,Px0 "R@j~ŸP 04T0D@x 0@x0!@P~0 @x0!@B~< hPJT:k(o`P@) E1? (P 0 01  @`P 1 000R ;P= 9W 0p(Ā HLa8XcUcWc\aWc\a\a\a(XcVcWc\a[a\a\a\ac-Xa8|YaYaTa_cYacZaT[atc[a`\acdpLaPd|d p-!:LMP`0S@! 3P@' : # 0S 00 00SxP@`pTPH@0 R 00 00S娀Xc4XcUcWcd p-LMS@P` ,:8l#*( #800R 0 SP*  ^0"5060p y8Xcd -80L0 00 Ơ z0 _Xc0XcYaXc -d0L \R00#P00*0 $) 0hXc|a_Uxa_00 R 0  \05055Xcxa_|a_ -L$Mz(z1"01@ +.  0 ;>00 @0+. R 00@0H4Xca_Uc -LM40 >0P, 0 0 S S @ 8 < Z4 # 00Z 3 #@46S``V 0088 00,^>>)*10S006J00 Z4!H,): R xG PP? 8#8ZS#0 @)`p@V ?>0U.!!Q 0@ST0ȌJ0 0H 0)6< 00U>!10 R0ʌ0 Jh0H\ j~T0T 0 80 H0@ 0<0 u808 0 80 ,0(W~4XcUceeWcWcXcWcXcXce0Wc -``LM0pS P0  @P@/00 RWcP0P0S  \:00Q0SWc0@-l0@P 0S P  T :00U0S000Wc0 H 0R0 0 0  0 00. 0U0. 00 |0t t0t p0404 00UcS 0PP0!?#=?00c?S ~@Tjڢh~,@Y@ BP@CPmPFP$~8Xcf(fV#1(KPQ @/ 1b10 ^:0A^P%:?0s c!(01B@T H4$4D\~8@T W 0 *4u~@TX0l00\aUcff -!LM!:1(P`U!0 001 `R8pJ$JT( 000p帀00 0+; 00 :P 0 R 0Hp@:#:S P@*:#:"*S:(21@(PX0 P 40 P \a\aXc4XcUc[aXc - 1LM@@pPP1 K'PU$: 8 #!( R#8 001 0R0 U.! 0 R*㑁P0H `  0@(P4 Hc8Xc4XcUc0  ")0 )Р)0 ) ) -LM@p P 0SPTT0 R0 00b81Q00@R{|_a__a_f -LMB2< r R0S tRP "88 #$0LI}H2`ӌP 0S@ 7}th P0Up7*!A06T&*46!SAQ  Kx1 :Pp`UJ1 16T:0U00 pW0#02S0ES||S || "88 #$h|(0S} dp\c|_Uca_a_g(Xc8g,bc$8Xc@gLg@BPghgtggggg 0-LMPK P@ 008@Uc -LM0@XUc -0LS S  -L@LL`P. p1L!.@ L1:404L1L@H@L!L 0V800`H`0 0 04$ -LM 0@F  hꬨax -:#:LMS`@PR pK D  OjVJZ5z8Xcg -L M00' H ~p@g0>0L ^| PrU@`H@ $@K,0  $ 00ZUzjza_8Xcg p-LM`00l H0N@0d0>0^P <0,0 4L 0L0H py8Xca_gA- QQQQQQQQ RA- 0@P`pQQQQ R -0L勀P 0-LMP@Zh{D80<0  @00S0 00 0hay\X h -LM@Q"QdQQ?qpV{?q`Q{\0qTL{HH{X<D{d(@{x <{0h8h@hLhPh\h -YMLM⠒8 0pP<@ @%  ,0  0p"8% D (K0`d4 0X4 0S! ?K ?K! D 2% 0S7 0S-[nK`F`F0 P0S  1 b ,0S ,n]0 |z0S(20 Lz0 8z[KHKH/㉃0S30 P 0Sp"0R  0a2b`/gz0p2  0 z0S0Hz08z0afX-|hhphhhhhi0i -LP px$ xHiPiXihixi p-0L Mx` P0 P K0S@ p@ T 0 @d1 \kaka -0pL M00x` V0@ P  KP `0 04P`M?p 0 (@jX0xkaka `i -L Mx0@`SsP`X1s /0Ss? r`㹖Pp 0d1` 0x 0$0K`0 0P (0Kd0 0Pp $ 0$( p( וP $( 0pUP 8y`$ ( V i -LM0pP0` 0X0L Tp@`XPP0` 0 0  0p$ @0Pfyᓖ KP0 d $K0S < Hkw/<P}` 00$ `0  0 @0kalka\i p-L Ma`P@0P TP@W0S0 , ,1T phy0!phyij -LMx0@sPp`  0 (2 (#>x00P W x(0qIP 0($0K(K KIX1 S s 0&W0S(20 Q $^;? (0R r ` xW $[?R`X!d \ W,24  0JGP4` I( 0`W0`\x0/,20  P W x0>00lP  10U -Ltk0%($-!R!$S ^  -LM@0K KK0S(00550 4 0-LM@P K0K K0S(0055 0!4P0 -LM5 @R4$ R R @0BS 0BS X0@v00 @47vR R  k0l Q-@ L<0A ^  0  Zv  3tXl]adlll p-L MN \@ `P0`PjTp `p=]a]aN  0O   ! -- -i`@0P @!1 ! ,Oi<ЍG-qԁA 090 1C&   Q 00#QY l  030Y P000 0& P0P0$0(@0,@04$00 00 ` 0 04 P(@,  0R  000 X0C&   R 00!QY]a_c_c 0000_c_c @-@00C& R 00#!l000 X0C& P 0 "!0, 0 R@=_c_c_c0 0-0 @P00C& RL  0 0#!t000 `0C& X 0 "!04 0 R0_c_c_c_c0 -LMpW!聟00@00#!a P00U00;00!00p 0!!0`00 0 0  "!}00#!000 0 0  "!g00#!060 0 0  "!Q00#!0X60 0 0  "!;00#!]a_c_c_c@-0  "!X@X0  0 "!, ,00Q@Z_cXg_c0 -0L Md C\0@T 0Q @0 ZE0  "!_c_c_c]a -PLM Up8` +R*0@!T  000(`,00p4PP00#! 00 @@X4 @0` 0!!s q]alal -LM4 \!0@  "! R0000 0 0!!]a -L "Mp"0W00 1C&  ,  p}0@0p0`00 W|0  Q 0@!!@0  "!0   ! 00   0  "!PU ,, P(`V @0 PUV 0!!L0P000 @0C& 0 , 0 0C60p_c_c_c0]a c -80LM@/040\4^c -LM܀004/0\}{'{W 0`0P40@/G$,| 00`pW@gp02.040\ @W W Q r4^c_c_c_cl -0L`yppP*Ppp3:5Wl@ 004\0p0 40\0 040\_4^c 0-L0@L2P00Ϡ(0Bl@D 004^cC_c_c_c -LM q0\ P S  0`Or @< <0 00!A  8@B@@0Sp 0SX0 T @/HH0S0Rp0(∂X@00C\ 0  "!$0 00 1C&  0 "!0  QF0p0pI0p0 Np0 lK0.\@^/, @Tp Wp00p0NN0adc__c_c_c_c0n -L Ml 2"`  $(0QS0@4p$ R RK S KS S d2d"#8C@4, R0,0   R@  R`    . 0\[/,0\Z/0\! 00 !400L P, XT H0 09900( P0 P 0.\,0[/\0Z/\00@00C\ 0  "!0 00 0C&  0 "!0 0 RD80 3t@tK S ʖ Sh Sfdc__N_c_c_c_c0 - 1LM p` lP!1\ @ldhpd hP00C\ 0  "!0 00 0C&  0 "!0d 0 R U@ HPh02@T_c_c_c_c0x/ -LM0@4`pp, ^/,^.,PY/,@UO X p0  hQ,d0 PPh  Q 10 <  0 S, ' ܐ0 0C\ 0  "!0 00 0C&  0 "!0h 0 R s000 ,00 _c_c_c_c0 -LMl0hhp@P&0pP` 0 0 $jc_`c`cxc_ԍan -,0L( &0`c`cԍa K R-L`p@0 6KR- R+ 0 #8 C< SP P  S@P  S`P P P BD0.@P\0[/\0Z/\00 r @K R ʖ R R_N -,1,a4 p 1!@PL^/,.,0Y/P,@p00C\ 0  "!0 00 x0C& p 0 "!0L 0 R@U 0_c_c`c`c_c_c0 -8184 ,1(!P` ALp^/, @T0.\@^/, @T@0 0C\ 0  "!0 00 l0C& d 0 "!0@ 0 Rm0_c_c`c`cP`_c_c00 -Lin -Lhn0R R | 0\q 0 Q  -LdM,3x0 | t3| , n t0_40t#0 02  P;.XK  @0S S P@0'\00pjtNt卾X2X0S0H1H!|xj<2  |50|5(2  |5@0|5|5Y@C 2/@ H_50%0PXjx@K n!t 0/x0Kl KԾP |Ej100|0\0T0lL1h! 08P Y DgJ1 ,0S ,,L|$j!0`/͊_0@@%0jP0`@#Hh P 8`p@5͊P%00|di0apnn(o otd_-pr\dLoXo~oJHFDoo -1ap @ $LP P00$ ;004P$ $PxAp00C\ 0  "!D0 00 01C& ( 0 "!0!0 R5 0PUb p@0SP 0@! 0UP0U p@0SP 00@ 0UQ0TL&8ec_c_c_c_c0$_ef_(_dq_- -LMD`!88#|!RPpb[`}'r4rXrrr -LMP12l1, p ^ `0@yR420 Pc 00 [ 0@@= 0T R P0$0@(0 T- 0 a0$0@T  0 0 0 000 bQڰ0 0$0c zT 0  (00 a00  ᨵdX @ 0p@a0@0$0/ E  0 a_'4rrs$sXss p-LMPJ `@Aڸ0 00$ 0 ( p(phE p-LM`J@ PA00ὸ000  ph靱(+ -LM02ct$Y1 pP,` 0 S P~x~ȀЁ R_0$00$0@ 0PCt00 k(0!L00 0@ 0S 000@  @ @0 000C000,   0S\0#10 0 00S  0  0" 0 00 0 @`(0  p`0$00 0L+D`+ 0$0( dY 0  0@`@0$0 @*z@ 0bPA00 (0! 0} 00   偶0000@d@ 04P@00 (0!T d@ 0 P@00 (0!] d@ 0 P\@00 (0!Y d'ssPzssss ttt-08$0"R(00  0$0+ (  2( S0<0( 0@000$0 -LMđ0勯Kp _K,0 @ ?d 02J /+b212b2c2cJ!{~TŸTp 0002c2cZ P 0002c2cJP0 0 S1   002c2cZ  1 !02c 2c"bJ"bZ1Ϡ Bl02c2cJ:_ Ue2e2cd!J \1 P1Pa`n(@2`!J0!!Gp@0/K30K,K40K- K.@K0PK1K2K04K400C\ 0  "!0 00 0C&  0 "!0` 0 R^4e_d_ay-nme_E.ųQ_c_c_c_c0 -d3LM\pp80S8c8#P(00000K8P' CP00C\ 0  "!0 00 2C&  0 "!0"0 R lBP00C\ 0  "!80 00 $2C&  0 "!0!0 Rp(0[,[1)[a-[1a`.0[+ [vL@ L1"b0"bS#JB!00*0[t!SMDJ1QpZF0 Q0818!0 Qp$02c2cP C0"b>CA 000X0@0Z <0TWp @h$ o0f5f#/@!bP Exf` lW`1CADLs  \@:]2nd_a_c_c_c_c0nme_4e_ųE.«*$u -L M8@4T 0 @@Rx`a`cv -("(LMp0@ 00 `R{P0U!KP6P?0S USPP/ ;a00C0`Ap00C\ 0  "!D0 00 <1C& 4 0 "!0!0 Rp\000@p00C\ 0!!  0p C6000 "!0D 0 RP_c_c_cv`c_c0v -LM @PS  %00S Z00 R  048 00 R 08< 40@Z00 0S  048 00 R  0480H  0B P0ST0 N -L M,`K@P^0p0(0K([pZ,K0 +KP pP -L$MP @4KD@` p^``$U-Kz4K 0 3KP `p,@K -0L@ p50S h6Pu0P" P 0`V U004P< (0;4P00@ @00 0SV hP 0,0h -LM0$ @(X , 0PQ LPQ XC @a@!p000  P0!P30 Pp00C\ 0  "!0 00 0C&  0 "!0 0 R X 00Sp P  0,0 W_c_cw_c_c0w -Lp`lPP` Y@ 5b` 0`$0  00 @0 000 020V9 _pp2 @ P000P0P0C\ 0  "!0 00 p0C& h 0 "!0D 0 RY _c_c_c_c0 -LM,0@S$p Pp00Cs0 0 00, 0S P;p  ,X0S 4w 0-LM0@0S S T@D P0`` P2P0@DS000Sa`-`adw - pL0`04PS^0@0p0CS0Օ QK,$0( R0(0Q 0  O0@0@S 0S :S0@00 0S 0CSh0 @ 0)S 00000 @@@@p@ -LM0 S 0 2Xlwtw 0-PL 4@ @0!qT p@DXT4@ 3S05 00h XmxX0; 08< 4 0<S8! 4W0S 08< 4FPC`PQ <P9`P WWWW0 S0@ lWdW\W0,LW0,,b`uuu4uuuvv,vDv\Tvxvv -8qLM@P[ 0Uă`9 U 0 aU <0?R0S0ASܥȥܥܥx 0@0p| WP0c0T  W0D 08    0|`a8e_ -@LMMT`pP1 )@T 0 S 1S 0S0t P_W0S hMa< 0 hNWpT 0 |g,Dl - LBa BP@K[0 0Q0p0P0`0C& R@P 00#!x000 d0C& \ 0 "!08 0 R`ac_c_c_c_c0 p-0LM 0@00 `R0P00 00C& R 00#!|000 h0C& ` 0 "!0< 0 Rph _c_c_c_c0 0-0 L@ 0T00 0P @TP 00C\ 0  "!x0 00 d0C& \ 0 "!08 0 R0f_c`ac_c_c_c0 p-LM0`@V@ P7 P0[0X Z ,0S DXlt|$0  B0[0$ ph 0Y0X 4(^0[0lU0,XU00 0X 4(Y0^ phU 0L -LM`bP < 0A^0S  R0ˠʌ ʌ00ɌH0 `(P<Q!p0000   @0!@/00  Ap00C\ 0  "!|0 00 h1C& ` 0 "!0U |>U|t>U*l>Uh>rd>U`>5n:T 07 > ,0S $,#0>U@ >U Q>UK 2=U) =U 0Sdh 0W5=U =U  0 0  0 0=U :<U =U0000000<U- <U :<U l<U0<  4<U :h<U `<U 02o H  <U M;U< ;U ;Ur  jy;U ;Ug n e/U>;U ;UV 0kX;U P;UHQ #  lIP 0d;:U=:U"*:U :U"P)$:UQ Qc00 "  d0 0@7P 0 '00079U 9U? 9UyɟP 00`0 R0@0( P00C\|Y 0  "!p0 00 \9C& T 0 "!$)0,)0 RP0FSL8` 8 8 bB&! 02 S61b1 R0@@00@xȟ`00C\ 0  "!D0 00 08C& ( 0 "!7  QA2 0PJ '7 `7 bB&! 02 S4`1b1 R0@@00@ǟ`00C\ 0  "!0 00 6C&  0 "!6  Q 0S6 0! 0#$0$   BR !b&(6 P6 bB&! 02 S1b1 R0@@00@şP00 0bJ10000 1 0,$,!$#, \@Zh@0SAt@ 000 R0P0 $@00C\d 0  "!t0 00 `4C& X 0 "!(ğ4$00 R`IO  0@@@P& #3 @ 3 bB&! 02 Sʤ1b1 R0PP00PXß@001 <4(<"4!<001 0#$0$ 0 S0S0002@ 2 2 bB&Po2U 2U  @0D,S 0\PKP@EPZ0[Y [$ R !QP@ 0P@`@K P 0 HP0!  6[#$0$&K SU0U 0410U 1U 00U0y0Uv 00Uq 00ae_ Q@c c c c c Q c@c c c c c c c c c pd sd ccedA c@rdAc c cmdqdgdfdhdcmc cc_c_ca_c_c0aaaddQ @QQ` -LMP e,0 0 -N, *NB2`  0 S 4 p00 t`00C\ 0  "!@0 00 ,2C& $ 0 "!0"0 RmM d0( 008,!2040 0 R  xM  rM0*@KϠ<0  DX@*3<0`0`` P4` 0 0bP  0  4 P40S )(0 ("4400$ 0 0,0| o#d %M00b pc_c_ca_c_c0QWEV( -L,M` 0 ؀!4pKP@ .^M%4K@(0K P P@rP# [$['0[(["[(,&[!P[8<%@[$ 40 RQ  0cP  N -L$M@4 ` ,@ p/PP ,0K ) 0K@@@ pP@,0S@@T,4 ,0 , 0^ @7@0  N -LMP`p $P P@ $0K   pPPPPRP $\00S 00  00   -L$M@`p 0@ PPb 0KN 0@@@@ p P@0\@@T  0,0K 0+ K  *K)K4K@@@ pP@0Q@@T, [00 0+0[ 0  * [000 0)0[ 0  40S T 0 @? 0 b  N -L$M,`KP @p-LY0,K0 (K$pKP @@B@  -L$MP $ 0`L  Pp8 (K$0K @@@ `P@$ R@@T00$000$ 0S (0S T0 %@ 0  N -L M0pK@` K$PE.KD$h$t*0K0 -`K,pK+@K)K(K P PP@  -SL M@ Qr2` 00Q00P0 Ģ`00C\ 0  "!0 00 |2C& t 0 "!0P"0 R}gK  3P`0 0@T@b@bXhJ! @0L\U 0 @o`1@ 1 1 bB&! 02 S5h1b1 R0PP00P@00C\ 0  "!0 00 0C&  0 "!0  Q0N^J0D@T;` PS_c_ca_c_c0aaa -L M0`KP pJG0KP*K @(K8)K0 -K,pK+K@ @@ N -L M(`KPp J@K}(K0 pKP @@ -LM@}̠ 0@ @ -L M0@KP `pwJBU0K/[@/K&.K)K4 Π0 -pK*K`(`K -L Mp0@KP` MJJJCV0K/['Ġ/K)K8'KP 0 *Kp (pKT - ML`0 PpPP@0nT `:PP` -LP -L 4pK `D00&((*&<&%4K20K1 K0K/`K-K,PK p0P*00 0 00<H0 @ 0   XP@0S * ?0S2U6 !p2U t2U l2S  0 00<01U 1U  ?K e/G1UE 1U 1U00 "   QL10S 00p2 )P  0 P0U 0p00)|&4400 0 0-0Sh 0S00000]D0U^ 0H0Qf_QQ @pd Q@mdedAsd rdAQmqdhdk~gdQ` -LP6 F < n0  0X00(d'*((0 "4400$ 0  0 X80 ,0S <,  *HRF0atWEV  -L$M(K@0PKp0B-B(KP`0&$$X$t ʠ,K+PK*pK)@K` .K-`K6 -L 4  4 p0BS00S 0S 0S 0S S  P 8 8-#DLp$&PP) @0d 0  0S(0 4 @V &*0#P@*0P@ f_ -LM`P8 Pd,88 #$"Pt00pU0YQ @( KDP< K SD _D2P` 0SX`p.4PK jA(D&,&Ƞ&*040K2 K1K0K/`K-@K,K[A0:00 0 x 0 0 P08 $ (<0,000 0P<<aaf_Z0  pC S S  S S S  D 40PS@P  0`440 0 S@   048` 04D0 ;C@ 4K 00K @ @0^ 0?0S0S,P K0@p K` KHP<L0XP#HP T@ 4PPK0pK@P0\@$<T`0 dP `@Kp@K40S0 440 Q -L$MPp0@0Sڰ1,Kl  @5,KT0L @` `0S0@00 ;順 -LMK 0)8 p-LMP0@HP0Dw;T0Q`  n; < P0S0S \; 00 000pdQ;`0TS L;00D@0@E;4B;lf_\e_,b]   -0L MP@ KH00 ST0h0 4 | -T0L`lP@p f?0h00 p   0000 @S00 P00W - 8LM0 8#Ă,"RA0QU= H@,!0 , p 3W  P`!0W00 @0, S  00  0 S00000 K,0@00  000Xf_ 0- 8 8#T%2AL00A?S 0S 4P` H0000H   CXf_ - 8!LM8# 2A 0 ` PHp 醀@ 00 1lh 4PP  '40@0sPPPP001t d0< <00 0 0 01p R08 00PP l:-C0 @ +0 0004PPJPPXf_, -LM0p P@@0 KH`U@ -W@ 00!=00  7H 0 ^L R P0R00<P <0LS7LLLL00` 0R00<800LS00;0000;8 Q 40 ` R  R  R 00 000R 00000` 00` 0R00<< -D0!#p0<!4#2PLaL 00T 8@l@P:tAt!P000( $( (0$0p(U4P0P0C\ 0  "!0 00 0C&  0 "!0 0 RhB 904000<;00`@`0@ P000L PP0S P08P0Xf__c_c_c_c0Lx -LMH`p0S 0PU $ R(0(0(00(0 00   00< ;000@ 40夦0S    00 0 <0+@400 000000 P00 7(K<00000<0 ( K(0K0000JK '0[80'0K<? 8 $&0K% K$K.8.$$K&0K% K4H@ 0P @@C  -L(MH`,K0pP @  ;@,Kl [ 40K@ P P@20[3[0[/ [1[48 $0@P0L 0u -L4MP, @ HpP`1 0K @8PU00  000 0K 0>H 0 j@:700 00!$0 0K @@0> 0 Hl@ 0$4 c@B 0u -L M$pKP@`9T0$0K@008@#0K#0KH 0` @  -RLMp`@@ *:R V(PK9H@(K&&T0 'pK&K%PK$`K@@ @00  0 000000 # Q#>  0 < P0 0  Q 0 0³00 0 004`F0?<` -QL M`@p% Q00? 00$PKn9H@$K`&&T0 "K!PK `Kp@@ @~00 0<0000#> -L0@ ^`Pp ^ 0000 P00V00Sa0 C 0^0 -`Lp$MV, K0@ 0P 40(KP V 0 080H(K0 $`KPpP P -L$M`0p, K@P(KU0 00#>008H0HW@@@0 (K@`'pKP P00u - `404 L@ P0p p0BS X 2 22 22222 22222 20S 0ҵ޵8ҵ<ҵ 400$Y 80 ( 0@ 00W 000(0@00B  00W 000(0@00S/40 0800 80 -L M@` p4PK 0g1`V00 0TT0S 4 00rcp`Sؿֿ00"c1a ᰈ ᗁL -L M1@Ϡ PNlpa4PKV8\0p  h!8 n /T40s 4!,!?L3cS 08T0S$ ,0S0\ 1W< G0<0  ?B3cS!3$0J0$008 b/0 H/<S~U U080SgfffLaMb 0-LM0@(()0K[ S 0K )|(^ PU 00++ 0KK|$0 W~0(()KP[\0K  )Pi|( 0- @L aP,00 0dS0@00@00(~ 0 T0 0pA -0P2c1RL@,p ` (H]0D 0,0T (0 0S0T00T0(QBL -LM` @\ Ƞ!$C"a,Ƞ@Qp 0 @ @40,P@000$0T0 0`0 S00B -L 0!0 0T  00 #(0 0 00   0000@00 `d 00 (00000d(0Qc(00@0I\0SdX D(0XS 000<Yz$2S|sQ@t0@- @,PU @0T00\0#(# 0$ 0 T0PXP04Q@ -LM `,Pp 0K NĠ@ KKPKBx000  z0T0# p-LMP`!"a,@  \40T0p) 0 0 00 T0}.? p4Q0R -PL0 aR@,p `  4*,0,0M} 0T0L(00T04Q40 ( 40(S"4S,_40 ( 40(S"4S,_ 0,_ p-LMD@`PO4 4PP U @ppą_( 0 PR ą_ -LM#P@ `+\0@T 0SD S8 @T(+++0pa`\ Q-LP8 `Pp@aFQ00`V00S00@0@T 0S S @T`t0P00n0P0|P 02$04 4)paG -LM(| ^0 @000C 0 0\ 00#!0 00 l0C& d 0 "!0@ 0 RZP_c_c_cU!(a__c0 -&LMf0弆 ,0 +0 6 r "4"@ !$"R@pK0`&P4+PPH ,60(&@T D3 0K45@Pn *0: eܥ܅pKⴐK*Q R a **@0 000匎i/Pㆎ@0@0C\ 0  "!<0 00 (5C&  0 "!4  QU$QU0 S*R  0P l40SQ q*Pd R R b f*@d*@0 0002/P,@0@0C& R 00#!000 3C&  0 "!|3  Q~U 0K8\[UP 0SQ   p rS S@ 0R@0 0D0 dp0S  0CSSp0D 0S 0Sx  P00SR 0S 0SPx x  0S 0SPx x   00  0! < Q08 0000,0S0?0,080S00, 8 WEV$4 -80LSP`p (0S KKT r> 1R0S ]PV# .(@2@R0`! 0R 0R: 0S  P 0 0 V081e/9-e/3-WEV -LMp( @]D@8P+X, `L T(0 "<00 @ ّ P@jHo@ - 0S 0S`v  P00SR 0S 0S`Pv v  0S 0S`Pv v 0 01,0 0T0,0 @0(0<00  ኑP@H( @0e?C\ 0R 0e?C@T e/,000 l@00:00Ì0S P (HWEV -LM(`< @PtD8/\") T0S`Q@ 4<0(` 4# S0 S00Y0 4 8*0@4000;0000 0 ἆ_p_0ἆ_0p_00 -L!L -Ly!` 200 R 200 R 200 R 200 R 200 R 200 R000 200 R 200 R 200 R 200 R 200 R 200 R 2 R -XALM 0T!  0T! 0T! 0T! 0T h0T  0T 0T (0T 0T 0T 0T h0T  0T鼆_-4 0,^0^ 0 bat,b -LM܁ Q 00#QY Z  030Y P$0P00 0 0(p,` p0@` $40 0@ 0 0@ 0 $4P (p,`@  Q 00!QY 0SYQHPD@000! T0 TbaDbc_|bc p-RLM@P9  `!0\0\00S\r pQ< 0Sx|$|||pT0S 0Sr00V0S` ba -@LQ`8 PPH T00T0SV|1!qP|}~~~T`0HM.$04 V000M.TP4 0(,04@ 0@!! 00 PP@0  "!鄠 $04 V00T 0V Pꥦ@ᢦ 5(a_ba_a p-LM40@S  S R 1Q`00#! R0000 0 0!!Q 70S0pba -TLM@ 0Q@0 Zr 0 @Ѭ 0ba4ba@0 0Dbc -0Lp 0AS`0t 1QU ,P(`V @0 PVU 0ba$ p-LMP`@U*T @T`p U*$$8#8&@pp_ -LM0@040 T004 $ p-LM0`@040P T0P40 Tp 0-PL @ U   0h 0-L@P        H0 p-LM`@``P }Hvp00 0-LM@040x 00PU   0g c KL HDD( @ (K0  $@ P 0D\\uT -LMpzsP`Us 0 0$  0Q< $P< <800S`P 40PP<00S<0   Zz ` <4<8  4  @h h0@K4@ , @P 0 6P $000S$ 0040$0$40D`(00(0 [ć( sr-LP`p  0 $@T uv u 80U 0@Tv D0VW WP + ' p-rqLMP`  0 $ R uv0@ u 80U T pv D0VT404040@ -QLM@8 0C?. B"0 @h - 0L0\ s0 00 0-$@0 TLP,00 L0 P0@T0 0-$@LTP L0 0@T0 0-$@0 TLP,00  L0 0@T0 0-$@LTP L0 0@T0 -PPL0@& 00 1 ` ^{'i$8 80$8P 8T0@8$0P 8$8 4  T0  h<Xp p-LMT P0`@H \ 8  0$ P@0 8$8P <8V @ $8P@40 i}TppT0 p0h@T0 00 T00T0| `X08<#30$P 8T0@ \ 0 <$ 8P< t p-LM(0a Pp0@000T8TP0$4P L0@0@0C& R 00#!l000 X0C& P 0 "!0, 0 R ph雨_c_c_c_c0 p-LMPP 5* 0` p8 $48@P0$ 4@@ pd R0d0 `00S`0 L0`@ppp p-LMT0@![Y$80 P8}㎫`$8P0 4P ` cVH0S T0  p8$;P8 T0hT[ -LL  -LMPP 00`Rp< L@$<0 T ,000@ 000q@0@0C& R 00#!000 0C& x 0 "!0T 0 R iէ, \00Q0S _c_c_c_c0 p-LMP0`, P@ @@0I [0Td0`[@P`dp 0-T0L @PP X0  v k _ U\0   B 1   X00H  00h T 0@ T d00<0H 00 T 0@ T d00<0H0 0\0HT  0d0T 0+ \0T H 0d0T 0+ \0H( 0H0& X0H0& X0H0# X0~H0# X0sH0"iHP~ Q- -LMT0@h-0S 0 ?C5A0P 0S0Q T  (RL#R!&R$0RA0R#& -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000. 000008P0 $4P0@8$ 4T0@@ \0 -P   006    0000000  < 000 006 000@006 000 0008P0$ 48PP0$ 4 -L>P ܁ p-LM@P`/  |(0tH0 L8 P`0 T0d  $8P4 00 X0pphX܁Ё 0-(0PL@ F 0ES t@4 H0"S 00 H0"SHp H0"S 8P0 $408$;P 80% 8P0 $4V>8$0P 80 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000$8P0 4# 8P0 $4P0@8$ 4@ 000 006 @006  0000008$P0 4@ 0-@L8P0$ 48P0P $4$0 S8P0 80 -L)P  p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pphE 0-(0PL@ 7 0ES D H0"S 00 H0"S5p H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008P0 $48@P0$ 4@@@DT̞؞000000000006006 -LM@8$P 08 -L2P $ p-LM@P`#  t(0lH0 L8 P`0T0 $8P4 00 X0pphN$ 0-(0PL@ 7 0ES ꜠h  H0"S 00 H0"S>p H0"S 8P0 $408$;P 80% $0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 000008$P0 4  00000000000006 -LM 0T@P  @%#,00R0S ? Z p-LM@P`(0H0 L8 P@00T0( `R ph $8P4 00 X0ppho4TX 0-(0L@P0  H0"S0ES(<0%0b_p00 -LM@8$P 1<8 p-LM 0`0@P 0?.AB"(0H0 L8 PP00T0P0 $840  X X0 \0  ph,phi$8P04\` 0-(0PL@ 7 0ES $D H0"S 0UY0 H0"Sp H0"S 8P0 $408$;P 80% &0 0-0LP@ P 0 0q 0Q 0P00 -LTM0d ` h 0 l0 p  d00 80dp d0X40   p <2P P Pp X  Rx t t0   p 1("(RP Rt0x0St0  @<  0t X0 0P0 lh0Z`0 8@ \ D `LA,M9p P J?Q,1(Q Z00 qw0 2  0 ,  ${P  P@0   0 (0 BP@   :P P T , 0 2 !; 28 0 @  @ ,2@ A0 @ ,2 @  0 ,25,2倂P@7' 1! $@0@0 m fP@$2 ? 0<K PP  0<$ @6<@ (P T 1 $$2("_0 000 T 0  (2? P $2@ P0t @ @Kᱡ 1 $ 0 ?0T$2  w00  T,2 =0#0Z00S0@0  `0Z T 5@0@ ,2;,2 0  0  4  4  $4  $$"`4    ᫇Pᕘ0 1 $4 1 $m?$" 1 $ PP0 T 1 $ > $ 1@ $@D k?0 T 1 $2$",207,2a 0 @  $20$2  0RqT pllj 1 $ Q@@0 T  [0T Q0 T  x0T! 0 T 1 $ $" 1 $ 1 $ 1@  $g 1 $$" 1  @* 4K8K0P@ @@UP4 8 T  0,K0K@ @@PAP@@X ]tLct,P7Rhcc<\5ccc!\8#\Q( "(R0SS S SS p-LM2 BP@ $@ 5 D` \4TPp 1$  -P$L p`:,2V4,24,22@ $2@W @ @X@@VHH"Z@@0@  1 $X000 V000 T" 0 T -LMPpP`M  0pჁPB ` 0T A 0T  0T  0p}b 1 $l p  0T A 0T 0]BP@ $2 , ` 0T A 0T  0TZ 1V! W00Y @   0*@ 0@"P?P,27,2 1 $` 1 $  1 $ dd8d,bc - 1L` $@2  1pb R$ 1@c $@D (> C@= 71+%2 0% 1 $  /0 T  0T\ P D 8 ,  @dldddde8e\e -!L p0 T Ax!0 T$2   h适8! 0 T m/0 T$2 1 $ ``0 T A.0 Tk?@ H$80 T Q$L0 T 0 T A( 0 T$2-A %>( 4 %ž0( 2$"05S(<2-A %>( 4 %ž0( 2$"05S(<2 -LM@P$2 7$2(A%>,"%0( 2$"(€ -LM@P0 0 -LM@P0 0 -LM@P0 0-A (%> < ž0($" 20% S<(("2,28,2 -LM@P0 0 -LM@P0 0-A%>,80 ž , "$20S(20(2<2V-+,("A%>$ Ɍ@ 0 2$",€( -LM@B 0 SA%>Q 0 2$" (,")<2,"(P0 2$0"0 (2 0(21b1`-" 0(S,,BA%>" ( 0 2$",v-" 0(S,+B@A%>" ( 0 2$", -LM@P$2 7$2 - L+ e -LM"@0S SB   A %> e -LM"@0SB  S 0 A %> ,2 0,2 SC e -LM"@00CS B %> ,2 0,2 A C D e  -L M0 p< 0P`  2  S S  ,Z  SO @0 K$K0  @@P 0  040 8 2=0<#P 0(K P 00 $ ($ @0( ` (P@|s T ln h`i c 40S , *0 e f4fnc<\7 -0`4pPL 0T 0X="<"2@ 00  L@ 똂q0<>,@@ڠ岎X,10 P00Ss @2  E?,2 P 2 & , F? 2219  1?E G? 1K1R  1X^ > 1d1k  1A?< `05 AϠ/\& ۀ HT < @0,BP@_  I0TL `0T P0Tp0  E?\0#T0( 2 < F? 80FL ,0UAC!"B -L@  8 < 04S < 808< 0I? wSu 80 8 0AB p-LMlP@T G 0 SP Rp 0-LP@@T0 -HLM($H"(P`p, ("(-K"0[![ (0"("K"0[ (0"(![<@K"0[! [H$H0  0 80 -(LM"(P`p0 X (0K A[(H@ (K0[ [0  (K0[ [0  ( (K0[ [ 0  (K0[ [0  0- @PL:X 0X0 0- @LP(0 08#8 X0 0- @LP(086#8 X00 @- L0 ( 00P0S0P 0 ( P 0 8-#x@L@`P1 V 0FS 0F`` (!0 X (0!0 Xp  V `F(  0F0!0 X  -L@P`j 0 8#h] p0]  <X` ( < X0V8#h0] h 4B0>3 -0L (P0 P00 p-(8BLMS@P"(R B`` (008#80 X pp p-LMP`  $@ @p p-LM@P` @0 T p -LM400pK@P .`  04 @0 [PR @0  0K@@4  ("( 0.[Q R.0[S/0[S@ 0 -@K/0[S,[8 P0(",0K8 0-[0>\:2  .0\ -K8 80Sp< L^< 80S @ -[e͠ 0-[0, [ 0p<0   0 I?@p ͠ 0 0 -[ 0  {p<0  d忀0I?p~ 0 0 0 <0 ῀Rq -[^pW  ,[ p< 0 p0  < 0 <0  5@0I?@,[CB -0L M '0K& K( K%K$K@0`4p<`P P U(0K@2(0K$@KB -P@ 0L`p~@ 0h4 0-L@P 0 @R2"0B-\0΀ L0R00224 NS0S"$PBC -LM0@P`$004PP (pR  PU 2UU 0E8#= $0| 2 x  P 0 RPi  P :^^ C^%^ ^^ Z^U^[0 00  , <S  (^^! 0 000 00a 0  pP  P*0   X<S  (^^ 0  ;;S0 a0 P  P0   0#000 0   l0^ 0 00.P 00C 20> 0`00H ABf4g -L M40p0 P`X 0 8@ 0 00S ,0  Zh0JŇ(́@Y,0X  *00 0 0 0  -L,M (`4 8 04< V@ Q 00 00C8#XH 0 0. K8 8- K ;1Q#xH 8 L L0EU8(0K8Q #XD +K,K+ K, K  @@;1("(#x 00K/@K8H 1D("(0 _H 0L8#8QH0 8 4@ <  .0[Q0E"(+PK,PKD .0K+K,KP -LMp0P@`04 0 % ;1#h 0@$ 0 0$0 @@ 0  0"0x 4 0 o   "D 00C 20> 0p@00B p-(LM"(@P0 `X 04 X 04 X0 X0 X0 X0 X1 X1 X 04 X1 X1 X 04 X 04 X2 Xp$ @0C1a!cP0$I-\\< <0   0S`\0 S*0B\ -P[Q(L"(`pm%X@ g@@$@P@@T -p@T`LP: 0P@ T: p-LM6 `P>@ p6 0O6 00dQT@p 0-6 L@P6 000h/ p-LM6 `P @p6 06 0d T@ -LM0pS` ;QX%(@dV` p-LM6 `P@p6 06 0 d T@ -0`4pLӠӀ@Pe0S Ӡ 0S t -L4MH 0P04L0 vP 0DKS@:;1("h  #xH\  0 0 @R*Pa<[A0ST0 00@    ("(0 k L0P>T -L,MH 0@04L0 &P 0DpKS`*P(;1#X<0 A0S 0 `R*00d  H@\  , 0   L0 -0L\M91 0`4p ӀP, 0P0 1 ,0S ,  P@  0@ | K0OS|K4@|K  0]Ka^KX@ zKxK`K0 @0 0 |KP00  000Ӏ| KGP`=  P A00a`g -LM00p40`@R!@P2`O0,0 L 0 PA0@U0 X (,0P0,0 ,0P0,0 ԠӠ, -LMH$H40 00f -0LM<`@Pp000, S04@P00S 0 00000 0$0S 0 R 0 J 0 S ,  0B/00 0S , o&P 0 0 0 -LM@0S< 00S  0P pgg -LM`@ 02Pp 0UV 0UU00000U/ U = 40 A0o LP U DP >P-000 4P-000  )P U | !P-000X P000 4P, 000ggggpggA\@-@ 0R\ 0 00_c_c @-@00C& R 00#!l000 X0C& P 0 "!0, 0 R@_c_c_c02` 0 Mb8#8- SP 0S P 0S\^ 0\ -L/ 0-2L@,0 $P 0$T0jl p-LM@\H0P p@y`Vd$id> l S2 !y p-@LMT`PT0T H,@0@   404@0,BT ph=kkPl\ldltll\AB -LM4 (0#DP8 D @ # 3R 4x0S0 @ 00 <04@5@888 T p 8 PE8 O~Z px0S Z`pP,@0PUOW80OnZ `  2  0@0 ^@\p 0@ 0@X 05p0008 0< _ Ÿ4, K00K4S 804  4S <PQ l0p l`p0  ;l@PtUp0 PPU 0$@0 80x04804  , 8< 0000 4SZ 0 0 000d 00400 6 <80`05pP \p  (0K80O^W P(@,K@$l\@GO$? 0-L@P@  ,0\R0h (0 ,, -LM`)&P #0x0 S0  ;$000d 4R 4R4R*4R 4=B 0CS000000 405 X4R 84R04R*,4R :=B 0CS060$3QQ 3Q 3Q 3Q 3Q Q 3#QQ33`00<0 880pWPT3h#Q00Q@@T㨀YL3QV D3QS QQ  AP80pWO^ Psl0p@ 01 4 8 h% 0  l5S  B,0K0K @=l5S YP l5S `l5S  4 8l9.p04 @  P A,0K0K  @ l5S `00!:00` q0S0Q1RP1|1Rx15H*REh1R ,1R?*1R1D1R05 R5 01,1R0 $1RR0R0R05:0R00R 0R =B"0C=B0CS0R  R0|0R x0x0l@G$$$!$$$$%%Q&R&.0UXm$?O$$$S&%o&'vqqʄ -LMl0p@  2"r,`9r d2 pL"0U RB = ,K+ K@12d1 ,0K @T,[ P+[@p12dQ00@TY lp0@  |! 0 T0p 0 ͠ 0S Ɨ+K,KR01,0K, [+0K  0 ,K+ K0,[+[ 0Q ,K0 0Q 0 ,0K+ K|0+[,[t 0Q 00+0KT0T 0Q, 0S0!,0K, [+0K  x>Ad_n_i_q_ -LM8 P8l0@ pl0@pD l0pH , l0pT @ @$41 0@00 4 @9848 < p,@!8,27, 2<O^< p4Qlp 0@ l@p 0D lp,0H l@p00T 8o|4! 0T0`~ <#83 QQ (3Q 3Q 3Q 3Q 3Q 3Q 2Q 2Q 2Q 2Q 2Q 2Q 2Q "=A 0CQSx|2Qu t2Qr l2Qo d2Ql \2Qi T2Qf L2Qc D2Q` <2Q] 0,"SS RO000 0R0玁0 C800 ( &  1 ,!`, 4< 04 {< R <X> @95<  0R0` C` @90 0'0  R0000 0S0:0 0 S:'0 00'Α0 0 00 ]$!$J$K$$$$$$$%o&S&'vt_ -  808 0 0 0 q_n_i_d_E-08 P` @TP0 p0P:P 00^0:0SS00Q  00QQ0 0Qd_n_i_q_ 0@-P@ 000 000 00q_n_i_d_ -LM4 `)(P4%x0 S0 1!00d 0 405 1Q^ _1QZ 0601l`0 080< p@ 8 8  80pWP  g0Pᨀ 80pO^W Plp80@ 8  0h%X4lŕ\ ,0K4 @0K@\8 8 lŕ4\ 00,0Q0l@GAttbm$?it -L MP`0l0p00 0H 40 l0pP 0l@0c,Ÿ2p@ , h p,@ pWOYlp0H l@p 0P  |! 0T0g! 00 4 2 00, 8  R00ą 0g a 12  07\00L000Ũ0 ` 12 # 0# 04h0 PQ 0 0Rg0 000g0fa\ tm -LM*0S(0`#400 40 P` "3R  0 l0@ l0 P <S  0S % 3 P 3P 3Pu 5060 0x0 S0  60+S2 d000 00"040` <58480pW P4 'P㨀80pO^W Pl0@ p g0280 h%40  fl5S A,0K0K 4 @"l5S >P l5S ll5S  40f80lp 0@ 0S,0 1P1 P|0{0?S0t0S0P 0Pf0e0P 00%PL 0  l0@ l0 P 4d1G1l@Gim$?mt0mmw1n'21q -LMP@l0H pl0pP 0\"0c2#pp2  ,2  2Q2 R020ĕ!0SQ00ė`, `VYlp0H l@p0P  |! 0T0f# 00 ? = 00 6 b"f, Q0|  Q  Q  00| 06\00L000Ř0 ` 12 # 0#d0 ,0 s|00Q fjnz______ -LMlpQ0 @3g1pP `*0 S(0#4 0 P @ p!p1W0`4p@0P!QWL5Ť4Fڤ4S$(> W 7 04 0 4S@,0K0K @4S 0P W @ PP  < 4P  0$46 㜛kkIknm -l0`LpP l0T p 8 pW P@4S PONU @UU 5P8 8 p -`L)P`p@0 <00 x@880T +80@Tm -LM*0pS(0`#4@ 0P @ l0pT lPp`@T $L4<T -LMpPxx0 S0  `1 00X16 d00<0H1lPp@ 4 5`08 00 l@pP 00 lPp` @ $H@8@8 80PU@ 4SONP @80U n\@Gdz -L$M8 4 803a410* <0 (0R8#4 @ 0p!@0  h1<\0 4<PE 8 20D0 D0lP @pp `@A 44  Z8@ 0 @0<S0$0@R,0K40K<@ @<4S4<8 @0$,;kkPl\ldltl$?0nHn -LM8  < 0 p0l@0 8@ !  , 80,4 *40叟0S40 8@@A@@ ,00 @0 R8o8<0 |0! 0T40,0 , j 0080 S"` BX@ 0 SP4 84 @,A08@T@D0 @,0 0010"00"`P @ R0!@2@ 04 00 0@  88@ @  00P0 @007 8 4@0!A,0`@08X@Dp0@ ,0 @TXPh&PA04@ @ &l04 @0 4 0.0 '80@4 0`A, @08\@Dp0@ ,0 @TXPh&PA04@ @ &l04 @ -LM 0@  pqW35W p0 Sr 0@ ,`4 R 0D ,0S *$0 RV 0@ \0 SI*P$0p R 0D \T$`0 00lpD0l@0p `0`0C\ 0  "!0 00 3C& | 0 "!0X#0 Rok S #`0 00lp@0l@ 0p `0`0C\ 0  "!0 00 2C&  0 "!0`"0 Rt nkr,B,"P0 00lpD0l0p P0P0C\ 0  "!0 00 1C&  0 "!0l!0 R& 1k$8A8!P0 00lp@0l0p P0P0C\` 0  "!0 00 0C&  0 "!0x 0 R j 0  p p8p0  p_c_c_c_c0 -L MpP [D2[P 0   @0  m H  0mTb 0 $ @ P00Pc |^0 S:ӌ0Ո0S0x0 S00 40 8!A> 000d 0 506 1!`0080h <* (0R#480`ㅀVP H\`  (0K80O^V P@,K@]4S `` 0 @  0 0@ Pl\@G@H$?xn -Lp^  ,0^\RQ1 t1 1Pt@  0\ m8Q81` 0 lp l@0p `0`0C\ 0  "!0 00 0C&  0 "!0x 0 R i T0 ,,p_c_c_c_c0 -Lp 0,  Rdp?T&0L!01QxN  6\l&0 01Rx  <\l%0 01R| 0 ,@0S ꔊ \m$ H0m0S   l0S] 0  0P4ğ  UP 2200T200C\ 0  "!H0 00 44C& , 0 "!0$0 R 0#P P mh 0 $  $ 0 $ 0 P $  0Ty (dB2P 0 lp l0p P0P0C\` 0  "!t0 00 `2C& X 0 "!04"0 R@hQ1` 0 lp l@ 0 <k H 0  k $ 0 @ Pv00 2R0p  0\toi0x0 S0 4 d"A> 000d 0 506 D2D"<`0h 8 0(K P`  I 0($ @P1(p@ (Pt U! /@18 3d1TP@l0S 4S `HU 8  (Q(1` 0 lp l@0p `0`0C\ 0  "!0 00 0C&  0 "!0h 0 RZ gXPxnpl\@G@Hh$?hhi<_c_c_c_c0 -d!L`1M, H `, L1L0,0D!D0P 04 , |040 8 8P1 @0e!pS1#D 0   PP%U4 80 0R4 80 , 0 , 0, 0 , ||0,t t0 0 0, x0,0Lx0 o\0CPEEp|Lho -L03a`^q\0@@L0 hŇ`埑PU$T h%*T_o -L M1 p`$$t 1,0 $, @0 Q 1D!00 0 0 P$  o04 <0M>000 P$013$0@ P⊡ X00P  PPX, 001  8  Z*04$po p_0p -LMx0@  001<@$0 01 $ p-LM0 h0 P@` 0 <@Tp 1 0  -00L!|0D $ -40LM|@0D T -00L!|0L $ -40LM|@0L T -40LM|@0T \ -LM`P)P n2pWQ0 Q0 @0q lP@b x0 S10 !000㘡d @40 0`<58 @h(7PB L1L!  @/ 40( K,0K 0 0 0'4S ?) P 4S 06-lp 0|,K (0KXPx@D}x@\pl@GxkPl\l|pp$?pppm -LM810,0 p P `,@0(`VOl0pL 01pp,0wpP  Q10Y |! 0 T 0w 0Wp <040 P0S RQ0mĎ_Ɏ_0@-p0"R 0\P0X@00"R  ^0S0( 0R%9dad_$0(#00"(R0 Q(0S009 -LLMp0lpH  80l0  )PDP` ,85 0 l0@ l<  0`K80 P@% 4 0S0060 $0 x0 S0  `4P00X$X4d 00 040< 85PdddDD4lPp``0P @$H@P @88P 8 80X` eP80OnX `{Xl0? X: 0  4S Cd0KhK  @l4S  0P Xl0l 0 l0 l l@pPH l 88H 4S `l $D02lPp``0H @H $D@<@4H 1l`pP`0P @P @00P lPp`P @$HP @ZlPp`T @T $L4@<T 0 Q 0   0 l0@ l0<  8 `KPH D 00   6LxU06`@06@dagl@G$?mUTq -L Mp` ,P, l0pT A 100p0@000 0Z_Yo |! 0 T % 0S000 PR0C 000 ,00,0 lp0 ,00!,0000@l0@Q@ p@A0  H0!80,000,0 0 R0 0Ņ -LMP$2p0,0 F`,@0YO` l!p@ 0Xo |! 0T0,0 .0S000 PR0C 000S0,0 0\ ܨܨܨ0 0 0 00lH p 02 0S00ą,00LS ꌩĩH0   ,]$00`q -LMpP4B x0 S20 "l@pP00d T 00T lPp`@ @@ $D@@<4@ x!l040` <85 p D῀8l0p@ p`l@PP@ @PP00@ 80`VP \ 080`O^V PGĕ\  (0K L@,K@ĕ \ 0Sl d -LM0 4 , ,0C, 叏 R, 40S00^lPp`@ @$D0@ @L<4@  D |0! $ |0!0 T |! 0T00 7010!08 @,lP@Ap`D@@  822 , @lP@AppE@` @A844 ~0 RC0S0 ,0,4  0.4 ____ p-LM|0`!$ |0!P $| 0PP!0Tp -LMl0pp@ 8  Y P `@4ZS PON U @`  |0$ H8%0S$ 8|qq -LM`)PH x0 S0 (!(1d $!000840<56` 08R:000480pWP \ 080pO^W Pĕ\  (0K T@,K@ĕ \ 0`l@G4$? -LM, l0pD 0 ,`0XoY o,0|! 0 T,0l0@80 A@ pl0D@ p4  00(  %  0!4  0 P0@00080lP!@ A1@ plD@p 4000   ,0!P4  -LM4 p< 0P4-x0 S0  <0S000 < 0R000<0S006000#;00d #l`pP040` <85P @P $L@@4<P lPp`P @P @@00P l`pP@ @@ $L@4<@ lPp`L @L $D<@4L l0p 8 8 l)p08  l0p 80  <0SM80`VYP "P㨀80`O^V PJ 0S h%4 04 jl5S < 1RA0K@4,0K @"l5S4 0r8Pl5S '80l 4p 80 lPp`H @H $L4@<H l@Gm$?ܻ -LMT 8 l0p0 2"0 40 , ,P,可P, 8T l00p4 R o>80 |4! 0T@,`01 0.00 0000 d 00 0 H 00@,0 10! P0 4,  04 ,80AlPpZ@pt1 `@A 44 8H lPp`@H $L@4<H @ \000 QS0L00 0S0@@000 8H l0p0 PO 20 S2Ʌ0SɇGjΎ_Ԏ_n -l0`pt L8 XP @4pS PONU @5 "0S  8 q -LMpP *08 S(0#4 0偠 R R R R R  x0 S0 #3d #000` <04508  SR6 R R ta04 8080PU"@PS ` l0p4P 0 12#  [P}80PONU @ Rm R' R% R# R! 0BS8RQlPp`X @$L@TX !@ @4<X lPp`P @P $D@<4P l`pPT @T $D@<4T lPp`X @X $H8@8X 80@S4 ,0K  , K00Kll5S 0 0 A &h0K 5h%`8 0BSR:80S0 6040ꅠ80ASl\@G qm| -L MPX l`p@ 8 00CSi80DSW1堑, 00 p,@0pWOXo |! 0T l0 !p@ 0  00 0bZ30 0S00ą  0l !p@ 00,  Q 0S0@0 0 T DD0D@@0@80000D_X_d__$_0_|___q_̏_؏_ -80ZLP `@p|0 $ 0S 80`ONVp @  0S0 |0 Tq -LM0`(|8PP l8P d8P \8P T8P L8P l0pP 4   P@ '7QQ 7Q 7Q 7Q 7Q 7Q4  4 '7 QQ 7Q x7Q p7Q h7Q `7Q 40 H[ 000 (7R 7RR 7R x0S 00&A>000d @4@5 Ɵ RR VR vR R 6RR \6R T6R R R R R R @6RRy 46R6u %5QQm 5Qj 5Qg 5Qd 5Qa 5Q%] 0`  <08 5RRN 5RK 8`%\5QQf P5Qc H5Q` @5Q] 85QZ 05QW @5@%<545  8p〆  W%8 lPA` p80ld@0p 80pW 4RR x4Rጄ |80 \|0 $|0 T|0 $|0 T80pW P P#80pO^W P0d#`3QQ T3Q L3Q D3Q <3Q 43Q lp40P 0"2QQ 2Q 2Q 2Q 2Q 2Q 2QQ 2Q0 4 '$) 0  4S 0\"QQp 2Qm 2Qj 2Qg 2Qd 2Qa 1Q^ 1Q[ 0KB  ,0K@>4SI !1QQ% 1Q" 1Q x1Q p1Q h1Q DP 0T!QQ' D1Q0# 4  '4  0g 0QQ 0Q 0Q 0Q 0Q 0Q =A.>:  0D6@0K:s꜀0 L0P 6@060000:00FhMhbiMibuuRurl3M8M0M@GHَ_ގ___m H -LM`0 t3RR^ h3R[ p,@PpWOYo!|! 0 T +  2 "   0P2 2  <\W  l !p` 0 P2P"008 $2$"008|0 $l0pP @ ;:   20S`1  1 R20SU!0S00Ƈ  20S T1  H1 R20S020ƅ(!0S00Ƈ  20S0 - 0 R) 0B|0 T0 G  000S |0  00S 9| ! \00 0B0208M0M__َ_ގ___jn -(|@qL` 0 T| $0@ , 0P^h%| 0T   T  0S00 -LM|0` ,8pWP @4!S PONU @;2 \  0p 8q -8 ZLp `4S OnX ` 4S 0 0QQ$ 0Q! 0Q 0Q 0Q 0Q |0! $8 P8  l0|A  0T|0@ $  hMhbiMibuuRurq -p03a`LMP5 @ i+|0$|0 10 T5%$|044 \ -`pfL  P 0m|0$|@0 0< T| 0\ -L4MP pV㵁4V 0,K P@` 0,$4  848  p, (Pt &40S  |0K  0 @@iPPx 0t,0 00@ @@OP@ L|0 ,(#(3d  005 0#40060` <l 2\0H ,2H0"2TL P08Dp4"P 8  03it1ਠ 㘠h%xp P<H 0 1cA< 4 0#@ 0@0/8000 P0`@ PLV 00P P`@P8 LV<  01ca l1 0 @0&.<000 P $8 VP80U@0/L000 PD  |0<D ,|@=P0<0D \!0\ &4fr<\,rXrxr30Cdhhrrr_ s -Lpu`,@P0PUOZm Ƞ 0 000  00CQ 0 "!000 X0C& P 0 "!0, 0 R U_c_c_c_c0 -0`L0@ ,80Z @ dPp%U@ \ 0 80q -LM`p0@pAd|0A< ,|=P0<0 \Q 0\ -QSaQ0偀PR@L$|AdAp`,0L \|0< ,400|`< \ -LM@0 `|P1clA 0< r,|0<0 \@M^(0S P 4$0(@$ -LMx0@  001c148$0 01c1 $ p-LM0 h0 P@` 0 `48Tp 0a   -LM`)0P-x0 S0 1!00d 0 405 0!>C0CS  060H1 < `008!pS00W80P \ (0K80pO^W P  0 0@d  :9d x@,K@ĕ\  0 4S 0S00l\@GD -L,M, "0 l0p@ 4 l0pD l0pH 08 l0pT @ @`00 00"0!D0 4D0` 8 n,0 < 4 8 ,@4YOlp40@ l@p 0D 0!Q lp80H lp0T <Q,o@0|< 0T,DpT10 0(H0 1L0 0H T0 40!2P 8T 40 8 ( & 0S!PL0 bH1< 0h< l0, p00  0200 00   H0<0< 0  < u000r -80ZLP `@p|0 $ 0S 80`ONVp @ 20S0 9|0 Tq -LM@`P }1Pvl0p$ Pq  $ 0 @ cP kx0S 00l!A>000d 00 506 H1H!p<0`0h 4p8p 0(K P  0($ P0(0 (Pt X   P183e1 U `P0S HX 8 xnl\@GOh$?hhi<-|0| H t0t L0P D0d |0`0 XX0X T0T P0P L0  0x0 0CPEE8t - |0$L0 $ -LM|@ Ġ00 T - |0$L2 $ -LM|@ Ġ20 T -LM|@ Ġ40 \ p-LMP0 `$t0@4 0$0 0 Rx0$ ph $  0S $$ 0 0 ph|Phph_ -LM03`p 0,  Rdp?DHP 2\@T <\7T0@@ ,0@S t ti0 \i0S   T0S] 0  0P1  UP 2200Q200C\ 0  "!`0 00 L1C& D 0 "!0 !0 R E0#P P i<:lP 0 $  $ 0 $ 0 P $  0Ty @dPnn_c_c_c_c0o\$o8oLo  0-!L 0, 0 , -LM 0  A0 0\ -LM0 A8  #0 0\ -L MP+PL *0( S"4pp#x0 S0 |1|!00d 0 405 00CS$$0600!0`  <08 `@ P80`ONV @0 R l0pH l0p8H  $0K x$ K(0K+4S 0 0 (K00l\@GD$? -L MP0 R l0p@ , t3,l@ pD , !00 p`,@ 6pWO`0 R$ 0 R lp,0@ l@p 0D l@!p,0@ lp 0T |0! 0T00) ' 0 R  22 2 1!,0 0, 0  111 2 00% # 00 0S h1h!002,!, 0  0'0 ~$1$!0,04", 000 0S 0 002,!, l0pH l0(8pH Op0p 0,04", l0pT !0, .kdrux} -80ZLP p@|0 $`80pONW @ $0 |0 T0S  S Zq -LMp0l`P ) 4 lP  ix0 S0 2"00d 0 4 5 Rb gSR_ `5R\ 0601 `0< 8 k80pWP  g02P80 娀 80pO^W Plp40P 48 0h% lŕ\ ,0K @0K@lŕ\  0#\  0 484 `0eR RoR0 R(0R 0Rl@Gmen -LMPl0P plpX l0pp\ l` p0j!2#0,0  p@,  @Tό,0Slp0X l@p 0` o|! 0T00  0 000c1`,  0$, V00Ft `000`00c1s00  00Q `` __ -LM8XpP `@4 S PONU @`|$080S 8q -LMlp0`@ l0pP @P8x0 S10 !00040 1d  6 `0<58Ll@0pP 80pWP v\p $0K80O^W Pl0p@ lpP ,@(K@`l@GT$? -LMP`l0@ ppl0P pl0WT X p0 07 80 0, 40 ,A)^όlp 0@ l@P p 0lWT X 00p,0So|! 0T00"  0S40 00 0 55$$‘0 ,@ 0N,@ X000H000S8 00  04@0  Q0 -LM`)P$ x0 S10 !000400d  `0<6 58!80pWP \ 080pO^W Pĕ\  (0K P@,K@ĕ \ 0`l@G$? -LMPl0@p@ 0@ 8 l0pH l0pD 4 l0pT , ,p,` 0pWolp 0T l@p40D lp 0H l@p80@ ,\o0|,@! 0T00/ - 0 , @ 0, T@0D0^  0080 180 8@0A8@ 00  00 `04@0L4@  P@@4  0,,4  nj, @ -$l0 !Q, ,8ZCL06LQ (0#(#<S R\ ^ -L$M `i  ,ĠXX 0[0p0<,` HKH 8 4 D @@ V@P<??7 -LM`, "0 , 00 r 00, P   kqP@0 S –P@@  P;H–  P <B(0S/, 00 ?Y,00  0 ,000 00?Y0 –(0Sd0  $0 (< 0,, #$0 (7 -LM`4p(0S"P0@T00U0– (JJQ@DC 0–(0S. t20,000 X20–(0SXl00l0 vh0<0Ph0U–1 $0 ( $0 ( $0  (l0 0l0p-83.) $@0 10,000 00–(0Sx 0 $0 (–(0ST0  $0 (,0  $0 (@ t\4tHt\tttttt 0-4l0L0l0 P (0 •08#8 X)HK 2 ( @T塹 0000T 0 • 0 \ 2 (0 •08#8 X 2 (0 •@08#8 X0't  -l1LP`04@S/ 0 {0R(  t00t0x00x0 x00x0x0px 1x0pQ (0S2$2  5;5P0S0P R% 2 ( pWPH 000W 10 – 0 \$t -$!$Qp0a0@00L0 ,_0E ,@*p00C& R 00#!000 0C&  0 "!0h 0 RhCŸ000_c_ct_c_c0 -LM4p5Pg  0X 2 ( Hw10SB mkd10SHP010S 10S t0!0t00Q 2 (0 •08#8 X 2 ( •0 08#8 5@05 •0 X1S :   V2f-x*p'h#l00l0} • 0X$ ""$u\ u0u<c0 0b<0 00mBkBs_c_c`aDa_c_c08a -LM5P Ap1` R@T  0S0000LP;0! <P2`0S !0V& —`(0S 2 (0 — 08#8 X050S5;50  $0 (0S l1 00 1R0@@1( -|%|LM04p005@@P,( DE00C\ 0  "!0 00 4C&  0 "!0$0 RoA@F~o • 0@TT 2n $ •00n T 2n $ •000n T 2n $ •00n T 2n $ •000n T 2o $ •00o T 2o $ •0800o T 2 $ •00 T 2 $ •0@00 T 2 $ •00 T 2 $0 •==0 T7P$} 7Pw 5 h 2 $ •000 T5J 2 $ •000 Tx1 B 0 \ • H1X@1 B ,0; \ • 1X B0 X ٖ5F@05%E +%0,0峕 2 $ •00 2 $ •00H[_c_c_c_c0, Z\u -5 L@ 0-@LL,@Pᮖ000,  0 -3LM3p@`4P0 P2B'0 0C\ 0  "!0 00 t2C& l 0 "!0H"0 R!@(2Ts 2T]*2TM 2T A%< = S( =@S @ !0A8#  %8!C801   2 $ —00 T41   2 $ —000@ U5050 R _4P5@xy`0T X0T,, 0ሡ_c_c_c_c02i 1i i i 5i 6i( 0-t0@0Pt0L4L 1S00hꀰ -4@LMPF=U pE ,z5 =5 —(0 —08#8 X 2 (0 B08#8 X —0 X B0 \ —0 \P?`(P80BT (0S2$20`VPZ3P`$P0GT (0S2$20`VPZ i$ k( s n -L$M0@ 7G3"pR 3R 2R  Zg @ ͇0,K @@ ڟP@S7 χ0 0K @@ǟPL278 04K P (a—|, 720 4$ @14 p (P0=T 84>t/2|, X(  `   @  P< 8    0  0  0  80< _07T0`0R N:EN0 @@ 0' PJ`44Px8&Pd2#PL+ }O 6,)`bZb-,2S 04V03 0 2SdIO L i|=t9 02>0 WON)v,vTvv>->vvP8 0-5L=@S@P 0? R R P R 0S010C1<0S05ꋄ5;50 -2LM2p@`0P0 {Px2tB'0 0C\ 0  "!<0 00 (2C&  0 "!0!0 R ;1TI1T)*1T 1T A @ @  505x0 RN4P5@  2S   ^0T 0T P:P0P0 ?<-P0CP\0S\\0T-0V_c_c_c_c02i 1i i i 5i i )6i( 0-PL2@ ,04 0505@054040v -3sP 0` L@ 5 2S22,, 2, 2  B! 2 0CS񟗗CCFFFx2 S( `%04$"0*\} ㊸7P+ $徯 BP00C\ 0  "!0 00 1C&  0 "!0!0 Rh:Px  P T₯ 5@05%1+%孏' `03P00C\ 0  "!0 00 0C&  0 "!0x2 S0(r p n0  00N_c_cN,v_c_c0wDw -1崡LM P 0`2 , "0? R00S@T 5@ @404hJ0/ Y5@ 1S)@0 0C\ 0  "!0 00 p0C& h 0 "!0D 0 R9_c_c_c_c0 0-PL@0 0 ? R"0 00"R d00dS S ; R006600#00S00&00+ 0-PL  0 SD0S6I8J8JI8J8J J8J8J8J8JHJ8J8J8J8JHJ 00/00@CR00 06Sx0 h0 T T006S  08 00 00lw -L\MSC 0S`l d h pt  0SXĖ?0` K@0 @ 0 PXĖ0` d P@`<3( QĖDT\lP h@ Yp #\m ,0@@rT`0P00 2 !PUPt p0`0p0 p(0 \ĖĖ\l"hDT00"h0b0`00d t `00XĖ(0S-040$Ė(0S  Q 2Q!!0\ 2 S d; Rh (84 (` $0 (0,0 \0Km @T*1\K h0S0@h0  T@4 t r P T KP4 0 00 UPT :{4l0X$`DĆ474X$04X$0`44 044704LN88 -2L @ 1\`! ,0᳠ X Up @42 0!X \(P"x U^P0" @\^P \pbM>0P@ m88DN 0- @P0L00P0P0C& R 00#!p000 \0C& T 0 "!00 0 R00h7_c_c_c_c0 -; RL  + 0B>>Q P4$0bS4% -LM2 @h2\``" ,2 –@\P<"C.,U 2 " rR  ,2 "䁟QR@  ,T2!,2@!,T2|!,P2+,"@0+\2 "R  4\2 "R  4\"4 \"4 \"0+\2 ,M^@0 Ȕ88844(4 404 p-LM2`,,2 P0@,5,  PP ,0p\P0\p -LM2@,,"0,\ -LM 2 S, `0pZ ATP @ ˯K 0S5`<5V P &T`@V*K 0'! 2S ,0S ,Ս2,,2@0,\9?   2,,2@0,\2,,? @ 2@0,\90aw p- 1LMQ `0@00D 00 R 5@.0@`00C& R 00#!000 l0C& d 0 "!0@ 0 Rpph5 _c_ch__c_c0 -LM2@ , 0` pPPW+  2b3c!00#0td [0i.Q0 ;d  [ 0-@L  ڊ0P׊5=5N0hD 0-3N 0PL  ?2/0"0  l0,  P0 / P, 2 0CS020/w -LM3~  P[ ψ0ɟOP @PfPO 2S!@ 0  0CS@@'T`ψ70O_ P@ P`CP(\ 0,K P@,$ P|0,  (P Pɩ@ĩU 0忩,彩 ww4ftFgc<\w 0-PQL@<3|3SS l3|SSlS0$3(h#t3px#, p-LM_@` d%0S/.0S*%2,/0?;C0C ?; 8c0 ?].B` B :0 03 " 0S,GpIpwxPx p-@LM Xr010`,!5(1 $!0 1 ] B000@! 0” \0* 0# 0ݕ 0&ؕ 0ӕ 0Ε 00ɕ 0 ĕ ᑃph껕 +0?>BN(IXH+#&0 -LM? @R2S a0S 1  TU+ U 0S404_"pK  2[:2K"[ f0STP P2[<2K"[P"K  2[S  2[S  2[  :2K"[ 24 0R4 PP P2[<2K"[ -LM8ÐPp  p 0` P@M 000p p *,P@70 04P@%8Ø0  0P@`   80 00 0 00 40 txxx0y -LM0@ $  80 00  0-LP@L <^PT #0 Ƨ 0Nhy p-LM83@X4PP4` @ 0T DTHTpNL -LMp(4 ",@RPB.+0\2 —`1\5H! 0\! @0|^t! 2\2 —@\H!0C.\2 —@(1\$! 0\ 2P0CS2S "0A.\2 —@\ -4\ Q" Q007+\4 $S4P$P4" 48 \ 8$N8(888  8,8 p-LMPTP 0` @V 0`S0x 00@VTPX4S0X4pF^0T4X4$X4N0@- @QA 2 <0 4S0& DT@40TĔ0"00!00 0 04S20 S P420x0 P UP B DT0(000 <0( 4S00000 LN -1LM `R07 $ĐHD(0T$@SqRG 0 0@S,1@ TT@R 0q$Ė(0S HD0X ڴ5;5 X0 0 X 050峀 (84 (p00p0X4$X41 (84 (NL -RL MP`08 $0 0 \ 3R)ĚAp 0 P`P,0$@ "Ě(0S $0  (u\r\2@ 00H0wPP 42 !!$ !0``1` `"@00C\ 0  "!0 00 1C&  0 "!!0!0 RSUL P1@ 0`0048!$@0@0C\ 0  "!0 00 0C&  0 "! 0 0 R$ R 1 0+10 ,`(` 00 0Q00Sq 5@n ĕ$(0AS0<0 p00 $ <8 <0@40 @ Q0a0 80A4@  B#88<@0 80 #H 0p 4S0"0R00S PS |20C\x20N4 04[@PADD dĕ(0S03` V< `R d<P!< ld$0 00Q00S 5@d`V$3E • A2`BB@\#J/0\<v hx4 (9\N? @T0D8#H 7Pq @\ h2R`280S0c081#8180 58 % 82RRRF B R:Y34S 00tt 18 0R1 $8 00a 08 00b04p$040 0040Sk $h00h0$W0< 44\,K ៫ 00 0 ◫⓫0 R000 ,K↫ 0 CC I4 04P044N|2\x20e $0 ($ĕ hx4  (( 2S 0 0 0@ 0@0 0  0  0  00 -2L 0\ - LQ 0 0\ -L M@K @ AK 0ئP0 -LM0 0 @ 0  0-0L 0 P@  0 - L ; 0  - L ; 0 A-` ^0P@p00`0A  S R0 ApQN `000 000p0 -LM2S 2 , 2*,O^Pm0@*0,` 2),N~p`\*0@|0,p`,*0@Q~0,`*0@p0,`)0@R~0,`)0@p0,`|)0@S~0,`P)0@p0,`$)0@U~0,p`(0@V~0,`(0@p0,`(0@W~0,`p(0@p0,`D(0@}0,`(0@p0,`'0@Y~0,`'0@p0,`'0@Z~0,`h'0@p0,`<'0@[~0,`'0@p0,`&0@}0,`&0@p0,`&0@]~0,``&0@p0,`4&0@^~0,`&0@p0,`%0@_~0,`%0@p0,`%0@|0,`X%0@p0,`,%0@a~0,`%0@p0,`$0@c~0,p`$0@}0,`x$0@p0,`L$0@e~0,` $0@p0,`#0@f~0,`#0@p0,`#0@g~0,`p#0@p0,`D#0@}0,`#0@p0,`"0@i~0,`"0@p0,`"0@j^0, ˜ \0%0x %400X%00PŘ0$0 00l0%(5  t 2!,O~`!0@|0,`!0@}0,`h!0@U~0,` 0A @>-: 0p01K![k t g <@8#X N[/q!y012 s<:CS񟗵LȏȏЏЏЏЏ؏؏(((   (00(00S S000 0CSꠏ0P00T00000 0 00000 0 00 00 -LM@Q00,0R 0ڀ0R x0R Q:Q0Q 0 , 0 0 000`({ -0LSP! (0S 0 0\0,0\ 0+\0 @,@*0 , p R R R 0BS񟗨   Ȕ Ȕ  #c00CSpꄒ, *0 ,0*0 \0 ,}* 0BS0 R R 0 0\0 ,0S ; 0,, <4<,\0!, :!\ P MP 2*0 ,0*0 \0 , 3 \Y 3 0,, ` @ 0,\0,,@ } @)`V  1 \$) 8G' X N p-LMPsP` p0S@@T  R @0R1R,,@0\T 5:0S  RxR R (0SU  `R1R+ 0BSR `0[,, 3[,\0X",0("0\  0!, 8R:R厓 R  0!\ @K  K1[[`0`S "Q* 01K[ Kn0 , 0 \ u 0,\0 ,); Ibm 0,\0 ,0(-08 0\(9(8 -LM0@S 0S S0K P ![,0R 01K![P -LMPP  R Q00 Q 1S00 Qh f 0S`0( p2\0, <\00 1\ ;.\0`0@\x!0Z/\0@X!\.0\1S  @;\ !Z/1\0@\; .0@\; Z/* 1[02 \Q0 0K ? Pp 1[: m  S00 0f`!h! -0L0CS@`n0 ,0PS^ P PP0SHtq0^/0\ 0 \0 ,lp'0S 0 ,P P'0 ,P1U2U0p00p0&PpDp@p0Sg`0$ ;\'  -LM0@ ,0S10@ +0 \P P0 SS SS S S S 01 K31[01K![00a-0 \P -LM1PS GP@ *'0,, <4<,\P@oP@`K P@0 S Sg1[ :1K ![0P@0S% L0DpS0LS00: S)   P@![ 0  WH W  P@;1K![W:*!K1[; P@1[01K![P@}  P@v1[:1K![ P@l![0*0Q!K1[: Q1[: 1[:1K: 0-LM1@S 0PK XP1[;1K![` !KQ0$|p01[ 01K1[ 0R1K1[01K![P 0 2P1[` p0R1K 1[<1K![,!K![xPR1[`01[@0 -LM:@/0:*R/0:P  KP1[<1K![PP0S00P -LM0@SP Q PP -LMP]P@) 0BS:R2 0S) P@ `pK @T @T 1[%08#h VP@]P@ $P@hP@  -LM K@yP  K rP1[>1K1[![ 01K1[,@01K1[!K01K1[<1K 1[<1K0S\1[;1K![P![ 1[;1K![+!K1[; -L M0@@ `,P" K [P@2^-2[ :2KRR2[2[<<2K0BPPS"[2[*"K2[=Ã@0Ó\\Ń2K 0 \ 0S&K P@ 2[`02K"[=P2[@92K"[3P@$0S4 BKP$pK @T ^@TY2[^$0E8#X 0SP P2[$ @T >0EP@88#X 0S  P@2[p02K"[P@ P@2[;2K"[P@00CS0S0S5P@ %P@rU&K WP@f2[:2K"[*"K"[P@f꠆ -LM0@+, 9:7+\0 , 0-LM0PS00 , K@KPM1[ @@1[9 SL  SL 0 \0 -LM0@ ,0SDP\0S0 \ 0-LM @0BSp0SR 0SP R0S0PK P P1[   KP KP![  1[  h0S 00K KlP1[SP; S ; S h0SS 1S 01[; S1[; S0 -LM0pP ,0` ,@0DST0ST| TP 0DS@ 6T 0^/,P' D#0-,@0 3@0T0^/,P0 , @ l0^/\ @0 \@0p0S0p0 l01^/\0 ,0A`0 \P` 7 S&pK P` P`{2[| @X00CSs R0SLRH i0S<LP`\0S (K* Kp2[S 0S 0,,0 0,\@`W0Sk 00,,0 0,\X-P`! 0 \0 , 0 \0 0\ 0-,@pT0S00 -LM0@S?`p0)00 PU 0S "K P2[P  PdQ Q2[@002[  0 ,?@d0 000 p-LMP-@`K \ \0 1[ !0D8#Hp p順 -LM 0@6 \0 , h! -LM 0@6 \0 , h! -LM@8 #80CpP S,U  `K 0 066 0 0  0\0 , k!P -LM0`@ ,pK 60' \0 ,vP8#hm0 ,0 0 `w0PUXm p-LM 0Q0CS .\@P`  ph\P p p-QLM@`P.0S0(6 \@2 0 ,@?Tpp 7; 0 1gp p-LM QNH0^ $H8\P `#H phP p p-(LMQ@"hP*0S0(B6 \@ 0 ,@ T:pp 9280 p p-LMPzP@z0SL0 , 1` \0 ,0 S/0 0\0 ,0 S5 0 S S ph0,, <4<,\  0 ,0L@0 \0 ,L0@0 \0 ,p' -LM@P 0 S :0CS eP  00CS! KP1[91K![P 0-LM0@0CSP(!0 0\ 0 KP 01[8\0 KyP[\ 0 B\` R#P\\\\\hhhhtt|\ d0RPPP\ 40\ ,0\ 00\ 0P A0 A A A -LM @0S  0 S~0 p-L M 0 00@KP P p1[`K0 P1[);5 R0   P1[*:6B& 0K K P2[![002SPS0nS0S000 p-LM0`K 0@ PP p1[K 03 0 E P1[0 P[@0)C3 R0 =30 P1[*:6B& 0 p-0LM0000 00000@SP`K P p P1[ 00CSRpp0 S0SS0 0 -LM0P ,0`0C,@pSPPPPP00@00000 020 0 R 0 S;51K![ 020@000KVPp1[;C51K![R0  0000200<@000000000  0 0000 000000 0000 000000000P00;00f 0\ -LM0@00  \0 ,h -LM0@00  \0 ,h -LM0ȠP ,Ƞ`H0L |4,,0,@S$ 0- S* $PK$00$0 $  $0\0 ,p$0 0$0  \0$0 -LM0@ Ƞ P<,@ T$ `*$pK8#Hh0 ,0`0@$0 qV: -L`P,p@T0 ,0PS S%@T T 0P0 \0P0 \0P0 \0@P0 \0 ,30#P0@P0 \0 ,30#0@T0#02SP p-LM0@ ,,0PS,`' S p0P0 \0 ,P 0 \0 ,ph0P0 \0 , P0 \0 ,p P0 \0 ,P 0-0LP ,,0@S ? S  0@@S 00h8\@0\ @0 \0 ,  @0 \0 ,@@0\ 0-L@P#?0 08#X0U 0U0 -,PL!x(\@"hV00 gV0S P 0S P0SJ 0S S [X*  !60X:P!0WSQ   !X* 4 <X0: 0 PP 0S  -(p"LM WP!`*1@ 0 \@Pㆀp` @ 0, V : (-L"x\P! `: 0 @AH@`P@ 0\PV:, -LM`p`P@U00 < ,0@T:順, -0LS  0,7P -LM@PT` pK@0 08P#H 1[?T08#h0VPpK0 1[0# 1[[SɌ# 0K2꺺 p-0LMP1K@`K0 08P#H1[![>T01K[H 0K a c? P,0S pp麺 -,L!H(\`"Xp#U   dU R R P,0S  0@D< 0T@ h' (-"@TLP!x,`:P6G VA0WSQ  G !AT*0 "! 608#HᓒP T:T: -LM,p Ƞ,Ƞ H.P ` B("( V$+*  !0 @0 ,0208#HTT 08#hV:  ("(  B("( -LM0`!,0SqP 0 ,@ PaU:U < S  7 P\U:U0 ,@ P>U:0,0\< p-LM@K0 `P@\0  [ Ƞ4P0![00 p p-LMP@`K0 08P#H$ [T 1[#400S: S S @08#H T p0 ,00#0p - @L pR PU `3*0R1+@ 0\ 0S;@0 P0\U` 5:0Spp -LM`, P pJ W11@P2*0P1+@ 0\ 0S;@0 @0\ TP5:@0P1R,,@0\T5:@ T*,P W0 *qp@ TP:#0S|0S,@T0 2" 0 20 3" 0 -LM@"0PSqR,,, 0Rh 0RR,,0\ 0PE!R,, 0SR,,0\ 0S!R,,0 -pL0`@P 4T8@<+Q@ \ 1R ;@0 0\ -LM@PP` 0P0V,,0\ 0pA!V,, 0S0V,,0\ 0S!V,,0 -PPL`p @0TP1V,,@0\T:!( 0r` p-LM0@Sp0,,0K [P>![0RR 01K`P1^3 @R xxx0!2200@S 0!22008#Q0!220!22p -LM0@0C S P :  P0S S  0,\0,, 000 -LM0@0C S*P0,\ -LM0@ ,0S:SS 0S S  0 \ 0,0S -LM0@ ,0S:SS 0S S  0 \ 0,0S -LM0@),0 T(,0 8(,0 (,0 (,0 ',0 ',0 ',0 ',0 t',0 X',0 <',0  ',0 ',0 &,0 &,0 &,0 &,0 x&,0 \&,0 @&,0 $&,0 &,0 %,0 %,0 %,0 %,0 |%,0 `%,0 D%,0 (%,0  %,0 $,0 $,0 $,0 $,0 $,0 d$,0 H$,0 ,$,0 $,0 #,0 #,0 #,0 #,0 #,0 h#,0 L#,0 0#,0 S0#,0 ",0 ",0 ",0 ",0 x",0 S0\",0 4",0 ",0 S0A,,0 !,0 !,0 !,0 |!,0 `!,0 D!,0 (!,0  !, g@@@@@ @(@0@8@@@H@L@P@T@X@\@`@d@h@l@p@t@x@|@@@@@@@@@@@@@@@@@@@@@@@@@@ @4@<@@@@@@$AAA AAAA A -QL0T  Q(P \X -1LS   S\+0\1 *\;;0 ;;L \1S \ 0;1 \XG-`0M@O0L 0P 0  @P@ P(P,PP00 ^`@0@00 `P0@ Rf  0P@ t0\K @\A \4 \! h1\ X1\ P1\ 0Ѝ0P@ @0pW P@0`PU` ` P `@0 P J0S(1S 0@0S0 -LM0@0CStt0HH0$0(0 00 ,,0 R( Q 9 S0 S00  000$0 S0 00Q000 $0( 0 0$ 0(  0-0X@L LPP0 \0@P L,0 -0X@P`LLP0p  \0@PL 0\ -@L M@@ 0S`ph S4 S 4K pP040C* K08P #X2[Ġ 0 Q 1P p(U"H 000c8H DR 0 04K@ >P0* K08P#X2[à0L 8}S H W p!UT0g8 #H I7#H  0AS0 0* KP2[=3SDT`lx202P0Pn0n00~𫪪 p-LM 0@SP 0CSp`K lP![9 S0 0 _P1[x    KTP1[00 -LM @0LS K\ K 0;0P1[ 02030P1[? -LM4`KP@ 㑋 0S T0S4 L0S \( KP@@ aP@(#-XP@* QP@3,JP@ "[AP@L ( KP@ 1P@h-(P@&Kp @T#2[92K"[)"K"[08P@#X3,P@"[P@00*K, KP@2[S{6K8 Kr0S/ L\q3[1Sn&K  pP@`e  t08P@#&0[pWWd`X:N0L0i P@E 3[1S&Kp Q@T2[92K"[08P@#X00[/ N5 -LM@Q 0S0K bP1[L'S  R  rP lP p-LM 0@0CSPp0 S Su`K P pU>0 S S01[01K![BP p0S S p P1[01K![+P p P1[01K![P p1[01K![P:S/S S0 S S1[01K![P p P1[01K![P1[01K![P`K P p-LM0P S@p`K rPT/1[01K![P0S S p ZP1[01K![P p JP1[01K![P p1[01K![P 1P1[01K![P 0-LM0 S@!K S 0 KP 0 dPPK P1[<1K![TP NP P1[;1K![?P![9 p-LM`P@0!, ,0@T:p 0-0LP,,@ 0,,0 0@ T T 0 0 -(LM8"0 #Pp 1 R Z,`K)C 0b8#Z4 *@ 0  8#H T 0 0 !,0"+\08#Z:40S @4 T04'070 8#H T 0 0 !"+,0\0  @0 !8 "+,Z,  0  8#H T 0 080"+,0\0j0c 8(#" p-LMP0x`0@0D 8#H T0a0@ 1!"+\08#HT:p -LM0@,, 0,\ -0L ,PT[ p-L MH @0$H 0K KP!K!K`AK\ 0 pK\ K\PP *0 0R:0` -L@0SP``0SP <0 pR ` `W0 IAMT p-LMP0PSp0 ,8S@ p`V P0P ,0@0 @,T p XT[0[ -LM PP@ !}P@ vP@`pK @T S@THN1[0S $ 0F8#h   SP@  JP@ ,AP@  8P@ 1P@`  @T @T4 1[ 0F8#h@BP -LM(0 S@ 0, 0 \ -LM(0 S@ 0, 0 \ 0-(0LSP2N 00 ,0d @T 0T 0-0L0CSP @0 ,0 n @T0T 0S 0a ^ a 0-0L0CSP(@0P ,0F @T0T 0< ' 0-@TLP' 3P 0 ,0 0\ \0L , 2 PU0U 0P[ -LMT0H S@0, 0 \P[ -0 SL,  0, X -0L0CS0 0,T[$ 8 #8S 08 ,( #P 08S0R,8 S ((0"(R,8S(0!S_ -L M p0 4 `  X  P   @ , < 0  d|  0 0  ,0  00< u -L M0 p`P< , υ (K 0 iP | 0,K P,$ @h6, P (P0 <|(@4&L$8#8Ss n$( 6"(R[ 5R 5R5 R $ !"(k|0,L2H( 5 S] 5 ( RRM RK X ? Rl5    H5Oz0 SS& SS ? RR 0B RSR4  3|$0S00{ , 4P|29|2 @ 01 @ 0| @$?||"?4 h|"{$ 8S S{|"/ ?h|"{3R$ 3Rj3 S Z|" -?|"  62Pp TH3ŗo|2 < 0/|2$$3 S1 3 S # 8SS %0D S|2:|2|2/ < 0|2$2 SF|2 0  0 P x2x,Õ<0K,pK0D0* ,P@ 0,Õ? 0 <  D04P@  x,ÕD?0 0  P@ ,Õ84#D0 P@ tlw ` 303LwT <w8}c|_4f7|}H}x}}dh_c<\ - 3 L$!$ -LM C $0 T -L -LM Ð@$0@ \0<3 -L M 3`$T 0@S,@p<3S D3PP00C& R 00#!t000 `0C& X 0 "!04 0 Rpphj_c_cbc_c_c0@- 000 R R 000  0  @00C& R 00#!t000 `0C& X 0 "!04 0 R@"_c_cbc_c_c0 p-LM0P\2S `0S @ 0 @M0\2S 0S ? \00\"R P0Sx@002c1 T MP0S , 00C0O@L@Ok%̓_ -\1\LM 0H0DDq0P@ 0T0! ? Q00!00 00P00CQ` 0 "!000 0C&  0 "!l0|  Q  80 0P00|@3M@T_c_cbc_c_c0 Q- L0s頀 88#$R\\ 0R01SP0SQ 00__bc - 8LcM‑8#P, @F0 SBHaH1p  P kK -0S! 0#PLPP @p00C\ 0  "!0 00 0C&  0 "!0 0 RU ,0 S T,9U  @P0a_c_cԓ__c_c0 88#P0 _bc -L Ƞ Ƞ,4MP@p <2 QPPy(2Q 2Q 0ό1Q 0B~S001<P   0 d0T N  VS00< R V P0KH0 @0KP T TD 0 ,p L` 8` 4 (00S 00<1 P0T0 V 00S X a)TH K@T H K?PT H0Q @0QQ(0$0p_UU@Ut}f~fbc 88# P-L=@0P  A p 0 R p)`P00C\ 0  "!0 00 0C& x 0 "!0T 0 R\ ,_c_cܓ__c_c0bc@-0@ 00Q000 0 S0  0S00@00C\ 0  "!t0 00 `0C& X 0 "!04 0 R@_c_cbc_c_c00 R=  0ܓ_ -1Ls 88 #4 S@pP`0 1P0 0`000S( `P00C& R 00#!000 0C&  0 "!0p 0 Rpph000 00 e00p=_c_c_c_c0 p-LMQ@@P Q pTP L0S X R 0`S XX `1PS-p 0-LbMP@0 @S0 4P0-L0S600`"R 0fK1 0 S tQ00 0`20,KH0@ 2c 10IP ;o+0a 000 _ 00C0 _ -LM  -LMPp\@`  1P& 0S \ 0S K0P  0R 0 0 0 0 0 00  -LMp $0K`PP@0 "PP @ @` $<$0 $P$0( 4$ P@0 $$0($0 0- 0 0CSL@ 0P U R 0 0 0 00C00  $Pe% 0 -LM0p$0 PR<D0 `20#0V00Su10#0V00S D00%0 00S[ 00P@D0F1 T A!` 000$ R 0h!\R 0L! HDq`00C\ 0  "!0 00 0C&  0 "!0 0 R= 00 D00D00  v0 00 P@D00D0{$l_c_c=(_c_c00101S 0-80@!0 ,0K+ K*pK)`K0J0,K '0K(K%K&K0 -LM`@pPU0K 0 !0 ,0K+ K*pK)`K0J0,K '0K(K%K&K0 -LM`@pePU0K 0 ^0 ,0K+ K*pK)`K0J0,K '0K(K%K&KE0 -LM`@pBPU(K 0 !0 $0K# K"pK!`K($K KKKK#0 p-L@Bd M ~0AT 0KK0" K0KKPK`KK@K p 0-LMP P@ K 04 R *0S0҅0!S S  R:00 -LM@`$KpuPU P   0Č ]0P  $P@ 300 -0L M@ 0K0KK0K@K@K@K@K@KC -LMȠ,Ƞ Ÿ@ 0R@ `5!@ 000,P, ) a@00C\ 0  "!0 00 x1C& p 0 "!0L!0 R, 0$ hA@00C\p 0  "!0 00 0C&  0 "!0 0 RW,K 0 ,Pg,%qd_c_c_c_c0C -LMȠ,Ƞ Ÿ@ 0R@ `!@ 000P, ) a@00C\ 0  "!0 00 x1C& p 0 "!0L!0 R, 0$ @@00C\p 0  "!0 00 0C&  0 "!0 0 RW,K 0 x,P,`f_c_c_c_c0 -LLM02c10 @{@0@Shf`B -LM@P 04 P*0S 0P: -cLßM @PU@p ࢟0Sy (PUR00C\ 0  "!0 00 |2C& t 0 "!0P"0 RN0e PPE 0 `@p 0@  0,P/ 04P00 0 P 0PP 8 0e00S: 0S:( @R,0,0,0 00 C B\  0!! x 0d C6000 "!08 0 R_c,__c_c_c00_A-0@P 0 00R( 0Ȁ(,,P0p`0 C \  00#!x0 00 d0C& \ 0 "!08 0 RA_c_c,__c0__c0 -LM@R@\dll2lR p@0T00 0 R} @T(0K@ P`) Bp00C\ 0  "!0 00 1C&  0 "!0!0 R9(0dx$@(0 @00@S00  Q@ @00   R 0 0 0@ p00C\ 0  "!0 00 0C&  0 "!0x 0 RT EP 0`$0_c_c4__c_c0A- $0SQA;0  0 0 00R 0p p @0 `0C& R 00#!|000 h0C& ` 0 "!0< 0 RAA_c_c4__c_c0 P-0L 0 dda) -LM0K0K㸐@`BT/K -Kp4K0.@K)K+PK*K,`K@P4\ 0 @)K*@KP4 0  -LCMP0Q0@`O P51!sJKKK1 (B(0P&,1?0@CP I_KPE00 $("8  00X00",S ?00^0 0JKKK 0xP,1S QK% Q&0Q41!P0 S0 S0 0 SR 000 S P-L@8Pp] S`NWV dQ  0$0S` 0SV \  00S' 0SV 0S 04 cW 0S 0 4 mc  mtm pm 0 4Q p (` "p~ppL|b -LMB4 , @RcpT0 P0D01 -LCMhK_K@K `0, 0 i4!0  P0c Ok01pVg!8P 4 0@ Pg  TDc:kpg 3kpg  c,kpg %k0p0p gbk00<0 ,0S @,:E0b kp0at p-LM@`  P ;p 0-"a1LM1p ?0 ST0@L T 0<0K@ ,^#30W<0=(a_Mb -#0L MHD(0K0P(K #@K'K&0K%K$K"K!K`P@ p2 P@0 0pGWW  @p@-0@4\P` *0 S \0S \:p0 S@ `UQ 0-L@P D@P 0U0 ^ *0S ^0S S ^:0 R0 -1aLLa4P@pPh PUPYL 04\@9^*0S Q 0S R 0S ^:P 0S aPe00  0S 0 0 \0000 S 0 4S 40@e P ,8h 40!b1\e -L M@A 0K 0KKK@KKKKK  -QL M`@ I0PU ,pK 6P'0[S I0PU  -LLMß 0`S,  L0@PT4eSLeP0 040L0x d KPp 2 ,0S t,tCb [a0[eT LP @ 0pW@ mT e0SpP0@0  @ A@0 0S Y p0 0l`0 @RPpPee P4p 0W@ 0L Pp@T@TJ$@TZ  _0l0K 0lKT Kf0KkKepKjpKipKhpKgpK9PQ0[ XKPX0[ pc@TI0at -LM`P4 ep P@0 0P 0,p`$   (   00PU0e@0l -LM@00  0e0C0hY <0S R -MLM8   ` P@ Č`$ D `D`d4 Pd"d2XKL@ PP H < 8` 0` ,` 4` X TP \ FP@ e :PX0@` 00h P!SP!1\XK`P 8P 4` T FP@  ePX0@P0 h P@FL0P` PEKT IEK40I1PU0e 0 ,` PX pWP  \0\XKPUW0XeXph0\h 8 @P@ DFP@ X0X 0p11\$d4`$K_ĉ -LM, @00 4P4 \e PP \ b,0$00 -02, \ 0 P0? @./12 P 0S P 0SPz T0 Q~< 0S00 0 Q p@$ 0 0@P@p8` 0p@T` pW `0 R4 0S,0S) 00 10<P@4P@  C  I4d 1 F? l1 R001 P1 X0SP PR ,@I va00XP!U00R00S@U2I? PePU T0S # 0PUYχ 0 0S 00 4 PUT T 0U 0 13 p-LMPP!4P L0@`TeyLP XPephoemej@T4 - @LX `Rp 0PS [0 1< h` \PQD\X0DX01X P1S\p@-|` @P  0 Č$ L0#Q `P8Sp0 S0S S<* -LM@ 0 S0 S  -LTMP$`0p0P,0 @\ |\ oPd`  0S  @|\,4 ,0S (,>_0\@KTK\0K[K)0  Y0KVKZ`KX`KW`KU`K3R[X00P00SQ@T PK?>1 1DQ@T XcXCXT#00LßQD  4\ 0S 00>0S S3  %\#\X 0f P` 2T  0S00S 0S  ` KpP ` `P L 00S 8 [V f80T0f840` pPPn J00>0S Sf -Pd P010  P 0S}?d0000d>0S0 S`\ T @ 0T4`090 WP@*T8 0 [  |[01 0CĠ UKV0KC0a\pD,b| \xܙ -L MT p, 90S 0S,`0Vʆ0AP P , `0VT 0 DXZ  P T0S  0S<  3 K P  T[ oP 0  0 00  `PP   Z  Z   z d 0SS00D Z4 Z0 Pl  -00QLT0 Q S R 1 e!\:0> 0C0 n>S -LhM ` PPpK $P@ < R RXp0 SD0Sl -LM 0@S  P 0S0S   -LBM @0004@pPV`W0P W[ tP 0 SW0\000S< 2@Rx CKA A Bf0T0C.K BP B180@T<@P  RW0S S@}0T@4 { f@ P< @$`}Sm D0  <@P0\jH$d___ p-LlM0 d0 @P`KP d0T@p -QLM@ W0SV8D -LM 0@~  ^ 0 S 0000 p-QLMP Q pP`V@*T0!@RT:0\0^?P`-p -P80PL\0pHPP` V@*T 1S@ T:0 >T 01P`f y 0-LM@P0K  MT TP@ P00C0 Q *T0\ 500  <gV080TH00L -LM50`p 0P5 X00SX0 D0 Sf <@4P@ DH80@ @SPf @ 500508pXp 0-50L0@ 5 X0PCUXP80S@0fS0` @P8c8P -LM4p^@` 00 4`[ 40P 0^004 40@1  -LlM 4@T`pK$ P 0 04P $0S $$I8@KP^4@K0ap -LM4@04 0 -L M@K K; 0QP -81LM<0` 0 0@40PU  U|U0p00EϠ30 0Ā^P1 S᠀00 0Y (0 , $@ 5 F5~00wH 0K02<|E 1꘯\bc,,,  -QLM@CϠ m? R  0S T @ h Q0--0L@P  Q 00|1Sm?@= p-LM1 S@P\`|P50p<`TE 0 bc -0 RL`p@ @*PX@ iP 0p000 @WP:!]E? R 1S 1S 1S m$>FO5\ 4m4>FO 5 400BaQ -L(M0PS`| LpX @ W*0@ 0SLK S <00p0 T:!P^P @T*0P\i@T:@T*0\O@T:L0W> P>Q1 P @ LK0|  @ET8A00C\ 0  "!0 00 0C&  0 "!0 0 R:c LK\qQ*0P \ Q:0LKpQ*0 \ Q:0,LK p_c_c_c_c0 -LMm? R`1S  K` T!R\13 0K <\ 0[D!2 0K HQ 0[P!2 0K K0`0 Q-L H0Q 00(0Q`1 W@W@ W -0PLPp@0S' p+0\1c?@L`c a7\ 00@W0@m004\XS00 da$da p-LM00P@K4U` 0 000000p 00C& R 00#!000 p0C& h 0 "!0D 0 R 00C0=_c_c da_c_c0 0 bc -L|M`K0 K pK@XPP< @0S<6[S4 t0S 8\X 80Kp[Ƞ 80S4^00 1S80KḀ{@40Oφh P40RφL P40Uφ0 PH`t 0- LP@0RPP 0 CP 0S 000CSPPP 00 -LMP`@FR BR000 4 080P@XY\` 0X0 Y 0\0 ` 0S4Pp X0S0S S0 X0Y R 00CS񟗩ꐾ 0 Y0X0S S0BSdlt\|#0QT 0S0@T<0S~ =Q{ X Ru R00e 4D0 P iM4<@0 PX0SI 00p@Pp @TZX 0S/ 6S, 0S' S|2Y T00BSꬼP0 i,Q QQ1P X S4>H0 LP P=  ieQ>0S4<P 0 S00S=  X0S 0@Tf 00S> 00S<  i8QPJ a > < : 8 6S(0Y0 00S PS 00\p@[D $PCl -L`p@P@PRPU@ZDAD!P 000  BR GqP00C\ 0  "!0 00 0C&  0 "!0 0 RAT P0X1 *0 $ 8@p_c_c_c_c0 -Q L1-  Q S 0S 9 -L`p@PPPU@Z@P`@PPU@Z@`p -LM0@S  1S01 1SP P1 010C1P1 RN -LM`pP @ 0TP@@ Ƞ,Ƞ 0000 R P@@= -LM@PP`  h0!T` 00040 R Pࠁࠓ[=Y0S 0r0Ss 0Rr0 R0S0w00ZR0S 0{ z0 0$S$0 -LMP@U`1p @0<0L00MQ0PNPOPRPSP L0 -L ML0Xp 0 8@8P`DD!LMNORPPQ@S`j -L MP0pN=U``GGGL0 0 10S U0d0e B0C f0g 0S0)0K h 0C4i0 j k000nmo@lp)PK)0[s@p0qrS  W 0P00p000 0 0PPEDd 0 P@00 0S Axĕ_= p-L M0PS@- 0BSd,hT 0R0P RA R*R# T00CS000@  0PPpph9y0\# N W 0 |T T 0Q0ph jWD 0@@@ 0@ T R 0\`@ `@48" <S^  hi0jk 48@0TA KPK0K 0?0\0K00K0K0K@K@KK@KPPP[ -L M->@TA K0K ?0\0K00K00KK@K@KK@KtP0 [0[4 p-L M->PUAd0 K! K p!0K@0\!@[ 0K00K0K`K0KPKK@KNP p-L M->@TAT0$ KLd K p@0\ 0K00K00KK`KPK@K$K#`KK*P00 p-LM P # H`@#b@TT !phy5I -L`pP@P@U@2/02 -LM@ 20CS2h -->pLWP@`  %X@ (T\`@( @TT &#H$HH -@Lp`P &Q P %( ($DP@(@TT hH 0-@L_ 000S5  006S$   c->PU? 0h87 #80h  0@-HP@ 0, Q ^?0 -05L P <5Z mS @ @TaVp `5<5 R0SA@.0!lVp`5 -LM@ ]{ Y hT p-LMP  I`@ @TT ? ~$ ~ 3& ~/? $ph? G' -LM 0S4D 0 0\P 00I -LM`Pp@G G RP@?/@@3#2#0RSp#@4 KP@ LmG0D 04?\b`! 3 p/p10`Th2S l2S p2S2弢 0@K  L./ 5G} Ol2l"0p5 `2`"0  X0P\QD2o@"40<28  @<0  " 2p3 0k'$ R "03"3!/ /'1A  0 0C\ 0  "!p0 00 \1C& T 0 "!00!0 R\ I4P 0 S00Sl" 0@T_00Sp"00Sh"  tF\p If_c_c0<8 t_c_c0@ -tL 0PS0`&\G\D4q4! 000%@@O \' 4.S!2 0CS 2@00C\ 0  "!0 00 |0C& t 0 "!0P 0 R\ ]~_c_c_c_c0Q-0 Q->0 -RLM`P P$ ; 0 0 PDrD2@ 0000<PP 2 !!$ !0``1` `衟@00C\ 0  "!0 00 1C&  0 "!0t!0 ROUI <1@ 0L00J<$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0+10 ,`(`@PQ0 + 5@ U U00U``V p202PUtph;"04Db0St00t00`x00x0 -LM`->pQ@0P 5@ R- R00RPPU 202uPT ̠Bt0  @52t\"0DR00K i 00 eM00S ,KA \M*0[0*0K*[P l00l000 @0C00 0 0h  1h P0 00a7Pl00l0 <P*i*@0 0C\ 0  "!0 00 l0C& d 0 "!0@ 0 R x_c_c_c_c0 -P->LP`p0@5DD!0W00%+%9 WW( A00C\ 0  "!0 00 0C&  0 "!0 0 Rm't00t0 `CWx%p00p0 | p1S _c_c_c_c0P-> R\P -LM-> PRLO0I 8a81p  %  R ,0 000S 00!R3O $ #0@#p00C\ 0  "!0 00 p0C& h 0 "!0D 0 RiD_c_c_c_c0 p-AMLAO0P `0~ P 0 C400x\\  P202p .C\p'P -LM@-> R# = R 5+Q P 5;5Q 0S010C1<P5 ;%5 -LM-> PR0p5@ 鬒2 @ }o @:Tڴ5   .7P8 d7P~ uH    #t2S9 5A@05%+%00C\ 0  "!t0 00 `1C& X 0 "!04!0 R O" " 1o"=P @00C\ 0  "!0 00 0C& x 0 "!0T 0 R\ oxD?BZ j_c_c_c_c0, p-LM@? ?`PP? 3`PP? +΄%'`d @(oPP ̠t ` Pzwp 4Ap  Hh 0--> LR_ = ( R $@T $0@T#0 0-@LOP;#000,  0 -@->PLP`p2 |2 \ l2\j*d2\Z \2\* pPB0 0C\ 0  "!0 00 2C&  0 "!0!0 R%# = S =@S @ 8C8p2g%2  t 2 i @ 505H0 R0I 0*4Pp5@p0)+0\ |0\p0P\|z`0\w/ 0/.pq_c_c2i 1i i i _c_c05i i 6i( -LMt0@0Pt0@a!p 0O000 K 1S(@p00C& R 00#!|000 h0C& ` 0 "!0< 0 Rꀰ_c_c_c_c0 -00%P-@%LU   tPSxP:|P!`PpPP`PpP P = rfybr`ybKP |P0|2  V@ P@5P xP0x2 x@@ d:@P tPtR ,+@ %@(H 0-LM =@0TA KPK0K 0?00K00K0K0K@K@KK@KPPP[ -L M =@TA K0K ?00K00K00KK@K@KK@KP0 [0[4 p-L M =@\AdBT0 K  p@0 0K00KPK`KK@KKKP00 0-LMQP@ ?0@00KAĠ0EKK@KPK0KKK0KrP0 0-LM?0@P K0K 00KK@K@K@K@K@KZ0PS0?0l -LM0p5`, = <5 =?\ ! =@?\ QU@ P5<5% =@';;1@"  I0S ';;!@0U@P5@ -L M =@ \K @00K 00KKKKKKKP? -LM 0S4 0 0P 00_ -L MPp`@@> >H PR!2 `2/`2..t2/2rr, K,P D>,@ 0PT,Pv 0 Sj00S," ^0@T(@KQ!`000~& >} FG1!0@5 t1t!0 X 0pHy& 818  `0`0C\ 0  "!0 00 0C&  0 "!0 0 R r00S0"00S("  T*>\p&_c_c0X_c_c0 -LM@y(-0 qS0P9 1` 000%@39&P00`00C& R 00#!000 |0C& t 0 "!0P 0 R E_c_c_c_c0Q-0 Q =0 -RLM`P P$ ; 0 0y PDrD2@ 0000*4PP 2 !!$ !0``1` `衟@00C\ 0  "!0 00 1C&  0 "!0t!0 ROUI <1@ 0L003$@0@0C\ 0  "!0 00 0C&  0 "!0 0 R$ R 1 0+10 ,`(`_c_c`aDa_c_c08al ?0-LP $@?7P  0S 0?P7  PH7 -LMO0 S   !P7  P*7 -LM`0p,0 0PS0@ 5@ R- R00R@@T 202IPU ̠A40  @ 40"0{7PA 7P; R02S- 5@@05%+%p00C\ 0  "!0 00 0C&  0 "!0d 0 R iIP (@p0(3_c_c_c_c0, p-LM@? #>PP? oPP ̠0 L P[Xp 2p~ X/h -@ =`LPPpTT2 H2 \ 82\k*02\[ (2\* pB0 0C\ 0  "!0 00 1C&  0 "!0!0 R鵽%$ = S =@S @ 8C8p<2%<2  =  <2  =  @ 5050 R0: 04Pp5@pC06P0\D0P\}_c_c2i 1i i i _c_c0i  -L MP0 -@ qTo t00t02 0$K000 $ 1S'@00C& R 00#!x000 d0C& \ 0 "!08 0 R !_c_c_c_c0 -0 5P=5U@0LPP4P78Ph`PpP`PT`PpPLPLrjTb`rjhbrP 8P0821 }1+ w1\P 4P042 xg1 da1FP 0P0R ,R1 L1(H -L M`, pP@ V Q0 00 P`0(00 00 PP 0S0 P ZW 0 0 @ 0pDbc -L M0@S K K 0 .+C` Q-LpP 0S00@T 0a h9P@ 0T p-PLM@` <0TA,!<0 ph00 04 - QL MpPr<0Sl8P@e 00K4 K400 ,0K( KP` (04@KP  @"P@B 001< 000p R+ A0 0C\ 0  "!0 00 0C&  0 "!0 0 Re04`0 0lpp@4(00 _c_c_c_c0 0- PRL R1<@T  030  30p0Sl0 0 0-0LS@P0Pxx 00 S P <0 T  \0 0hѲh 02(_Jdq_x/ - QLM`Pbq0<@T[ t1R 0S 0 88!000p R0p00q<00C\ 0  "!0 00 0C&  0 "!0 0 R 00@t400  L[/9 ꋺbc_c_c_c_c0P 00sS0S  p-L M 0@  P`0 P*0S ``0 R pP0 R@@00S  R0 840ԍaX_(_Jdq_ Q- L/h -RLM@PpsM)P`r T\P.Wr @ 0@@@ @P<p1p h1P.y#P H.<0l@p04.5,0 q00 84 0@X(T!t0@12c10 0!/B!0  00P Q 00 05 h 0P0@T<&+4,xbcbc\x_|_Xn-o -LMd@P``p"400  0 0  0bc,bԍaX_bc - (Lp(P"!$RO01SK RJ RF1<`VB @T$ p!20#p0 0lP!  0 Q0p0h 0P W 0 !,0 !, 00 0:T`0 X 0K<0 [p0_Xp^x/+ -1 L R pr 1<`Vl @T 0S3h 12I0S# 0 0 0 $X1 R 0H!0 0P 01 $110 $ @0P  P0P0C\ 0  "!0 00 0C&  0 "!0\ 0 R@ꙸ0_x/bcbcbcbc_c_c_c_c0 -0LM`0 ^@ 7 1<@P 0@S h02@0_x/ -0LM`0 ^@ 7 1<@P 0@S h02 @0_x/ -080  QL 7 1<0S+0_ -L M@ ^ gp( ^$Qp (^>!P00C\ 0  "!0 00 1C&  0 "!T1`  Qp0Hp0p  ,0 dp0W 0   0(0 Z дr@P00C\ 0  "!X0 00 D0C& < 0 "!00__c_c_c_c0 0-0L 000p0P@  0p000C& R 00#!t000 `0C& X 0 "!04 0 R0k_c_c_c_c00$ (0  -PLM 0 0 PfW P-L`@ 0PU R@B $ph02T@Dx/ p-LMpP!/ PU,  \ h 0 \2pd0,R 0 K P@@ ,`0h "0 T@Dpx/ -2L@`p+  Q,10 XW 0Ra R R P-L P ?#?00cSpq qqh^^P Q hQ h - PLM@`PA T9 T# ,q0@<\ 0 ?01 <0!! <0 <0 <0 <0 <0(02o@ 0(@,"P00R00S0P 0200 RpP0 bꀖ_bc -LM0Pp 0弁p@-+`A+@D0S0ץ0CS`` p0  00CP0ҥ0CP0p 0l"!0pP (0 o: (0 p (00(0oꀖ_ -LMܠHp0$H 400pP*`* 0p < P)$p 6 :w0 *`*P 0逖_ 0-h0 !Xp0 L0  8#UP@008#HTꀖ_ -!LM0, p 0岂@*1 8C00C8#0 p04`0p0@*Pm*  0 P8  X#, R Z 0J  X逖_ - LM0p 0尢?* J , 0 8p C04p@0`E*P)*  0J8 P #,0XY0I 逖_ -8!LM`p0 P@*10`00C8#8 4,0 *p )0P  00 p04`0p0@)P ) H0 !0 R8, Z#X0H逖_K -TL M`p0  @JX) 0`8#84,0 )p)0P   00 40 0Jp 4p 0`@)P) \ 0I!48#00 R, X040S0C040 4逖_K -LMܐHp0$H X0`40h)pL) 0p 8%X h`#80A40N)p2)  1@T@逖_K -H!LM0%P "%  P 0 S!,  0(p"0  @%@D,0P8# 00("0 , Z40Y0 0逖_bc -h0h LQ@#& X -L@M0 48 mQ`( C PMQLQCQ _AQN -@Q (0S (C 0TPR35 nQ@1@!pg\ Š%5 TP45%D 0 0aRP 0CS00P0 0S 0 0CR0T00T0 D0R 0cS0!PcP0HQ DQ0S, 0Q01 c, JQ KQD,( 0HSD 0Q   B P R 0 R 0 BS T 0T S0>"R ! B0,0 `0T00 S0R !0 TS2 a0 BRDpHP0S 0 l gR@1@!aL^HD HPDp34fQ @XQ- "PQ(0TPpS>0 gR@1@! b\ Š%5 TP>%d45%.cQ0S$ T 0Q3S<$ pW@*L0 0/S5IJ̲̲̲̲̲̲̲̲0@TPp @TTK 0X@K@IPwT0X @p004 8PJ? ,i?h?l?p$? -LM@P`p 0@0 00P+ 0@`@ 0@@`@ 0@ 00@p@`00 0 0-PLU@ U$L g ^0 /R 19R00C P^L0 0 C000^L00CAQ$!R,00 ,R ,0,00,0 p-LM,@AP0CQK8`hhhpXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX!R@ ,R@,@p!R@ ,R@!R @ ,R @ !R@@ ,R@@T@` @` 0V!R@ ,R@ p-LMP@p !0@Tp`@t 0!0@T@`@x 0!0@Tph$P$Q -LPp@| !0@TDD@`01| 0 !0@ TTR$R 4S!3=8S>08S, >8 ST3T#1 $t2Q h2Q `2Q L2L2H2@2Q 82Q,2,2$2$2222Q 2Q 2Q111Q 1Q1111Q 1Q ʼ1Q 1Q1Q 1Q1Q ʈ1Q 1Qx18 h1Q `1QX1T1<1< @1}<1{81y41w01u,1s1k n1!10 101;C _@7_ (da _53 -LM@ 0 S 000 h -LM 0@S0 0 -LM0PS#0000QS 0BS0%pa 00C|a2\ 0  "!0 00 2C&  0 "!0\"0 R&0 0#B Wp 0`00S@g00P0T0SpWWp  `p@p0T!2@P`0Q HA00C\ 0 !1 0!C600  00#!0 0 R @00C\ 0 !x0 0d C600X  00#!0< 0 R#闛(_c_c_c_c0 -0@PLpA 0R p) `P00C& R 00#!|000 h0C& ` 0 "!0< 0 RMp$_c_c_c_c0 00000 Q- L, 00sS0S  -LMp1 ` | 00 0SXl0S\1l0B P l0 ` lp 0 t0 0 x 0 1 P:l0 P0@00SX u P i0`\Q p $$ll 00lx, 눗_x8dal_|_\84daPd p-H@LM 0`P]$ $$P`0 p8da8L0da -$0@LM@@@0@8da0da -T1Tq` L @R 0SC \P PUl00;0PU\\(@`00C\ 0  "!0 00 0C&  0 "!0d 0 Rh7H0 @0 ,!5 _c_c_c_c0MbQ -LM`0PS0S{|0S1  X@TO 0SL a!p000  BR 000 R00/#0SS0SJx0p!2c1P:PAp00C\ 0  "!0 00 1C&  0 "!0 0 R0P 00 S P0 z香l0D )00C00~s y4da_c_cx_c_c0(_dq_ p-LM0@SP`E0S1 U)  lP`\P l0 QPU \0`  p0,!phWl0\0PU\P  U\ 0, P`00 00cMb -XPLU @ ?#<0 p` @cT0p  @@G"0S 0 S0Dm00m(  p-LM\0PS`px@V0@@T tp0x@ 0-\ @RLP0Stp00 0SX0S7  - (L(" P`&0AT" P0S `0SXpW4P`P`Xpn D_0X0 -T0LM (("!X@ T  00XD_ -0@LM0X@ -t0LM Ƞ Ƞ,A04S 0000 0CS0  D_@-$ @.MЍ@D_ 0-LMP@@ 0@0CS00 -LM\. 0\ 02pXP D1` Q 40P d0\ \0\XP D1 PXQ 00S00}f|f~fvt -4L M^P@`p 4^ 44^ 3^ ?3^: 3^ 3^00 tpp 0 tp p3^ x3^p 00 P3^H  00  2^w G2^B )2^0S!1p  cP` u \ l H2^8P`0 00  000 1^# 1^y0       0 0 p1^d0 S0 ! caP`,0      00 000tpA@< S l0 K  $@ P`l@10< S< 0S   $L0^ :L00SW WW WW @W@WW@ W @|_W@l_ W WW W-00 Ƞ Ƞ,1X0SD_D0P  0(1S \0SPD_ -40LM@ T0 \ 04da p-LM@|0Q\PPSU \`V0U\0P\P \`pU 0 ( pp\`VpPP 0P 0!R `0SX0S D_ -0LMP' 00S P @`Pp0 KS0C$ K00 0,A(oR0: S,>   P`0R P 0$ $ G000da4da_8da,da -@0L R 000 0S 0S 00da4da8da -4L,\ \ 0da8da 0- 0P @@ @  @ @RL x0T tp  0x@0R  Q 00# 0Q 0 000 -L Ml 0 \P l :$@h`0Tel 9_l : ,- $%'(*+ . -LMQ0 `P @Y TQ R0R 1pT R 00K0; S, # Rr Re R n T PPM P P@0`0UAP Ƞ ;,HnP; S) 0 @0D T  8:S00S@ 2T@ 30D8S0D8#H8T@ 008#HA0A1l2,R0U0 R0002T; 001R 1R R;00A Rx!t Ha[0080 0-0 0(0 0#0 00 00 @00 00 < 0 <T 0 ; qT 0S 0 R R0U&0U#0 9,pK 0<0 0  -p!LM04 S\q1Tq080 0K  8P`@`V@DPEAJ3[ S"[00b0cS  0KX8@ @08@ 040`၀?000 R # 3 R?H0`?À 4@ 0R # 3鬚__ 4S @08#<@8oS: S>; S P 0 R0,RtS -LM@Q <X|<0000000000000000000000 -<00000@ L `+ p\&0S \\ 0PP*; Sh!,\1R 0P: R: S:#:A >; S= ^; x   Sp , d0R P0 R:U  hK P0S   p-LM0`PP@ SP 0\  00  00  0 \p -L,M@  `^Q 0S `^ \ ^PK aQLXPpPKa @0T*<@8oS: S >; S|p2Q} @ T:XZ WePKa @p0T[* ; S1QO: Sʠ,ʠ >; S<@8oS: S <= S= 1P: 1P7 |1P4 TP*00@ ;   S 1Q P0 R:U 1 c0 @0Tp:XZ  10 p@: S:#: >; S Pw: SZ%Zr >; SPPm0S @0Q 0`c -LMp0PP쀟0AT :P@ 0 Aᔀ `P@ V !;0 S0SV @ 㸼bȚ_̚_ml ( (-"L@pPP@0 T0 `04@S X`V0p 0P -L p-LMp@p`TPX 00d@Tp 0-D0 (("ALXPU 0X00̚_ -LM@X@ p-LMp@pPT `00X`d@Tp-00 Ƞ Ƞ,1X0S̚_@-$ @.MЍ@̚_ -L M`0V,0 :4V%4V" 4V L4V@ ;4V% X0S\0S p@ppTP ,000 0 d@PPTU 4V 0x0 X@T D1` Q 40P 3VX@T 00S00P3V <3V0S SooC3V 3Vp@pT ^ 00  00d@TX@T~ r"`000P 0 P?#<00cSB  ዛUPP0S00S'(B`00C\ 0  "!0 00 1C&  0 "!0!0 Rt &r0D 00\A`00C\ 0  "!(0 00 1C&  0 "!0 0 Rp@pT9 00 R d@T0 0RX@T% D1 PaWbW`Wvt}f|fW~fcW_c_c_c_c0-00 Ƞ Ƞ,1 X0S!̚_ -LM@P `0SX0S T0 S `0Sh& p-LM`P |㷹P@|0 p04 p`0 00`x 0p_ -PLMP@A p`d``0ph0p R0pd@\0S 000SXQW d 0R`0h0h00h0hd Pp d 00pPppWx0S px 00 W 0-`PL\0@S 000Sd pRh0h00h0h0d Sd 0p `00X0S 00 -LMp@p`Tp 0P \ 0d@TWPpQ\00 S \0 S\0 S -p@QpPpp TL\` 000Sd@TV P `(0$8 Q!0  Q:tT0@-P(P  $08@Dt @\ 0 0 A\(@Dt0 -0` 0p@0T0L0P  @T@p00C\ 0  "!t0 00 `0C& X 0 "!04 0 Rh1_c_c`da_c_c0-LQ@0 0R, 0 S \da_`da,0 P 0SP`da -LM0@`PUp@ T0 0$ R, PUA`00C\ 0  "!l0 00 X1C& P 0 "!0,!0 R齌W 0 RZ 0( RX lP@`00C\ 0  "!x0 00 d0C& \ 0 "!08 0 R逌_c_c`da_c_c0 -LuM℥0 0`00 $ (0 bP(L@ 00Q00P0 %@00C\ 0  "!0 00 4C&  0 "!$0$0 R0V 00 t$000 \@0 Q0000 $@00C\ 0  "!0 00 3C&  0 "!3  Q< { $ (  VVz Vu4#V80B 000 Rb 08  80"0 0C\ 0  "!0 00 2C&  0 "!l2x  Q3088 1 08"10 0C02\P 0  "!0 00 1C&  0 "!1  Qpn@垶8!@V Vp! Vh! V V VP! VyH! VvV8!Vq0!VnI[ <y.A qP@0 0C\ 0  "!x0 00 d0C& \ 0 "!08 0 R_c_ca_c_c0_`da8apaaPaa0aaa -LŸp0@P`P@r U ,0U 0S?C0,PV 00V 0S3G00`00("X0XAp00C\ 0  "!$0 00 1C&  0 "!0 0 R饊@p00C\ 0  "!|0 00 h0C& ` 0 "!0< 0 R{P_c_c_c_c0 -0@0`LpSP10  `0P0C& R 00#!|000 h0C& ` 0 "!0< 0 RU3_c_c_c_c0 -0@0P L Pp 0(S"x) `P00C& R 00#!|000 h0C& ` 0 "!0< 0 R_c_c_c_c0@-0S4 S/0!0@ ^@(00^$ 0lQ T00^ 0@bS 0 S00T0P00SS0 _ -LM P`mp@T K0  KKpppD\! K0 !K@5 K0 KK@@@$4 0S 0P 0Qcc 0-LM0P S 0s# @ K0K0b0@@P@ P00[4S 0P0 p-L$M@P` V) K0 0)K0400 P00@@ (K0(` $ P <p (000 0)0K0) K```4`\cc`UtU  0-QLMP$ 4@T00 0 K 00b0@@@{P@ 00P0@40 0000^ K 00b 0P@00 4@Q0@-P0@0 " Q 0* 0 S0R R R00 0  0  0\ 0 0 0QEQ QQ 00 -`L@pPwh00000000 -LM@00KK0[0 80 K0 -L M@ K00KP<  0-0LMQ@P( 0Q0 0 00Q 0Q 0 00KK0[0 80@ K0@@ 8 W@W@ WW -LM<@T 0cccc 0S 0cccc p-d`MLP@ 0Q K 00b0@@@@Z pccUU p-LM@`PA| 0 P p   0QR*0S b R*0S -R0 0c BSR48 R p-@P`x BRpR0 BRRRR-0^0  R R0 R00-P@cbP L0 p-QL MP@`S K0 V Ks 0K Kp@rPp`@- a0`S@@BR0-P@ 0bR3 B1 010QP:  QQ0Q00 0cc 0S !1 0S 00S  p-QLM`P@S 0 8V pp@rP`&p`R 0R\ Q- *0 Q*0  aQ! -LM`p^ P@! P P @T00PU0S 0,p@W l%`FpGP  PH00PW pW`F<4@\-0 R 0Q cP 0 S Q!0-P@P !20R0-P@ 0bR03 B0 -QLM2p`S)P@WU (W # 3f g0T0e 0d0 "2R0c0 0 Z  p @rP*`ppp@-(Ƞ !8"(,ȠP@p^`b `n0 # 3\ c l0 "2R(#ȃ 0(BR00.8 c0(R0#03 8 " P@p0(R0#03.8 -LMK0KR @0S R -LM -LDM@PKP@ 4\T QP 0P KSR0S0PK0 P@[[TK$P@KK ,PT@,83K#[$8KK[[R3KL K0KKK4pK@KX d0 d@@DTd@ 0S 0d@S@d`@ p0`SL` `` \JX0@\@ZXp3QPX h h P Uh R `0d@Dh \ l l偀 0 RPh H  `\ 8R \0`FP(*SdP\l 00 L cPe%88cP\X%X@ʷ0Pe%8P d`F\P l@00 L P\P%X@ʷ000l`X\l ` R" h0S d@\ c0 Sh0`@.L0#\ ʌ0#[[[2[P T PK $[[[4[P T P KP@V8#C0HL8#90HB8#/0H8\ h "  P T P0Kp_p@-^`@ Pb 0 2%$^ 040p@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  0-LBP|@ 0S L| 0SPeT 0S \00LS `00000S  0SbQ1QR0@-P@ 0bàR? B0QQ000-P@P@0Q0-P@P%@ 0Q1Q3:P: R0P0QcP  R0-P@P@0! !Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  R@-@08#8S  0   pl` `! R0-P@ 0bR03 B00t_``0 B`3`1`1c11c!0"b2c3c0acP@t__ NR- R 0S0 \R000Sa@\0S S0S0S  S 0S R  0R P0Qc\R0@-P@0 A@P `R00\00Sa@ 0zR @R00Q00S ZR 0 PP ^0b0Q &,'$(#80x25P- 80x25P-80x25bfP- 80x40P(- 80x40P(- 80x40bfP(- 80x50P2- 80x50P2-80x50bfP2- (@X,,H d"*' "eYj$@@h>@@h@<`>` Bh@xM0Lp90j^Q 1W jvQ^Q09`0pj^r0@~100MW@ 1eX` @xj"` x@ h x jjjxP0jHj]jjHj]j&z=znx=z=1=21NyeXfxf1f21f|@fhie AWe@aj^Q q xe@z=zx=z jeAe^e@ h j "xee>00  0T0xee4T4x 44 x4@ 10z0?|eX y0jp]@j>] y j]]x0 yjp]e@@le "|e 0e]?*d# e]?*d"De"deBD@je 0e]?s@j:0jteAdjj]dldtdtjbtdt#dJtd^taj^e]QqeBD\|Qj`]Q\dT|^lAj^e^D!j^e^DjV]0eAX| 1f fQ4L=(d|e> 10eeLj"j eeTj"j eeeLj"jeeUj"jl0QuQ]Q 1e6E?>6ue^Pefj Bnj jDj^ j];&1;\nj ee^eTf &eFjj `nbn|n|n|ndd0fpffv`f=d(e`F& ~nbe^e^e^e^00000004l21l21l21l21l21l21l21l25~& nj nB~1jv4jv e BfAfj^jA 10jvFB 14A~14e"1jj 8m(m(m m  Hm m Hmlm Hml"l%0l%l* Hm- l1 Hm208m2 Hm3(m5l7 Hm8l< Hm=lG HmHlK HmLlO HmPl[$@8m] Hm^(m`(mi8mm Hmn0(mn Hmolp Hmtlu8mw Hmxlyl|m8ml Hml Hml Hml HmlT 8m8m Hm llm08m) xlTl98m. Hm/l2xl7l8 Hm:Tl>@l@ 0l@ HmAlF HmG8mKlR @lRlSHmT0lUle00leHmkxluHmzTlzl| $l}llTl%0l Hm l Hm% xlxl Tll Hmlll 0l Hml@l xlTl%@ll Hm0l Hm 8m l) Hmla8m Hm0l Hm 8m Hm0l Hm 8m Hm%pl`l Hml HmHml Hml Hmk%mH HmIkLlNmP8mV HmX8m[ Hm\l]0@l^Hm`li Hmklo*0lq"Hmy& lz"m Hml Hm mlllm Hm lllllml HmlBmRl Hml Hmlk:ll cl Hm@l Hm0k Hm Hm#0l/K HmAmYmZ Hm]xl^ma3  fuZ]agikkm%2K} }}}%}2> > >>> > > >>%+2>K}  4x5x7r x@t xxxx4x5xxxxx6x 7xT8 t4j 5l@`@`7j @`6j@`4z`884t5r@`X@`PP``XXP``@4zhh5~~4|X4zhh5~~X4|r\jr]jr^jr_j\rj]rj^rj_rj|`@`H@`@@@`HHxx5r6r           xxxx(C|z%2K} }}}%}2> > >>> > > >>%+2>K}  xHlHxNA~ NC [sF .6*6.*6. %+2> 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-| n;AvXaM ְdx 4    H`TAlCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2006 OpenBSD. All rights reserved. http://www.OpenBSD.org  $ H$,4@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@netconnetclsnetionetlck!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~U 0 8  TA,  TA<  TA d n;0&AvQkkXaM~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@شhhpT Dt ؓhpTȧȨvmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVELAUNDRYANONAOBJ@4L44Q58Q5DQ5HQP ,, LQ,PQTQ \Q`QhQpQxQpQQpQQpQp QQp 0QQp `QQp pQQP QQP QQP @QQP PQQ QQQQQQQQQ4hQ4hQ4hQ4hQ4hQ4h  |~|~RR@ RRRR R R R$R/(Ro,R0R0/HQp 4R( 4x>>>>0?\????ܞ???<?X? t? ? ? ? П??? ?0@TAtBC\DРEFGG0GPGGGܡGH(ITJlKKKKԢKKKL$NLPlPPQQУRSS0SDT`UUUUؤUUU<W\XYZZإZZ[<[L[d[|\\\Ħ]]]4]h]]ԧ] ]@]t]]ܨ]]D]t]]ܩ] ] H]!]"]#]$(]%`]&]'̫](])4]*h]+],Ь]0 ]1H]2]3]4]5,]6d]7]8Ԯ]9]:@];x]<]@]A ]BT]C]D]E]F ]GT]H]I]Jܱ]K ]L8]Pp]Q]Rܲ]S]TD]Ux]V]Wܳ]X ]Y<]Zp][]\д]`]a@]bx]c]d]e]fH]g]h]i]j]kH]lx]^^^ ^H^l^A^B^Cи^E^G `4aDa\atbcc̹dde$f4fXf|fgغgg g8g\g|gggg g h@i\ixijk̼kkl m<n\o|ooo0o`oqоrrr<rdrrȿsss$sDsdss$4<H,b,b,b,b,b$,b0,b,b8,b@L,b`h,bpx,b,b,b,4,bT\,bhp,b,b,b,b,b,b,b ,b$,b4,bDL,b\d,bt|,b ,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b,b5150ES SCSI FA1501 Ad\hp|,bp@,bT`,bt,b,bT,bT,b,b,b,b,b 4<H,bEEEE|,b,b,b,b!A  !@@@@DHTQ`$023X.?466x?`h$*,5(E<xEDL d p| r 0 @0<Hh6L*d\dl t| !6$4 @tL\dpljx85 h   @ Ć0H)g:g%h2h6h rh83iLri\qpq#r'35E UPWP(WQ0WR<YHPYXQYlRY``U`V``ebeceVdeeeFvpw(@HXl| PQUVXZ 4H\l|  $, 4==<==D==L==T==`==h==t== == tPEH  Q 4BX@LX`l x 0@P3@ 3@`3@p%5EI Q,a8DP\!h#t135ACc!1DG 3RR$)R47RD9RPCR\FRpGR|IRKRLRMRcRRRRQTUTWT q $ ,4<xLx!X`8hxPtxUYYu`x`xaxpxqxrxsxtx xx$x0x<xHiXxdpPQ_ ,8DPT`lxded ,<L\l#%'25.B0BB"dB$d 08;@;H;P"X"p""" " " "@ "0"p"p" p" p$"p0"p8"tD"tL"tT"t`"th" tp" tx" t"t"t"t"t"t"@t"At"Ct"Et"Ft"Ht"It"Pt"Qt"Tt0"UtD"XtP"Yt\"`tp"dt"ht"it"jt"kt"mt``5 D/T!0k8k@kDkLkXkdkpkxkh6k k!k"k$k%k&k'k(k)k-k.k/k0k1 k24k3@k4Lk5\k6\k;lk>|k?k@kAkBkCkEkFkGkHkIkKkLkOkPkQkRkS kT kU kVkW0kX4kY<kE88D8Lh6푠X홠`hp[xCuP1T1P>p>PAQARASA XApA qA4rAHsA\BBl6C|7CACBCECGCHCICLCMCSCTCXCaCcC(iC8pCDqCPrC\sCltCxuCxwCvCxCyCzCTEBGDGIGLGMGNGOG PGQG$RG0SG8TGDUGPVG\WGhXGtYGZGfInIBLDLELFLGLILMLNLPLQL RL,SL8WLDYL\ZLtfLFMLMDNENJNHNPNdN0hNHDP\FPlRPxDQEQFQGQLQMQNQOQWQYQZQ^Q$lQ,ER<FRHGRTKR`LRlHSxKSLSMSNSFTLTRT`TRVSVTVUV(VV41X@3XL5Xd8X@YAYPYQYTYUY`YaYbYdYtYuY4Z(6Z47Z48Z(?Z4AZBZaZbZ`[@b[Ld[`p[pr[t[a\c\D]O]o]pp ,8PGDC\ltt| (4#H#P@#X@#`@@hP!pDD DD` `VD0E8FGHI$J4L<MDSPTXXdYl]t^hijknvwxy|}~ $0<HT`lx  C C"C$C3C<DXXX X !X"X#X$P,Q4n<oDxLyXtdK@pK@K0tcsg}?%,,,,,,,,,0 8 $0<HT`lx````@(@4B<CDFLGTH\IdPlpxs11$1215qNC * 203040@p@@,@<@L@`@p@@@@F ph6*)*+ 2(3@4P5d@|Ci*l5m50(`x  0$P0@ H\3h6h4$4$C$x/xtrqYYY ,<Pdx@0pppp8$8DXdx<xxxxxxxx 2 (0@ H PX`hx!"#$%&Fe((4(@(L(L(X( h(@( @( (((((((@(L(@(@(@(@(!@ `@3@C(K4K@LLDXDhDH+DxDXJu#H  <5 6P.B0B>B`$t$%$$$$ $!$"tqtPtX ]]h$]i0]xD]P]X]h]t]](]8(](8 ''$46@T`lFPxp<<<< <(<)<0<1<H<T0<@<P<p<|<<)<*<.<<2<2<2 <2<2<2< 2 <"2 <#2,<%2@<02 <12 <22 <32 <42T<52h<62 <72 <82 <92 <:2 <;2 <<2 | 3\3*3xK   , "4.T6D>PWXphpT|$OI"P`  !$ ",I4<9D L X&')l*l,l0x2@A  `  b $ d 4 D X Vl           $ < T T  l l     l & ' ( ) 0$ 1, 2, 38 48 5D 6D 7D 88 9, :T ;8 <8 =, >8 @` Cl H P, Q, R8 S8 T8 U8 V8 W8 X8 Y ^ _ ` d e, f8 g8 h i j, k, u v, wD x` yx z { | } ~  x   8 8 8 8 8  0 H ` l x ` x  ` !l 0` 1l 2x a   " # & ' ( ) - . 04 5 78<@KTPl`t`|ab`!#$01HH $$$($4$D$T$d $x!$"$#$%$&$($@$B$C$D$E$F$H$(I$<J$DK$TL$`N$pP$|R$S$Y$]$$$$$$$$$$$$$4$@$P$\$P$l$|$P$$$$P$$$$$$$ $$ $0$$@%P%\0%h1%t2%3%4%5%6%@%A%C%D%E%F%G%H%L%P%Q%R%S%T%`%a%(b%@p%Pq%hr%|s%v%x%y%{%%%%%%,%8%H%T%`%t%%%%%%%%%%%%%$%&4&@&@&@&@&@&@&@&L &L &L &\&h&&&&&&&&&&&&& &!&"&#&$&%&&&'&@&A& Q&0R&@S&PX&`Y&`Z&`[&`\&``&lb&ld&lf&lh&|j&l& m&n&o&p'q'r't'u'v'x' y''$''4'@'L'\'l'|'l'''''''''''' '''''02@3$A30u5<v5Pw5`x5|555555555 55,5,5,5,5,5,585P B\!Bp"B#B$B'BRRpp p0pqqq$q0q< qL!qT"qd#qp$q%qqqqqqqqqqqqqq$q$q0v8xDĄPń\ʄp˄ !"A RT0DXd~p`r8`s8`w8`8`8 @aa0{`#.0(v,v4v8v<v@HTTT<< T!T``<<<<lxx}}f727d77 @ABCDEFGHIJKLMNPQRSTUVWXYZ\Xh6X(X4XD P\1d2p%|  , H\l=|* C@CACBC CC DC, EC@ FCT GCh PC| QC RC `C aC bC cC P @P AP !P!P,!A`)P)Q)R)S)T)U)V)W)Y)Z*[*\*]$*^4*`@*dL*e\*fh*gt*ht*j*k*l*m*n*****++(+<+*P+d+t++++++++,* , ,,(,+*8,H,`,p,,,*,,,,p,,--$-4-<-H-X-d-@p-A-B-D-F-P-Q-R-S-e-p-q-r.t.u(.v8.xL.y\.zp.{.|...... //(/9H >9I>9P>9Q$>9R,>9U4>9V<>9XD>9aL>90T>93\>95d>9@l>9At>9E|>9F>9H>9P>9Q>9R>9U>9V>9`>9a09 >9a >9b >9c >9d >9e >9f ?9U?9U?9U?9qU$?9U0?9U8?9U@?9UL?9UT?9bd?9bl?9ct?9c|?9%c?9&c?90c?9p?9p?9p?9p?9p?9p?9p?@@0@<@oH@oP@o X@o`@oh@o p@o x@U0|@U`@Ua|@Ub@Uc@)@)@)BI@) aAM AM9$AM8ALAXAdAhA|A8Dh6+APATTAUTAAAAAAB# B! B hqB hr$B4,BS?SfSgShSiSjSkSmSnToT T,T8TDTPT\ThTtTTT`TaTTTTTTTT U UUU U(U0U8U@UPU `UlUtU|UUU1U1U2UBUUJ¸BPUP@UP@ UPeUP VPZZVPf$VJ0V DV]PV]XV]hV]hV] hV] |V]hV]V]V]V]VsVsVsVsVs Vs Vs VsVsVs VV8W @WW`6 aW{! W{!(W{!0W=8WpHWWTWu\WhWpWWWWW W WWWWWW"W#W%W(X)X+X,$X/ #$sH6s#6@6 PH#6`OH#6`bF M#asM΁3swO 33i`J`c,c<3 #hM #h##acj3 Nv3 6-3PNPDF##Ɓ#a Jac6-3#hW`愀#愀sKa O#AObHFV#s)Bg#sw2|<LزjNgc-xfjn3|P`P##< #%aOo##$+fj 3cCM #a15l8?#a31 5 9=~-   x33|`B~`)1`C~"X<\"3%|>`> 3B~#:nl8?B~B؃|3/B؃|ă3&8+26##k#c 3|`  k#c-<4830| ` 3 #b cZ3cd# v3 3B##"#"(#"#"B#JaE#3 bG# 3 bC##D#sM3'##&KOO"va F$Hڀ#4#Ja@#AK`#I0I`w#]b#c3-c#Ja#APb#Ac̆_+gcz|#hH##c|#cJa6#Ac37 #c`c#|ocKARaN#Ac3 b#Acg#cc#|gc3@ bcc|+@c|@cC|g@c|#c3*c +3)Ccކ3 bڀc|{c3, .c,|3=gc D|#acrqpcrppqrqppcrppqrqppc##3H#HCڇ#c nCvwc nCvwc#tC@Dt$&$scuZF&JudNsc{cv3>gcc8+8+2 1 c26:>c26:>c8+@2@6@:@>cZ @]cs #ss#f ##bswhA###BT+%2K} }}}%}2> > >>> > > >>%+2>K}  }}}} } > > > >  >> ! >> >  @DHL  @DHL     &(`& 0&0 0 `"0 0  JtT4$   rq! 2r!qq! 0  S1B1SSA1B1B11qw!! RSQQP@064a2]G4" w! TJ"TJ0XP.XPvXPpXPqXP4XPqXPʄXP$XP!$XPJ$XPK$XP$XP$XP$XP$XP$XP$XP$XP$XP%XP%XP%XPo&XPS&XPQ&XPR&XP'XP'XP tP`tP`AtP`itP`@HoCoFoHoIov15@1 qHeqHed1HeI1NI2NI3NܚUNNN)R,3MD8MD0 D0MDhMDhbDiMDibDuDuRDurD33q3u3v3w3s3r3HHHH H00000@dAdBdJdeS5enNNNTNUN6N>NfNgN~NNICiCvCyCzC " 0x9 f4 Z222CC @ @  "2"]G4" w! C0ae01S0 3@ Fv PQUVXZEUPU`V`)0 I$567129=PQejk348;<>RSTUVWXfgY):Y$]$l&ih'ixv|w   &'(yz{u^_`}~ (((((((((2222222<<<<<<<<<FFFFFFPPPPPPZZZZZZZZZddddddddddddddnnnnnnnnnnnnnnnnnnxxxxxxxxxx   #&) !%),036:=#(,159=ADHKOR(-38=BFKOSW[^beh<BHMRW\`dhloruwySY_dimqtwz|hmrvy|rrrrqqqq) ԱP@ & 4JPJ.0T@.H.HED $ 8D!0XFl!0X Ԃ ؂@܂@@@@ @ @$ @,A0A48@:FH:5\:5d:FPxg " @ ` ̃`܃hh!hahv0 8THTT h 1x Є Є43 x a   , < L \ l=|J)f(ąԅrp$ 44HH!P"P#\$\1h2hG1!tG '|, ̆', ܆!!  , w4 < <!(3DW lW LW \W <W pW@o 33Vv؇vvv0vHvdv P@48hЈV؈ P   4  D  T  !d 7|  Pp ȉ  \ \ 3 (ng@"P "`A0pC0E0G0H0N0# # Ԋ# #7  @,e6!DjXjht| <<̋؋23vJP$<#UP q` qh8/?9:;<=>?@ABC D E FG HIJK,L!MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.e mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= 2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;7.:8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8 ,R. n/]0N1I/0J2R373 $0 P0 `0 0K^66@#6666 66H@6 N*4 _5D78\>: : ; :E$; ;m4K;A\<[<=0= >"?j0@A8ع0ll(  v      W 1 Q `  @  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85     L+ L lL2 D   O  {o  A F  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n n@n @nn@0Df @  Q k k"k"k"k"k @^z BF |9 08 | @ @ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0 %()x+   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000vt1008h4\  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!#@[\]^_`{|}~@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_ABCDEFGHIJKLMNOPQRSTUVWXYZ@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_? h 1!2@3#4$5%6^7& 8* 9( 0) -_ =+! qwertyuiop[{]} as d!f"g#h$j%k&l';:('")`~*+\|,z-x.c/v0b1n2m3,<4.>5/?67*89 :;<=>?@ABCD E F G7H8I9J-K4L5M6N+O1P2Q3R0S.W X  / ,-.2"36&7/{ 8([ 9)] 0=} ?\ qQ@z+*'() +#',y2mM3,;4.:5-_V<>| '`+*~)^2"@3#4$6&7/{ 8([ 9)] 0=} +? |'()+'*3,;4.:5-_V<>\ '`|^~ +?\'()V<>| '`|^~ \'()|V<> \`^~&12~"3#'4{(5[-6|7` _8\ 9^ 0@ )] =+}az$q'm(%)+*,w2,?3;.4:/5!V<> 2"35%6&7/ 8( 9) 0= '? ^{[+*}]'@(#)\|+3,;4.:5-_V<> 1!2"34$5%6^7& 8* 9( 0) -_ =+('@)``+#~V\|2"6&7' 8( 9) 0 -= ^~@`[{';+(:*)+]}ps\_y{}\|1!|2"@3#4$~6&7/ 8( 9) 0= '? [+*]'({)\+}3,;4.:5-_V<> !1@-2_/3#;4$:5,6^.7& =8* [9( ]0) ?+' xX%eE{wW}!'(")`~+qQ|-34fF5\9 &1|2@"3#'4(56^7 !8 9{ 0} ) -_az[$*]q'm(%)+`,w2,?3;.4:/5=+~V<>\ `~)<> W  FE7JG7H8I9K4L5M6O1P2Q3R0S.-N, [{ ]}'",<.>pyfgcrl/?=+o e!u"i#d$h%t&n's(-_,;:-q.j/k0x1b3w4v5z:; <=>?@ABCDW X 6^6,7&7.qQwWeErRtTyYuUiIoOpP[{]}aAsS dD!fF"gG#hH$jJ%kK&lL';:('",zZ-xX.cC/vV0bB1nN2mM3,<4.>5/? 6^6,7&7. -_ =+qQwWeErRtTyYuUiIoOpP[{]}aAsS dD!fF"gG#hH$jJ%kK&lL';:('")`~+\|,zZ-xX.cC/vV0bB1nN2mM3,<4.>5/? 1+|2"@3*#46&7/ 8( 9) 0= '? eEz[!]'({) +$},y3,;4.:5-_V<>\ '? ^`~!]['({2"@3#6&7/{ 8([ 9)] 0=} '? <>+*'()\|+3,;4.:5-_V<> 1!2"3#6&7/ 8( 9) 0= '?\ qQ@+*~'({[)|+}]3,;4.:5-_V<> 1!2@3#4$5%6 =+[{'()'"+]}5;:S.V\|s/?2'3^#4+$5%6&7/{ 8([ 9)] 0=} *?\ -_qQ@I~'(i)"+,;345.:V<>| ''+,;`eEoOaAsS&lL,zZ-xX.cC1nN 1'~2"3+^4!5%6/7=` 8( 9) qQ\wW|zZiIQP!fF["gG]$jJ'$()0+qp,yY>-xX#.cC&/vV@0bB{1nN}3,?;4.:5-_*V< 1!~2"3#^4$5%6&7/` 8( 9) 0= '? +*qQ\wW|zZ!fF["gG]%kK&lL'()+,yY/vV@0bB{1nN}2mM3,;4.:5-_V<> 1!2"@3/4$5%6?7& 8* 9( 0) -_ =+oOpP[']';:~({)#|\+<>}2mM3,'4..5V ^^[](``{5UOW BXZbYFVXXGZMZ4>[ X Y .Y RYC]KH^^@#^^^ ^^H@^ J[ [ ]._`Xb b b bBbi:\Gc=dWd 6e0Le effgh  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzOpenBSD3.9RAMDISK#177 @(#)OpenBSD 3.9 (RAMDISK) #177: Thu Mar 2 09:50:47 MST 2006 OpenBSD 3.9 (RAMDISK) #177: Thu Mar 2 09:50:47 MST 2006 deraadt@cats:/usr/src/sys/arch/cats/compile/RAMDISK dackirqsizeiomemiosizdrqdrq2channeldrivetargetlunphydevfunctionconfigurationvendorproductreleasereportidconsolemuxslotwsmuxloopbpfiltervga_init_screen: no font vga_init_screen: no fontvga_common_setup: couldn't map vga iovga_common_setup: couldn't map 6845 iovga_common_setup: couldn't map memoryvga_common_setup: mem subrange failedvga_free_screen: consolevga_doswitch: disappeared vga: pcvt font support not built in, see vga(4) vgadrive at %s channel %d drive %datapiscsi at %s channel %dwdcspl%s channel %d: reset failed for drive 1 drive 0atapi type: %s c_bcount: %d c_skip: %d missing untimeoutwdc_probe_caps%s(%s:%d:%d): using PIO mode %d, Ultra-DMA mode %d, DMA mode %d using BIOS timings%s: transfer error, downgrading to PIO mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to Ultra-DMA mode %d wdccmdwdccommandwdccommandext%s:%d: %s %s(%s:%d:%d): %s physio split wd ioctl request... cannot proceed user_strat: No ioctl TagSCB %d - Abort%s Completed. Bus Device ResetSelection Timeout%s: ahc_intr - referenced scb not valid during SELTO scb(%d, %d) parity error detected %s. SEQADDR(0x%x) SCSIRATE(0x%x) non- Unexpected %sDT Data Phase Illegal CRC packet request No terminal CRC packet recevied CRC Value Mismatch %s:%c:%d: %s: Someone reset channel %c %s: Transceiver State Has Changed to %s mode %s: Spurious SCSI interrupt NONEaic7770aic7850aic7855aic7859aic7860aic7870aic7880aic7895aic7895Caic7890/91aic7896/97aic7892aic7899Illegal Host AccessIllegal Sequencer Address referrencedIllegal Opcode in sequencer programSequencer Parity ErrorData-path Parity ErrorScratch or SCB Memory Parity ErrorPCI Error detectedCIOBUS Parity Errorin Data-out phasein Data-in phasein DT Data-out phasein DT Data-in phasein Command phasein Message-out phasein Status phasein Message-in phasewhile idlein unknown phase80.040.033.020.016.013.410.08.06.675.75.04.44.03.6%s: WARNING no command for scb %d (cmdcmplt) QOUTPOS = %d Attempt to queue invalid SCB tag %x:%x%s: brkadrint, %s at seqaddr = 0x%x ahc_intr: seqint, intstat == 0x%x, scsisigi = 0x%x %s:%c:%d: unknown scsi bus phase %x, lastphase = 0x%x. Attempting to continue %s:%c:%d: Warning - unknown message received from target (0x%x). Rejecting ahc_intr: HOST_MSG_LOOP bad phase 0x%x %s:%c:%d: no active SCB for reconnecting target - issuing BUS DEVICE RESET SAVED_SCSIID == 0x%x, SAVED_LUN == 0x%x, ARG_1 == 0x%x ACCUM = 0x%x SEQ_FLAGS == 0x%x, SCBPTR == 0x%x, BTT == 0x%x, SINDEX == 0x%x SCSIID == 0x%x, SCB_SCSIID == 0x%x, SCB_LUN == 0x%x, SCB_TAG == 0x%x, SCB_CONTROL == 0x%x SCSIBUSL == 0x%x, SCSISIGI == 0x%x SXFRCTL0 == 0x%x SEQCTL == 0x%x Unable to clear parity error. Resetting bus. %s:%c:%d:%d: Attempt to issue message failed data overrun detected %s. Tag == 0x%x. HaveHaven't%s seen Data Phase. Length = %ld. NumSGs = %d. sg[%d] - Addr 0x%x%x : Length %d Bogus TAG after DMA. SCBPTR %d, tag %d, our tag %d for safety%s: BTT calculation out of range SEQ_FLAGS == 0x%x, SCBPTR == 0x%x, BTT == 0x%x, SINDEX == 0x%x , A == 0x%x %s: No free or disconnected SCBs %s:%c:%d: Missed busfree. Lastphase = 0x%x, Curphase = 0x%x %s: Interrupted for status of 0 (?) ahc_intr - referenced scb not valid during seqint 0x%x scb(%d) HOST_MSG_LOOP with invalid SCB %x %s: Missing case in ahc_handle_scsiint. status = %x Unexpected busfree %s SEQADDR == 0x%x %s: %s: Infinite loop in critical section critical section loop%s: ahc_alloc_tstate - Target already allocated DT%s: target %d synchronous at %sMHz%s, offset = 0x%x %s: target %d using asynchronous transfers %s: target %d using %dbit transfers %s:%c:%d:%d: Bus Device Reset Message Sent Abort%s Message Sent ahc_intr: AWAITING_MSG for an SCB that does not have a waiting message SCSIID = %x, target_mask = %x SCB = %d, SCB Control = %x, MSG_OUT = %x SCB flags = %xNo or incomplete CDB sent to device. %s: Issued Channel %c Bus Reset. %d SCBs aborted Protocol violation %s. Attempting to abort. Completed command without status. Unknown protocol violation. No SCB found during protocol violation Target did not send an IDENTIFY message. LASTPHASE = 0x%x. HOST_MSG_LOOP interrupt with no active messageUnknown REQINIT message typeTarget MSGIN with no active message(%s:%c:%d:%d): Target Initiated PPR (%s:%c:%d:%d): Initiator Initiated PPR (%s:%c:%d:%d): requested %dBit transfers. Rejecting... (%s:%c:%d:%d): refuses WIDE negotiation. Using 8bit transfers orderedhead of queue(%s:%c:%d:%d): refuses %s tagged commands. Performing simple queue tagged I/O only (%s:%c:%d:%d): refuses tagged commands. Performing non-tagged I/O %s:%c:%d: Message reject for %x -- ignored (%s:%c:%d:%d): refuses synchronous negotiation. Using asynchronous transfers %s: %s on %c:%d. %d SCBs aborted Unsupported adapter type (0x%x). Ignoring %s: WARNING - Failed chip reset! Trying to initialize anyway. hardware SCB structuressense buffers%s: ahc_init_scbdata - Unable to allocate initial scbs %s: No SCB space found SG spaceUltra Ultra160 Ultra2 SingleWide%s%s Channel %c, SCSI Id=%d, %d SCBs%d/%d SCBsTwin Channel, A SCSI Id=%d, B SCSI Id=%d, primary %c, shared data%s: Host Adapter Bios disabled. Using default SCSI device parameters %s: unable to allocate ahc_tmode_tstate. Failing attach Infinite interrupt loop, INTSTAT = %xInactive SCB in Wait List scb_index = %d, next = %d Waiting List traversalWaiting List inconsistency. SCB index == %d, yet numscbs == %d.found = %d, qinstart = %d, qinfifionext = %d First/Second Qinfifo fixupInactive SCB in qinfifo qinpos = %d, SCB index = %d Loop 1Disconnected List inconsistency. SCB index == %d, yet numscbs == %d.Disconnected List Loop. cur SCBPTR == %x, prev SCBPTR == %x.Inactive SCB on pending list Bogus resid sgptr value 0x%x %s: Program too large for instruction memory size of %d! ahc_loadseq: Could not malloc%s: BMOV not supportedUnknown opcode encountered in seq program%s[0x%x]%s ahc_print_register:(|================== Dump Card State Begins ================= %s: Dumping Card State %s, at SEQADDR 0x%x ACCUM = 0x%x, SINDEX = 0x%x, DINDEX = 0x%x, ARG_2 = 0x%x HCNT = 0x%x SCBPTR = 0x%x SCSISIGIERRORSCSIBUSLLASTPHASESCSISEQSBLKCTLSCSIRATESEQCTLSEQ_FLAGSSSTAT0SSTAT1SSTAT2SSTAT3SIMODE0SIMODE1SXFRCTL0DFCNTRLDFSTATUSSTACK: SCB count = %d Kernel NEXTQSCB = %d Card NEXTQSCB = %d QINFIFO entries: Waiting Queue entries: %d:%d Disconnected Queue entries: QOUTFIFO entries: Sequencer Free SCB List: Sequencer SCB Info: %3d SCB_CONTROLSCB_SCSIIDSCB_LUNSCB_TAGPending list: Kernel Free SCB list: FEATURES = 0x%x, FLAGS = 0x%x, CHIP = 0x%x BUGS =0x%x ================= Dump Card State Ends ================== Untagged Q(%d): (SCSIPHASECard was paused %s: failed to create DMA map for %s, error = %d %s: failed to load DMA map for %s, error = %d %s: failed to map DMA mem for %s, error = %d %s: failed to allocate DMA mem for %s, error = %d ahcahc_attachcmd fail %s: board is not responding %s: Illegal cable configuration!!. Only two connectors on the adapter may be used at a time! adv%s: unable to allocate control structures, error = %d %s: unable to map control structures, error = %d %s: unable to create control DMA map, error = %d %s: unable to load control DMA map, error = %d %s: unable to initialize ccb, error = %d %s: unable to create DMA map, error = %d advccb%s: unable to load overrun buffer DMA map, error = %d %s: unable to create overrun buffer DMA map, error = %d %s: unable to map overrun buffer, error = %d %s: unable to allocate overrun buffer, error = %d %s -set: tag queuing enabled w/o disconnects unknown warning %d I/O port increment switch enabled %s -get: Chip is not halted Couldn't get MicroCode Start address I/O port address modified EEPROM checksum error IRQ modified adv_init: adv_find_signature failed%s: bad signature%s: unable to initialize board RISC chip%s: unable to create control blocks %s: WARNING: only %d of %d control blocks created %s: unable to load MicroCode%s: unable to initialize MicroCode%s: adv_scsi_cmd, more than %d dma segments %s: adv_scsi_cmd, error %d loading dma map timed out AGAIN. Resetting Bus %s: exiting ccb not allocated! %s: timed out [ecb %p (flags 0x%x, dleft %x, stat %x)], AGAIN sync negotiation disabled espESP100ESP100AESP200NCR53C94NCR53C96ESP406FAS408FAS216AM53C974FAS366/HMEout of memory %s: unknown variant %d, devices not attached : %s, %dMHz, SCSI ID %d %s: unknown revision code, assuming ESP100 %s: resetting SCSI bus ncr53c9x_ecb[NCR_INIT(%d) %d] SELATNS [ncr53c9x_select(t%d,l%d,cmd:%x,tag%x,%x)] [0x%x, %d]->%d [ncr53c9x_scsi_cmd] [ncr53c9x_poll: rescheduling] [ncr53c9x_poll] %d:%d busy [ncr53c9x_sched] ncr53c9x_sched: not IDLE (state=%d)requesting sense sense=0x%02x resid=%lu %s: QFULL -- throttling to %d commands [ncr53c9x_done(error:%x)] [flushfifo] cont [rdfifo %s (%d): %02xncr53c9x_rdfifo: bad flag[wrfifo(%d):ncr53c9x_sched_msgout %x %d %s: reselect from target %d lun %d tag %x:%x with no nexus; sending ABORT %s: reselect with invalid selid %02x; sending DEVICE RESET %s: msgin: no msg byte available %s: phase change, dropping message, prev %d, state %d %s: unexpected MESSAGE IN; sending DEVICE RESET %s: reselect without IDENTIFY; MSG %x; sending DEVICE RESET got %ld extra bytes cmdcomplete unrecognized MESSAGE EXTENDED; sending REJECT %s: wide mode %d async mode max sync rate %d.%02dMB/s SDTR period %d, offset %d extended(%x) save datapointer restore datapointer disconnect %s: tagged queuing rejected: target %d (rejected sent tag)%s: sync transfer rejected: target %d %s: wide transfer rejected: target %d msg reject (msgout=%x) noop unrecognized MESSAGE; sending REJECT ident TAG %x:%x%s: TAG reselect without IDENTIFY; MSG %x; sending DEVICE RESET gotmsg(%x) state %d[ncr53c9x_msgin(curmsglen:%ld)] %s at line %d: no nexus %s at line %d: unexpected MESSAGE OUT phase [ncr53c9x_msgout(priq:%x, prevphase:%x)]%s: waiting for SCSI Bus Reset to happen %s: identify failed, state %d, intr %02x selid=%2x %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] %s: target didn't identify backoff selector ncr53c9x: no nexus%s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] MESSAGE_IN_PHASE %s: unexpected bus phase; resetting MESSAGE_OUT_PHASE DATA_OUT_PHASE [%ld] COMMAND_PHASE 0x%02x (%d) DATA_IN_PHASE STATUS_PHASE ncr53c9x no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] <>%s: target didn't send tag: %d bytes in fifo [%d] %s: STATUS_PHASE: msg %d %s: can't get status, only %d bytes %s: ICCS: : [intr %x, stat %x, step %x] %s: invalid state: %d sync nego not completed! %s: unexpected disconnect; sending REQUEST SENSE %s: SCSI bus parity error %s: DMA error; resetting %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: SCSI bus reset regs[intr=%02x,stat=%02x,step=%02x,stat2=%02x] [ncr53c9x_intr: state %d] %s: nexus in reset stateDMA activetagged DT %s: target %d now using %s%s%d bit MHz %d REQ/ACK offset xfers 13.3??3.33async siop: can't find my sync parameters%s: unable to allocate script DMA memory, error = %d %s: unable to map script DMA memory, error = %d %s: unable to create script DMA map, error = %d %s: unable to load script DMA map, error = %d %s: rejecting invalid wide negotiation from target %d (%d) %s: rejecting invalid PPR negotiation from target %d %s: ppr negotiation for target %d: offset (%d) or sync (%d) out of range %s: ppr negotiation for target %d: transfer width (%d) incompatible with dt %s: ppr negotiation for target %d: sync (%d) incompatible with adapter %s: ppr negotiation for target %d: no DT option %s: bad offset in siop_sdp (%d) clear fifo failed %s: timeout waiting for DIFFSENSE to stabilise %s: invalid SCSI mode 0x%x %s: switching to differential mode %s: switching to LVD mode %s: switching to single-ended mode siop%s: can't alloc lunsw for target %d %s: unexpected phase mismatch %d %s: selection timeout without command %s: unexpected disconnect without command != NULL%s: siop_intr() - we should not be here! istat = 0x%x, dstat = 0x%x, sist = 0x%x, sstat1 = 0x%x need_reset = %x, irqcode = %x, siop_cmd %s %s: script interrupt (0x%x) with invalid DSA !!! unknown irqcode %x unhandled message 0x%x scsi message reject, extended message sent was 0x%x scsi message reject, message sent was 0x%x our reject message was rejected %s: done without command, DSA=0x%lx invalid retval from siop_wdtr_neg()invalid retval from siop_sdtr_neg()MSG_IGN_WIDE_RESIDUE: bad len %d invalid retval from siop_iwr()%s: extended message too big (%d) %s: target %d lun %d tag %d reselect without command %s: target %d reselect with invalid lun %d %s: reselect with invalid target %d %s: reselect with invalid target error, DSP=0x%x reselect failed %s: reselect with invalid tag %s: command with invalid status (IRQ code 0x%x current status %d) ! %s: unhandled scsi interrupt, sist=0x%x sstat1=0x%x DSA=0x%x DSP=0x%x parity error %s:%s: phase mismatch without command scsi gross error %s: DMA IRQ: DMA fifo empty, DSP=0x%x DSA=0x%x: last msg_in=0x%x status=0x%x current DSA invalid parity bus fault illegal instructionsingle step dsp 0x%08x dsa 0x08%x INTRF %s: unable to load data DMA map (for SENSE): %d request sense failed %s: untagged command already running for target %d lun %d (status %d) %s: scsi bus reset cmd %p added to reset list from urgent list cmd %p added to reset list from ready list cmd %p (status %d) reset with status %d, xs->error %d cmd %p (tag %d) added to reset list %s: unable to load data DMA map: %d %s: can't alloc siop_lun for target %d lun %d %s: can't malloc memory for target %d siop_start: bad statustimeout on SCSI command 0x%x %s: unable to allocate cbd DMA memory, error = %d %s: unable to load cbd DMA map, error = %d %s: unable to create data DMA map for cbd: error %d %s: unable to create cbd DMA map, error = %d %s: unable to map cbd DMA memory, error = %d %s: can't allocate memory for command descriptors %s: can't allocate memory for command descriptors head siop: resel switch fullsiop_stat_intr %d siop_stat_intr_shortxfer %d siop_stat_intr_xferdisc %d siop_stat_intr_sdp %d siop_stat_intr_saveoffset %d siop_stat_intr_done %d siop_stat_intr_lunresel %d siop_stat_intr_qfull %d lc%s: fatal RXD error, attempting recovery %s: recovery failed -- board disabled %s: reset: EEPROM checksum failed (0x%x) PIO mode (internal 2KB window)2KB windowchanged 32KB window to 2KBchanged 64KB window to 2KB%s: address %s, %dKB RAM, %s %s: disabled due to error %s: command never completed! %s: eeprom failed to come ready %s: reset didn't complete %s: bogus xcvr value in EEPROM (%x) %s: choosing new default based on card type %s: WARNING: no media options bits set in the media options register!! %s: this could be a manufacturing defect in your adapter or system %s: attempting to guess media type; you should probably consult your vendor %s: unknown device ID: %x -- defaulting to 10baseT %s: guessing MII %s: guessing 10/100 internal %s: guessing 10BaseT transceiver %s: guessing COMBO (AUI/BNC/TP) %s: guessing 10baseFL %s: guessing 100BaseT4/MII %s: guessing TPC (BNC/TP) %s: guessing 10/100 plus BNC/AUI %s: rx load failed %s: bad receive status -- packet dropped %s: transmission error: %x %s: initialization failed: no memory for rx buffers %s: unknown XCVR type: %d %s: watchdog timeout %s: no carrier - transceiver cable problem? %s: failed to read station address : can't alloc list mem : can't map list mem : can't alloc list map : can't load list map : can't create rx spare map : can't create tx spare map : can't create tx map : can't create rx map xl%s: warning: SCB timed out fxp: %s, address %s %s: no phy found, using manual mode %s: Disabling dynamic standby mode in EEPROM, New ID 0x%x, cksum @ 0x%x: 0x%x -> 0x%x %s: Failed to malloc memory %s: unable to create rx dma map %d, error %d %s: unable to create tx dma map %d, error %d fxp_stop: no buffers!%s: device timeout %s: fxp_mdi_read: timed out %s: fxp_mdi_write: timed out fxp-d101afxp-d101b0fxp-d101mafxp-d101sfxp-d102fxp-d102cfxp-d102e%s: timeout loading microcode %s: failed loadfirmware of file %s: errno %d %s: phy_read: bad phy register %x %s: phy_write: bad phy register %x %s: failed to force tx and rx to idle state %s: reset never completed! %s: MII without any PHY! %s: failed to force tx to idle state dcne2000_attach: setup failed : where did the card go? ne2000_detect%s: remote transmit DMA failed to complete ne2000_write_mbuf: negative len%s: %d silo overflow%s, %d ibuf overflow%s comprmcomstartcomcninit: mapping failed: unknown uart %s: console : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: can't establish soft interrupt%s: probed fifo depth: %d bytes kbdauxkbc: cmd word write error kbc: aux echo error 1 kbc: aux echo error 2 (%s slot)pckbc_slot_enable(%d) failed pckbc_cmd: send error pckbc: command timeout pckbc_start: command error pckbc_start: send error pckbc: cmd failed kbccmdpckbc_set_inputhandler: bad slot %dpckbcintr: no dev for slot %d pckbcihaerror %d loading SG list dma map buffer needs >%d dma segments error %d loading buffer dma map iha_init_tulip%s: couldn't create SCB SG DMA map, error = %d %s: couldn't create SCB data DMA map, error = %d error %d loading request sense buffer dma map SCSI Parity error detected SCSI OpCode 0x%02x timed out %s: target %d using %d bit %d.%d MHz %d REQ/ACK offset %s: unable to allocate SCBs, error = %d %s: unable to map SCBs, error = %d iha: invalid EEPROM, bad signature or checksum version %d.%d%s %s: unsupported OHCI revision %s: reset timeout %s: SMM does not respond, resetting ohci, legacy support%s: blocking intrs 0x%x %s: unrecoverable error, controller halted %s: resume detect %s: %u scheduling overruns ohci_add_done: addr 0x%08lx not foundohci_rem_ed: ED not foundohci_abort_xfer: not in process contextohciabohci_root_ctrl_startOHCI root hubohci_setintr: 0 interval %s: isoc TD alloc failed ohci_device_isoc_abort: early return rd%drdattach: device name too long RAM diskfictitiousrd_idleAll breakpoints used. Already set. Too many breakpoints. Not set. No breakpoints set Map Count Address %s%p %5d %-12sdb_commandCount missing Bad modifier Ambiguous No such command Malloc debugging not enabled. the kernel did not panic procscalloutbreaksextentsmallocobjectpanicpoolprocregistersuvmexpwatchescrashhaltrebootpoweroffmachineexaminesearchdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallshowboothelphangmandmesgddb> Bad function %#n Argument missing Too many arguments ELF[ %s symbol table has bad start address %p ] ELFbad magic[ %s ELF symbol table not valid: %s ] bad e_machine.strtab.symtabsymtab unaligned[ using %lu bytes of %s ELF symbol table ] symtab corrupted= 0x%lx %c\%03o%-*ld%-*lo%-*lr%-*lu%-*lx%-*lz: %*d%*o%*r%*u%*x%*zAddress missing Value missing Syntax error Symbol not found Divide by 0 Negative shift amount ^R String too long Bad escape Bad character Bad character in number End of stack trace. --db_more-- -%*lo-%#*lo-%*lu-%#*lu-%*lx-%#*lxFaulted in traceback, aborting... Starting stack trace... %-12s%#*ln %s+%#lr[after %6d] bsd[ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s%s Sifting table %s: db_printsym [%s:%d]+%sBreakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! After %d instructions (%d loads, %d stores), radixmaxoffmaxwidthtabstopslinesUnknown variable No value All watchpoints used. No map. Too many watchpoints. No watchpoints set Map Address Size %s%p %8lx %lx Unknown size %#8n = %#8n Nothing written. () Score: %lu/%lu db_hangman/etc/firmware/%sdp8390_initdp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d : failed to clear NIC buffer at offset %x - check configuration %s: device enable failed arc4_stirextract_entropyrndrdRRIP without PX field? RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_P1282RRIP_1991AIEEE_1282SPcd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: directory crosses block boundary %d[off=%d/len=%d] fhtovp: bread error %d fhtovp: crosses block boundary %d fhtovp: lbn exceed volume space %d cd9660_strategy: spectag VT_ISOFS, isofs vnode elf32_load_fileOpenBSD#!/dev/fd/%dswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodoned/sbin/init/sbin/oinit/sbin/init.bak/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initinitclocks: unable to register softclock intrfileplfdescpldup2: fdallocclosefkqeueplknoteplkqreaduser mapping failed kernel mapping failed %d init died (signal %d, exit %d)waitppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: unknown locktype request %dlockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: upgrade exclusive locklockmgr: processor %lu, not exclusive lock holder %lu unlockinglockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: draining against myself lock type %s: EXCL (count %d) by processor %lupid %d with %d pending not locked lock type %s: SHARED (count %d)malloc: allocation too largemalloc: out of space in kmem_map%d,rwlockphysbufphysio%-16s %-8s %18p %s %5d %5d %5d %d %#10x %-9.9s %-16s COMMANDSTRUCT PROC *UAREA * PID %-10s %18s %18s %18s VMSPACE/VM_MAP PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSGWAITPPIDPGRPUID PID %5s %5s %5s S %10s %-9s %-16s usage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info procinit: mallocprocplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0idlestopzombiedeadonprocADVLOCKCTTYINMEMNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCFSTRACESSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUEDSWAPINBIGLOCKPROC (%s) pid=%d stat=%s flags=%b pri=%u, usrpri=%u, nice=%d forw=%p, back=%p, list=%p,%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu mawn%c%5d %-10.10s %18p %18p %18p plimitplsensorssensors kthreadsigaplpauseissignal procfs debuggingpid %d was killed: %s sorry, pid %d was killed: %s coredump%s.corehashinit: bad cntsysctlsysctl_disklockkern_sysctl%s,denied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleep%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func smashed stack in %spreempt: cpu_preempt not yet implementedsetrunnable not configured unsupported >>> %s probe returned %d >>> probing for %s* mapply: no match function for '%s' device>>> %s probe won >>> no winning probe root device %s not configured %s at %s%s (root)config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: duplicate %sexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: device name too long%s detached config_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structurewrit%s%d%c: %s %sing fsbn %d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)disk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dfilesystem type %d not known.. assuming ffs dk_mountrootcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0bufq_default_alloc: no memoryintrextentplextntextent_free: start 0x%lx, end 0x%lx extent_free: region not foundFLWANTEDWANTEDNOCOALESCEFIXEDextent `%s' (0x%lx - 0x%lx), flags=%b 0x%lx - 0x%lx extent_print: NULL extentklogmtx_enter: ipl not implementedphpoolpcgpoolpool_init: too much uptimepool_get: %s: page emptypool_put: %s: page header missing page %p, nmissing %d, time %lu,%lu POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page cache %p: allocfrom %p freeto %p hits %lu misses %lu ngroups %lu nitems %lu group %p: avail %d %p no log curpage %p pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) kernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %slogprikprintf%llx%lld%llobug in kprintf: bad base0123456789ABCDEF(null)0123456789abcdefaddchangeddbdisableenableexitqfindlistquittimezoneverbosev--- more --- 0%o*UNKNOWN**FOUND*%3d free slot (for add) Unknown devno (max is %d) %3d at disable %s flags 0x%x ???%3d %s count %d (pseudo device) %s [] ? Unknown argument %3d can't change free slot change (y/n) ?%3d %s changed flags changed out of memory. alreadyError unknown state %3d can't disable free slot %3d %s can't disable pseudo device %3d can't enable free slot %3d %s can't enable pseudo device command args description [count] number of lines before more enter ddbdev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst don't know toggle verbose bootingUnknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Device not complete number or * is missing Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d Unknown command disautoconf verbose %sabled Unknown command, try help User Kernel Config UKC> Continuing... sys_ioctlselectpipelkpiperdpipewrpipeclpipeplttckoutqttwritettyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk empty foreground process group putc: required clalloc b_to_q: required clalloc WARNING: mclpool limit reached; increase kern.maxclustersmbplmclplm_copym0: null mbufm_copym0: m == NULL and not COPYALLm_copym0: off %d, len %dm_copydata: off %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_copydata: len %d < 0m_apply: len %d < 0m_apply: null mbuf in skipm_apply: null mbufm_apply: off %d < 0m == NULL in m_pulldown()unixsockplsoclose: NOFDREFsoaccept: !NOFDREFsbappendaddrsbappendcontrolsemi-panic: sbcompresssbdropsbcreatecontrol: message too large %d acceptuipc 1uipc 2uipc 4piusrrequnp_attachunp_bindunp_connect2unp_disconnectbremfree: lost tailbufplgetblkallocbuf: buffer larger than MAXBSIZE requestedgetnewbufbiowaitbiodone alreadynchplcluster_read: DONE bpcluster_callback: too little memoryClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocksvop_generic_revokealloperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.nameilockfpllf_findoverlap: defaultrelookup: null namerelookup: lookup on dot-dotvnodesvfslock%s_mountroot failed: %d vnodevgetvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevvgonel: not cleanmissing aliaskinfo: vp changed WARNING: some file systems would not unmount retrying unmount of %s failed with error %d syncing disks... giving up done softdep vwakeup: neg numoutputvinvalbufvinvalbuf: flush failedvinvalbuf: dirty bufsvflushbufvflushbuf: not dirtybgetvp: not freebrelvp: NULLsyncersyncer vnode sys_mountmount: lost mountunmount: dangling vnodesys_statfssys_fstatfssys_getfsstatsys_getfhsys_fhopensys_fhstatsys_fhstatfsvn_lockvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_leasevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_strategyvop_bwritedead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockfifowfifortag VT_NON, fifo with %ld readers and %ld writersfifo_badop calledspec_read typespec_write typespec_ioctlspec_fsyncspec_fsync: not dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calleddos2unixtime(): month value out of range (%ld) denodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largeextendfile(): attempt to extend root directory extendfile: pcbmapmsdosfs_lookup. .. doscheckpath(): .. not a directory? RRaArrAamsdosfs_sync: rofs mod dev %d, %d, %s msdosfs_createmsdosfs_write(): bad file typemsdosfs_renamemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_mkdirmsdosfs_readdir.msdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED)bpf_detachd: descriptor not in listbpf: ifpromisc failedbpfbpfwritebpf_mcopybpfattachtoo many interfacesif_attachhead: mallocif_attach: mallocif_clone_listifioctlifconfif_getgroupif_getgroupmembersegressif_group_egress_buildifpromisc%s: can't handle af%d lo%dlooutput: no header mbufifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedrn_addmask: mask impossibly already in tree Mask for route not entered Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2raw_usrreqrtentplrtfreertfree: %p not freed (neg refs) rtfree 2ifafreertrequest deletertinit: wrong ifa (%p) was (%p) rttmrplrt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputroutearp_rtrequest: bad gateway value arp_rtrequest: malloc failed arprequestarpresolve: can't allocate llinfo arpintrarp: attempt to add entry for %s on %s by %s on %s in_arpinputarp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to overwrite permanent entry for %s by %s on %s duplicate IP address %s sent from ethernet address %s arp: ether address is broadcast for IP address %s! arptfreearplookup: unable to enter address for %s revarprequestrevarp[NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p (%s) ifa=%p genmask= gwroute=%p llinfo=%p (NULL)Route tree for AF_INET (not initialized) in_controlinvalid argument to in_lifaddr_ioctlin_ifinitin_addmultiin_delmultiin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplIPv6 pcb passed into in_pcbconnectinterneticmp_erroricmp lenicmp_reflecticmp_mtudisc_timeouticmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeout%d.%d.%d.%dipqeplaeshmac-sha1deflateip_initip_outputip_setmoptionsrip_attachrip_detachrip_usrreqtcp_inputm_pulldown malfunctiontcp_pulloutofbandsynpltcp_outputtcp_output REXMTtcpcbpltcpqepltcp_inittcp_respondtcp_ctlinputtcp6_mtudisc_callbacktcp_timer_rexmttcp_usrreqtcp_identudp_inputudp6_ctlinputudp_usrreqipip_input: should never reach hereetherip_inputMD5Finalrpc denied, status=%d rpc denied, error=%d RPC timeout for server 0x%x krpc_call: sosend: %d bind failed nfsbioread: type %x unexpected nfsbioreadnfsvinvalnfs_doio: type %x unexpected Process killed due to text file modification nfs_boot: using network interface '%s' nfs_boot: socreate, error=%dnfs_boot: GIFFLAGS, error=%dnfs_boot: SIFFLAGS, error=%drevarp failed, error=%dnfs_boot: client_addr=%s nfs_boot: set if addr, error=%dnfs_boot: server_addr=%s hostname=%s nfs_boot_initnfs_boot: bootparam whoami, error=%dnfs_boot: no suitable interfacenfs_boot: bootparam get %s: %d nfs_boot: mountd %s, error=%d nfs_boot_getfhnfs_boot: portmap NFS/v2, error=%d nfs_boot: bootparam_whoami: bad reply nfs_boot: bootparam_getfile: bad reply nfs_hashlocknfsnodeplnfskqlcknfskqpwnfskqdetnfskqpollnfsconnfscon sotypenfs send error %d for server %s nfsd send error %d receive error %d from nfs server %s Egad!! short receive (%d/%d) from nfs server %s %s (%d) from nfs server %s impossible packet lengthnfsreply nilnqnfstrynfs_requestis alive againnot respondingnfsndlcknfs sndunlocknfsrcvlknfs rcvunlockKerb nickname short Kerb nick verifier bad Bad kerb verifier Not fullname kerb verifier nfs server %s: %s build > MLENnfs S too bignfsreqplnqnfstimrcld kerbnfsd initnfsidlnfsionfsauth1nfsauth2nfs_mountroot: root/root on %s nfs_mountroot: getattr for rootswap on device 0x%x nfs_mountrootswap/swapswap on %s nfs_mountroot: getattr for swap WARNING: no swap nfs_mountroot: can't setup swap vpnfsnfs_mount_diskless: vfs_rootmountalloc failednfs_mountroot: mount %s failed: %dnfs_args: retrying connect nfs_mountnfsdismnfs: writerpc iovcnt > 1nfs_remove: no namenfs_remove: bad v_usecountnfs_rename: no namenfs readdirrpc bad uioEEK! readdirrpc resid > 0 nfs readdirplusrpc bad uioEEK! readdirplusrpc resid > 0 .nfsA%05x4.4nfs physio/asyncnfs_fsyncnfsfsyncnfs_fsync: not dirtytag VT_NFS, fileid %ld fsid 0x%lxbwrite: buffer is not busy???file system fulluid %u on %s: %s %s: write failed, file system is full ffs_realloccg: bad blockno%s: optimization changed from SPACE to TIME dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optim%s: optimization changed from TIME to SPACE dev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevmode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free pos = %d, i = %d, fs = %s ffs_alloccgblk: can't find blk in cylffs_alloccgblk: cyl groups corruptedffs_clusteralloc: lost blockffs_nodealloccg: block not in mapcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corrupteddev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %u bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free fragffs_blkfree: freeing free blockdev = 0x%x, ino = %u, fs = %s ffs_freefile: range: dev = 0x%x, ino = %d, fs = %sffs_freefile: freeing free inodebno = %d, fs = %s ffs_alloccg: block not in mapstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedffs_balloc: blk too bigCould not unwind indirect block, error %dffs_update: bad link cntffs_truncate: newspaceffs_indirtrunc: bad buffer sizeffs_isblockffs_clrblockffs_setblockffs_isfreeblocksoftdep_flushfiles calledsoftdep_setup_inomapdep calledsoftdep_setup_blkmapdep calledsoftdep_setup_allocdirect calledsoftdep_setup_allocindir_page calledsoftdep_setup_allocindir_meta calledsoftdep_setup_freeblocks calledsoftdep_freefile calledsoftdep_setup_directory_add calledsoftdep_change_directoryentry_offset calledsoftdep_setup_remove calledsoftdep_setup_directory_change calledsoftdep_change_linkcnt calledsoftdep_load_inodeblock calledsoftdep_update_inodeblock calledsoftdep_slowdown calledffs_mountroot: can't setup bdevvp's ffsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck WARNING: soft updates isn't compiled in ffs_reload: dirty2ffs_reload: dirty1ffs_mountfs(): Sorry, no UFS2 support (yet) ffs_statfsupdate: rofs modffsinodino1pl%s: typeffs_write%s: nonsync dir writeffs_fsyncffs_fsync: not dirtyi_ffs_size too smallmangled entry%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory chown: lost quotaufs_linkufs_renameufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_rename: lost from startdirufs_mkdirufs_readdir: lost in spaceufs_strategy: specufs_makeinodemode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocext2fs_nodealloccg: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedbad block %d, ino %d dev = 0x%x, ino = %d, fs = %s ifree: range: dev = 0x%x, ino = %d, fs = %sifree: freeing free inodeext2fs_mapsearch: block not in mapext2fs_alloccg: map corrupteduid %d on %s: %s ext2fs_indirtrunc: bad buffer sizeext2fs_readdiri_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryext2fs_direnter: newblkext2fs_direnterext2fs_direnter: frag sizecheckpathext2fs_writeext2inoplext2dinoplext2fs_mountroot: can't setup bdevvp'sext2fs%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsExt2 fs: unsupported inode size Ext2 fs: unsupported optional feature ext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_rename: lost from startdirext2fs_mkdir: blksizeamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing thereamapplamap_wipeout: corrupt amapcownowpagecownowamap_cow_now: non-resident wired page in anon %pamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countuvm_anon_add: can not allocate %d anons uvm_anon_adduao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_create: kernel object already allocateduao_create: hashinit swhash faileduao_create: malloc swslots faileduao_create: asked to enable swap on kernel objectuaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getuao_getpageudv_attachudv_detachudv_faultfltamapcopyanonget1anonget2flt_noram1flt_pmfail1flt_noram3flt_noram2flt_pmfail2flt_noram4flt_noram5fltagain2uvm_fault_unwire_locked: address not in mapuvm_fault_unwire_locked: unwiring non-wired memoryuvm_fork: uvm_fault_wire failed: %duvm_swapin: uvm_fault_wire failed: %dschedpwaitscheduleruvm_init: page size not setuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: submap allocation faileduvm_km_suballoc: unable to create submapkm_getwait2km_allockm_alloc1wuvm_km_alloc1: non-released pagevallocwaitkmthreadkmallocvmmaplkuvm_mapent_alloc: out of static map entries uvm_mapent_alloc: cannot allocate map entry# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpluvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: locked=%d, pgops=%p, npages=%d, refs= PAGES : <%p,0x%llx> refs=%d PAGE %p: %b flags=%s, pqflags=%s, vers=%d, wire_count=%d, pa=0x%lx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) checking pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< uvm_page_printit page found on pageq list anon backpointer is OK checking object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found on object list uvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_pageboot_alloc: pmap_growkernel() faileduvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: bad free list %duvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = BSEARCH number of buckets = %d uvm_pagealloc_strat: bad strat %demergvapager_mappagedaemon: deadlock detected! pgdaemon%s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern/kmem)=%p/%p swapsysuvm_swap_init: can't get vnode for swap deviceswapmapswp vnxswp vnduvm_swap_init: extent_create failedswapdrum_addsys_swapctlswapctl: copystrswapctl: miniroot copy failedswap0x%04xswap_on: miniroot larger than swap?Preserved %d pages of miniroot leaving %d pages of swap swap_on: unable to preserve minirootdisklabel regionswap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filewarning: resource shortage: %d pages of swap lost swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attach: blocked at %p flags 0x%x uvn_attachuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: kill flag set on referenced object!uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getuvn_getpageuvn_iosyncrd%d: fixed, %d blocks NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressin6_pcbconnectin6_pcbnotifyin6_ifloop_requestADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_controlnd6_prelist_add succeeded but no prefix prefix ioctls are now invalidated. please use ifconfig. in6_update_ifain6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_addmultiin6_delmultiin6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_prefixlen2maskin6_ifawithscope: output interface is not specified get_rand_ifid%s: interface identifier generated by random number %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to get interface identifier %s: borrow interface identifier from %s %s: got interface identifier from %s %s: got interface identifier from itself in6_ifattach_linklocalin6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) %s: no ifid available in6_ifattach_loopbackin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_nigroupin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattachin6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifdetach%s: didn't unlink in6ifaddr from list in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_mtudisc_callback_registerENOBUFS in icmp6_error %d icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ICMP6 checksum error(%d|%x) %s icmp6_notify_erroricmp6_notify_error: in6_embedscope failed icmp6_mtudisc_updateni6_inputicmp6_rip6_inputicmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d /usr/src/sys/netinet6/icmp6.csanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d (src=%s dst=%s tgt=%s)icmp6_redirect_inputICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_redirect_input: invalid ND option, rejected: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s icmp6_redirect_outputicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s ip6_savecontrolip6_nexthdrip6_nexthdr: m == NULLOpenBSD-currentcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_mrouter_doneadd_m6ifregister_mifdel_m6ifadd_m6fc: %s o %s g %s p %x dbx %p multiple kernel entriesdel_m6fcip6_mforwardip6_mforward: ip6_mrouter socket queue full ip6_mdqregister_sendip6_outputassumption failed: hdr not splitip6_setmoptionsip6_setpktoptionsip6_rthdr0nd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsduplicated ND6 option found (type=%d) too many loop in nd opt nd6_options: unsupported option %d - option ignored uninitialized ndopts in nd6_optionsln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_lookupunspecnd6_lookup: failed to lookup %s (if = %s) nd6_freend6_rtrequestnd6_rtrequest: bad gateway value: %s %s: failed to join %s (errno=%d) nd6_rtrequest: malloc failed nd6_ioctla router(%s) advertises a prefix with non-link local address default router list contains a non-linklocal address(%s) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) nd6_ns_inputnd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad NS target (multicast) nd6_ns_outputnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_na_inputnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: invalid ND option, ignored nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid target address %s nd6_na_outputnd6_na_output: source can't be determined: dst=%s, error=%d %s: starting DAD for %s nd6_dad_start: memory allocation failed for %s(%s) ???nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_timer: called with null parameter %s: DAD complete for %s - no duplicates found %s: could not run DAD, driver problem? nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: DAD structure not found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required nd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_ns_inputifa == NULL in nd6_dad_na_inputnd6_rs_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_rs_input: invalid ND option, ignored nd6_ra_inputnd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid ND option, ignored defrouter_addreqdefrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlinknd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_offlinknd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) nd6_prefix_offlink: %s/%d is already off-link in6_ifaddin6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_inputrip6_outputrip6_attachrip6_usrreqrip6_detachudp6_outputspsrr1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spFaulted in DDB; continuing... address %p is invalid address 0x%08lx not a valid page framedb_fetch_reg: botchbranch_taken: botch scp=0x%08x rlv=0x%08x ( rsp=0x%08x rfp=0x%08xBad frame pointer: %p Bad user frame pointer: %p %sr%d=0x%08xtrace: pid %d not found swapped out at %p frame address = %08x frame address must be specified spsr=%08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbusmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu%s, #0x%03x-imbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfrndsqtloglgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcund%s %08x %s%s#0x%08xp%d_f%d#%s[r%d]cpsr[%c - unknown]%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d, rrx, %s r%d, %s #%d{r%d-r%d}^[r%d#0x%02xf%d, c%d, No support for this CPU type (%08x) in kernelcpu.cachecpu.nocachesa110.cachesa110.icachesa110.dcachecpu.writebufcpu.nowritebufsa110.writebufUndefined instruction in kernel WARNING: not updating battery clock Warning IRQ's disabled during boot() real mem = %u (%uK) %uMB cpu_startup: system table size inconsistencycpu_startup: cannot allocate UVM space for buffersavail mem = %lu (%uK) using %d buffers containing %u bytes (%uK) of memory cpu_startup: not enough memory for buffer cachecpu_startup: no room for system tables; %d bytes required_bus_dmamap_load_raw: not implemented_bus_dmamap_sync: mix PRE and POSTunknown buffer type %d _bus_dmamap_sync_bus_dmamap_sync: ARM32_BUFTYPE_INVALID_bus_dmamap_sync: ARM32_BUFTYPE_RAW_bus_dmamem_map: size botch%s: SA-110 with bugged STM^ instruction rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM810ARM920TARM922TARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzunknownCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SARM10ECPU_ARM10SA-1CPU_SA110XScaleCPU_XSCALE_...wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15** IDC disabled IDC enabled WB disabled WB enabled LABT EABT%s: %dKB/%dB %d-way %s unified cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache branch prediction enabled DC disabled DC enabled IC disabled IC enabledunknown CPU (ID = 0x%x)%s %s (%s core)Processor failed probe - no CPU ID Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P) uvm_fault(%p, %lx, %x, 0) -> %x UVM: pid %d (%s), uid %d killed: out of swap Non-emulated page fault with intr_depth > 0 data_abort_fault: Misaligned Kernel-mode Program Counter kerneluserFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortInvalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x badaddr: invalid size (%lu)mmrwpmap_enter: no pv entriespmap_enter: failed to allocate L2 bucketprefetch_abort: page is already mapped - pte=%p *pte=%08x prefetch_abort: pc=%08lx proc=%p process=%s prefetch_abort: far=%08x fs=%x pmap_init_l1: can't get PA of L1 at %ppmapplpvepll2dtblpll2ptpplpmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: No L2 for L2 @ va %ppmap_alloc_specials: no l2b for 0x%lxCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_map_chunk: no L1 table provideduser pmap (%p): pmap_kernel (%p): domain %d, l1 at %p %08lx: %c |0000 |8000 |10000 |18000 |20000 |28000 |30000 |38000 pa 0x%08lx: krw %d kro %d urw %d uro %d %c va 0x%08lx, flags 0x%x dumpconf: bad dumpdev=0x%x dumping to dev %u,%u offset %ld dump device bad aborted from console i/o error device not ready succeeded area improper area unavailable dump to dev %u,%u not possible pagemove: size=%08lxvmapbufvunmapbufisaisaattach: can't map `delay port' irq %d drq %d drq2 %d/%d iomem 0x%x port 0x%xisascan>>> probing for %s%d succeeded >>> probing for %s%d failed >>> probing for %s%d >>> probe for %s* clone into %s%d %s: iosize not repaired by driver >>> probing for %s* finished >>> probing for %s* nonepulsededge-triggeredlevel-triggeredisa_intr_typename: invalid type %dcom_isa_attach: mapping failedkbc selftest: %x pckbc_attach: couldn't map%s: unable to establish interrupt for %s slot %s: using irq %d for %s slot : can't map i/o space %s: overriding IRQ %d to %d %s: warning: can't establish shutdown hook : can't map mem space lemac_isa_probefootbridgepci bus %d%s: Cannot map registers: DC21285 rev %d serrsdram_paritydata_paritymast_abttarg_abtparityfcom%s: Unrecognised IDfootbridge_intr: ctrl=%08x footbridge_intr: pcistat=%08x footbridge_alloc(): Help!footbridge_free(): Help!footbridge_pci_intr_map: out of range interruptpin %d line %d (%#x) pci_intr_map: no mapping for pin %c isairq %ldirq %ldfootbridge_pci_intr_string: bogus handle 0x%lxNo memoryfootbridge_intr_establish: IRQ %d out of rangestatclockhandler: Statclock overrun clock: hz %d stathz %d profhz %d clock%s: Cannot install timer 1 interrupt handlerstat%s: Cannot install timer 2 interrupt handler/usr/src/sys/arch/arm/arm/softintr.csoftnet_intrhand != NULLsoftintr_establish: unknown soft IPL %d: consoleserial_rx: can't establish soft interrupt%s: Cannot install rx interrupt handler%s: Cannot allocate rx buffer memoryfcomstartfcomcninit: mapping failedfcomcons_alloc(): Help!fcomcons_free(): Help!wd: <%s> %s: %d-sector PIO, LBA, %lluMB, %llu sectors %s: freeze lock command didn't complete wdattach%s: WARNING: unable to establish shutdown hook CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors LBA48, %lluMB, %llu sectors %s: IDENTIFY failed __wdstart: bad return code from wdc_ata_bio()wddone%s: soft error (corrected) , retrying device faultdevice timeoutST506/MFM/RLLESDI/IDE disk%s: %s wddumpwddump: try againwddump: device timed outwddump: unknown error typewddump: %swddump: drive faultwddump: DMA errorwddump: polled command has been queuedwd_get_params: bad return code from ata_get_paramsST506%s: flush cache command didn't complete %s: flush cache command: drive fault %s: flush cache command timeout wdc%s:%d:%d: not ready, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq %s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad statewdc_ata_ctrl_intr: state==RECALrecal%s:%d:%d: %s drive fault error (%x) %s:%d:%d: %s timed out piomodedmamodesetmultino media/write protectedinterface CRC erroraddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detected%s %serror not notifiedtodclockClock has gained %d day%c %ld hours %ld minutes %ld secs %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s off INFO: 0x%x (VALID flag %s) SKSV: %s FRU CODE: 0x%x ASC/ASCQ: %s COMMAND INFO: 0x%x %c Incorrect Length Indicator Set%c EOM Detected%c Filemark Detectedscxsplgetxscannot allocate scsi xs only the first 4,294,967,295 sectors will be used. scsicmdscsi_execute_xs: invalid return code (%#x)unknown error category (0x%x) from scsi driver scbusyprobe%s(%s:%d:%d): No Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorReservedNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedCD Control ErrorPower Calibration Area Almost FullPower Calibration Area Is FullPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullDEFERRED CDBParametersError in %s, Offset %d, bit %dProgress Indicator: %dActual Retry Count: %dASC 0x%02x ASCQ 0x%02xDiagnostic Failure on Component 0x%02xDecompression Exception Short Algorithm ID OF 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)host adapter code inconsistency unknown error category (0x%x) from host adapter code User command with no ioctl User command with no buf scistrcmdlen too big physio split the request.. cannot proceed DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2ALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14scsibusscsibus at %s: %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun linksscsi_probe_busPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669vendor-uniqueremovablefixed targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sscsibusprintdirectsequentialprinterprocessorwormcdromscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICE offlinescsibusprint: qualifier == SID_QUAL_BAD_LUscsibusprint: qualifier == SID_QUAL_RSVDNEC CD-ROM DRIVE:260cd%s: not queuedcdioctlATAPI CD-ROMSCSI CD-ROMdvd_authdvd_read_physicaldvd_read_copyrightdvd_read_bcasddrive offline%luMB, %lu cyl, %lu head, %lu sec, %lu bytes/sec, %lu sec total%s: not queued, error %d SCSI opticalSCSI disksdgetdisklabel%s: WARNING: cache synchronization failed TDC 3800 ARCHIVE VIPER 2525 25462SANKYO CP525 ANRITSU DMT780 VIPER 150 21247VIPER 150 21531WANGTEK 5099ES SCSI5150ES SCSI5525ES SCSI REV7EXABYTE EXB-8200 263HHP T4000s TANDBERG TDC 3600 ????TEAC MT-2ST/N50 rogue, %s: %sdensity code 0x%x, drive empty or not ready %d-byteprotected blocks, write-%s variable%s: cannot set selected mode %s: bad request, must be multiple of %d %s: bad request, must be between %d and %d %s: not queued %s: block wrong size, %d blocks residual %s: bad residual %d out of %d %s: %d-byte record too big atapiscsiwdc_atapi_start: not ready, st = %02x wdc_atapi_intr_command%s:%d:%d: device timeout waiting to send SCSI packet unexpected data phasezero length transfer requested in data phasedata transfer direction disagreementdata phase where none expecteddata transfer direction disagreement during senseunexpectedly in command phasewdc_atapi_intr: warning: device requesting %d bytes, only %d left in buffer wdc_atapi_intr: warning: reading only %d of %d bytes atapiscsi: Shouldn't get here %s:%d:%d: device timeout, c_bcount=%d, c_skip=%d, status=0x%b, ireason=0x%x Device Reset WaitIdentifyPost-IdentifyPIOMODEunknown state%s:%d:%d: soft reset failed use one of: %s[a-p]parsediskboot_file: '%s' rootconf: device name too longboot device: %s. root device (default %s%c)swap device can't figure root, hope your kernel is right rootconfroot on %s%c boot device not knownboot device: lookup '%s' failed. rebooting... The operating system has halted. Please press any key to reboot. OpenBSD/cats booting ... Incompatible magic number passed in boot args(hd0)wd0diagcan't init serial console @%xinvalid geometrydos partition I/O errordisk label I/O errorno disk labeldisk label corruptedisa_alloc(): Help!isa_free(): Help!stray interrupt %d%s ; stopped loggingintr_alloc: bogus typeintr_establish: bogus irq or typeintr_establish: can't share %s with %sintr_disestablish: bogus irqisa_irqdispatch: %x dsrtc: cannot map I/O space : lithium cell is dead, RTC unreliablemii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_phy_setmedia: MASTER on wrong mediamiiautnsphyDP83840 10/100 PHY: %s, rev. %d qsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYexphy: 3Com internal media interface %s: ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYukphy: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present dev %d function %dpciprintpci_io_find: bad requestpci_mem_find: bad requestpci_mem_find: bad 64-bit requestmiscellaneousSCSIfloppyIPIethernettoken ringFDDIWorldFipPCMIG Multi ComputingXGAvideoaudiotelephonyflashhostMicroChannelNuBusRACEwaySemi-transparent PCIInfiniBandparallelmulti-port serialmodemGPIBsmartcard8237 DMA8254 timerRTCPCI Hot-Plugdigitizergame portgeneric386486PentiumAlphaPowerPCMIPSCo-processorFirewireACCESS.busSSAFiber ChannelIPMISERCOSCANbusIrDAConsumer IRRFbluetoothbroadband802.11a (5 GHz)802.11b (2.4 GHz)standardvoicedatanetwork/computingentertainmentDPIOTime and Frequencysynchronizationmanagementprehistoricmass storagenetworkdisplaymultimediacommunicationssystemdockserial buswirelessI2Osatellite commcryptoDASPundefinedOZ6729 CardBusOZ6730 CardBusOZ6922 CardBusOZ6832 CardBusOZ6836/OZ6860 CardBusOZ68[17]2 CardBusOZ6933 CardBusOZ69[17]2 CardBusOZ711Mx CardBusOZ711M1 CardBusOZ711E0 CardBus3c9853c9963CRDAG675 (Atheros AR5212)3CRPAG175 (Atheros AR5212)V.90 Modem3c9403c3393c3593c4503c555 100Base-TX3c5753CCFE575BT3CCFE575CT3c590 10Mbps3c595 100Base-TX3c595 100Base-T43c595 10Mbps-MII3CRSHPW796 802.11b3CRWE154G72 802.11g3c556 100Base-TX3c556B 100Base-TX3CCFEM6563CCFEM656B3CCFEM656C56k Global Modem3cSOHO-TX3crwe777a AirConnect3c940B3c900 10Base-T3c900 10Mbps-Combo3c900B 10Mbps3c900B 10Mbps-Combo3c900B 10Mbps-TPC3c900B 10Mbps-FL3c905 100Base-TX3c905 100Base-T43c905B 100Base-TX3c905B 100Base-T43c905B 10/100Mbps-Combo3c905B 100Base-FX3c905C 100Base-TX3c9201 100Base-TX3c920B-EMB-WNM3cSOHO 100B-TX3c980 100Base-TX3c980C 100Base-TX3cr9903cr990-TX3cr990-TX-953cr990-TX-973c990b-TX-M3cr990-FX3cr990SVR953cr990SVR973c990BSVRVoodooVoodoo2BansheeVoodoo3Voodoo5300SX500TXDeltaPermedia500MXPermedia 2Oxygen GVX1Permedia 3Escalade IDE RAIDFE2500 10/100PCM200 10/100FE2000VX 10/100FE2500MX 10/100PC4800 WirelessPCI35x WLANPC4500 WirelessMPI-350 WirelessACCM 2188 VL-PCI2051 PCI2051 ISAATP850U/UFATP860ATP860-AATP865-AATP865-RAEC6710AEC6712UWAEC6712UAEC6712SAEC6710DAEC6715UWMPX 5030/5038EN2242EN1217RhineIIrtl8139AWA-100M1435 VL-PCIM1445 VL-PCIM1449 ISAM1451 PCIM1461 PCIM1489 PCIM1511 PCIM1513 ISAM1523 PCIM1523 ISAM1531 PCIM1533 ISAM1535 PCIM1541 PCIM1543 ISAM1563 ISAM1621 PCIM1631 PCIM1644 PCIM1647 PCIM1689 PCIM1695 PCIM3309 MPEGM4803M5219 UDMA IDEM5229 UDMA IDEM5237 USBM5239 USB2M5243 AGP/PCI-PCIM5246 AGPM5247 AGP/PCI-PCM5249 PCI-PCIM524B PCIEM524C PCIEM524D PCIEM5263 LANM5281 SATAM5287 SATAM5289 SATAM5451 AudioM5455 AudioM5457 ModemM7101 PowerAL981AN983AN985ADM8211 WLANAIC-7810AHA-2940AU/CNAHA-2930CUAIC-7850AIC-7855AIC-5900 ATMAIC-5905 ATMAPA-1480AIC-7860AHA-2940AUAIC-7870AHA-2940AHA-3940AHA-3985AHA-2944AIC-7880AHA-2940UAHA-3940UAHA-398XUAHA-2944UAHA-2940UWProAIC-6915AIC-7895AHA-2940U2 U2AHA-2930U2 U2AAA-131U2 U2AIC-7890/1 U2AIC-7892 U160AHA-29160 U160AHA-19160B U160AHA-3950U2B U2AHA-3950U2D U2AIC-7896/7 U2AHA-3960D U160AIC-7899BAIC-7899DAIC-7899FAIC-7899 U160ServeRAIDAAC-2622ASR-2200SASR-2120SAAC-364AAC-3642Dell PERC 2/QCAIC-7901 U320AHA-29320A U320AHA-29320LP U320AIC-7901A U320AHA-29320 U320AHA-29320B U320AIC-7902 U320AIC-7902B U320AHA-39320 U320AHA-39320B U320AHA-39320A U320AHA-39320D U320AHA-39320DB U3201200A1200BABP-930/40UAABP-940UWASP-3940U2WASP-3940U3WWaikato Dag3.2Endace Dag3.5Endace Dag4.22GEEndace Dag4.23AT22AT24AcenicAcenic CopperBCM5700BCM5701AC1000AC1001AC9100AMD64 HyperTransportAMD64 Address MapAMD64 DRAM CfgAMD64 Misc Cfg79c970 PCnet-PCI79c978 PChome-PCI53c974 PCscsi-PCI79C974 PCnet-PCIElanSC520 PCI751 System751 PCI-PCI762 PCI762 PCI-PCI761 PCI761 PCI-PCI755 ISA755 IDE755 Power755 USB756 ISA756 IDE756 Power756 USB Host766 ISA766 IDE766 USB766 Power766 USB OpenHCI768 ISA768 IDE768 Power768 AC97768 Modem768 PCI-PCI768 USB8131 PCIX8131 PCIX IOAPIC8151 Sys Control8151 AGP8132 PCIX8132 PCIX IOAPIC8111 PCI-PCI8111 USBAMD8111 LPC8111 IDE8111 SMBus8111 Power8111 AC97MegaRAIDMegaRAID Series 428MegaRAID Series 434ADSP 21535 DSPAD1889 AudioSafeNet ADSP 2141TC9021BanditGCOHareHeathrowPaddingtonUni-N EthUni-NUni-N Eth FirewireUni-N AGPUni-N GMACKeylargoPangea GMACPangea MacioPangea USBPangea AGPPangeaPangea PCIUni-N2 AGPUni-N2 HostPangea FireWireUniNorth FirewireUni-N2 GMACUni-N ATAUniNorth AGPUniNorth PCIIntrepid ATAIntrepidIntrepid USBK2 USBK2 MacioK2 FirewireK2 ATAU3 PCI-PCIU3 AGPK2 GMACShastaShasta ATAShasta GMACShasta FirewireShasta PCIShasta HyperTransportK2U3L AGPK2 AGPARS106SARS0303D1000PV2000PV2000MT2000MIAX88140A/88141Radeon Mobility X600FireGL V3200Radeon X600 (RV380)Radeon X600 (RV380) SecRadeon 9600 ProRadeon 9600 LERadeon 9600 XTRadeon 9550Mach32Radeon 9600 Pro SecRadeon 9600 LE SecRadeon 9600 XT SecRadeon 9550 SecRadeon 8500 BBRadeon IGP 320MMobility M6IXP200 AC97SB200 PCI-PCISB200 USB2SB200 USBIXP200 IDESB200 PCI-ISAIXP200 ModemSB200 SMBusMach64 CTMach64 CXIXP300 AC97IXP300 SMBusIXP300 IDEIXP400 AC97IXP400 PCIIXP400 SMBusIXP400 USB2IXP400 USBIXP400 ISAIXP400 IDEIXP400 ModemIXP400 SATAMach64 ETRage ProMach64 GDMach64 GIMach64 GLMach64 GMMach64 GNMach64 GOMach64 GPMach64 GQRage XLMach64 GSMach64 GTMach64 GUMach64 GVMach64 GWMach64 GXMach64 GYMach64 GZRadeon 9000Radeon 9000 SecMach64 LBMach64 LDRage128 LEMobility M3Mach64 LGMach64 LIMobility 1Mach64 LNMach64 LPMach64 LQRage P/MMach64 LSRadeon Mobility M7 LWRadeon Mobility M6 LYRadeon Mobility M6 LZRadeon Mobility M9 LfRage 128 Mobility MFRage 128 Mobility MLRadeon 9500/9700Radeon 9500 ProRadeon 9800 XTRadeon 9800 ProRadeon Mobility M10 NPRadeon 9500/9700 SecRadeon 9800 Pro SecRage 128 Pro PDRage FuryRage 128 PKAIW RadeonRadeon QERadeon QFRadeon QGRadeon 8500 QLRadeon 9100 QMRadeon 8500 QNRadeon 8500 QORadeon 7500 QWRadeon VE QYRadeon VE QZES1000Radeon 8500 QlRage 128 GLRage MagnumRage 128 RGRage 128 RKRage 128 VRRage 128 SHRage 128 SKRage 128 SLRage 128 SMRage 128Rage 128 Pro TFRage 128 Pro TLRage 128 Pro TRRadeon Mobility M300 M22Radeon Mobility X700 M26Mach64 VTMach64 VUMach64 VVRS300 HostRadeon IGP 9100 HostRadeon Mobility IGP 9100Radeon IGP 9100 AGPRadeon 9200 PRO SecRadeon 9200 SecRS480 HostRX480 HostRadeon XPRESS 200Radeon XPRESS 200MRadeon 9200 PRORadeon 9200Radeon 9200 SE SecRX480 PCIERS480 PCIERadeon X300Radeon X600 (RV370)FireGL V3100Radeon X300 SecRadeon X600 (RV370) SecFireGL V3100 SecRadeon Mobility 9200Radeon Mobility 9200 (M9+)Radeon 9200 SERadeon X800 GTORadeon X800 GTO SecRS100 PCIRS200 PCIRS100 AGPRS200 AGPS5933 PCI MatchmakerMyrinet LANaiAR5210AR5211AR5212AR5210 (Early)AR5212 (IBM MiniPCI)AR5210 (no eeprom)AR5212 (no eeprom)AR5211 (no eeprom)AR5212 (emulation board)AR5211RefIDE-2015PLVortex 1Vortex 2Vortex AdvantageAVL2301AVG2302ALG2301ALG2302ALS4000LP-PCI 4 SerialBRI ISDNFritz ISDNFritz v2.0 ISDNPRI T1 ISDNF5D6001F5D6020V3F5D6000VME 617VME 270655015601BCM5752BCM5752MBCM5702BCM5703BCM5704CBCM5704S_ALTBCM5706BCM5708BCM5702FEBCM5705BCM5705KBCM5720BCM5721BCM5705MBCM5705M_ALTBCM5714BCM5714SBCM5780BCM5780SBCM5705FBCM5750BCM5751BCM5715BCM5715SBCM5750MBCM5751MBCM5751FBCM5782BCM5788BCM5789BCM5702XBCM5703XBCM5704SBCM5706SBCM5708SBCM5702_ALTBCM5703_ALTBCM5781BCM5753BCM5753MBCM5753FBCM5903MBCM4401B0BCM5901BCM5901A2BCM4318BCM4306BCM4322BCM4309BCM44015801580258055820582158225823BT848BT849BT878BT879BT878 AudioBT879 AudioBt8474 HDLCMultiMaster NCMultiMasterFlashPointGPPCINitrox XLCinemasterNx10 10GbE643106554565548655506555465555685546900069030CL-GD7548CL-GD5430CL-GD5434-4CL-GD5434-8CL-GD5436CL-GD5446CL-GD5480CL-GD5462CL-GD5464CL-GD5465CL-PD6729CL-PD6832 CardBusCL-PD6833 CardBusCL-GD7542CL-GD7543CL-GD7541CS4610 SoundFusionCS4615CS4280/46xx CrystalClearCS4281 CrystalClearAAR-1210SAPCI0640PCI0642PCI0643PCI0646PCI0647PCI0648PCI0649PCI0650AUSB0670USB0673PCI0680SiI3112 SATASiI3114 SATASiI3124 SATASiI3132 SATASiI3512 SATAGigaCardEX110TXTriflex PCIQVisionQVision 1280/pSmart Array 5300Smart Array 5iSmart Array 532Smart Array 5312Smart Array 6iSmart Array 641Smart Array 642Smart Array 6400Smart Array 6400 EMSmart Array 6422Smart Array 64xxNetelligent ASMCPCI HotplugUSB OpenHostSMART2P RAIDISAPnPNetelligent 10/100TXNetelligent IDENetelligent 10 TIntegrated NetFlex 3/PDP Netelligent 10/100TXProLiant Netelligent 10/100TXEmbedded Netelligent 10/100TXNetelligent 10 T/2 PCISmart Array 5300 rev.2Smart Array 5i/532 rev.2iLONetFlex 3/PNetFlex 3/PBCompexeRL100-ATX 10/100PMAC 9871356k WinmodemSoftK56 PCIHSF 56k HSFiMUSYCC CN8478MUSYCC CN8474MUSYCC CN8472MUSYCC CN847182C599 VLBCY82C693U ISAFEther CB-TXD 10/100FEther II CB-TXD 10/100CG-LAPCIGTC-Bus II-PCISoundBlaster LiveSoundBlaster AWE64DSoundBlaster AudigySoundBlaster Live (Dell)SoundBlaster Audigy LSSoundBlaster Audigy 2PCI Gameport JoystickSoundBlaster Audigy DigitalEctiva 1938Cyclom-Y below 1MCyclom-YCyclom-4Y below 1MCyclom-4YCyclom-8Y below 1MCyclom-8YCyclom-Z below 1MCyclom-ZIQ80310Cx5510GXm PCIGXm ISACx5530 SouthCx5530 SMICx5530 IDECx5530 XpressAUDIOCx5530 VideoDM9009DM9100DM9102DM913221050 PCI-PCI2104021030Zephyr NV-RAMKZPSA21140TGA2DEFPA21041DGLPB (OPPO)ZLXP-L2 (Pixelvision)21142/3Farallon PN9000SX21052 PCI-PCI21150 PCI-PCI21150-BC PCI-PCI21152 PCI-PCI21153 PCI-PCI21154 PCI-PCICompaq SMART RAID 42xxSWXCR RAIDPERC 2/SiPERC 3/DiPERC 3/SiRAC 3 Add-inRAC 3 Embedded/OptionalRAC 3 OptionalPERC 4/Di i960PERC 4/Di VerdeRAC 4RAC 4 Virtual UARTPERC 4e/DiRAC 4 SMIC8139Viper/PCI550TX530TX+DFE-690TXDDWL-610DGE-550TDGE-528TDGE-560TDGE-560T_2DGE-530TMemory ControlSmartCache/RaidSmartRAID (I2O)SmartRAID 2005SPCI-SCIDMX3194UIS64PH ISDN155P-MF1 ATM (FPGA)155P-MF1 ATM (ASIC)25SS-3010 ATM (ASIC)SpeedStream 1023QuickStep 1000 ISDNLight Pulse FibreChannelLight Pulse 8000Endace Dag3.6DEndace Dag4.23GECB-1211 CardBusCB-1225 CardBusCB-1410 CardBusCB-710 CardBusCB-712 CardBusCB-1420 CardBusCB-720 CardBusCB-722 CardBusAudioPCI97AudioPCICT5880ES366H ModemMaestro IISOLO-1 AudioDriveMaestro 2EES1989ES1989 ModemMaestro 3ES1983 ModemMaestro 3 AudioES366H Fax/ModemES2838/2839 SuperLink ModemES2898 ModemRoadRunner HIPPIRoadRunner Gig-EFreedom GBusWL11000PATM PCA-200ATM PCA-200e801 SoundTMC-18C30 (36C70)GL24110P03GL24110PGL24110P02PR103WinTVPN672TX 10/100Visualize EGVisualize FX6Visualize FX4Visualize FX2Tach TL FibreChannelTach XL2 FibreChannelJ2585AJ2585BDiva Serial MultiportElroy Ropes-PCIVisualize FXeTopTools Communications PortNetRaid-4MNetServer SmartIRQ82557B 10/100 NICPluto MIOzx1 IOCMercury Ropes-PCIQuickSilver Ropes-PCISmart Array V100Smart Array E200iSmart Array E200Smart ArraySmart Array P800Smart Array P600Smart Array P400Smart Array P400i77516500781179517814/7851/785480658165815479567955/7954MCACPU - Alta LiteCPU - Alta MPISA w/PnPCPUAuto LANStreamerGXT-150P82G267582351 PCI-PCIMiami/PCIOlympici82557B 10/100FireGL2PCIX-PCIXEnvy24 I/O CtrlrEnvy24PT/HT Audio77201/77211 ATM (NICStAR)WDT 50x Watchdog TimerINIC-850 (A100UW)INIC-1060 (A100U2W)INIC-940INIC-941INIC-950IPN2120IPN22208849EES ISA2114580303 IOP80312 I/O CompanionPCIE-PCIEIOP331 Channel 0IOP331 Channel 141210 PCIE-PCIX82375EB EISA82424ZX Cache/DRAM82378IB ISA82426EX ISA82434LX/NX PCI/Cache/DRAMGDT RAIDi960 RP PCI-PCIi960 RM PCI-PCIi960 RN PCI-PCIPRO/1000 (82542)PRO/1000F (82543GC)PRO/1000T (82543GC)PRO/1000XT (82544EI)PRO/1000XF (82544EI)PRO/1000T (82544GC)PRO/1000XT (82544GC)PRO/1000MT (82540EM)PRO/1000MT (82545EM)PRO/1000MT (82546EB)PRO/1000MF (82545EM)PRO/1000MF (82546EB)PRO/1000MT (82541EI)PRO/1000MT (82540EP)PRO/1000MT Mobile (82541EI)PRO/1000CT (82547EI)PRO/1000CT Mobile (82547EI)PRO/1000MT QP (82546EB)PRO/1000MT (82545GM)PRO/1000MF (82545GM)PRO/10082559PRO/100 VEPRO/100 VM82562EH HomePNA82801DB LANV.92 ModemPRO/Wireless 2100PRO/10GbE LR (82597EX)PRO/100 MPRO/1000 PT (82571EB)PRO/1000 PF (82571EB)PRO/1000 PB (82571EB)82801FB LAN82801FBM LAN82801GB LANPRO/1000CT (82547GI)PRO/1000MT (82541GI)PRO/1000MT Mobile (82541GI)PRO/1000MT (82541ER)PRO/1000MT (82546GB)PRO/1000MF (82546GB)PRO/1000GT (82541GI)PRO/1000 PT (82572EI)PRO/1000 PF (82572EI)PRO/1000 PB (82572EI)PRO/1000MT (82573E)PRO/1000MT (82573L)PRO/10GbE CX4 (82597EX)PRO/1000MT QP (82546GB)82815 Hub82815 AGP82815 Graphics82806AA APIC82559ER82092AA IDESAA7116EE Pro 10 PCIEE Pro 100EE Pro 100 Smart8255x82437FX82371FB ISA82371FB IDE82371 ISA and IDE82437 PCI/Cache/DRAM82441FX82380AB Mobile ISA82380FB Mobile PCI-PCI82439HX82806AA82870P2 PCI-PCI82870P2 IOxAPIC82870P2 Hot Plug80960RP ATU82840 Host82840 AGP82840 PCI82845 Host82845 AGPPRO/10GbE SR (82597EX)82801AA LPC82801AA IDE82801AA USB82801AA SMBus82801AA AC9782801AA Modem82801AA Hub-to-PCI82801AB LPC82801AB IDE82801AB USB82801AB SMBus82801AB AC9782801AB Modem82801AB Hub-to-PCI82801BA LPC82801BA USB82801BA SMBus82801BA AC9782801BA Modem82801BAM Hub-to-PCI8256282801BAM IDE82801BA IDE82801BAM LPC82801BA AGP82801E LPC82801E USB82801E SMBus82801E LAN82801CA LPC82801CA/CAM USB82801CA/CAM SMBus82801CA/CAM AC9782801CA/CAM Modem82801CAM IDE82801CA IDE82801CAM LPC82801DB LPC82801DBL IDE82801DB USB82801DB SMBus82801DB AC9782801DB Modem82801DBM IDE82801DB IDE82801DBM LPC82801EB/ER LPC82801EB SATA82801EB/ER USB82801EB/ER SMBus82801EB/ER AC9782801EB/ER Modem82801EB/ER IDE82801EB/ER USB282801ER SATA82820 MCH82820 AGP82850 Host82860 Host82850/82860 AGP82860 PCI-PCIE7500 MCH HostE7500 DRAME7500 MCHE7501 MCH HostE7505 MCH HostE7505 MCH RASE7505 MCH AGPE7505 MCH PCI-PCI82845G/GL82845G/GL/GV/GE/PE AGP82845G/GL Video82865G/PE/P CPU-I/0-182865G/PE/P CPU-AGP82865G Video82865G/PE/P CPU-CSA82865G/PE/P CPU-I/0-282875P Host82875P AGP82875P PCI-CSA82915G/P/GV Host82915G/P/GV PCIE82915G/P/GV Video82925X MCH Host82925X PCIEE7221 MCH HostE7221 PCIEE7221 Video82915GM/PM/GMS Host82915PM/GM PCIE82915GM/GMS Video6300ESB LPC6300ESB IDE6300ESB SATA6300ESB SMBus6300ESB AC976300ESB Modem6300ESB USB5300ESB USB6300ESB WDT6300ESB APIC6300ESB PCIXE8500 HostE8500 PCIEE8500 PCIE x8E8500 IMIE8500 FSB/Boot/InterruptE8500 Address MappingE8500 RASE8500 MiscE8500 ReservedE8500 XMBE8500 XMB MiscE8500 XMB MAIE8500 XMB DDRE8500 XMB Reserved82801FB LPC82801FBM LPC82801FB SATA82801FR SATA82801FBM SATA82801FB USB82801FB PCIE82801FB HD Audio82801FB SMBus82801FB Modem82801FB AC9782801FB IDE82945GP82945GP PCIE82945G Video82955X MCH82955X PCIEE7230 MCHE7230 PCIE82915G Video82801GH LPC82801GB LPC82801GBM LPC82801GHM LPC82801GB SATA82801GB AHCI SATA82801GB USB82801GB PCIE82801GB HD Audio82801GB SMBus82801GB Modem82801GB AC9782801GB IDE82801G PCIERCU32 I2O RAID31244 SATA82855PE Hub82855PE AGP82830MP CPU-I/O-182830MP CPU-AGP82830MP Integrated Video82830MP CPU-I/O-282852GM Hub-PCI82852/82855 AGP82852GM AGP82852GM Memory82852GM ConfigurationE7520 MCHE7520 MCH ERRE7320 MCHE7525 MCH ERRE7520 MCH DMAMCH PCIEE7525 MCH ConfigurationE7525 MCHPRO/Wireless 2200BGPRO/Wireless 2225BGPRO/Wireless 3945ABGPRO/Wireless 2915ABGi960 RD PCI-PCIPRO 100 Server82371SB ISA82371SB IDE82371SB USB82437VX82439TX System82371AB PIIX4 ISA82371AB IDE82371AB USB82371AB Power8281082810 Graphics82810-DC10082810-DC100 Graphics82810E82810E Graphics82443LX AGP82443BX AGP82443BX82440MX Host82440MX AC9782440MX Modem82440MX ISA82440MX IDE82440MX USB82440MX Power82440BX AGP82443GX82372FB IDE82740 AGP82450KX/GX82450KX/GX Memory82451NX Mem & IO82454NX PXB82802AC Firmware Hub 8Mbit82802AB Firmware Hub 4MbitI2O RAID PCI-PCIRCU21 I2O RAIDRCUxx I2O RAIDRCU31 I2O RAIDRCU31L I2O RAIDS21152BB PCI-PCIS21154AE/BE PCI-PCIPowerstorm 4D50TIntense 3DExpert3D5526 FibreChannelPRISM3PRISM2.5Prism IndigoPrism Javelin/XbowPrism GT/DuetteAEONGV-BCTV3AGX016ITT3204 MPEG DecoderIT8211FIT8212FIT8330GJMB360 SATA IIKTIHSSIDS3SSIDS1HSSIcAppian LiteDual SerialQuad SerialParallelDual ParallelDual Parallel BS3 805Leadtek WinFast TV 2000LXT1001EG1032EG1064PCMPC200PCM200PNICPNIC-II8031K56flex DSVD LTMODEMLTMODEMVenus ModemUSB 2-portUSB QuadraBusFW322 1394LS242 DVD DecoderPMAC 98715PMAC 98727MX86250Smart 16/4 PCI RingnodeSmart 16/4 PCI Ringnode Mk2Smart 16/4 PCI Ringnode Mk3Smart 16/4 PCI Ringnode Mk116/4 CardbusPresto PCISmart 100/16/4 PCI-HS RingnodeSmart 100/16/4 PCI Ringnode16/4 CardBus Mk2Collage 25 ATMCollage 155 ATMi740 PCILibertas 88W8300Libertas 88W8310Libertas 88W8335Yukon 88E8001/8003/8010Yukon-II 88E8021CUYukon-II 88E8022CUYukon-II 88E8061CUYukon-II 88E8062CUYukon-II 88E8021XYukon-II 88E8022XYukon-II 88E8061XYukon-II 88E8062XYukon 88E8035Yukon 88E8036Yukon 88E8038Yukon 88E8052Yukon 88E8050Yukon 88E8053YukonYukon (Belkin F5D5005)88SX5040 SATA88SX5041 SATA88SX5080 SATA88SX5081 SATA88SX6041 SATAMGA PX2085 (Atlas)MGA Millenium 2064W (Storm)MGA 1064SG 220MHzMGA Millennium II 2164WMGA Millennium II 2164WA-B AGPMGA G200 PCIMGA G200 AGPMGA G400/G450 AGPMGA ImpressionMGA G100 PCIMGA G100 AGPMGA 1064SGMGA G400 Twin HeadMGA G550 AGPMGA Millennium G200 SDMGA Produktiva G100 SDMGA Mystique G200 SDMGA Millennium G200 SGMGA Marvel G200 SDMN-120 10/100MN-130 10/100Powerstorm 4D30TGUI AccelMPC105 PCIMPC106 PCISM56Raven PCICP-114C104HCP-104ULC168HDMA4 serialDAC960P V2 RAIDDAC960P V3 RAIDDAC960P V4 RAIDDAC960P V5 RAIDAcceleRAIDeXtremeRAIDMyrinet LANai 9.2MTD800 10/100MTD803 10/100MTD891 10/100/1000MV1000NCP130NCP130 Rev A2DP83810 10/100PC87415 IDE87560 Legacy I/ODP83815 10/100DP83820 10/100/1000CS5535 HostCS5535 ISACS5535 IDECS5535 AUDIOCS5535 USBCS5535 VIDEOSaturnSCx200 ISASCx200 SMISCx200 IDESCx200 AUDIOSCx200 VIDEOSCx200 X-BUSSC1100 ISASC1100 SMISC1100 X-BusNS87410PowerVR PCX2I/OVersa MaestroVersa Va26D MaestroMagicgraph NM2070Magicgraph 128VMagicgraph 128ZVMagicgraph NM2160Magicgraph NM2200Magicgraph NM2360MagicMedia 256AV+MagicMedia 256XL+MagicMedia 256AVMagicMedia 256ZXXframe 10GbEMA301GA620GA620T1P2S1P4SCMI8338A AudioCMI8338B AudioCMI8738/C3DX AudioCMI8738B AudioHSP56 AMRNSP2KNetVin 5000Universe VME53c81053c82053c82553c81553c810AP53c86053c1510D53c89653c89553c88553c87553c151053c895A53c1010-3353c1010-6653c1030SAS1064SAS1068SAS1064ESAS1068ESAS1066ESAS1064ASAS1066SAS107853c875JMegaRAID 320MegaRAID 320-2EMegaRAID SATA 4x/8xFC909FC909AFC929FC919FC929XFC919XFC949XFC939XYellowFin61C10263C815Packet Engines G-NICFNW-3603-TX 10/100FNW-3800-TX 10/100NX82C501 PCINDR4600 PCIBS21 10/100E-mobility WirelessImagine-128Imagine-128 IIImagine-128 T2RImagine-128 T2R4NV1DAC64Riva TNTRiva TNT2Riva TNT2 UltraVantaMCP04 SMBusMCP04 IDEMCP04 SATAMCP04 LANnForce4 ISAnForce4 SMBusnForce4 IDEnForce4 SATA 1nForce4 SATA 2CK804 LANnForce4 AC97nForce4 USBnForce4 PCI-PCInForce4 PCIEnForce4 DDRnForce2 ISAnForce2 SMBusnForce2 IDEnForce2 LANnForce2 USBnForce2 AC97nForce2 AudionForce2 PCI-PCInForce2 FireWirenForce2 400 ISAnForce2 400 SMBusnForce2 400 IDEnForce3 LANnForce2 400 USBnForce2 400 USB2nForce2 400 AC97nForce2 400 PCI-PCInForce2 400 SATAAladdin TNT2GeForce Go 6800GeForce Go 6800 UltraQuadro FX Go1400Quadro FX 1400nForce3 ISAnForce3 PCI HostnForce3 PCI-PCInForce3 SMBusnForce3 IDEnForce3 USBnForce3 ModemnForce3 AC97nForce3 250 ISAnForce3 250 PCI HostnForce3 250 AGPnForce3 250 SATAnForce3 250 SMBusnForce3 250 IDEnForce3 250 USBnForce3 250 USB2nForce3 250 AC97nForce3 250 PCI-PCIGeForce 6600 GT AGPQuadro FX 330GeForce256GeForce256 DDRQuadroGeForce2 MXGeForce2 MX 100GeForce2 GoQuadro2 MXRGeForce 6600 GTGeForce 6600GeForce 6600 GoGeForce2 GTSGeForce2 TiGeForce2 UltraQuadro2 ProQuadro NVS 285GeForce4 MX 460GeForce4 MX 440GeForce4 MX 420GeForce4 440 GoGeForce4 420 GoGeForce4 420 Go 32MQuadro4 500XGLGeForce4 440 Go 64MQuadro4 200/400NVSQuadro4 550XGLQuadro4 GoGLGeForce4 MX 440 AGPGeForce4 MX 440SE AGPGeForce 4 MX 420 AGPGeForce4 MX 4000Quadro4 580 XGLQuadro4 NVSQuadro4 380 XGLGeForce2 Crush11nForce PCI HostnForce 220 DDRnForce 420 DDRnForce 220/420nForce APUnForce AC97nForce ISAnForce SMBusnForce AGPnForce PCI-PCInForce IDEnForce USBnForce LANnForce2 PCInForce2 AGPnForce2GeForce4 MX nForce GPUGeForce3GeForce3 Ti 200GeForce3 Ti 500Quadro DCCGeForce 6150GeForce 6150 LEGeForce 6100GeForce4 Ti 4600GeForce4 Ti 4400GeForce4 Ti 4200Quadro4 900 XGLQuadro4 750 XGLQuadro4 700 XGLMCP51 ISAMCP51 SMBusMCP51 IDEMCP51 SATAMCP51 LANMCP51 HD AudioMCP51 USBMCP51 PCI-PCIMCP51 HostMCP51 MemoryC51 MemoryGeForce4 Ti 4200 GoC51 HostC51 PCIEGeForce FX 5800 UltraGeForce FX 5800GeForce FX 5600 UltraGeForce FX 5600GeForce FX Go 5600GeForce FX Go 5650GeForce FX 5200 UltraGeForce FX 5200GeForce FX Go 5200GeForce FX 5500GeForce FX 5100Quadro FX 500/600GeForce FX Go 5300GeForce FX Go 5100GeForce FX 5900 UltraGeForce FX 5900GeForce FX 5950 UltraGeForce FX 5700LEGeForce FX Go 5700MCP55 SMBusMCP55 IDEMCP55 LANMCP55 SATAOTI107OC2325OC2183OC232682C092G82C557 Host82C558 ISA82C568 IDE82D568 IDE82C621 IDE82C70082C70182C82282C861010L100L110L200L210L400L800Lx10H100H200H200HV2400H/800H800H011HExsys EX-41098OX16PCI952OX16PCI952 ParallelOX16PCI954OX16PCI954 ParallelQStor SATAPMC/GNIC2RZ1000HSP MicroModem 56CMIC-LECNB20-LE HostCNB20HE HostCNB20LE HostCIOB30CMIC-HECMIC-WS Host (GC-LE)CNB20-HE HostCNB20-HE Host (GC-LE)CMIC-GC HostGCNB-LE HostHT-1000 PCICIOB-X2 PCIXPCIE-PCIXHT-1000 PCIXCIOB-EHT-2000 PCIXHT-2000 PCIEOSB4CSB5CSB6HT-1000OSB4 IDECSB5 IDECSB6 RAID/IDEHT-1000 IDECSB6 IDEOSB4/CSB5 USBCSB6 USBHT-1000 USBCSB5 LPCGCLE-2 HostHT-1000 LPCK2 SATAFrodo4 SATAFrodo8 SATAHT-1000 SATAVerite 1000Verite V2x00SAA7130 TVSAA7133 TVSAA7134 TVSAA7135 TVPT80C826PT86C521PT86C523PC87550PT86C523_2PCC-ISESES1849I/O 1076I/O 1077I/O 9050I/O 9080PDC20265PDC20263PDC20275PDC20318PDC20319PDC20371PDC20379PDC20378PDC20375PDC20376PDC20377PDC40719PDC20571PDC20579PDC40718PDC20575PDC20267PDC20246PDC20262PDC20268PDC20269PDC20276DC5030PDC20268RPDC20271PDC20617PDC20620PDC20621PDC20618PDC20619PDC20277ISP10160ISP1020ISP1022ISP1080ISP12160ISP1240ISP1280ISP2100ISP2200ISP2300ISP2312ISP631285008580RT2460ART2560RT2561SRT2561RT26618029812981388169818081855C465 CardBus5C466 CardBus5C475 CardBus5C476 CardBus5C477 CardBus5C478 CardBus5C521 Firewire5C551 Firewire5C552 FirewireRS56/SP-PCI11P1 ModemViRGETrio32Trio32/64Aurora64V+Trio64UV+868ViRGE VX86C92886C864-086C864-186C864-286C864-386C964-086C964-186C964-286C964-386C968-086C968-186C968-286C968-3Trio64V2/DXPlatoTrio3D AGPViRGE DX/GXViRGE GX2Trio3 DX2Savage 3DSavage 3DMSavage 4ProSavage PM133ViRGE MXViRGE MXPSavage/MX-MVSavage/MXSavage/IX-MVSavage/IXSuperSavageTwisterTwister-KProSavage DDRSonicVibesSafeXcelMagicLAN SWL-2210PNeo-4SK-98xxSK-98xx v2.0SK-9D21SK-9SxxSK-9ExxTigonSTG 2000XSTG 1764Kyro-IISTG 1764X64GXDVDmagic-PRO86C201 AGP86C202 VGA648FX AGP86C20585C503 System5595 System85C503 ISA180 SATA181 SATA182 SATA1905597/5598 VGA6215300/305/630 VGA85C50185C49685C596530 PCI540 PCI550 PCI85C601 EIDE620 PCI630 PCI633 PCI635 PCI640 PCI645 PCI646 PCI648 PCI649 PCI650 PCI651 PCI652 PCI655 PCI656 PCI658 PCI661 PCI730 PCI733 PCI735 PCI740 PCI741 PCI745 PCI746 PCI748 PCI750 PCI751 PCI752 PCI755 PCI756 PCI760 PCI900 10/100BaseTX961 ISA962 ISA963 ISA964 ISA965 ISA966 ISA551155125513 EIDE5571 PCI558155825591 PCI55965597/5598 Host620462056300530 VGA650 VGA6326 VGA6330 VGA5597/5598 USB7002 USB7007 FireWire7012 AC977013 Modem7016 10/100BaseTX7018 Audio83C170 (EPIC/100)83C175 (EPIC/100)FDC 37C665FDC 37C922LynxEMLynxEM+Lynx3DMLynxELynxE+Lynx3D910Victory66 IDEVictory66 ISAVictory66 USBVictory66 PowerPirahna 2-portTulip, power, switch extenderFPGA I-Bus Tracer for MBDSZB6120CXD1947A FireWireCXD3222 FireWireMemory Stick SlotVelocity128PCIO Ebus2HMEPCIO Ebus2 (US III)ERI EtherGEMSimba PCI-PCICrypto 5821Crypto 1KPsycho PCImicroSPARC IIep PCIUltraSPARC IIi PCIUltraSPARC IIe PCICassiniST201ST1023ST202140XX4018ASurecom NE-344S2PSpectrum24 LA41X382C10182C10382C10582C565 ISAMC322TC9021 GigETC9021 GigE (alt ID)DC-290(M)DC-690CDC-3x5UTerratec TV+Terratec TValueTerratec TValue RadioTLAN3DLabs Permedia3DLabs Permedia 2TSB12LV21 FireWireTSB12LV22 FireWirePCI4450 FireWirePCI4410 FireWireTSB12LV23 FireWireTSB12LV26 FireWireTSB43AA22 FireWireTSB43AB22 FireWireTSB43AB23 FireWireTSB43AB21 FireWirePCI4451 FireWirePCI4510 FireWirePCI4520 FireWirePCI7(4-6)10 FireWirePCI7x20 FireWirePCI7XX1 CardBusPCI7XX1 FireWirePCI7XX1 FlashPCI7XX1 Secure DataPCI7XX1 Smart CardPCI6515 CardBusPCI6515 CardBus (Smart Card mode)PCI1620 MiscACX100AACX100BACX111PCI1130 CardBusPCI1031 PCMCIAPCI1131 CardBusPCI1250 CardBusPCI1220 CardBusPCI1221 CardBusPCI1210 CardBusPCI1450 CardBusPCI1225 CardBusPCI1251 CardBusPCI1211 CardBusPCI1251B CardBusPCI2030 PCI-PCIPCI2031 PCI-PCIPCI2250 PCI-PCIPCI2050 PCI-PCIPCI4450 CardBusPCI4410 CardBusPCI4451 CardBusPCI4510 CardBusPCI4520 CardBusPCI7510 CardBusPCI7610 CardBusPCI7410 CardBusPCI7610 CardBus (Smart Card mode)PCI7[46]10 CardBus (SD/MMC mode)PCI7[46]10 CardBus (Memory stick mode)PCI1410 CardBusPCI1420 CardBusPCI1451 CardBusPCI1421 CardBusPCI1620 CardBusPCI1520 CardBusPCI1510 CardBusPCI1530 CardBusPCI1515 CardBusPCI2040 DSPPCI7420 CardBusPCI interface5634PCV SurfRiderR4x00TC35856F ATM (Meteor)R4x00 PCIToPIC95 CardBus-PCIToPIC95B CardBusToPIC97 CardBusToPIC100 CardBusFast Infrared Type OSD ControllerVirtual NorthbridgeMem1Mem24DWAVE DX4DWAVE NXCyberBlade i7CyberBlade i7 AGPCyberBlade i1CyberBlade i1 AGPCyberBlade Ai1CyberBlade Ai1 AGPCyberBlade XP/Ai1TGUI 9320TGUI 9350TGUI 9360TGUI 9388CYBER 9397CYBER 9397DVDTGUI 9420TGUI 9440CYBER 9525TGUI 9660TGUI 9680TGUI 96823DImage 97503DImage 9850Blade 3DCyberBlade XPHPT343/345 IDEHPT36x/37x IDEHPT372A IDEHPT302 IDEHPT371 IDEHPT374 IDEPyramid3D TR25202ET4000w32p rev AET4000w32p rev BET4000w32p rev CET4000w32p rev DET6000/ET6100ET6300IGA-1680IGA-1682IGA-1683CyberPro 2000CyberPro 2010CyberPro 5000CyberPro 5050CyberPro 5202CyberPro 5252UM82C881 486UM82C886 ISAUM8673F EIDEUM8881 HB4 486 PCIUM82C891UM886AUM8886BFUM8710UM8886UM8881F HostUM8886F ISAUM8886AUM8891AUM9017FUM8886NUM8891NUS201USR9979023CP5610V961PBC i960 PCIV292PBC AMD290x0 PCIV960PBC i960 PCIV96DPC i960 PCIK8M800 HostK8T890 HostPM800 AGPKT880 AGPK8HTB HostVT8363 HostVT8371 HostVT8501VT82C505VT82C561VT82C571 IDEVT82C576 3VVT82C585 ISAVT82C586 ISAVT82C595 PCIVT82C596A ISAVT82C597 PCIVT82C598 PCIVT8601 PCIVT8605 PCIVT82C686 ISAVT82C691 PCIVT82C693 PCIVT86C926 AmazonVT82C570M PCIVT82C570M ISAPM800 ErrorsKT880 HostVT82C416 IDEVT82C1595 PCIPM800 HostVT8251 PCIVT8251 PCIEVT8251 VLINKVT83C572 USBVT82C586 PowerRhine/RhineIIVT6306 FireWireVT82C596 PowerVT82C596B PMVT6105M RhineIIIVT82C686 SMBusVT82C686 AC97VT8233 AC97RhineII-2VT82C686 ModemVT8233 ISAVT8633 PCIVT8366 PCIVT8653 PCIVT6202 USBVT6105 RhineIIIS3 Unichrome PRO IGPVT8361 PCIVT8375 PCIPM800 Unichrome S3VT612xCLE266VT8623 PCIVT8233A ISAVT8751 PCIVT6420 SATAVT6410 IDEP4X400 HostVT8235 ISAP4N333 HostVT8377 PCIK8M400 HostVT8378 PCIPT890 HostK8T800M HostVT8237 ISAVT6421 SATAPM800 DRAMVT8251 ISAVT8251 SATAPM800 PMCK8T890 IOAPICVT8378 VGAPM800 PCIVT8231 ISAVT8231 PMGVT8363 AGPVT8371 PCI-PCIVT8501 AGPVT82C597 AGPVT82C598 AGPVT82C601 AGPVT8605 AGPK8T890 PCI-PCIVT8633 AGPVT8366 AGPVT8361 AGPVT8235 AGPK8HTB AGPVT8377 PCI-PCIVSC-7174 SATAGDT6000/6020/6050GDT6000B/6010GDT6110/6510GDT6120/6520GDT6530GDT6550GDT6x17GDT6x27GDT6537GDT6557GDT6x15GDT6x25GDT6535GDT6555GDT6x17RPGDT6x27RPGDT6537RPGDT6557RPGDT6x11RPGDT6x21RPGDT6x17RP1GDT6x27RP1GDT6537RP1GDT6557RP1GDT6x11RP1GDT6x21RP1GDT6x18RDGDT6x28RDGDT6x38RDGDT6x58RDGDT6x17RP2GDT6x27RP2GDT6537RP2GDT6557RP2GDT6x11RP2GDT6x21RP2GDT6513RSGDT6523RSGDT6518RSGDT6x28RSGDT6x38RSGDT6x58RSGDT6x33RSGDT6x43RSGDT6x53RSGDT6x63RSGDT7x13RNGDT7x23RNGDT7x18RNGDT7x28RNGDT7x38RNGDT7x58RNGDT7x43RNGDT7x53RNGDT7x63RNGDT4x13RZGDT4x23RZGDT8x13RZGDT8x23RZGDT8x33RZGDT8x43RZGDT8x53RZGDT8x63RZGDT6x19RDGDT6x29RDGDT7x19RNGDT7x29RNGDT8x22RZICP82C592 CPU82C593 ISA82C594 Wildcat82C596/597 Wildcat ISA82C54182C54382C53282C53482C53582C14782C97582C925Virtual SVGA IIVirtual SVGAVirtual NICP9000P9100WD33C193AWD33C196AWD33C197AWD7193WD7197WD33C296AWD34C296WD9610W83769FW89C840F 10/100Linksys EtherPCI IIW83C553F ISAW83C553FW89C940FW6692 ISDNLinksys EtherPCIVolari Z7X3201-3X3201-3 (21143)CardBus EthernetMini-PCI V.90 56k ModemMini-PCI K56Flex ModemCardBus 56k ModemCBEM56G Modem724734738737740740C724F7447541221PCI-ST32Genie TV/FMDVDZD1201ZD1202ZD1205Martin-MariettaHauppaugeTTTechDynalinkCompaqSymbios LogicATIULSI SystemsVLSIAvance LogicNSTseng LabsWeitekDECCirrus LogicWestern DigitalAMIAMDTridentAcerDellSiemens Nixdorf AGMatroxChips and TechnologiesToshibaNECFuture DomainSiSHewlett-PackardPC TechnologyAsustekDPTOptiElsaSGS ThomsonBusLogicTexas InstrumentsSonyOak TechnologyWinbondSMSCMotorolaPromiseNumber 9UMCI. T. T.PicopowerMylexAppleYamahaNexGen MicrosystemsQLogicCyrixLeadTek ResearchInterphaseContaq MicrosystemsBit3OlicomSunIntergraphDiamond MultimediaCMD TechnologyQuantum DesignsBrooktreeSGIACC MicroelectronicsSymphony LabsSTB SystemsPLXMadge Networks3ComSMCAcer LabsMitsubishi ElectronicsSurecomNeomagicMentor ARCAdvansysMolexMacronixEvans & SutherlandNVIDIAEmulexIntegrated Micro SolutionsTekram (1st ID)NewbridgeApplied Micro CircuitsTviaRealtekNKKIO Data DeviceInitioCreative LabsHighPointSigma DesignsVIACogent DataSiemensZnyx NetworksAcctonVortexEfficent NetworksIDTFORE SystemsPhilipsZiatechCycloneAlliance SemiconductorSchneider & KochDigiMutechXircomRenditionServerWorksRicohD-Link SystemsCorrollaryAcardZeinetOmega MicroMarvellLite-OnV3 SemiconductorPinnacle SystemsAT&T/LucentDolphinMesa Ridge (MAGMA)Analog DevicesZoranPijnenburgCompexCycladesEssential CommunicationsO2 Micro3DFX InteractiveATMLC-CubeAVMCoregaASIXIntersilNortel NetworksSilicon MotionEnsoniqTransmetaRockwellDavicomITExpressPlatformLuxSonorTriTech MicroelectronicsAlteonUS RoboticsNVIDIA/SGS-ThomsonAurealADMtekPacket EnginesForte MediaSIIGDTC TechPCTELCNetLAN MediaNetgearMoxaLevel 1Hifn3wareAbocomSundanceC-Media ElectronicsLavaSunixIC EnsembleMicrosoftOxfordChelsioTamarackAskeyAvermediaAironetMyricomVScomAvlabInvertexBroadcomPlanexConexantMyson CenturyTopic/SmartLinkENEAralionTerraTecSymbolSybaBluesteelVMwareZoltrixAgilentNational DatacommPacific DataEumitcomNetSecZyDAS TechnologySamsungAtherosGlobal SunSafeNetVitesseLinksysNetoctaveAltimaAntares MicrosystemsCaviumBelkinHawking TechnologyNeterionINPROCOMMLanergyRalinkXGI TechnologySangomaJMicronTekramHint3D LabsAddtronIndustrial Computer SourceNetVinGemtekc't MagazinIntelAdaptecAtronicsNetMosTigerJet NetworkEndaceBelkin ComponentsARC LogicINVALID VENDOR ID"%s %s"unknown class 0x%02x, subclass 0x%02xclass %s subclass %sclass %s unknown subclass 0x%02x, rev 0x%02x) rev 0x%02xvendor "%s", unknown product 0x%04x%svendor 0x%04x product 0x%04xunknown cy82c693_init: bus_space_map failed (%d)cy82c693_initcy82c693_readcy82c693_write%s: External SRAM, %s access%s, %dbytes/SCB %s: couldn't map interrupt %s: Using left over BIOS settings : couldn't establish interrupt%s: Enabling 39Bit Addressing : unable to map registers %s: unable to allocate bus-specific data fast, parity checking enabledslow%s: PCI error Interrupt at seqaddr = 0x%x %s: Latched PCIERR interrupt with no status bits set %s: Data Parity Error has been reported via PERR# %s: Signaled a Target Abort %s: Received a Target Abort %s: Received a Master Abort %s: Signal System Error Detected %s: Data Parity Error Detected during address or write data phase RAID functionality unsupported adapter at unexpected slot %d unable to map to a channel : unable to map device registers : adv_init failed : couldn't map interrupt AscInitFromEEPAscIsrQDone: completed scsiq with unknown statusAscIsrQDone: Attempting to free more queues than are activeAscIsrQDone: Corrupted SG list encounteredAscExeScsiQueue: Queue with QC_SG_HEAD set but %d segs.AscExeScsiQueue: Queue with too many segs.AscResetDeviceQUANTUM XP343011071NEC YAMAHACDR400CD-ROM DRIVE TDC 36HP : broken match/attach! : %s: invalid memory type %d , using %dK of on-board RAM, can't map on-board RAMpciide %s: device disabled %s: couldn't map %s cmd regs %s: couldn't map %s ctl regs %s: couldn't map native-PCI interrupt unknown interrupt%s: using %s for native-PCI interrupt %s: unable to subregion %s ctl regs %s: couldn't establish native-PCI interrupt, (unsupported maptype 0x%x), unused (couldn't query registers), unused (registers at unsafe address %#lx), unused (couldn't map registers)%s:%d: unable to allocate table DMA for drive %d, error=%d %s:%d: unable to map table DMA fordrive %d, error=%d %s:%d: unable to create table DMA map for drive %d, error=%d %s:%d: unable to load table DMA map for drive %d, error=%d %s:%d: unable to create xfer DMA map for drive %d, error=%d %s:%d: unable to load xfer DMA map fordrive %d, error=%d %s:%d:%d: bus-master DMA error: missing interrupt, status=0x%x %s:%d:%d: bus-master DMA error: status=0x%x channel 0channel 1%s: %s cannot allocate memory for command queue%s: %s disabled (no drives) %s: no compatibility interrupt for use by %s configuredwiredcompatibilitynative-PCI, %s %s to %s: DMA%s:%d:%d: cannot allocate DMA maps, using PIO transfers %s:%d:%d: using DMA data transfers not responding; disabled or no drives?other hardware responding at addresses%s: %s ignored (%s) , (partial support) (unsupported): no DMA%s: %s ignored (disabled) %s:%d:%d: multi-word DMA disabled due to chip revision : ATA33: ATA100: ATA66: ATA133 %s: bus-master DMA support present%s: %s %s to %s mode %s %s: can't allocate memory for command queue: unable to map BA5 register space %s: port %d: device connected, but communication not established %s: port %d: unknown SStatus: 0x%08x %s: port %d: device present, speed: 3.0Gb/s, speed: 1.5Gb/s%s: port %d: PHY offline : can't subregion offset %lu size %luport 0port 1port 2port 3%s %s channel: can't allocate memory for command queue%s: couldn't subregion %s cmd base %s: couldn't subregion %s ctl base %s: couldn't subregion %s channel cmd regs : unexpected PCI function %d , %s %s to native-PCI compatibility : cannot allocate memory for command queue , (unable to map ctl registers)540630630S633635645645DX651652655658661730733735741745746748755760962963: 5597/5598unknown SiS IDE type %d %s:%d: error intr %s:%d: bogus intr %s: unexpected PCI function %d %s: no known timing values %s:%d: bogus intr (reg 0x%x) : couldn't establish native-PCI interrupt: couldn't map bus-master DMA registers : couldn't map IDE registers : DMA %s: channel %d: can't allocate memory for command queue %s: couldn't map channel %d ctl regs %s: couldn't map channel %d cmd regs %s channel %d: can't subregion DMA registers ppb%s: not configured by system firmware pci at %svr: failed to map i/o space : can't load dma map : can't create dma map : can't map dma buffers (%d bytes) : can't alloc list : could not establish interrupt%s: rx error (%02x): rx buffer error system bus error received runt packet received giant packet FIFO overflow frame alignment error crc error%s: rx shutdown error! %s: tx shutdown timeout %s: restarting %s: receive error (%04x) packet lost overflow no buffers%s: rx packet lost %s: initialization failed: no memory for tx buffers %s: chip is in D%d power mode -- setting to D0 i82562, %si82558i82559i82557i82559Si82550i82551%s: Allocation of PCI resources failed %s: Unable to initialize the hardware %s: EEPROM read error while reading mac address %s: Invalid mac address %s: Unable to allocate rx_desc memory %s: Unable to allocate tx_desc memory %s: watchdog timeout -- resetting %s: Could not setup transmit structures %s: Could not setup receive structures %s: Unsupported media type em_set_multi%s: Unknown MAC Type : mmba isn't memory: can't find io space : can't find mem space %s: The EEPROM Checksum Is Not Valid %s: EEPROM read error while reading part number %s: Hardware Initialization Failed%s: em_dma_malloc: bus_dmamap_load failed; error %u %s: em_dma_malloc: bus_dmammem_map failed; size %lu, error %d %s: em_dma_malloc: bus_dmammem_alloc failed; size %lu, error %d %s: em_dma_malloc: bus_dmamap_create failed; error %u %s: Unable to allocate tx_buffer memory %s: em_allocate_receive_structures: bus_dmamap_create failed; error %u %s: Unable to allocate rx_buffer memory %s: Excessive collisions = %lld %s: Symbol errors = %lld %s: Sequence errors = %lld %s: Defer count = %lld %s: Missed Packets = %lld %s: Receive No Buffers = %lld %s: Receive length errors = %lld %s: Receive errors = %lld %s: Crc errors = %lld %s: Alignment errors = %lld %s: Carrier extension errors = %lld %s: RX overruns = %ld %s: watchdog timeouts = %ld %s: XON Rcvd = %lld %s: XON Xmtd = %lld %s: XOFF Rcvd = %lld %s: XOFF Xmtd = %lld %s: Good Packets Rcvd = %lld %s: Good Packets Xmtd = %lld : %s,: unknown device: %x:%x dc_pci_attach: can't subregion i/o space ne_pci_attach: impossible%s: init failed, error=%d vendor 0x%04x%s: unable to map registers pcscp%s: can't create dma maps %s: unable to allocate memory for the MDL, error = %d %s: unable to map the MDL memory, error = %d %s: unable to map_create for the MDL, error = %d %s: unable to load for the MDL, error = %d dmaintr: discarded %d bytes (tcl=%d, tcm=%d) dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d pcscp_dma_intr: empty esp FIFO of %d %s: dma_intr: DMA aborted. %s: error: DMA error detected; Aborting. pcscp dmaintr: DMA wasn't active%s: unable to load dmamap, error = %d pcib%s: %s (rev. 0x%02x) pcibattachisa at %s%s: %s channel interrupting at irq %d pre 1.02.0usb: USB revision %s, not supported usb_attach%s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d usbtaskunable to create task thread usb_create_event_thread task%s: unable to create event thread for usb_create_event_threadconfigusbevtusbtskusb at %susbreausbreadusbd_add_dev_eventusbd_add_drv_eventusb_add_eventusb_detachusbdet%s: event thread didn't die usbsynusbd_transfer: not doneusbd_start_next: error=%d usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usb_desc_iter_next: bad descriptor usb_detach_wait: %s didn't detach HomeConnectBluetooth3C19250 Ethernet3CRSHEW696HomeConnect 3C460U.S.Robotics 56000HomeConnect 3C460B3Com OfficeConnect Analog Modem3Com U.S. Robotics Pro ISDN TA3Com HomeConnectXX1XX2URE450 EthernetUFE1000 Fast Ethernet1/10/100 ethernetXX4XX5XX6RTL8151XX7XX8XX9XX10BWU613USB320-EC Ethernet2664WT-Sinus 111 WLANSpeedStream EthernetWarplinkAcerscan C310UAcerscan 320UAcerscan 640UAcerscan 620UATA/ATAPIAWL300AWL400Prism2.5 WLANPrism2.5 WLAN AROPEX FreeLan 802.11b802UAT1ACT-IR2000U FIRI/O BoardI/O Board, rev. 1AWN-8020 WLANAWU-120AN986A EthernetAN986 EthernetAN8511 EthernetAN8513 EthernetAN8515 EthernetUBS-10BT EthernetQ-DriveSnapScan 1212USnapScan 1236USnapScan TouchSnapScan e40SnapScan e50SnapScan e20SnapScan e25SnapScan e26SnapScan e52AirPrime CDMA Wireless EVDO cardAWU2000BWM-168bUSB-HASP 0.06MacAlly Kbd HubAU9814 HubMicroConnectors/StrongManNEC Kbd HubAT-USB100ADA70 SpeakersASC495 SpeakersBack-UPS Pro 500Eagle IEagle IIEagle IICEagle IIIEZUSBEZLINKOptical mouseADB deviceSpeakersTrue Random Number GeneratorPENTAX Optio230WLL013 (Intersil)WLL013Voyager 1010USB 2.0 10/100 ethernet controllerAX88178AX88772RT2570WL-14010Mbps EthernetUC-110T EthernetUC210T EthernetDSB-650CUSB Cable 205UHB124 hubW-Buddie WN210DWL-900AP Wireless access pointAT76C503 (Intersil 3861 Radio)AT76C503 (Intersil 3863 Radio)AT76C503 (RFMD Radio)AT76C505 (RFMD Radio)AT76C505 (RFMD 2958 Radio)AT76C505A (RFMD 2958 Radio)AT76C505AS (RFMD 2958 Radio)ATC-HA4USB USB headphoneUSB Audio Speaker1200UuLinks RS-422/485F5U002 ParallelF5D6050 802.11b Wireless adapterFBT003v2 BluetoothF5U103 SerialF5U109 SerialF5U409 SerialUSB to LAN ConverterF5U237 USB 2.0 7-Port HubF5U120-PC HubF5D7050 54g USB Network AdapterUSB100N 10/100 EthernetUSB100LPUSB100ELUSBE100USB2AR EthernetBCM2033BCM2033 (no fw)HL-1050 laser printerKeyboard/MouseCANOSCAN N656UCANOSCAN N670UPowerShot S10PowerShot S20PowerShot S100PowerShot G1PowerShot A20Netmate EthernetNetmate2 EthernetUSB Chief Bus & Protocol AnalyzerAndromeda hubQVBE-300 PDACASIO Nameland EZ-USBEasyDisk PortableMy3000 keyboardMy3000 hubCypressKB-8933 keyboardPro ThrottlePro PedalsFighterstickFlight Sim YokeUSB200M v2HU200-TSiPAQ PocketPCA1500iPAQ WLANW100WLAN MultiPort W200Personal Jukebox PJB100SnapPort EthernetCM-5100P EVDOC11UWL-210C54RU WLANEye Q 3xQuickCamEther USB-TFEther USB-TXWirelessLAN USB-11FEther USB-TXSWireless LAN Stick-11FEther USB2-TXULUSB-11 KeyWLAN USB Stick 11FEther USB-TXCNomad IINomad II MGNomadVoip BlasterBlueCoreEx1300 hubthermometerKeyboard/HubFM RadioUSB2 HubPhotoClipJ-6502 speakersUSB-FOB/iBUTTONTrueMobile 1180 WLANEarthmate GPSRio 500WL-200UCHUSB 611GWL-240UXH1153 802.11bAccelePort 2AccelePort 4AccelePort 8PS/2 Active10/100 ethernetDWL-120 rev EDWL-122DWL-120 rev F10Mbps ethernetStorage AdapterFlash DiskDiva 852 ISDN TAhubmonitorGoldpfeil P-LAN29UOLD-USB/TXLD-USBL/TXUC-SGT SerialUC-SGT0 SerialELSAMicrolink USB2Ethernet1S serial2S serial1S25 serial4S serialE45 EthernetCentronics1S9 serialEZ-USB2U4S serialUSB PrinterISD Smart Cable for MacISD Smart CablePerfection 636U / 636PhotoPerfection 610Perfection 1200U / 1200PhotoExpression 1600Perfection 1640SUPerfection 1240U / 1240PhotoPerfection 640UPerfection 1650GT-9700FPerfection 2400Perfection 1260Perfection 1660XTNDAccess IrDAFalcom Twist USBConnector for DVD drive8U232AM Serial2232C SerialPS/2 Keyboard/MouseMatrix Orbital MX200 Series LCDMatrix Orbital LK202-24 LCDMatrix Orbital LK204-24 LCDCrystalfontz CFA-631 LCDCrystalfontz CFA-632 LCDCrystalfontz CFA-633 LCDCrystalfontz CFA-634 LCDSEMC DSS-20 SyncStationMass StorageAH-F401U Air H deviceYP3X00 PDAIque 3600GeneLink Host-Host BridgeGL650 HubGL641USB CompactFlashGN-BR402WGN-WLBM101GN-WBKGGoCOM232 Serial converterGWUSB2EGamePad ProCF-writer/MP3 PlayeriMate, ADB adapterExpert mouseCLOCK USBDA LeaderHWGUSB2-54 WLANFlashGate SmartMediaFlashGate CompactFlashFlashGateCrossam2+USB IR commanderHandspring VisorHandspring TreoHandspring Treo 600WinTV FMUF200 EthernetDVD-CAM DZ-MV100A CamcorderDeskJet 895CScanjet 4100CPhotosmart S20DeskJet 880CScanJet 4200CCD-Writer PlusMultimedia Keyboard HubHN210WScanJet 6200CPhotoSmart S20DeskJet 815CScanJet 3300CCD-Writer Plus 8200eDeskJet 1220CDeskJet 810C/812CScanjet 4300CCD-Writer+ CD-4eOfficeJet G85xiLaserJet 1200Scanjet 5200CDeskJet 830CScanJet 3400cseDeskJet 885CScanjet 6300CDeskJet 840cScanJet 2200CScanjet 5300CDeskJet 816CDeskjet 970CseScanjet 5400CDeskjet 959CDeskJet 930cInkjet P-2000UDeskJet 640cPhotosmart P1100HN210E EthernetiPAQ 22xx/Jornada 548Jornada 568PhotoSmart C500OpticalCD-ROMFlash Go!EdgePort/4 RS232Hubport/7Rapidport/4Edgeport/4 RS232Edgeport/2 RS232Edgeport/4 RS422Edgeport/2 RS422/RS485Hubport/4Hand-built Edgeport/8MultiTech version of RP/4Edgeport/(4)21 ParallelEdgeport/421 Hub+RS232+ParallelEdgeport/21 RS232+Parallel1/2 Edgeport/8Edgeport/2 RS232/DINEdgeport/4 RS232/DIN1/2 Edgeport/16Edgeport CompatibleEdgeport/8 RS422OEM deviceUSB2 StorageIDE ISD110IDE ISD105Portable USB Harddrive V2USB cableUSB Storage Adapter V2EasyPCAP310 AnyPoint IIWireless 2011B82930 test boardPrism2.x WLANValueCANNeoVI BlueUSB-SSMRW SD-cardUSB-SDRW SD-cardUSB ETTUSB ETTXUSB WN-B11USB Airport WN-B11RSAQ1 SerialUSB2.0-SCSI Bridge USB2-SCZip 100Zip 250CDRW 9602iFP-1xxiFP-3xxiFP-5xxJD 350AirH"PHONE AH-J3001V/J3002VMP-XP7250 Builtin WLANMP-PRX1MiniHub 4000PKC-180 IrDAHKS-0200 USBDAQOrbit trackballTurboBallOrbit trackball for MacVideoCAM VGAUSA-28 serialUSA-28X serialUSA-19 serialUSA-18 serialUSA-18X serialUSA-19W serialUSA-49W serialUSA-19QI serialUSA-19Q serialUSA-28X/XB serialUSA-28XB serialUSA-28XA serialUSA-18XA serialUSA-19WQ serialUIA-10 remote controlUIA-11 remote controlKNU101TX EthernetDigital Science DC220Digital Science DC260Digital Science DC265Digital Science DC290Digital Science DC240Digital Science DC280EasyShare DX4900Niche mouseGenius NetScroll mouseFlight 2000 joystickColorPage Vivid-ProAH-K3001VKPC650 EVDOHard DiskCD R/WjumpSHOT CompactFlash2662W-AROptra S 2450Camedia MAUSB-2USB10TXUSB10T EthernetUSB100TX EthernetUSB100H1 Ethernet/HPNAUSB10TA EthernetWUSB11 802.11bWUSB11 802.11b v2.5WUSB12 802.11b v1.1WUSB11Network Everywhere NWU11BWUSB11 v2.8WUSB11 v3.0M2452 keyboardM4848 mousePageScanQuickCam WebQuickCam ProQuickCam ExpressQuickCam Pro 3000QuickCam Notebook ProQuickCam Pro 4000N43N48 mouseM-BA47 mouseWingMan Gaming MouseBD58 mouseiFeel MouseWingMan GamePad ExtremeWingMan RumblePadWingMan Force joystickWingMan Formula Force GP (GT-Force)iTouch KeyboardUSB-PS/2 TrackballTrackMan WheelCordless mouseCordless keyboardCordless Desktop OpticalQuickCam ZoomLCS-8138TXUSS-720 evaluation kitD-Link DU-H3SP BAY HubRS232 InterfaceSitecom RS232ML-4500LUA-TX EthernetNintendo Wi-FiLUA2-TX EthernetLUA-KTX EthernetWLI-USB-S11MCR-SM2 SmartMediaUSB-IDE Bridge: DUB-PxxGWLI-USB-KS11G wlanLUA-U2-KTX EthernetWLI-USB-KB11 WLANWLI-U2-KG54-YB WLANWLI-U2-KG54 WLANWLI-U2-KG54-AI WLANRicochet GSSP128AR EtherFastSideWinder Precision ProIntelliMouseNaturalDigital Sound System 80Sidewinder Precision Racing WheelTrackball ExplorerIntelliEye mouseInternet Keyboard ProMN510 WirelessSCSI-DB25SCSI-HD50CameraMateFreecom IDEPhantom 336CX - C3ScanMaker X6 - X6UPhantom C6ScanMaker V6USLScanMaker V6ULMidisport 2x2Digital WalletDimage S304Dimage XDimage 7iDimage A1CD-R/RW DriveMouseFDDEasiDock EthernetMC141555 hub controllerT720cUSBLANSB4100 Cable ModemMT5634ZBA modem1200 CU600 CU1200 UB1200 Plus1200 CU PlusBearPaw 1200FMDC-800DV2000DiskOnKeyGPIB-USB-ABearPaw 1200BearPaw 2400RepeaterPicty760Picty900Picty920Picty800USB2.0 Hub6-in-1 Flash Device ControllerMulti-format Flash ControllerTurbo-ConnectClik! 40EthernetGadgetUSB 2.0 Fast EthernetMA101MA101 Rev B802.11b802.11b V2E990E880E885Merlin V620C-1C-700 Ultra ZoomUSB TO EthernetOV511OV511+MDCFE-B CFMemory Stick+CFDatafab-basedPNY/Datafab CF+SMSimple Tech/Datafab CF+SMCF + SM Combo (LC1)Datafab MD1-II PC-Card8In2model 01 WiFi interfacemodel 01 Bluetooth interfacemodel 01 Ethernet interfaceSolid state diskUSB Serial AdaptorPalm m500Palm m505Palm m515Palm i705Palm Tungsten ZPalm m125Palm m130Palm Tungsten TPalm Zire 31Palm ZireLS-120MultiMediaCardTY-TP50P6-S 50in Touch Panel6 in 13 in 1Serial ConverterAt-Home EthernetWL-503IADSS 350 Digital Speaker SystemDSS XXX Digital Speaker SystemPCA645VCPCA646VCPCVC675K VestaPCVC680K Vesta ProPCVC690K Vesta Pro Scan CameraPCVC730K ToUCam FunPCVC740K ToUCam Pro PCPCVC750K ToUCam Pro ScanDSS 150 Digital Speaker SystemDIVA mp3 playerPS2 to MacXkeys Programmable KeyboardCRW-600 6-in-1GW-US11H WLANGW-US11S WLANPlatronics DSP-400 Headsettest boardExpress EthernetTravel Flash DriveG2-200G2E-300G2-300Colorado 9600Colorado 600uVisioneer 6200Colorado 19200Colorado 1200uG2-600ReadyScan 636iG2E-600ComfortMouse-in-a-BoxSony PCGA-UMS1PL2301 Host-Host interfacePL2302 Host-Host interfacePL2303 SerialParallel printerATAPI-4 Bridge ControllerPL2501 Host-Host interfaceUSB-1284 BRIDGEScorpion-980NCDMA MSM modemCDMA MSM phoneUSB StrikePadi-Key 2000USB serial REX-USB60RTL8150RTL8151 PNARTL8187UA-100 Audio I/FUM-4 MIDI I/FSC-8850 MIDI SynthU-8 Audio I/FUM-2 MIDI I/FSC-8820 MIDI SynthPC-300 MIDI KeyboardUM-1 MIDI I/FSK-500 MIDI KeyboardSC-D70 MIDI SynthUM-880 MIDI I/FSD-90 MIDI SynthUM-550 MIDI I/FSD-20 MIDI SynthSD-80 MIDI SynthUA-700 Audio I/Fgamepad 203USBCyborg 3D Gold JoystickImageMate SDDR-05aImageMate SDDR-31ImageMate SDDR-05ImageMate SDDR-12ImageMate SDDR-09ImageMate SDDR-75JY-DV9USB gamepadSanyo SCP-4900 PhoneSWL-2100USL11R-IDEUSB-Serial converterRoot HubSN1 L1 System ControllerPocket AdapterSL5500A300SL5600C700C750E-USB BridgeeUSCSI BridgeImageMate SDDR09eUSB SmartMedia / CompactFlasheUSB MultiMediaCardSony HifdeUSB ATA/ATAPIeUSB CompactFlashCD-RW DeviceSCM MicroSpeedStreamSpeedStream 1022Datum Networks SSF-7X Multi PlayersDigiFilm-ComboMULTICARDREADERU2EPsion Dacom Gold Port EthernetYAP Phone (no firmware)YAP PhoneNetComm Roadster II 56LN029WL-022CN104SmartLink EthernetsmartNIC 2 PnPEZ Connect EthernetEZ Connect 11MbpsEZ Connect 11Mbps v2NUB100 EthernetNUB110 EthernetSony DSC CamerasMemorystick NW-MS7Harddrive V2Memorystick MSAC-US1HandycamSony MSC Memorystick SlotClie v3.5PlayStation2 keyboardPlayStation2 keyboard hubPlayStation2 mouseClie v4.0Clie v4.0 Memory Stick slotSony Clie s360Clie v4.1 Memory Stick slotClie v4.1Sony Clie nx60Sony Clie tj25KeikaiDenwa 8KeikaiDenwa 8 with chargerUB801RCommunicatorInternet Access DeviceMobile AdaptorU-Cable type D2U-Cable type P1Slipper UIr-TrinityU-Cable type A3U-Cable type A4Type 6 KeyboardType 6 MouseSGC-X2ULSupra Express 56KSupraMax 2890 56KRio 600Rio 800Nike psa[play 120EP-1427X-2 EthernetEricsson DCU-10/11USBPS2CameraMate (DPCM_USB)ZodiacUSB-PDC Adapter UPA9664USB-cdmaOne Adapter UCA1464USB-PHS Adapter UHA6400USB-PHS Adapter UPA6400FD-05PUBALLNET 0193 WLANZyXEL ZyAIR B200 WLANU-300CMicrophoneUT-USB41 hubTUSB2046 hubNex II DigitalFusion Digital GamepadArgos Mini SmartcardThumbDriveThumbDrive 8MBU209 SerialUSB/MP3 decoderXXX 1100SM-20001200 UB PlusAstra 1236UAstra 1220UAstra 2000UAstra 2100UAstra 2200UAstra 3400Panache Surf ISDNUSR1120 WLANUSR9000 SureConnect ADSLG773 Monitor HubP815 Monitor HubAirsyncG773 Monitor ControlCPiA CameraOneTouch 7600OneTouch 5300Scanport 3000OneTouch 6100OneTouch 6200OneTouch 8100OneTouch 8600DSC350Vodafone Mobile Connect 3GGlobeTrotter 3G FUSIONGlobeTrotter 3G QUADCT-0405-U TabletGraphireGraphire3 4x5Graphire4 Classic A6Intuos A5Imaging DeviceIBM PC CameraFlashbuster-UUX256 MIDI I/FUX96 MIDI I/FRP-U200NetVolante RTA54iNetVolante RTW65bNetVolante RTW65iNetVolante RTA55iU640MO-03M4Y-750XI-725/726XI-7352986L Fax ModemZD1211ZD1211BOmni 56K PlusAOXAtmelMitsumiHewlett PackardNational SemiconductorFuture Technology DevicesEastman KodakMelcoADI SystemsComputer Access TechnologyStandard MicrosystemsAdvanced Gravis ComputerSun MicrosystemsTaugagreining HFAdvanced Micro DevicesLexmark InternationalNANAOAlps ElectricThrustmasterKYE SystemsDiamond (Supra)Primax ElectronicsAMPCherry MikroschalterAmerican MegatrendsLogitechBehavior Tech. ComputerSanyo ElectricConnectixKensingtonLucentKyoceraPlantronicsSTMicroelectronicsHitachiAcer PeripheralsVisioneerNikonCypress SemiconductorSeiko EpsonRainbow TechnologiesI/O DataTDKU.S. RoboticsMethode Electronics Far EastMaxi SwitchLockheed Martin Energy ResearchFujitsuToshiba AmericaMicro Macro TechnologiesKonicaLite-On TechnologyFuji Photo FilmPhilips SemiconductorsTatung Co. Of AmericaScanLogicMyson TechnologyITT CanonAltec LansingPanasonic (Matsushita)SharpIiyamaShuttle TechnologyAnnabooksJVCChicony ElectronicsBrother IndustriesDallas SemiconductorAztech SystemsKawatsu SemiconductorAmerican Power ConversionAdvanced Connectek USANetChip TechnologyALTRAATI TechnologiesAladdin Knowledge SystemsUniversal AccessViewSonicXirlinkAnchor ChipsVLSI VisionAsahi Kasei MicrosystemsATEN InternationalMustek SystemsTelex CommunicationsPeracom NetworksAlcor MicroWACOMe-TEK LabsEIZOElecomHauppauge Computer WorksBAFO/Quality Computer AccessoriesY-E DataQuickshotRolandRockfireRATOC SystemsZyXEL CommunicationIomegaA-Trend TechnologyAdvanced Input DevicesLaCieOmniVisionIn-System DesignApple ComputerDigi InternationalQualcommQtronixBrainboxesUltimaAxiohm Transaction SolutionsMicrotekSUN CorporationLexar MediaSymbol TechnologiesGenesys LogicFuji ElectricKeithley InstrumentsEIZO NanaoKawasaki LSIFFCAnko ElectronicP.I. EngineeringAOC InternationalChic TechnologyBarco Display SystemsBridge InformationSolid YearBio-Rad LaboratoriesMacallyAct LabsAlarisApexVivitarAvisionTEACSilicon GraphicsSanwa SupplyAcer Semiconductor AmericaSigmatelAiwaACARD TechnologyProlific TechnologyMinoltaCH ProductsHagiwara Sys-ComChuntexAskey ComputerSaitekAlcatel TelecomAGFA-GevaertAsia Microelectronic DevelopmentBizlink InternationalKeyspanAashima TechnologyMultiTechADS TechnologiesAlcatel MicroelectronicsSirius TechnologiesBoston AcousticsGuillemotPutercomMCTImationSusteenEicon NetworksDigital StreamAureal SemiconductorMidimanSurecom TechnologyGriffin TechnologySanDiskJenoptikBrimaxAxis CommunicationsABL ElectronicsSun CommunicationsAlfadata ComputerNational Technical SystemsOnntoBeFreecomMicrotechOlympusAboCom SystemsKeisokugikenOnSpecAPG Cash DrawerB.U.G.Allied Telesyn InternationalAVerMedia TechnologiesCASIOAptio ProductsArasan Chip SystemsAllied CableSTSNZoom TelephonicsBroadLogicHandspringAction Star EnterprisePalm ComputingSOURCENEXTAccton TechnologyDiamondBayNETGEARActiveWireB&B ElectronicsPortGearSystem TalksMetricomADESSO/Kbtek AmericaJatonAPT TechnologiesBoca ResearchAndrea ElectronicsBurr-Brown Japan2WireAIPTEK InternationalSmartBridgesBillionton SystemsExtended SystemsM-SystemsAuthenTecAudio-TechnicaTrumpion MicroelectronicsAlation SystemsConcord CameraGarmin InternationalGoHubsAmerican Biometric CompanyYanoKingston TechnologyBlueWater SystemsAgilent TechnologiesGude ADSPortsmithAdirondack Wire & CableBeckhoffMinds At WorkAltius SolutionsArris InteractiveACTIVCARDACTiSYSA-FOUR TECHAIMEXAddonics TechnologiesAKAI professional M.I.ARESCOMBay AssociatesAlteraCambridge Silicon RadioTrek TechnologyAsahi OpticalBoca SystemsGREENHOUSEGeocast Network SystemsNeodioOptionTodos Data SystemASUSTekram TechnologyHAL CorporationKurusugawa ElectronicsASIX ElectronicsAmbit MicrosystemsAddonics TechnologyAgate TechnologiesDMISealevel SystemEasyDiskZ-ComTangtopPen DriveABCConceptronicMicro Star InternationalELCON SystemtechnikHawkingG.MateOurs TechnologyPilotechAirprimeVTechFalcom Wireless Communications GmbHGIGABYTECCYU TechnologyAsanteJapan Radio CompanySphairon Access Systems GmbHDeLormeAcer Communications & MultimediaTsunamiPheenetAraneus Information SystemsTapwaveAincommMobilityDick Smith ElectronicsCisco-LinksysSharkNovatel WirelessSilicomRalink TechnologySilicon PortalsOQOSOHOwareUMAX Data SystemsInside Out NetworksGood Way TechnologyEntregaActiontec ElectronicsGigasetCMOTECH CDMA TechnologiesD-LinkPlanex CommunicationsTripp-LiteNHJASUSTeK ComputerAEIPQIDaisy TechnologyNational InstrumentsMicronet CommunicationsI-O DataiRiverAveratecZinwellSitecomNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%x.%02x, class %d/%d, rev , addr %dusbd_devinfousbdly0 lengthout of datausbd_fill_iface_data: bad descriptor(s): %s iface descusbd_set_config_index%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS portusbd_print%s, %s configuration %d interface %d port %d%s: at %s (addr %d) disconnected %s: %d port%s with %d removable, %s poweredmultiplesingle, %s transaction translator%s%s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: port %d power on failed, %s %s: cannot open interrupt pipe %s: no ports, hub ignored uhub%s: hub depth (%d) exceeded, hub ignored uhub_attach%s: port %d reset failed %s: device problem, disabling port %d %s: strange, connected port %d has no power %s: illegal enable change, port %d %s: port error, giving up port %d %s: port error, restarting port %d hid_start_parsedefault bType=%d Local bTag=%d Main bTag=%d Global bTag=%d BAD LENGTH %d uhidev%s: %s, iclass %d/%d %s: could not read endpoint descriptor %s: unexpected endpoint %s: no report descriptor %s: no memory %s: %d report ids uhid at %s reportid %duhidev_intr: bad repid %d uhidev_set_report_asyncukbd %s: attach failed, %s %s: was console keyboard This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). too many modifier keysbad modifier sizemultiple key code arrays key codes not on byte boundarytoo many key codeskey code size != 8umassCBIBulk-OnlyRBC%s: using %s over %s %s: bus attach failed %s: command protocol=0x%x not supported %s: isdata not configured %s: unable to get Max Lun: %s UFIISD-ATACBI with CCI%s: got polled xfer %p, but %p already pending %s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: transferred %d bytes instead of %d bytes%s: Unknown state %d%s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Get Max Lun failed: %s umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsi_cbaue%s: EEPROM read timed out %s: MII read timed out %s: reset failed %s: setting config no failed auemii%s: getting interface handle failed %s: missing endpoint %s: address %s %s: couldn't get endpoint descriptor %d %s: no memory for rx list -- packet dropped! %s: %u usb errors on intr: %s %s: %u usb errors on rx: %s %s: usb error on tx: %s %s: aue_send error=%s %s: tx list init failed %s: rx list init failed %s: open intr pipe failed: %s %s: open tx pipe failed: %s %s: open rx pipe failed: %s %s: close intr pipe failed: %s %s: abort intr pipe failed: %s %s: close tx pipe failed: %s %s: abort tx pipe failed: %s %s: close rx pipe failed: %s %s: abort rx pipe failed: %s cue%s: read MAC address failed %s: couldn't get ep %d %s: cue_send error=%s kue%s: warm boot, no firmware download %s: cold boot, downloading firmware %s: failed to load trigger segment: %s %s: failed to load fixup segment: %s %s: failed to load code segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: kue_send error=%s wsdisplay%s: screen %d-%d added (%s, %s emulation) %s: screen %d deleted wsdisplay at %s mux %d: console (%s, %s emulation), using %sdmuxwsdisplay_common_attach: no memorywsdisplaytty() on ctl devicewsdisplay_switch3: giving up wsdisplay_switch3: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch2: giving up wsdisplay_switch2: screen %d disappeared wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwswaitwsmoused_sleepwscons: copybuffer memory malloc failed wsemul_vt100_output_c0c1: ESC in kernel output ignored \[>24;20;0cP0!u%5\wsemul_vt100_handle_csi[?62;6c[%d;%dR[?13n[?21n[?27;1nP2$uwsemul_vt100_handle_dcs: bad type %d[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[28~[29~[31~[32~[33~[34~OPOQOROSOpOqOrOsOtOuOvOwOxOyOIOMOD[7~OBOCOA[8~[6~[3~[2~[5~[4~[1~OjOkOlOmOnOowsevent_readwskbdwskbd at %s%s: attach error=%d : console keyboardcannot load keymapwskdetwskbd_detach: %s didn't detach %s: event queue overflow %s: connecting to %s %s: disconnecting from %s wskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwsmux: attach out of memory wsmux_getmux: no memory for mux %d wsfont_unlock: font not lockedpckbdprobe: reset response 0x%x pckbd_enable: command error pckbd_disable: command error pckbd ccd'(r PmXmL\mdmlmtmxmmmmmmmmmGmmmmmmm 4&'./$#! *+.-4)(% ,(]_<]_<^_^_a_a_<a_|<a_|Xa_a_a_a_b_Pc_dc_< Ld_`d_ d_d_<e_e_<|e_e_f_f_Df_Xf_f_f_ $_8_tL_`_t____Ĉ_؈____(_ _(_<_L!(_h!<_!P_d!,_@_!__!_,_!@_!T_ !t__!_4!_H!_0!,_!@_T_!__!8_<&\,<_<&P_<_'p,_',_5C_'-_ { }xYYvw E--   <<cr39AAAAEEEIIIIDOOOOUUUYaoybuiltin@ `P0p-H.p...8/ ../Xo $( ,h667d778H8@ssssssssssssssttupDu21XlhXhĐАܐ)+-/13579;=?ACEGIKMOQSUWY[]_acegikmoqsuw ! 4UU&`H@?@@,pTHIS is A memory TEST pattern,%Kjj k𮭨`hx     pL||D\4 h ("D"`8 <&))-, @ @   )D0 kaؽ||8>BBA$B8@B\BBB Tm,B4@W4E<HE`EDtELETE`Oh@L@LpQ4L0x=$T=>؅Tr|Trs5sr4s4sľtF̾D0p|ԾܾB4EDFI,JK\KdKlKxxvavaPcc0 pa ##$0a0a@PXTTFlPNxRRCE8STNMXCL0PL0RE@RRCE8STSL RRCE8STERCE8ST3@4hl4TA4TA445H5t555TA5\A$6P6066\A7TA47X(l7TA7TA7TA7( 8`L8&x88$8t8((9(T9,:(9+4+9+9TAT:aP3 5H5t58$8t8((9(9+4+a 3 5H5t58$8t8((9(9+4+T:a @=!46!nativer0 "@,[4;uunativer0 "[uu9ص$ B F F do9S @V 9E C  HQ ^  a  9 9`4 ; D9 z pw@z m $ X <\ |] X> &9t9N@OOx  @!d@TTU\`2lockf@`  34\A62 8@3 8\A8(9$94 4,<bp3z \{ ~ x 0 d|  484 d4  4 ,4 84 D5 P@5 \l5 h5t55 6H6 t6666 (7 X7 7 7 7 8  D8 0p8<8L8X8 d 9 pL9 |x9999(:P:3,:T:4@4l44445H5t5555$6P6|666747l7777 8L8x8888(9T9999:3@4P l4D 4D 4d 4\A5< H5< t5< 5l 5 $6 P68 6\A7D 47D l7D 7D 7D 7D 8< L8< x8D 8\A8\A8t (9$T9 ,:@ 9 4,9< 9< T:\ADb;3@4 l4 4 4 4 5| H5| t5| 5ؑ 5 5\A$6T P6 |6 66\A7 47 l7 7 7 7 8 L8 x8 8Ȕ 8@ 8(9$T9 ,: 9И 4,9$ 9 T:\AHb4<$ Ț ( devopndeviodevwaitdevindevoutdeviocdevcls3@4ě l4 4 4؛ 4D 5 H5 t5 5 5t 5\A$6 P6 |6 66p 7 47 l7 7 7 7 8 L8 x8 8P 8\A8(9$T9 ,: 9ܩ 4,9 9 T:Lb=. .. 3@4 l4 4  4D 4L 58 H5 t5 5T 5 5\A$6P P6X 6d 7 47 l7H 7 7# 7X$ 8$ L8P- x88p 8 8X- (9p- T9- ,:,. 90 4- 90 9|0 :$. T:b5 H5$ t5 5>5`>6<88888(989;49T:cQ ... ...(FtF(F G(F4GTTU3@4,ul4Ъ444d 5ȫH5$t555@5\A$6P6|646747l7$7(77L 8hoL8Hx88_8088(98T9[,:99;499@9T: cR3 4@<5ȫH5$t55;5;68_8088(989;49 cT3 4>5ȫH5$t55>5`>68_888(989;49T: cT,H D8 \UDUU  ` h @WEVrdroot WEVpZ  08(D <  gD( {/mnt]h h@@<@`bT 08(gD <  gD( @@<@`bTU D {p<|7@@@@@@@@@7@@@@@@@@@.\nA hDDD0AhDiD*#iD*#)[A hDmD,mD,PX>k~AhDnD+nD++ cAhDhDhD,"AhDhDhD9z-EǯAhD9zhD9zhD9z.tAhD9zhD9zhD9z/U AhD9zD kD k@ЅTChD9zhD9zhD9z2l AhD9zhDhDf3ЬDAhDjD9jD94uVMAhDhDhD5 GAhDhDhD6sũAhDhDfhDf7뭞AhDfnDL-nDL-8xvAhDfhDfhDf9H?AhDfhDChDC:?ChDfhDfhDf;>XAhDChDChDC<ъAhDChDChDC=XNpAhDChDChDC>`PC=hDQ*iDD ԘjanDIjDc'jDc'HB {$=!mDvmDvmDv-F?!mDvmDvmDv!mDvmDvmDvJ!mDvmDvmDv1!mDvmDvmDvx[!mDvmDvmDvH!mD ImD ImD I-y!mD ImD ImD I}ݓ!mD ImD ImD IA!mD ImD ImD I!mD ImD ImD IIZcv!mD ImD ImD I=Y!mD ImD ImD IW!mD mD mD / !mD mD mD /1!mD mD mD 0o!mD mD mD 0?!mD mD mD 1ˇ!mD mD mD 1jS!mDWmDWmDW2kM!mDWmDWmDW2WS!mDWmDWmDW3CM!mDWmDWmDW3J!mDWmDWmDW41(.!mDWmDWmDW4$t+!mDWmDWmDW5H'!mDWmDWmDW5M!mDWmDWmDW6S!mD>mD>mD>6 r!mD>mD>mD>7.!mD>mD>mD>7XR!mD>mD>mD>81!mD>mD>mD>8nX!mD>mD>mD>9#_>!mD>mD>mD>9ѠV!mD>mD>mD>:%!mD>mD>mD>: 1!mDmDmD;>!mDmDmD;gJ!mDmDmD<tw!mDmDmD<!mDmDmD=!mDmDmD=o`camDmDnDGQ!mDemDenD! #camDemDenD! $R"!mDemDenD! $amDemDenD! %εWC!mDemDenD! %_,amDemDenD! &T!mDemDenD! & amDemDenD! 'L'!mDemDenD! 'NGamDemDenD! ( !mDemDenD! (4amDemDenD! )CLv!mDemDenD! )Fw(amDmDnD! *W~?!mDmDnD! *wamDmDnD! +*6@!mDmDnD! +JoamDmDnD! ,!mDmDnD! ,&amDmDnD! -*n!mDmDnD! - amDmDnD! .i!mDmDnD! .4amD(mD(nD! /Jv[!mD(mD(nD! /9e\amD(mD(nD! 0eZy!mD(mD(nD! 0Q-amD(mD(nD! 1?僚!mD(mD(nD! 1ŋamD(mD(nD! 2!mD(mD(nD! 2pamD(mD(nD! 3>C !mD/ mD/ nD! 3VuamD/ mD/ nD! 4[!mD/ mD/ nD! 4* amD/ mD/ nD! 5J!mD/ mD/ nD 5%҉amD/ mD/ nD 6F !mD/ mD/ nD 6jamD/ mD/ nD 7wFD!mD/ mD/ nD 7HamD/ mD/ nD 8Q!mDU mDU nD 8,amDU mDU nD 96RZ!mDU mDU nD 95amDU mDU nD :v1!mDU mDU nD :[a=amDU mDU nD ;e!mDU mDU nD ;a{amDU mDU nD <[5!mDU mDU nD <'!mD`!mD`!nD >NamD`!mD`!nD ?O!mD`!mD`!nD ?aamD`!mD`!nD @cq!mD`!mD`!nD @*amD`!mD`!nD Am!mD`!mD`!nD A$ڍamD`!mD`!nD B!mD`!mD`!nD B4HamD!mD!nD C[!!mD!mD!nD C$amD!mD!nD D!mD!mD!nD DamD!mD!nD E-gi!mD!mD!nD EgamD!mD!nD FI!mD!mD!nD FOV!amD!mD!nD G !mD!mD!nD GC"amD!mD!nD H(qe!mD"mD"nD HVamD"mD"nD I55E!mD"mD"nD Ia`amD"mD"nD Jqo!mD"mD"nD J ETamD"mD"nD K3gj!mD"mD"nD K'gamD"mD"nD LėM!mD"mD"nD L{ _amD"mD"nD+S M{*d!mD*#mD*#nD+S M@amD*#mD*#nD+S N!mD*#mD*#nD+S NamD*#mD*#nD+S OAY!mD*#mD*#nD+S OVTamD*#mD*#nD+S 5>!mD*#mD*#nD+S +amD*#mD*#nD+S >e!mD*#mD*#nD+S $#amD*#mD*#nD+S +!mD*#mD*#nD+S x[amDF#mDF#nD+S us>!mDF#mDF#nD+S DgamDF#mDF#nD+S ka.V!mDF#mDF#nD+S $RamDF#mDF#nD+S wfi!mDF#mDF#nD+S PamDF#mDF#nD+S wÐ!mDF#mDF#nD+S xamDF#mDF#nD+S -4!mDF#mDF#nD+S i|amD[$mD[$nD+S Sf!mD[$mD[$nD+S qamD[$mD[$nD+S ^!mD[$mD[$nD+S 'IamD[$mD[$nD+S d=!mD[$mD[$nD+S %5@amD[$mD[$nD+S Xq>!mD[$mD[$nD+S VUamD[$mD[$nD+S Ͼ\!mD[$mD[$nD+S OoamD[$mD[$nD+S Ed!mDs$mDs$nD+S էamDs$mDs$nD+S O!mDs$mDs$nD+S KamDs$mDs$nD+S <!mDs$mDs$nD+S OMamDs$mDs$nD+S ԁO!mDs$mDs$nD+S  xamDs$mDs$nD+S aa!mDs$mDs$nD+S C6amDs$mDs$nD+S kI9!mDs$mDs$nD+S famD %mD %nD+S ;;!mD %mD %nD+S n^amD %mD %nD+S *!mD %mD %nD 触amD %mD %nD F!!mD %mD %nD 0tamD %mD %nD @~!mD %mD %nD amD %mD %nD !mD %mD %nD =amD%&mD%&nD  !mD%&mD%&nD \amD%&mD%&nD ;c3!mD%&mD%&nD  samD%&mD%&nD !mDc'mDc'nD (HVxamDc'mDc'nD )lJ !mDc'mDc'nD )>amDc'mDc'nD * R!mDc'mDc'nD *q%amD(mD(nD +$U!mD(mD(nD +鯦amD(mD(nD ,•!mD(mD(nDX ,9 amD(mD(nDX -_1z!mD(mD(nDX -tLBamD(mD(nDX .!mD(mD(nDX .UUbamD(mD(nDX /&!mD(mD(nDX /TamD(mD(nDX 0rG!mD )mD )nDX 0-DamD )mD )nDX 1!mD )mD )nDX 1mamD )mD )nDX 2E:n]!mD )mD )nDX 24-FRamD )mD )nDX 3[!mD )mD )nDX 3uamD )mD )nDX 4z#O!mD )mD )nDX 4xb.amD')mD')nDX 5t!C!mD')mD')nDX 5kamD')mD')nDX 6g&!mD')mD')nDX 63amD')mD')nDX 7B!mD')mD')nDX 7ޏcamD')mD')nDX 8~-!mD')mD')nDX 8z(OamD')mD')nDX 9!mD')mD')nDX 9]amD')mD')nDX :=,!mDQ*mDQ*nDX :/vamDQ*mDQ*nDX ;|7y!mDQ*mDQ*nDX ;ŦWhamDQ*mDQ*nDX <:!mDQ*mDQ*nDX <_F_amDQ*mDQ*nDX =<0!mDQ*mDQ*nDX = ՁamDQ*mDQ*nDX > "!mDQ*mDQ*nDX >ramDQ*mDQ*nDX ?N!mDT*mDT*nDX ?6amDT*mDT*nDX @e!mDT*mDT*nDX @f:amDT*mDT*nDX A -<!mDT*mDT*nDX AbamDT*mDT*nDX B3[!mDT*mDT*nD BK16amDT*mDT*nD Cf!mDT*mDT*nD CkđamD+mD+nD D+@!mD+mD+nD DnamD+mD+nD Em{!mD+mD+nD E4-XamD+mD+nD F?&!mD+mD+nD FamD+mD+nD G!mD+mD+nD GcamD+mD+nD Hr!mD+mD+nD H)wamD,mD,nD IT!mD,mD,nD Iq~amD,mD,nD J}Cz!mD,mD,nD J]amD,mD,nD K!mD,mD,nD KODamD,mD,nD Lr̊!mD,mD,nD L|ԪamD,mD,nD MT!mD,mD,nD MMamD,mD,nD N\@;!mD,mD,nD Nԏ`damD,mD,nD O!mD,mD,nD Or!mD,mD,mD, e!mD,mD,mD,lq!mD,mD,mD,vh!mD,mD,mD%3>h"!mD,mD,mDR 5}L!mDL-mDL-mDL-iCpB!mDL-mDL-mDL- Vo!mDL-mDL-mDL-!mDL-mDL-mDL-?!mDL-mDL-mDL-!mDL-mDL-mD5(z!mDL-mDL-mD6y!mDL-mDL-mDL-5j!mDL-mDL-mDL-$!mDD-mDD-mDn7*LnDnD9znD9z`DֵnDfnD/ nD/  P3v)nD"nD*#nD*#*gnD %nD%&nD%&1nDV'nDV'nDV'/tmp/disktab.shadow!8nD(nD(nD(/tmp/fstab.shadowjnDQ*nDQ*nDQ*/tmp/resolv.conf.shadow nD+nD+nD+/tmp/hostsqxc nDL-DDbD kDDh6D!Ds$Ds$ffp'Y DV'DT*DT*pDCDL-D50Dx.=HDB3DD{ 86sDZbDvDv  ( 0 8 @ v:zzU*BTe.QwN~h`%# )Ooү,BFl t&a6wk I*'R!h2-az-|;ֽTGqC ^vCA 0Vv?oLqGQӱNJ@X2_; 8+$;r4}SIzKQ+DtX BԵ l/{m\-i٬lWxqi?+hAdXfO8|rE|X5QTABrsr>K;ٕ;lӆi >ch56ivS8` U̜df vkڂ&|X0t ?YyarOB1X)7ؼ XR1*y$6˕$VdLH 15 G"SC(ou)A24F;jv#׀T!l i^UD?1,BVG]q. YRjN-tDQ";|CafpN]N!-{b80 ٥+ɾ7C-lU3@6A\wpƉ2 bq]l>743)x=Rt²r=W1}*v$/3w5`ډS?JPe{ \o"؉/ ,%ZmUP.}085P֡ѲoO+$2ЋFU"eP"GBea:vе$VΦe;Gqv.u"4"XHCUk+E3}p>Q`^Fq'4'Ҥ]CUPI_s}?CLLt -}@jF=|k=wRы}^vg﯏~70Ɵ+F}TΪ(P|a^NXTy%ivh[]q>6/18ض jRU`8<ZڜedO(Td0eĦ"Dd\^MQ^_0@y\@. Jlb"kCX #yvU4#=8b@gUͳ"K&$Δ?UmH2~;b +i";co+3^mݩk :s'´*^u{u IeS`&"m7iSV%pk-q;yPV? عuZtb=, "ERANхC wyn"`k{w0><5ڝVz{ . .. catchmod.chgrp. cp dd df edexpr .hostname ksh sh ln lsmkdir. mteject. mv pax tarcpio . rmstty .sync .ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP  . .. pppfirmware)groupspwd.db protocolsservices disktab fstab resolv.confL hosts ... ... ... ... . .. bin dev etc mnt mnt2 sbin tmp usrvarinstbin .profile  install.md upgradeinstall install.subftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs ... . .. binmdecsbinshare . .. ftpgrep .fgrep.egrep.gzip .gunzipgzcat.less .more .\sed . .. . .. . ..misckeymaps . .. termcap ... . .. tmp db runempty ... ... ... ... . ..chown.dhclient disklabeldmesg.fdisk.fsck . fsck_ext2fsfsck_ffsifconfiginit . kbdmknod.mount. mount_cd9660u mount_ext2fsu mount_ffs mount_msdos mount_nfsnewfs. newfs_msdosping .ping6.reboothalt .route.rtsol.umount wicontrol dhclient-scriptd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse*) M wsmouse$U c 62 $U 600 ;; wskbd*) M wskbd$U c 61 $U 600 ;; tty[C-F]*) U=${i##tty[C-F]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 54 $o 660 dialer uucp M cua$U c 54 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 dodisk svnd $U 19 19 $U 2048 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; ramdisk) R pty0 rd0 cd0 cd1 st0 st1 wd0 wd1 wd2 wd3 wd4 sd0 sd1 sd2 R sd3 sd4 bpf0 std ;; all) R ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 R cd0 cd1 rd0 tun0 tun1 tun2 tun3 bpf0 bpf1 bpf2 bpf3 bpf4 R bpf5 bpf6 bpf7 bpf8 bpf9 pty0 xfs0 ss0 ss1 ch0 ptm local R wscons pci iop0 iop1 uall tuner0 radio0 speaker audio0 uk0 R random lkm tty00 tty01 tty02 tty03 crypto pf systrace wd0 R wd1 wd2 wd3 raid0 raid1 raid2 raid3 std st0 st1 fd ;; wd*|sd*|raid*|ccd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; raid*) dodisk raid $U 71 71 $U 0;; ccd*) dodisk ccd $U 21 21 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi #!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]=";chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]=";chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]=";chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]=";chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M drum c 3 0 640 kmem M klog c 6 0 600 M xf86 c 2 4 600 M reload c 2 20 640 kmem ;; xfs*) M xfs$U c 51 $U 600 ;; uk*) M uk$U c 28 $U 640 operator ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; ss*) M ss$U c 29 $(($U*16)) 640 operator M nss$U c 29 $(($(($U*16))+1)) 640 operator M enss$U c 29 $(($(($U*16))+3)) 640 operator RMlist[${#RMlist[*]}]="scan$U" MKlist[${#MKlist[*]}]=";umask 77;ln -s ss$U scan$U" ;; speaker) M speaker c 99 0 600 ;; tun*) M tun$U c 33 $U 600 ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pf*) M pf c 39 0 600 ;; pci) M pci c 71 0 600 ;; lkm) M lkm c 35 0 640 _lkm ;; iop*) M iop$U c 73 $U 660 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; crypto) M crypto c 47 0 ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; uscanner*) M uscanner$U c 69 $U 660 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; uall) R ttyU0 ttyU1 ugen0 ugen1 ulpt0 ulpt1 uhid0 uhid1 uhid2 uhid3 R uscanner0 urio0 usb0 usb1 usb2 usb3 usb4 usb5 ;; wsmux|wsmouse|wskb . ..MAKEDEVttyp0/ptyp0/ttyp1/ptyp1/ttyp2/ptyp2/ ttyp3/!ptyp3/"ttyp4/#ptyp4/$ttyp5/%ptyp5/&ttyp6/'ptyp6/(ttyp7/)ptyp7/*ttyp8/+ptyp8/,ttyp9/-ptyp9/.ttypa//ptypa/0ttypb/1ptypb/2ttypc/3ptypc/4ttypd/5ptypd/6ttype/7ptype/8ttypf/9ptypf/:ttypg/;ptypg/<ttyph/=ptyph/>ttypi/?ptypi/@ttypj/Aptypj/Bttypk/Cptypk/Dttypl/Eptypl/Fttypm/Gptypm/Httypn/Iptypn/Jttypo/Kptypo/Lttypp/Mptypp/Nttypq/Optypq/Pttypr/Qptypr/Rttyps/Sptyps/Tttypt/Uptypt/Vttypu/Wptypu/Xttypv/Yptypv/Zttypw/[ptypw/\ttypx/]ptypx/^ttypy/_ptypy/`ttypz/aptypz/bttypA/cptypA/dttypB/eptypB/fttypC/gptypC/httypD/iptypD/jttypE/kptypE/lttypF/mptypF/nttypG/optypG/pttypH/qptypH/rttypI/sptypI/tttypJ8uptypJ/vttypK/wptypK/xttypL/yptypL/zttypM/{ptypM/|ttypN/}ptypN/~ttypO/ptypO/ttypP/ptypP/ttypQ/ptypQ/ttypR/ptypR/ttypS/ptypS/ttypT/ptypT/ttypU/ptypU/ttypV/ptypV/ttypW/ptypW/ttypX/ptypX/ttypY/ptypY/ttypZ/ptypZ/rd0aM/rrd0a/rd0cM/rrd0c/cd0aM/rcd0a/cd0cM/rcd0c/cd1aM/rcd1a/cd1cM/rcd1c/ st0rst0M/nst0M/nrst0/est0M/erst0/enst0/enrst0 st1rst1M/nst1M/nrst1/est1M/erst1/enst1/enrst1wd0aM/rwd0a/wd0bM/rwd0b/wd0cM/rwd0c/wd0dM/rwd0d/wd0eM/rwd0e/wd0fM/rwd0f/wd0gM/rwd0g/wd0hM/rwd0h/wd0iM/rwd0i/wd0jM/rwd0j/wd0kM/rwd0k/wd0lM/rwd0l/wd0mM/rwd0m/wd0nM/rwd0n/wd0oM/rwd0o/wd0pM/rwd0p/wd1aM/rwd1a/wd1bM/rwd1b/wd1cM/rwd1c/wd1dM/rwd1d/wd1eM/rwd1e/wd1fM/rwd1f/wd1gM/rwd1g/wd1hM/rwd1h/wd1iM/rwd1i/wd1jM/rwd1j/wd1kM/rwd1k/wd1lM/rwd1l/wd1mM/rwd1m/wd1nM/rwd1n/wd1oM/rwd1o/wd1pM/rwd1p/wd2aM/rwd2a/wd2bM/rwd2b/wd2cM/rwd2c/wd2dM/rwd2d/wd2eM/rwd2e/wd2fM/rwd2f/wd2gM/rwd2g/wd2hM/rwd2h/wd2iM/rwd2i/wd2jM/rwd2j/wd2kM/rwd2k/wd2lM/ rwd2l/ wd2mM/ rwd2m/ wd2nM/ rwd2n/wd2oM/rwd2o/wd2pM/rwd2p/wd3aM/rwd3a/wd3bM/rwd3b/wd3cM/rwd3c/wd3dM/rwd3d/wd3eM/rwd3e/wd3fM/rwd3f/wd3gM/rwd3g/ wd3hM/!rwd3h/"wd3iM/#rwd3i/$wd3jM/%rwd3j/&wd3kM/'rwd3k/(wd3lM/)rwd3l/*wd3mM/+rwd3m/,wd3nM/-rwd3n/.wd3oM//rwd3o/0wd3pM/1rwd3p/2wd4aM/3rwd4a/4wd4bM/5rwd4b/6wd4cM/7rwd4c/8wd4dM/9rwd4d/:wd4eM/;rwd4e/<wd4fM/=rwd4f/>wd4gM/?rwd4g/@wd4hM/Arwd4h/Bwd4iM/Crwd4i/Dwd4jM/Erwd4j/Fwd4kM/Grwd4k/Hwd4lM/Irwd4l/Jwd4mM/Krwd4m/Lwd4nM/Mrwd4n/Nwd4oM/Orwd4o/Pwd4pM/Qrwd4p/Rsd0aM/Srsd0a/Tsd0bM/Ursd0b/Vsd0cM/Wrsd0c/Xsd0dM/Yrsd0d/Zsd0eM/[rsd0e/\sd0fM/]rsd0f/^sd0gM/_rsd0g/`sd0hM/arsd0h/bsd0iM/crsd0i/dsd0jM/ersd0j/fsd0kM/grsd0k/hsd0lM/irsd0l/jsd0mM/krsd0m/lsd0nM/mrsd0n/nsd0oM/orsd0o/psd0pM/qrsd0p/rsd1aM/srsd1a/tsd1bM/ursd1b/vsd1cM/wrsd1c/xsd1dM/yrsd1d/zsd1eM/{rsd1e/|sd1fM/}rsd1f/~sd1gM/rsd1g/sd1hM/rsd1h/sd1iM/rsd1i/sd1jM/rsd1j/sd1kM/rsd1k/sd1lM/rsd1l/sd1mM/rsd1m/sd1nM/rsd1n/sd1oM/rsd1o/sd1pM/rsd1p/sd2aM/rsd2a/sd2bM/rsd2b/sd2cM/rsd2c/sd2dM/rsd2d/sd2eM/rsd2e/sd2fM/rsd2f/sd2gM/rsd2g/sd2hM/rsd2h/sd2iM/rsd2i/sd2jM/rsd2j/sd2kM/rsd2k/sd2lM/rsd2l/sd2mM/rsd2m/sd2nM/rsd2n/sd2oM/rsd2o/sd2pM/rsd2p/sd3aM/rsd3a/sd3bM/rsd3b/sd3cM/rsd3c/sd3dM/rsd3d/sd3eM/rsd3e/sd3fM/rsd3f/sd3gM/rsd3g/sd3hM/rsd3h/sd3iM/rsd3i/sd3jM/rsd3j/sd3kM/rsd3k/sd3lM/rsd3l/sd3mM/rsd3m/sd3nM/rsd3n/sd3oM/rsd3o/sd3pM/rsd3p/sd4aM/rsd4a/sd4bM/rsd4b/sd4cM/rsd4c/sd4dM/rsd4d/sd4eM/rsd4e/sd4fM/rsd4f/sd4gM/rsd4g/sd4hM/rsd4h/sd4iM/rsd4i/sd4jM/rsd4j/sd4kM/rsd4k/sd4lM/rsd4l/sd4mM/rsd4m/sd4nM/rsd4n/sd4oM/rsd4o/sd4pM/rsd4p/bpf0M/console tty memkmemM/nullM/zeroM/stdin/stdoutstderrksyms/drumM/klogM/xf86M/preloadwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: dialer:*:117: nogroup:*:32766: nobody:*:32767: dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs # emacs-style command line editing rootdisk=`dmesg|sed -n -e '/OpenBSD /h' -e '//!H' -e '${ g p }'|sed -n -e '/^root on \([0-9a-z]*\).*/{ s//\/dev\/\1/ p }'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet -alias $old_ip_address $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet alias $alias_ip_address netmask \ $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route delete default >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route add default -iface $router >/dev/null 2>&1 else route add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } if [ -n "$new_network_number" ]; then echo "New Network Number: $new_network_number" fi if [ -n "$new_broadcast_address" ]; then echo "New Broadcast Address: $new_broadcast_address" fi case $reason in MEDIUM) ifconfig $interface $medium sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || \ [ "$reason" = REBOOT ] || \ [ -z "$old_ip_address" ] || \ [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet -alias $new_ip_address $medium delete_old_routes exit 1 ;; esac exit 0 MDFSTYPE=msdos MDXAPERTURE=2 ARCH=cats md_installboot() { } md_prep_disk() { local _disk=$1 _resp typeset -l _resp cat <<__EOT $_disk must be partitioned using an BSD or an MBR partition table. BSD partition table or MBR partition tables can be created by OpenBSD. It is more a question of firmware compatibility disk portability. (Once we can figure out what filesystems ABLE can boot) __EOT while :; do ask "Use BSD or MBR partition table?" BSD _resp=$resp case $_resp in m|mbr) export disklabeltype=MBR md_prep_MBR $_disk break ;; b|bsd) export disklabeltype=BSD md_prep_BSD $_disk break ;; esac done } md_prep_MBR() { local _disk=$1 if [[ -n $(disklabel -c $_disk 2>/dev/null | grep ' BSD ') ]]; then cat <<__EOT WARNING: putting an MBR partition table on $_disk will DESTROY the existing BSD partitions and BSD partition table. __EOT ask_yn "Are you *sure* you want an MBR partition table on $_disk?" [[ $resp == n ]] && exit fi ask_yn "Use *all* of $_disk for OpenBSD?" if [[ $resp == y ]]; then echo -n "Creating Master Boot Record (MBR)..." fdisk -e $_disk >/dev/null 2>&1 <<__EOT reinit update write quit __EOT echo "done." echo -n "Formatting 1MB MSDOS boot partition..." gunzip /dev/null 2>&1 echo "done." return fi cat <<__EOT **** NOTE **** XXX ************** Current partition information is: $(fdisk $_disk) __EOT fdisk -e $_disk cat <<__EOT Here is the MBR configuration you chose: $(fdisk $_disk) Please take note of the offsets and sizes of the DOS partition, the OpenBSD partition, and any other partitions you want to access from OpenBSD. You will need this information to fill in the OpenBSD disklabel. __EOT } md_prep_BSD() { local _disk=$1 cat <<__EOT No special setup should be required to label using BSD disklabel. however if the disk has previously been partitioned in another manner, it may be necessary to wipe existing partition tables before proceeding. dd if=/dev/zero of=/${_disk} bs=512 count=10 disklabel -c ${_disk} __EOT } md_prep_disklabel() { local _disk=$1 _q md_prep_disk $_disk case $disklabeltype in BSD) ;; MBR) cat <<__EOT You *MUST* setup the OpenBSD disklabel to include the MSDOS-formatted boot partition as the 'i' partition. If the 'i' partition is missing or not the MSDOS-formatted boot partition, then the kernel required to boot OpenBSD cannot be installed. __EOT ;; *) echo "Disk label type ('$disklabeltype') is not 'BSD' or 'MBR'." exit ;; esac disklabel -W $_disk >/dev/null 2>&1 disklabel -c -f /tmp/fstab.$_disk -E $_disk } md_congrats() { cat <<__EOT Once the machine has rebooted use OpenFirmware to boot into OpenBSD, as described in the INSTALL.$ARCH document. The command to boot OpenBSD will be something like 'boot (hd0)bsd'. __EOT } _set xbase xetc xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="bsd base${VERSION}.tgz etc${VERSION}.tgz" : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat <<__EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configure the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -gt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "Sorry, $resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV >/dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $(stripcom /tmp/myname) ask_yn "Enable network using configuration stored on root filesystem?" yes [[ $resp == y ]] && enable_network manual_net_cfg cat <<__EOT The fstab is configured as follows: $( is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets finish_up t 127.0.0.1 localhost ::1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= while :; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" [[ $resp == $_password ]] && break echo "Passwords do not match, try again." done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab kbdtype my* *.conf *.tail host* ttys; do [[ -f $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db /mnt/bin/dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up #!/bin/ksh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while :; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} _ps=$_size if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_pp == $SWAPDEV || $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_ps if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done >$FILESYSTEMS : $(( _i += 1 )) done done cat <<__EOT OpenBSD filesystems: $(<$FILESYSTEMS) The next step *DESTROYS* all existing data on these partitions! __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "Ok, try again later." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >>/tmp/fstab while read _dev; do [[ $_dev == $SWAPDEV ]] || \ echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done <$SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp ( cd /tmp; rm -f host* my* resolv.* dhclient.* ) cat >/tmp/hosts <<__EOT ::1 localhos (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x ELFa(t44 (`d`d$$\k 444OpenBSD -LTP@0! MP@ -0LM 0PS`@p0 x/ P000`P`0 R ^ *0 0 Q P:00nn 0S SX 00-SL@  @1S@DQ@Dt @Dt0  -LM$@0S0S -< L04S0 00 h1ꔫz 0S00ꘫ -LM`pQ 0S5/㶐p@PPPQ P Q088 82Q  霫{{ p-PLM@@P` ph 0-@L PP \b['" 0OSP8  (00SPM[ꜫ{{T -鸢帒<LMP000圂S0: pP=xw @T` 8KX0  \ , (Ÿ8 =& RŸ8  0 8 ?0000S0A  10S000 B Z 1p0S0 Sl+ h10S X1X!0T!0SH!@1  !8 700011000S `R PpU/?0p @0S 0S  0< @0S 0Sl ?@x4+}~<~~ ~T8h|u -LZ 00@x -LO0 -LG P00 -L<0̮ -0L000<@0@ -0L00<x0x -Lp0 -Lh0` -L> 0-LMK Pp@81 0Y  R@ 0b0CS$,,,,,,,,,,,,,,,,,,0D0E0J0AS00 0xS S *S 0S ", 0 $B>0 =>04ذ p-LM KPC qr1 _Y PY 0b0CS5t`P$K4`P%%K5 `P*%F:`P!%O1 VU00 0xS S *S`P0E" $ VU "0 0 (=0 =p4ذ 0-x0LP h0   aAq 0A0q08@0P 0R0 : 0@x0 R0 @x - L =똤 - L =똤 - L v=똤 - L m=똤 -LMd#\#T'.P00s D@00Cs0 00Cs0cn(X̮ -8rLP,20  |&P ,10S0q QP1000 A0! 1]&P0 1!R&0P00 t=XLQPa` \10S 0@P4 $A0P 0P 0PX0  Rp: P 0 0; S0`@%,"~@0h0Q X<Phah@M̮x <(8H 0-LM@KgFP tW0: S\L KP5"P0000 0\.pq\0S0000阤m8@ 0-L1 R 1 0Su*Q  1Q   4A ЩP 0!0  tW l.0 0.8!0 0 0 0  P0    00 00000 0000 @0  W00 \D L000 VB0 0 00(00<@x -0LM 0RE0RQ0R_ x00 l@ R R*T bQ m300,00S hT<x -`1LMP``p@Q #XP@  . |0S@ V0/T0V000 0T0 0 0 0S00V 0pd  tk;P@0 fR `!* 00 0Rb10 00x`8t -pLuM0d yK,0 f 1b1 P a!  B=9! = 1 8. XP@10 'r/ p`+Pno JP PoOK 0!dPP2A ^ R  x1 RtVOKd0`!u2A K  R ,1,R@Kd0!b2w?KA7v?K!00/C#b10 ! 0 됀K p`0d wKP=2뉁 @v?K &00 ,0SD,.A?܀MbT -LM⁃@N~@ -LG! - L0 P `0@%,"0_,p6q . 2`p0-  P 0 pWp@0P`l 0S0C0T[:P00  Z 8; U0@̮\< -L Mȡ00 `@%,"0,pbq`C 2[ 8c8d0 K00 , PQ4 `0pSI 0SF 匧PQ4"`0 K03K,` p  @0 pR' 0S$ nV0`PP  lU@0 pR<0 0S@0p R 0Sxm -GMLM2 `@P d "Eep?@E 0P8갞````F-K0 B BJ0 @bTQ7A~K pGpG@ƆP 4 04 04 =K 0C 0CD $ $d ">P-0-S DD9 8zT0$(uT^p$px x -L06 8(K -LM`P-P( @(K,pK 0  (0@S@T -L M0@p00 0Sf PP 0S nSW =IP0`0@Q P QIQG  0V0P . 0' Y0  0000V 0`0 ,K, ?R0S@p @ꋁ0"Sl 08Y000 LPH00D 0oSP 8DT(D -||LxM@P`pd#dpA P0@$S3th`p2`2`p22qx2 Rl2L2\"0QQ@c (2 R}`K2PpUS0S'pW PU `@WUP@Tjo U P1 R  \W  j&0pS `K@cP40: S S' AP0 R 0  DWP pjO0S  D $S S坄PPL S}<744`5444$p l܃ -LMp K2@T` P P@ Tj_ 00T 0-x0L0PS0@Q  [P 0S(0 R00 R0 P-L` 0SB7nS 0@ ,P@l0PP@p` ,Pp@0oS` QR  -蠟L0S 0 R0 R 1 X @ Pp`0DS 0 PUjOvP D0\j/T0 i)joj@44 p-L M `K P@@0s  pp0 -LM, pPo5G"%$,0O"#!,0 0o -LMP, 0 异2  B 0R00 0`p @T TP+ =+4 Tv TtE+ 2+Te Tc:+07+,4  0凂 Q _ZP@E0 Z/ s ppl1 R/ @pTg' AZ`P;T0 o TP@0  PMToI  `P@0:x P@X*0 * * 4 { 5Y@A84@P4\(_ -0LMPpP`)0 R @;$0  0 @0 R BW@ $0@Tj_\ K$K.@@@$00 44p|4؄ -1L4M`, P!10 00 @,0P 1P寁TBp< AH0`JZ/ 0@K 0@`T9 T7 <* )*T) T' 1*.*T T &*#* 0@K,0<T00 mZj *0  * * 02P@.0 d I0PKY@4T -`L@SPP pJ0S p;Ppށ阤 -LM`@P0p& `P@ }0S T $ 0 $$ }x -0L  됫 -qLMʠ`0 P6 \P0d .40( 8%P<(@dl 3@ed, 0C0  $H0QZ T* Z *D  Tą -HL M, 0 [PnP #1RL0S @D@030( )Pp g@)B`@(v#,Pc P 00 0b0  0 0$ D0QZ Tq*,Z m*D 0Sȅ -AML ML6 DDf@Pp, 0&_pq ?0@8Szꔶص$<D5 WPp0S HP4 R>:P42Ptp4 8$ 0@bT<4 Q T Z\ P`+ P  PP 0SP(0  P7P<4 08$ <4 P<$0R08$R0S ?P 8cDD~PP B.K B B(ۃP@ 4P|p|0S YNBK@@-P 8$RP@0DP@Tj_0T,2 R  08 $P8P1 RbBKHHAP\ yP4 ,P0 + 0  HP zP`t 04D000$ 04| 04T  00T=P` 24P` P P | P P`x}2 lMą$p 5Іxh5, ؆܆:DPp -PLMP eP` @ pK C80S@@T~ 00S00,DT 0-P@ 0LSP  0S0S0  -LM Mß'}KpG` pG , P@qPq #T@U h`|P 0S 㫾PP @KA <0A؉  3) 0QqA9  ~9@X tN¾2 ,0S ,}9@TV/p@R P. ᦾ᤾KAA }P9C42 R uOKk;P~~P [; Lr~aMK@D0 @D!(@|[z0Sp \~0SQz0S ㏸ @P~8M~SuK+;P-]KZ PP]K  IP@U0 RwIKA 0h}PA`<0StPP@) 0cLT`L( 55ذ(ćЇ h, -L4M⠘在T `D0, *} 0DSpH  TTX' R  08S08pW $} @TP 0S T 7p DW7' 0|0WSFPBO0gWpW' 7` |P h7Qp`' 47W0 |  p 7 W$'| @ 6pW'|  p6W&|0S   R |6pWt0&|0S$ $  R <6pW4`0\&|0S( (  R 5pW 0 &|0S, , R 5pW0%o|0S0 0 R |5pWt0%_|0S4 4 R <5pW4`0l%O|0S8 8 R 4pW 00%?|0S $pWH0%3|L /|P +|T '|4W"| ,0S ,!0SR p44W($(H&0P0 pW 4p[PTKPK?(p3PTxWC@$0($(P{CP)0BOSl "l Rp^ X3pWßL0#P{0Stt3P p3W#0{p|P_0BOSl Xl RUp^ 2pWß0 #P{0St t 2R P2pWH0"{x0 2pW "{x0 1pW"~{x0 1pW\"s{x0 1pW4"h{x0= pl1lW"T4pPBOl0 $1pW!J{l0 0pW!?{l0 p0W!|P 0BOS 0 p0Wt@!t0{40H@KLKL0 000K{  p {58Ll7@PhlptxĈԈ <R (,8@8P\dt`ltxx, -LM` K$)PUp@ PP T P UjO 0 0-x0L0PS0@Q  kP 0S(0 R00 R05 P-L` 0SR.nS 0@ , P@l0PP@p` , Pp@0oS` aI 5 -PLM`p 0S'P_@\@@PP 0 pw%8I -LM@p`PC Tp KzP  0S -SH0=1@ !@!= P 0@0@DTȉ -L M$$@$$$ $0@̉Dt p-LM@7 PPP'PP & Pp Px P` ` PL P @ 0Hpp$Hpą( p-GML`1 M Xa T!P0@4 8!Xp ?P -K BoP B I1Q0@cTQ?ANK@D0@D4 zP# $04 04 =K 0C 2PvPx Pl vu0$L"--P@ 4UH> (pl$pȅċԋ -L0. ( -LM`P P( @(K,pK 0  (0@SٹH -L M0@p00 0Sf xPP 0S nSW =& P0`0@Q P QIQG  0V0P . 0' Y0  0000V 0`0 ,K, ?R0S@p @hu0"Sl 0~,Y000 LPH00D 0oSP g,DT(D -LNu -ML M .0~`P,0 -Wp B0@3S`lP$Pl8T|XX= <>L P  P<w P  ,< = =XLP d x=,L&P < \=,<|-<< << ; ;; ; ;;,; ;;,;;,;;,p;l; \; T;vP; ~@;<; w,; $;e#;,k;o; d:h:+]:a: `b0FSQ :M>KQ0C0C p2p   InK`F`F5P@ $`uFY0S 4: S < FMKHHș@ ( "Pv9؉9^@h9 9T D PQ R$ U9 P^ T Q R U(0  ܤ0J   H/Z 80380S5 0S  8 R 8 R8 R  % R\8 h8 R`8 R 5 Se  88 Rk i U Up80l* X00R00S7 P 0@ P 10135:3P Y X7 R 0B$ 70S4 \7 R R0$ 70S4 7 R 7 R\$ 60S4 60S4 6 0 S4 0$ Sa4%S04 RPؔ6Y> A  Д0AP,  6X@JP dV000TU 3 5#:,P( 0V00X@6h1h ? 6``U 0#5 %* % U UU 4S X0 4  \ P  @ؔ  YRJ^   $X T \% P ؔ PY0 <U U%1 ATE Uc ccXe 00S.K05 \pt \ IC6<0S@#/Q 0SKoP\0@  TS050P5 P  P㬄 X#%*X4dPP<5 4< 05 0@RQxp) <%!q0`J  0  5 SP L S3 p0# U Ugg Ug gg  X 0H,଄  <Ja ` 0 %P@V`!X:5 S S V X X42 v \b 2\b`$"#00C4 sD4R 00UV `P"u4S\004 e$ V04 0S03$ 54 5 X4 (4 $ u<Qp ,0 S ,$p(`5?(@ 5@Pdp(5,5x0545Ȏ855܎<5@5D5H5h5L5 P5l5|T5zX5z\5 DlА 8dؐ@|$ԌLTX\dhltxd5$5gfff555Զ| <t؍NK@TNK4@@4  P  4$S440 $ 5    ^ % Ue0Vf*0U U00R00SU $0R eVU:PU L U0#03RQ $$嗕p ܤ P%0W^  Pd \0#03\030"S3  `QP,<"(PK0d1P ^ U * X  PQ ܤ p 4P  5$ UP2Q 4( Td0 25P%$P ܤ0 0 P B24P%40P$(3R ^3  X4LS \ R 0\J>Kܤ0C@R0 00aAU0!|rP!d0B!U0PBBBB@B`BBpB0BPBBBB|4(KM.KP B4`( Kp$(0K4(K4(K-K0 B$@5 (K 4D% 0K.KH5 4 B#4 `5 4L% $D PT"$`lK``V! ` pK @X K DP,Ġ KHQ. ,KL R$D @5%(PK(`K@d! \!4 $ X! $0@ P \ 5 )0R`06P$(6R0/ D!b0 $v> 0Xp6BNKx6Q%̠%4%(@D@D0 P5&B !0S66TQ$0 N0o00  e T 8ܤU0 U 0A AH7(KJ.KP BX7(K`'(0K$"$d% $$PT0!l |! D! `0 @ p lKd`V,Ġ@ `000 q%4$]$ 0G> 40QAV>d8U U Uʠ 5M& V:%V#AU8'L40S@.ccT5l P0!01S030S345-*Q$H9U! $UT  h9Q eVPR 9U  T 9R UP9R R/5 QPBNK@D@D*5] P #p$ e /Pa4: S ܤEnK`F `F @P0   %%`\d4S: 8j\d4S0P T([44 嬄 D D ~gF -LM@(K P`5  Ppp0W0* R00S 0rS`Fv (P@ nP@Z`F (00T P P (0vj?(0 @(0 T0R%08 -PL`p@PDP @T:T @2 +%봴L -LPgM/, `uPBp  Q q00  R P\ 8Ÿ q00  RP 0`SpSapCP 0S.S  $00Y00S ,0S 0S 0S $0S5MK  | pI w8pW0SH00Y00S(0 0(0,0S0,00S' 0S $0S ?P $0 ?c02 $00 ,0S ,ƶ0 {$, u (l oX (gP@ <4_q0hedAA܎zБ -LMppQ5Q/pQ& xp,Q0S h@4 0kpip`8|@|PP`ph^p<Q@YpLVpDSp<Pp4Mp4@Xl)tx Q-0L $ Q*  $뤒 -LM`@pl $KPl0S0S 0 #$0 UR#UȒ p-LM`PU@ T<-PP UTUpTԒ- 0\ \8 0000ӑS^ 0 ^0  Br0 BS 0r0 -ALM3 0 08 0 0 0 0t 0d 0T| 0Dw 04r 0$m 0h 0c 0^ 0Y 0T 0O 0J 0E 0@ 0; 0t60l 1D4pԓ 4Ph|̔ , -LM00`Kq@ 00 p PPS 00@TH 0uS> <S2  0BS^Q 0( 0 0 0 ?R(0  -R   4K P@ 40 R0 0(@!> >/P0 0( d%P 0L>< 0pB PPx@8d$ P-L "}"뼝؝ 0-LMt@ 0PdnQ 7l@l 80hn0(0 n 0S@4 -LM0:(0 P0( 0S(0 0 (K  OnPP) 0S& =P`u 00,pK Q0cSb iSI lS> oS& A0S 0S 0S(0SP0AS, [0 0S0 PyP,00 0oSoP P,0(0cP,0 0 0ZP,00 0iSPP0 TP,0$0XCP,00 00.(0pT<@@HPX`h* -LM `P0p-S000P(K 0(P @P@  0S 0 Q (<w<r  D0h0S $ "-,0 0$  -LM@00$0 C 0+ 0 -00 $0 0 0+ -0 D0- -L M0KS0@0,0  K 0 0 0`t -LM@j0 00S 0 $: 00 $ 00 $: 0S00  <<  00 0 -LM@oj0 0 -LM0@S  h = 0 << 0 -LM@N00$08  0 0(0-K 00 $ 0g@+$l -LSjhlX -LM K00"8P;t  - L*P;nt  - LP;ot $ -A0 LR`P pPJ RDA R pP3 RA R pP R@ R pP 0S 0   0 p  0$  $ 0 p $ 0   0 p  0  0 p X̗pԛ -LMl \, P`p 0LSD ( li@iT 1 lW%X  @zW $8W8zW $8qWh8hW H8_W $(8VW00 NW $7EW@ $7<W  73W  7*/W00SW $ T7W 47W 7 W 6W  6W $ 6@W  6W $l6W@ $L6W ,6W  $ 6W 5W  $5W 5W 5W00 lWP5W $05W $5wW 4n@YW00cW4ZW $4QW@ $l4HW L4?W  ,46W$ 4-W 3$@W 3< S S 3$ W  |3W $\3W  <3W  $3W $2W $ 2W: b0S Q KdeW " @ ^ z0K0 P"o XK 0SXL1 ,0S ,KegKcgagK^ga0S @K00!dB 0Sn}i S  Selhd`oI S: @i4i( it4$,dtСTdt̢dt̠$T4Dܢ<, \lȣXhxȟH@Уأ0<84D ,8 0-0P@0LS 0@0900x5|5 0-|PL0@S d0dbi00 0HS@Wi4Ti$Pi0000x5|5ذH -0L0CSQ tM00-  Q^00?  Q^00@  ,00 0 jp5: -LTM\ X3XSp`| , xp p <R|0f |0@$0T #|]Hpa@ P p0| `Kx| Pxt K_PJ4K|x VP}W   |0S0t  | l h 0S |`KxPKP& |0 | Ql0Sh0S,0 S ,奮x PUi x'Pl7[PP|0 |(1  0P @ff0l0  6P|0|07.t  i~pA|@ePx :p7 PP7H  LTt@\ht@$gtht$p -0L  됫 -rLtM@P`!sGpF@; -P4`1`1`00P @a 0T Q $T 1@KP`  60: SP  0`SអD T 5555 q ,(5 -GML M1嘁\$ `@pL x1x!t1Q0T*IKAP4: S 81 R hP1P h$0 S $Wd0SlPP BNK@D0 P P`1:c?00 tgIKA℈PP0 R4: Sc0055: 555 -0L 0 됫 -LLMP` 0 4%\Fp ?0@8S񟗄T ,4t|0S$00, b 0S 3 Y 0S R 0S#00H #000#0S : h3`#TCX0P 0 R ( 0000 t ## n#0S  "0S0Pa0Ua ڼ2 R 2 0 R @rŸQ @0P@ X00CSt8U |P w !U oP  0K U dPP 1\  0030ESl hdPPp P=$ l  4 0 R, KZP"0ESU 0 Pe/$  Px Al Yi 0 RddL4Xx[[$p{{[4Z {[ 8Z[md p-LM@P`\0Se/ 0U $000 0 ph5p P -2LMpP` A4444100 1 RT 0S? 1 R20S 0 S(  \( KPH2  Q$ K@@"P 50P 0@P 0e Pa0S a0Sx H0 R\ |PH0Z[<tWEV{{4Zmdfdgd -LM@a00CS,"L"L"L"L"L"L"L"L"L"L"L"L"<"L"D"L"L"L"\"0h3$ weHp -2LM `RpY 1 RJ0 P QQ* P1 3"1lR' 3!|a0yM,@0U0x `1R `VD30S8S, e30S8S PL@P 0PMd0 R0 R ` P |t`| Ph?3`PT{4Z[{WEV 0Z,<Td[[8ZrdAedAsd  -LM( R,@:( 0e/eT *0 SR: -LM0pS`B0S0%  R2!( , 0 4 8 |< l4S X("PB4S  <0B4Sl4ScP0SZT0SRP@\0 S@PFUں(PU@0S PU@ 2i a  0@f0p y0 Xt 0S S@!18 0g 0S S (   X0 SQ L G@ At@ ;\@0 4M0 l/ED(08@HPXdpx -LM@Tp`U(XP@H0 B0JP@ S7))<*<*<**<*<*<*0*<*H*X0 8@pT`P0  `Pt l \ XT ( P@ p`A>P?> -L,MB0 80 0P, 4  ~딠p`0 w0S= / ᒜP80BUa ,P 0lPq 0S 0ڕX څ!,L, De 00Sv Sj ,$$"[4Q 80!R,00CS0, 0  ,0, o2,@0 8Q   ,5008 P,,00* C R +, 000 08@ $ @,0 08 P,,00* C R , 000R,20R,2 ,x L,T80a ,<g  ,4DX -LMZ0, #00 00pӑ Y33`   Rx3x!t0d 0P Y ( <, 00 $8 4 <  m+. P@፛PtB Z 0 sY  0 Y&. P@yP[B Z 0x _$h[Y (XUP2LL"P8@ToF0, 8@T$:$6$2P .T * 0 @ \0 BS@TZ@TP@\ xPU@ l0T0 D 40( X0 00CS00  ä0P {1L 00 X00 X0 {lxD 4HThp$04H\hp -LM@0p8(0 }pP P@| 0 0x!0s|PD P@\ o_Ke/  P P`D e/\ PP3 DA@b`X`DZ00CS0X0ӤX0 PpP A00CS00Ӥ0 PpNUnUya(0 S (?Tgap]{4_aT `<`<|[ @l \d 0-LM$PK@x,@ p1P h (K`1pH (00 SPM[P@\ 0#Se`(壠0,0 852,0S0 (,PK⏠ _p , 0BS ` n\0S j\0 S4k`0$^렦t|(< -LM@]0S@ -LM@@5\000S 00\0S -lL M@p` \ |0 0  Rp P00 0 > `` -AML ; MBK@$ I:I8 , 00 8$cP  P00 PP :gP`` R 00L`}P1V4k ,&(;P` KK0C 0C00 1.FP4V4 P 0S44X0PH`40S440044 PV 0S%0S440 0S  440@40@4 - P+VpPh 0Se BNK@D@D 0*04S\  4 44!\0PpPL W00R00SB-B~KpG pG 0AP 8V`P .*PPBNK@D@D0 044 S;;S(  04-@40@4 PBNK@D@D0 044 S,  0q-@@ PBNK@D@D0 044 S8  0\V-@$ @$ LhP BNK@D@D0 044 S0VP BNK@D@D0 {044 S4DP BNK@D@D0 i044 S<2P BNK@D@D0 &W044 Sptv8P BNK@D@D0%D044 Spt~ P BNK@D@D0p%1044 SptP BNK@D@D0$%044 Spt=`P BNK@D@D0 044 SPFP a0BS0S8a AR:R `0A8BV< B.K B BD$ PD4` 044 SV P D4`044 S<$V<4 `- DPT` *0S 8P #@T:q30  00S044 i04S44S R,044 0< 0<$ @T6 TV* tP `D4<$P V ePD4` u<$4 <4V TL"D4f<$P,,V ?PD4` O<4P~ V 0D4 B<$4 Q<4P m D454 <$0aC1 0 +@@ ]+@$ @$ k,0 @qS t,呢 d+@40@4 /8+@40@4 +)$ BNK@D@D0 044 STI440CSpבxʑ+@ @ (\|Dl $0L؇\zpyܺ@X| -LM(0S`d ,0S 00SH 40S Q| 80S0 ,0<08S804 <Ph (PaPY (PR8SIPU@0a Sp>P7<P-00S$0S0S8PU@U2 \aP 0 +PU***< * *8**x*l*`*T*w*< <h,\p -L3Mp0moKPe/OK 0 e/ KK?KH2 01 2e/$1 (  0S U -d1L(M\@@K @ Dq0_4Q@K`@@ 0< 0C 0 2 0H 02 00.      c  5 0pB 0`XX (0p4h L|H82P *0P ": -MLM N~KpG ) e/9 , Q  | P vPX}mP 4) KA  BA .K B B)   GP@j(K0PS44S W(K0S0( K0@4@44 @@ @\4p*S:\4 X4(KS:X4 0mKS(K008 We/뎎KH:  6 *mP 00CS00  ä0e)(K00qP@ P 0@pSAKUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUPNUUUUdNUUUUUUUUNUUUUUUUUUUOUUUUUUUUOhPPPPQUQPNUUUUQ RUlRRSTUTUUpSUUU' _OKe/e/   +P Ll_Ze/E 0 @8 WPP 0S WK@ 1p 1WP@ 6 0_W< -ZƟ6 R@@R@aY OKe/e/Z   | 0) e/P Z  P g e/OKe/e/ e/ePOKe/{e/w hOKe/me/iZ  0 - 0) nOKe/Ve/RXOKe/Ie/E(8P$OKe/9e/5Z    0) {Z      .v7 3]UH0| @P3 RLZ )9 e/P< tCtt#tPP  R0000ӑ yS0 R000ӑnSU P#00ӑyP p2 ,0S ,o  P@ 'e/U UU aP@  0p0X $$DPP0S e/iPZ s POKe/ze/ve/rX Z 6 |81 RPZ  )9l e/8P   vPM ('Ke/Ce/? ,h(*+  l A,rdA4\dtl,:{[0H\ 0 -ML M R, p0 @ S a`BV00?V p ,0 S ,兝0S 0S8V08ǡ8סPV08ǡ00000  SV4 00 0 ; 0 S P@` :0Sg  @1^:0^0n005:0 S0S  0s P<0S9 P@ aW440 P @0 P1 R 0S 00b01@ Q  Pm j P 00b P P 0SO` 0V0R00S`V@ P@; a`B0S 0S|V>p dVp0( KBNKa@D\0 (K@D . 0<\,:(:0<\ p-RLM0@`+ a@ R\0"(\` phq ^0S  0 SS S0d0T!\ ph (<<dP0, 0 ph0\D -SLMp 8Ka`N‡PV(VT` P' 0S0Sy  PK 0 SSZ, [RW R08 0R 0 @T0 4L 0 S?0S< 0S KS408   P`1 R 0SS 0J(U` hu  0S0S* U" X1 Q *D1 Q :0S S R0000V@@@@@ PA 0h* ((PU2UP 0S S R000(U 88/P0( \(:$: D -LM&KPpT b[P1^PD1@0!P * U:U: Q:Q"P^^@(1 Q:00Q$^T 0`S 0!@l0Q` PS 0S`}0S@0$:(: -RLM0`pl a@QgJ(T` iR 唀R 0T  0l!00`1 \ p; p0 3 P 0S S" P0bS0c00 Ri7 P iI*0 `0T< 0Sh. 80iT (@@AP0\@L(:D p-LMKP@ [PTPT`0 R*0R*0@  [PÔp$:(:0 P0:00 -a0L0p@TP  S P P0 S R @000?S T S 0?S h`+ QX0 ` BR X0  äX0 5$5l P  -AML M4 8 , - MK 3(K 8 BnK`Fs< `F {S 㘵 RpS3(@K @T 0 0S S@D00(K0?S (K0*S 3(K RTD   0SQ"0000ӑcS &S %S 0@-S+S@84 0D OBK0A0AP@O0"S 04 Rf<4SZ0 MK \8+\ 8-Q `@  00* <\' ZP@/48`V%0  U/ 3P V  @0aS@ lZ  R ,0 S ,٘  P@<l0 vO000@D0u MK4h <0gbSe4@D( b<$ 00]??A\h:l  Y@0@D0G( O -K0P kS gS844(< @DmS/4$(4( Q 0a#5<4 44800(K RK O( K0?S X0  BR X0`  äX0h 8" -LAM MhB>K0C0C4 , p@2(K0PS`V2(K \ @   0@R1(K T1(K `\ђ1 ,0S ,y 0g g0C B#b"Baa  X8 < QLL!LQH 0B0 0<Y ᣒBKJJX@8<$Q;K  ,CP 0(K;K, S QQa B RR24  y4 mL00CS0X0  äX0 1"hp  -$LkM0Ke/ ,0 4dQ0!PP 倲P@ zP' @T`t\iQX 0J@@`Q T8@ 4T00CS00  ä0 !/T`@ QPP  `!P,#3P P@t x3x t ,@0\#\3P Py@t 3  t0@8 # 3P Pc@t 2 t8@4"2P PM@t p2pk t4@<@T44T" L2@ 1p@S pb <PRR0SS T * R 0 dR0b00S@<@P!1P P@t T1T$ tDh!h1P P@t 0 tTDi0 ,0S ,倖0 Z e/0 a00M h0hI@ H0A{Իđ pl7zp@(:DyD -8@TLPp60S S 0 (S"H\T& ᩐP`$ 8@T0S S 0R8#H\T@<0 P @Te+  -LXM|`K@X p@PP 0rSPL |0@Sb00C8SMMOa嘁@O T@ p1GT0\0CS0<0  0DD PP 0姰P* @ᡰP" @TO 0r@O T@ 0 T00CS0  [@00T QPx0K @1S갦TlԻ l7tp -LMp<P@ 0P@ @p <P*`f ax x0P@ @p <0 fP0 0`mg((0 m$:(: (D -LM"KP< @0S0 @ 0耟  2[ 8#Rp`#P1 0 QS*10@  P 00!10 ᝏP!H0@ 0R!705@20  0 $:9(:0 < 0 $:(:A-p刀0 P0b0`Q0S S ^ @ 0S0T0%0n 0%!Q(:$: -0LD0C6S[||||||||||||||||||||||||||||| |(|0|8|@||H||||||P|X||{`|h|p||x|||||D}HhK@<840,($  |KzKxKvKtKrKpKnKlKjKhKfKdKbK`K^K\KZKXKVKTKRKp84@t(Pd,Lp<X| 0\ -L`pPAT 1SPU野A@@ᦎP  + p-LM`P@PQ@TpP Q P pQ -LIM MJ~KpGpGP @ , 1JnKS`F1A@TP,0 S ,l 1P0rSJ /QP@ PrU B>K0C0C4 000 !Pe@0@@ y5 NPP 4S JnKⴀ`F10 "\a0@|$Tʄ1SeBKAA  0Q0\p -2LMp`@0P0 $ \0 G~ 0 ~ x 0p ^\ :` 0X ^< :, h$:(:xD -LM`pP@0 0 08!0 01QQ p: p 02 X P 0 0S }P V 0 SS Px0`000< 0S40H. G8 0A0(:XD -2LMpP0 0|0`` `@t P0P tT @(}I  hy0dD -2LMPQ  0  @ a@t 0& t 80T:`xpW; 0 ~\l< X0 @ ,0 0x@D -2LM`px \p0@PP@ @| <0< | D -2LMP 0 Rp`0 0` `@t 0 tZ 0 @ 0Pxpx!ttP` @dP @T<TK 0 0T @D$P Q-Lp`( P% P# P! P !@R <PP .@T! 0 /\ PP ֋P ыA4 $0<D+P0S  0 S @ -LpMpK`P0sep @T X T0S@ 0@0IPrdAedA+ -LP\p@` 0B0C3SO`ЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋ`ЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋЋT <0( ,0P<0( ,048  1hHW <0( ,0P( 0;V ( ,0P<0W<0( ,048 ( (0R, ,0R0 00R4 40R8 80R< <0R@2 44 46P$ oH|<% D0 P 0Z<0 0Q&2 -L8M0U@p` 55 u  % 5PꨍlHT$4@  $Pp 4Q 0SDP PpdhP(D0: S  S  S0 0cp{ 00 R000Sg RĎ?;#003 <0S c#?;0P@ ?gLD T@ ;00S  ?+83 0S,3@T c ?J2"@@ 0S H2 AR;;S" ":00S 0S 2Ql2l"d2T"H2D2qE0S0||\ K1Ps1 V@| 00 ~E!0!t@m 00 oE0!f@g0*E0d!\@T P!P00p 0Q  E0!A@0 0T PE0 +@0P 0<0  H0̼|\d|м{{`|||{|ؼ,||m8@h( -LMc0Ss0S 3 R S0S3 Rt3 R hCP!FP,K kH0S 3 R| 0 0R  R B 0 S "000 R2 R0S㼂 00CS00  ä0N00`V xx20 0hP+&@2`DBH{P(@ 0S 0+0 a 000+\P !1aA0 @@AP| {@ 0X$1 v@e0A~PR0: SN8 @TI0I@D0 R㬀 00CS00  ä00 ( >808 $0̼|м\}{{`Լ|}p|P}0l|X|h|d{| -?MLMt0t` R   0S P }Dp0S?KK@D0P@D?+hPмؼ̼ p- LMP|Ut`0   p@0T PࠡC >мܼ̼ -\0L RL H0 @R0,0, 0[>0X>мd|<|P} 0-QLP) 0S-ЙЙЙ,Й0  QhP@ڸ0 T ;;S0@0T@|0 t>0C\ 0T C>00  (hP@0 0ؼм̼|{d|Լ| -b0LP@@xr PP PX"000SQꠚ888ԛUڅ;;SNU8U0011 U00R@@T U 1 Q P=1C!0|!=l1 h=\=,C0S C0S C0ES U0P0 0 R0Q/PUB0 S B0S B0S B0S00PXb=00 000ؼ̼мܼ{`Լ0|T -1LM R*ʔa0S& !00CSYxx0Sp1  0SK|0S0 0  0S==[0ȌlȠ@$ K$ @ SP@0 HP U0S \p0 p@0T@_0 0@TP 0_Q00000{ؼ\{м{̼m{ -P@LM0 U 5ࠟP.0 R  0-p`W 80 S80S*0S@0QB@ <000Pؼм̼{L -L M䁟P@P!0S꜠H\UTj<0000U$ha 0 RQ R 0QA!u< 1 R A T:P0U$`0 [0 njlȠ( Z`0P@( Kd$@ ^PA$0H ;<<Tؼм|̼Լ|m( L  -?ML M804S?KK (@D, r@Dz r"(K0?[K<(PE0 PE00 !PAb0 0PV?KK(@D@D?+eP`G?+eP;@@ HP+X@ P000 P ,0 S ,^A0 ;;A ;@ @p  @` @ ?+eP}ؼ̼m|  L    (  -LMdNK@D0 @Dp (0 Pw P3n -LM\q0`SN H!3#c1c0cAT R$0S8 Q0S. T 6P T $`P 00T 0$`00  XPl0(&PC3dAd"v@d@b000XRPn -LpPP 0S ,0SP!%0aV 0S P0S$0 0@0S# V P00 0$ 0 T %P(@u`PP0*000= -Lp>PP 0S ,0SP %0aV 0S VP0S$0 0@0S# V ) P00 0$ 0  R%P(@cu`PP0000  -LM@(aMP@ 0S l -1LM 0 bM@ ^0 - ! ^  ^ a0 :#:900 P \0  ^  ^ ^  ^    0-LbM(MPbMK@D$@D0p 0 d0 KX0P  0 @0 0 0S Gz0\l `x 0A0- SPL@ 0]0S8  R0SZ+ 0U+ -a- `L0Q!0p@[ P20P d 0p QL -+4 $$+ PP 0 KS- L0P 08 -PL@LPgb=0  <|1  5d1  .Lq0 '41  1$  1*  00   0A0a-  bam` ; P0@09P0: S `0  ,h 0S HP (,$0H8 W! -LTMr0 $0 @"P2b- 0LS`P2`  0L`pPKS񟗞a=0A 0WPP2 HD 0 P,2 0 P 2  @*$0 S $y1  0 P1 0 P1 0 P1 0 Pp1$ 0 P$1* 0 Pa=0 0 P; 0| PLPP00S S S S  Pd0 )@0l A 0O Pv A0@qh (,$0 mS- LB0P 00 mS- L30P 00 ]D} -2LM pR@ nPb0   2  l"0 T2  <2.  $262a-  am` & 1>  P F $04 4!N0 y P Vt $04 4`!f0 h L1^  a P@:0@0P3n000cBP) 0: S `@0 0S@P0 ` `,o 0S P `@0 0S@ Pn#RD} (,H8$0 |0 D} -H$L|M0 ,0 < P $00CS 4   4圐K R 0  & P3=6K 0 P7#00CS,,,a=0p`P@00S@b-P ``06 u P03 ($3 0 P3 0 P 2 ](2 ,0S ,w2 0 P2 0 Pa=. 0 P`2& 0 PDR>0 0 PF 88# 0 PQN0 0 PV 88# 0 P^ 0 Pp nP/P*Pn000cP@P00S S S S  P<00cPy0 'sq0b= 0P@60 0C PL [b=0P@06\  03 P 0D}q $T(,$`qQ-H0 4S Q 0 S  qt| -LMPpPb@03 R 0#400"400"40 0"40  0"40  0"400"40 a͠$ 0 `48 0`  !H8 0Da=$"$2T:0D0P300cPP*!0: S `@0 0S@P1 ` `,o!00 P `@0 0S@ %P0 400 400 40 0 40  0 40  0 400 40 a͠$ 0 `48 0`  !H8 0yt| (,$08H P& -%L0M0 (0 H P4H@ AR4  0AS8,88HPa`%<%8.K-0K.[- [%<$,0KP0K+K(,0[+[pPPČ%H8 0P`KPH0`P@P`b- 0^ H3 A&S(0 S (u0LS#H@4B0KAKB [A0[4Pq 80D KC0K 83H@@ 4#H0 4@0K?K@ [?0[4P#H@ 4>0K=K> [=0[4P" 4<0K;K< [;0[4P" 4:0K9K: [90[4P" 480K7K8 [70[4P8"@460K5K6 [50[4Pa=@,@8@4 K30K2K1K4[3 [2[10[ $4(PpPE400K/PK0 [/0[4UDKP2P-000cP@P#D1H`0S S S S\H  ePH<00cPLH0 %EC0HP H 0 @@,@8. K-0K,K+K, [.[-[+0[ 4H0P@b- P0@/HP b=0+ K. K- K, K#0 (,$< -0` LK$KP P0`P|  P*d 0QpL0L {P0, C% |(,` 0-QLM@P&0 R00P0 R0S 0;0 R0 R0 R a= 0P0U*\ 00h$40 |000 0 H}| dh8t(, p-LKtM @`KPP   \L0  Fp$p*0 00$- 0P ) -LpM`@KPP X0PpWH0P 0R ,0 ^a$P| -LtMpPK@P1 R* 0R5 0: S, =.P P ) 0Q` P X 0x @O$X)0L C$1P 0R $||<P -MLP4M H4p , t * $00C S <|DXl|||3P3 RIKII 4S+P) G)#0@P \ `3 RT3T P00##3 ,0S ,mr3P 2 Ro 2 BQ R0P0 R0Sx"0;0 RQQ B0S|2 R p2a  02L冿P P0SBB0S1 R  IKAAP!0S$\1  (4t!`#11  BnKP`F`FU!B4: S>p@ Pp( 00#00 ,  %x "B > X P}h|@}|(,tH}|dh8l|0 p-LtM`KP7P 0@T0: S ,Pp5(L 0"pPVp%( p|<P -LtM0@/SP @//㋾`@pKT/ `0S0S ĵx0\0S0S! *x H} -@LpMS` Pp0S 0 R KP0Sl00d0 Rd00HP'00 W"' 0P" dhp -LtMp@W0 P`0S 0 R KrP0Sp00d0 Rh00HIPq'00 "j' 0"0dhp -LM@0Sl`0P M'0S I'04 !$0 R Pd|P}| -LM@ R 0Sl`0½P '0S '04 !$0 R Pd|P}| -LM@0Sl`0噽P &0S &04 !$0 R Pd|P}| -LM!@kP& 0h~! -*0LM"*@7<P& 0hh! -LMRp, `1 0S00000SPP0e0 peR  V@*0S@T*0S T00- x@ x@@T P`W,0cu& 0  !pW>jP  0p\ x/0PQ`P& 0 X}T}(8 p-RLM`0 Pp1@0T<  P+& 0ph $& @l 0-0@SLP 4 0R0a 0h2|8 -ML4M!0QP,0 pG`1 KK`(@D@D V k#  JP p R0 RPa- 0S0S 0 Q 0 ,0S ,oK(A4A P a=(K0Q p0| 0QX0P%4 0@ Q % 0$ ` -0 0R00000L R0000 R0@00x0 RlGih0P PP0 RP$@}x|L}<}H ||| p-PLM@` 0SpiPP ᨾ@P0/S00H 0 S8 @`0 0 PPPPp HL0d0 R00T0T QH0  \80 R,0 P0^ P}}|TD 0-0P LRl0@T 0S @T00SU0 (($P^|HXt -QLP=aq R1 0S  0S0! @0S00 0  P 0P 0P$ 0` K$P DP 00DH||P x|$}  -$#L M0PS s P 30C S8LLLLL44LL2 R 0, K@00KXP0,0 0y0 \ 0D"00" 0"bMb=0@`l `0 @p 1封 * RY 7 R$00  +*P0 `ç 0p!勺 P;041 P1# 04!  Ra- 00 R0 0 R  R00 R0 00S  0a @0@00PE00P<|DT|  8 -P1LMP`U; pP@5*(P00CS00Ӥ0(p  T:0P0D@00CS00Ӥ0 P p eT pZPH ĈP  ӹP@P0  P  }l $D -2LtMxŸ@0pŸT S, Pp$T }0 CR 00g2 ,0S ,jl0R Y @K|1 R@(08&B`P0 \*L-S0!^ *\ ^ *\^0305 -$$q0LS`P P: 0-S00 00 0S&0@T0  ᄷ:TP 0 0:S l R1 0 LP04?0C0 h|$p|  p-LM0@P/(|P00l0f0SP`ph8<[0Sph00phP}h|l|d| -LTMptp % Jp 00@JS񟗈&'''''''''''''''''&'''''(''' (''( ('''0(H(''`(l(x(''''''&((('(''('((')),)'**0*<*H*T*\*'+p(4qDTA0S`0@0w,0S 3wC徶Pv  4 uǂ4Po\j43S Pvd43u,3u$33t 2 Pt2 Ps2s2r2rBp2P: \2p2pH2p 2|2 pt2@p}l2pzd2|w2|qP1@ 0S `Pa0CS"))))))))))))))**1` 0S{1P1P1P1P1  &t1p1{1[PzqT1z-L1y*D1y'xP0a,AH0pK @p /<1P@x  0P@ P┫UH@ 0t5 0'0 }$p|`}L}@}|<}|||}}|(}|}}dH}|h| }|X> H<}|n9 p` 4}( 0 \BXL0@0t0 X X0 t0SI0S| |0 0Sl,l,,,- 0S@0cP0 0S0w 0S @0yP 0$!0S0<1 _P1 RH!d1 p6QM Q ! R 1R B Q @A1A0t0 001A0t0 01A0t0 02B0t0 0 - 0PDDLM@, 0 4 8 0(Bp 00@JS񟗾//h1h1//h100h1h1h1h1h1h1h1h1h1D.0h1h1h1h1$000h1h10h1h100h1h1h1h1h1h1h10h10h1h1h1h1h1h1h1/0h100h10h1h1h1h1$1h1,181L11T1p11111h11vfP040 606666|6T6t&h640Y8  6 86   w4 8bP8  f$\6 0 f5b5%5 \0X5 | 0-S 0 , 0S,  5000 Bx5x%=l55P6W44 0$0,0%000( 55 %, 5R Q@b $4 00CSTY  0S(2(2(4(4YpP. Yi 80I`0< 80 VL hP\D;P< Pp$P(4 RYPW Ø3 , RPC0S 0S GP 0S,30 ĶtᇄP@\ L庳P R2P 2Pp姳P `P x2`0P<0 20H CQ0"Q0v <2PlYPN YY 8 I`0 @0 8 V; @Q P1sP B CP wPtcP1 RY0  8`KP@x )P`?P P0 OBPP;+P `P`P@  ,P).P# \0S |lP$p|x|L}@}<}^|\h|H}}|(}<}  pl | 04`8 -LpM`@pK@( 00RPP@P0: SU/00 0D 00SP  ( -4L$LM4$䄟P4 $4p $p 60@DSp9P:P:P:P:P:P:P:P:P:P:999P:9;P:p:;P:P:;P:P:;P:P:P:d8P:P:P:P:P:P:L;P:P:P:P:P:P:9d8X;`;P:l;P:P:t;P:d8|;;P:;;P:;d8;;;P:P:P:;3x3x#000d3+ X3>~H3@c@P@ P 3 R ) #b尒ŸH0pK  p *2P@l  2` @ pp`␧VH@ L2PpH2b 0-S 0!0S "22!0291100!101|1!0&H!1r!!0QS<<X<X<< R|PP R0S,1 $\P 0 R _ R 0 PPK H}|}|\|h|H|`|$p| X>lH@}^|Ƚ}}X(} p|<} l 4}( p-0LM` |@Pզ|d0 P0R4BDL S00CS00  0p phNP}X  P00x -L0L R0 R  蘦x  P-L 0SkP1 0PS$ p,᮰Pp`=ᨰP@ ]P  ppP0VPPS0  U  0S( ^  |x0  p-LM KP qd R0\4P0 0b0CS#@AAAAAAAAAAAAAAAAAAAAA`P$K4 V U  0xS S *S p`P0E" $ VUp`P%%K5`P*%F:`P!%O1Q0r 0-LMKPᏀP @"#  0 S R K]PP   B0 0 C 0 0 | -L 0ㆿWH m -L0,yW" -p@LM@ 0\k4 0LfE 0<aB 0,\0$= WjW#$8$$$ -MLML0P`(0  0S ,(0 S (Vb @Rpx 0\S@ S  R wR \PP`  PI000S  \R 0R 0S 0\P 00@0@0S PS" GS0000S 00P 00PPP \0 0gS pS00BNK@D@D ;D 0\z(v % %(%TXH%p%% -@TpL 0S A\`PUP Pϱ@@0`S 0 p`PPP P%%LP 0-\0P@LT 0 @T0U$ ~PL&t -LM0PS x@T l1P0000 <1`V0S`" 1 R @T 0T @T 0TT 00\ 0 pPp  R/00`J @0/S`0 0@4R R/00pL}}D&`& p-!0LM0PP@ 0 R 0 R pp0 " 0/S @T|0 Rp嫟PT @`H0@PpUP00L}} p-0LM`0@P?P6 *P *P 0S p*P P Q  P Qp*P Q P0 R /QPpQ @PQ}@-0 !S@@T0]P P 0-S P]P ^ \ ]\ P Q0 -PRp0LS@ 0/Sk 0S 0/S6 2 R2 RPp10SS S !Z 0(Pp10SS S +0  \Pp@!00CSk `,1 R.000S S 0/S 00CS00 0 <0C<`0S.000SlS 0/S 000 00C0l T(} & -ML M\\1 `P$ ^KPE840,0S/0S᭯0 S0 K0S( .S @ Wp ᯬ P;0W$0 S x$i_d0 K@TTfHbP}&& 'D' }P't'' ''' p-LM@P` 0P D0 L\ 0 pPࠣ -P`L/Q@@e Tp Q@:0Q Q0@*0CQ:0QQ0@*00 01( -LcMZK MpKK K(@DKK( @DN*K", 8KWLK KPH0`K: bK(J,J 0P'02(K  UT1*00UT1:T3 0 PPi1!(K(K0@cTP 0S 0Y pWp,0 S l,^T *0S 0TP*0S0T0* K\ 0 1(K R K(c0(K RK*K:K(啫ZKX:KZK(8J0S  KP KZK(8TxKQ :K(0nT T\ (,(D(P(t( -LMpXP, @ *0S &S  \S 0T*0Sh /R9R,00`BVP"0S 0S0 `bV0dV @\S R0P -LMp1PU|唾PP 0S`QP@ 0 S/R< KX4aP2 T,/00 1  bPP 0SVVVVV00 R,0 h@T0 0S/S 3@ ,I$}((0}8}\}|(((X0X P -88L(0 RLR|})<)| p-L,M(@KP zP uP pPt <8828Ÿ@@4`K@PK$Ÿ0 0 ,0 4 PV PF P6 P& P0  40 P PpX!Wp@0S P@0S P@0S P@0S P@P wP 0K  d 0K  ]w 0K  Vk 0K  O_X)P,}|W`) -x0LM @R`0 R P0 RP PaP|t p-PLM@3 R0 (a0S= 0#S4 \S. PP$ ~0"C12d1@cP 0S PVP P0! 0pxu  `o 0#S@ $~P,P  |/>3))=)X0X P#3!"c1 0c!R 0S R(/>3| p-PLM@3 R0 (a0S= 0#S4 \S.  PP$ 0"C12d1@cP 0S P^VP P0! 0px  ` 0#S@ }P,xP  ꀿ/>3)*=D*X0X P#3!"c1 0c!R 0S R,/>3 -PpL`@ 0Sd /PPp0 S 00C S0u 0SUP@j U 0SE0020S1W 0S !0 0P!10@ @@P000 RH 0h U, a U\ P 00000 0S MS CS000 0S 07 cS mS00dv,QW0p0@ .QT@}  ( x*tx*** +(+L+x+@-0\ @a 0S)  S   0R  0R \\  0 S0S 0 S0S  0R tH -LMPᳪ0pS@ q 20  00S| 0ST`q @ᖪP_0 1 !.B=R pGV0G SRddddddd$ddedc 0!0!>C111v>C 0C0 !0!>CP00 1 !.BR00 R0S P&0B00 1 !.BR00R0S P0 1 !.BR P 0 1 !.B;R p010!.CDR Pk?C@.PT @} 0-LPL@DT  0鷶0S0 ! ꄿ + -LM⬁PPe 1 R 1 R|1|!11a11acAT pP0 S @T0 0RT 00S0hS0鄿$qv -dpL0S ` AT@0`V01P@PSSUꄿ p-LMP@T0 pŵ0Sx`t 0 h0hQŹX0P 000 H 0 ꈿG0}+8},$, -ML0M (R04 ,0  2 ,0S ,X4! /!8 0AT ~KpGR0pG8 @T1SP@, Q0 N0Q  P HD! TPS4a=  8,1008 A.  0`PS 0S030S  (PT 4a=0 S0ń8  $ ꈿH,GT,t,,,, 0-LPL@DT  00S0 ^ ꌿ, -8L@T`M !0pAT ]PP! @T RP@ yP yP 0! 0ARRh T  3P R yP  錿-H-p- -@L0`SpP` 10AT  P @T P:0G0錿 0-LPL@DT  0\0S0  ꐿ=- -0LP -p`LP% 0Ƃ"S12e1PcAT 0S @T 0ST Q QP@ 0`0 10 A鐿/>3- -1L M@\, `p? ̡1 0, @R@\`0 PPI P 0S: Pda00S0@P! 00S00S QP 00 0 0   )&0, PhPP 0p p00  ` WPP 0X0@ VQP 00  ꐿ-. 0-LPL@DT  0v0S0  ꔿ=P. p-LML`0S P0AT  0r@TPOUp锿 -LM䀟pPP, / 0"c12f1`cAT 0S @TPP@ GxP pP ,000! 0AQ(o0ST 锿/>3. 0-LPP 0A"#12b1 cAT 0S @T00 ST 00 00PP0锿/>3 0-TPL@ T0 04 @00P0S0070꘿|. -LMP0@SȠp  0S P@w0BS` x0 (00 徐 L 000oP`V$ 0`00꘿|. -`L0S$ PPUJp0"S@0S w 0RH Q z[PPUZWP000阿|dh p-@Q0@LM@C!1`@P  KP*0P0:0 R@U K0P0,*0P0:0@p  -P 0S\ \P00S0 BSxxxlx00L\:0000L \*P\:000L\*00L  L 0 00L 0@- 0P@CRyyy$y00L\ :1!P@00L \*0\:000L\*00L  L 0 00L P-  *0 R: R$0 R:  Q0-LP0 S\  0S 3@T0   0(| -LMP@ PpP \ 00CSP0 @ ($ 0(/4/\|0R 2 "00<(@ /R }   @<0S@P `1`) (@0/S  00C0Xl1 @1) @1  5R K0BS` 0@Q KP0  @P00 9p 0 0 :0 d@0, @m, 0PT , @b, B$ (,H8  T}X} -3LCM |3 B, RlLX|dp||83 R  3 ,0S ,lSBP0SPdU <"Kظ d2K0b S Sy 0CSV+2 Kd1KK 0P>KdP2 0P >Kl,20 P  2 X>Kt10 Pa=.K0 PK&K 0P|KP RP@!0S Sa]P K@ 0K@P `p@< 0S@P``0  _+0 Kd2.K@/K N@KPt0h0x\0pP0hBS$  #0 $ 0<2S (@'(PKdA (KPYoK P0 `A \A XA TA PA LA HA DA @A PdC000 (3>K 嬮PVXCX_K#^?K@|A PHx!1RS@$0匮P0;CS040@4Q0S|  `dlA  !r 10C1 =At0\ T0 02!FP@T00< KcK0 ! 9`VKe/K:1 . < K eK& R x0S:+F A [@ 0S O5  1 刡 Ѱ 00Ì bK 0Pʱ; 0<4~D$&nr464\&=K@PpOd&Y?KP0C PܭP Y?KP0C PέPwָF]?K 幭0(PK0@00  O? K ^ 300 0p1  000+]?K哭 W ]?K剭 7 ]?K ~P@ 00 OOK,@@H 0-LXP:0^  x0\*FP0\@ PL0@ D@P@4ݞS h~`<ȿԿ -LM"@@ -MLMXXb0PpH,0 pp03*0* 201 0 2 Ѭ1  Q P1@ԡ`0 810 @@ʣ0P0?P P$JKx!(@D@D0h!`P\3 b0P ,0 Q  ,J O`8#8P#$0$ @JK(@D @DfK<:(<2: !<(K0<:(<2:(LL!<  0(`~~l4dP0566~ -L4MD 0K`/D 0P@K0 Z L7  噬  ,D h0S '0S0 0R0; 6"   R000 0p 6F 0 B0p0 \Ɵ0 ` DX@0S #S $J0 0c@BHX@000CS00  ä0, S7 S@%PHUp|0 ă ā Ă< 4 <( "4\,<PEU, pH'W 00CS00  ä0PHpWp!pW T0W6 'W00,P|0 ă ā Ă< 4 <( "4\,<pW0 PH 'U00CS00  ä0N pD 0T Phß00p@gU0#DHLᔫ$H 0 \DP0S.W)4S4#0pW@ *0 @S0pW:l0pW@ *0Sp _0W:ZWP@K0/ȕPKP@0/.0 \E 8K⡨48 < ( 4" <( "4, ! 0,< `Rc@0 , =9 A0 0 0 =,0 2a, 3c#0OPK< LH0`KqPK@ P K`KPKH 0@PK\,!L@0SPK! !H0Sh0L@Sd*PK`T0 A 0010Z1P7   p4(6~<l~8L6 `6h6t66\}6`}66666H7 77ܿ̿Կ(7MQڲ0AQQ00  8#8LȃLȌ 00Ѝ -ML$4Mx4Q (K @, \ 0 CR 004pK(IITK(JJT$0 t屬 * Ꮚ0# ᨬ* ᆊ#0S`V* X)|VP@#|X0 + - <P@|V0 I8#0 v *T *PQ 2 R >  m,0 S ,G2@2@P0 {Ÿp`0 t6@PK0L X0/0d)K@ B0/ɕ0/P@@T0/P@@幕0/D0/P@ @婕K0LP@0/@3)K0 BP@0/@嗕KP@P!<0 @ *Ӊ yi uW qP@M  ޫf  ٫ *㷉3K (JJ0 ˫ *㩉 0RK(II l*㜉Y@A `<7<X78p7RlTܿ̿Կ77708 8 -L0 K M00, 000K 0 ᷓ p/? 0@ @ _` Q @0 RQ   -LM@yT (0P20P;< -LM@Qsꐵ$,X`ķ̷Է`h;Q (PX`hpx%h0S #!Q ж p嗨`XPLHDh840#$(,"(hx0S S0Swusqo0("#$808L8p888889$949D9T9|9999:,:@:P:d:t:::::;;4;X;x;;;;<<<H<X<l<<< p-L M0@0apP0 !P))  0 tVP`F `00CS00  0p ph|(V`F<==(=<= D= -0L M0 K0 ) P@ ˧0888 (0 4}L= -LM@0 01R4 R(  0 $hT== -LxM0`S qP10  0D0SJ 0S TKPKLKHKDK @K p-0LM 0PaQ*@PU: P@ x 0P 0 Q@ 0S @@Tp0S 0 @00( -LMСpU>Pe 0Qi$0Sƚ LPo0@0  Po0 %5@"%$0& P; MP P (` 9PN>0S 0S?>z 0@ eͣPsH0 0QO$ 0@S8/X8+> -LMp 64 J, p" PͥP0S40UX0SP `4V ,"0 0S@媥P1 ,40X+0S*kP8 #! Pᔥ`S/0 P\ P8 L 4,  00X00,00 0S0S,0 2PP0S 4, 0t 00PPPPX,00@0& 0 0 0$0&0PO}t0SqmX? - qPFL` '0 Q00\0S@`.Q,*\ L0S `00S  0 Q0/S0S:0 R P /P RX4  -MLMp0P@AnK 0 `F_`F 0 0U0 U00S0 U> 0S l .B@I0S D 08: S0 % `o?4(?4?K0C4 01PßPoAJD  \ $  0 B00S00Y X 6#1@% "X`P$R`1 ,0S X,< 0@85P @" Q 710$ :  0bPPd 0hƑ(0CC1/|x0Pw00S  n Q<;P9XAAA B -MLM0tC\d#, 4 <(  P@\43~4 #A6T8 4 ` #140\F" $p`B6# AV#1%Y X @0 0 Ἄ p2Re L 8(LH0PS@*KAAD R& 48 S <8(000 @XT:8H000,0 S ,$< 4 0 |00S00YX   D0TPDHJPH @7 Q LF 1HH@8H0006#!P*8H0L Q@T *BKAA@ 0 S@@T:08+|0 @P0088  <  +X,BAA B4B  -0LM PU@p$`2` #T*U0 R  0喃" l`▂#0U<0 R 0o 0喃" ꤌXTBhBBB -0P0 P00LMS0 P(܀ R0 P.:p$60PP5`@2:(P`@֝,F0B$Ν|P0 R0`@00)$Fᾝ00$᨝@0 p4BxXx -!LM0\00 \pG\(:`(P``ጝ,F0Bv$儝0 ƚ \rPt0t0l h d@d0 =0(0000鼌XČ̌4tBЌȌ, - 6 8`0(@ 0L 0SĠP`;묀pp%P3@00 00`PS P@0Ss0S5P,UX̌ČxȌЌB -LM@P00+5긌 -LM@&B ?Ὂ Pa(4PUp* 0АΜ0 T00P00@ 000p@0 (($`匚d0 dS D 0 Q005P X(0$$C -P0LM@Ꮬ<0 P 0S P 댌$DC p-LM``0S TPT 01@CT*44000p40T*$0( 0  x -LM`P@aUpᰀ 0SP 0S 00C0$d \0 iD80  \0   >$(\C,dC0(!S 10`00!0`00 0@TQ OP J0 R T@DX  0;T@Dl6zX T0 R ,넌0(C$pHCD$ @A\A(DԌ p-L@M P`KpW0S 0S  { p1 D@! T 6`Vh!h1h!X0 d1@L@@0,@ \@ ,0KT@ P@ L@ H@ D@ @@ <@ 8@ 4@ 0@ 6`TP (0@T*0U U@\K (0PT*0U6`V /&ꀠ?>1 L!\  @YP ?>1 A! @TڑRڎX, -L M0 \0Z0 Z00S70E 0S 1St5  d50S`P<5&0O @0 V"U 5 RD G 0 0|P 0  ㉕Ta  D0S Y U`4&B ?{PPp` Y YP Y  Y! U@1(@Q0 T PEU@ #6#aኗPP@T1X@QcTP #0001 01S@  YD3  , \3)&T3 0@L#09$ 64$0 R  "0S  J0@$00 Pq p2l2    1/P x2 d` P~ 2 RA @|>1 R,9 Qh;Pe@0 ! PPZ @@TP|6#1@DT PM\1 R 0 K | P+ h1 !0/i (K0 b@0 ,J0S 0Sq P 00M(< \P0S "XZ P D k6C tt됌XF\CG$,|GDGl TGpG|GGGGGGt -LM@P.Ppe`VWY!?> DR.000 0. $0`F0V$0@X L0 S00*6.P (@ R00  0R 0S R0R0S P 0 R P` _X0 S00Dō<<8똌K|HpG,H$DHk|PHt -La8M0&0Q 0  p 0KL P H D @ < 8 4 0 , ( $ @0(0PU *0T0 T00SP (0@U:6pW<0P 40H@ PK0S  X$ -LM`VPڴp崀K@PT 0S  0T @T R 0S `FVP 0  0P 00|K -ML M0,0   BRhHXxt P d$PTDT$E>K0C4  L44 $0ß 3 R( K#d `$ *B>KMK0CL0C L4 p0 R X:p# X*pCp\  X:X$3 ,0S <,_2 0S 0 S s S # P"   00C0 "{ P  000 00C0  MR0S-@<2V᪔@U P  凗2(KWKK@$ (@Z0\4  X$ kEQ& B0O0  0lp 6`X!0SV Eo0 65@"%$1 R0 P P& Pd P <0:90|oHH(0`HII}I4IXDHI$t?h?thHH@pGHH -MLM$p\0,0 (`; R 0S L0 S8(K 4  `0 A?(K  A?(K D KK~0((K0Q 0@^^>KMK ᔑz P$ $\ 0S  R0.S $0'$00Q0Q0 Q00SpG h'dT X (,0 S <,100 00CS񟗳      $0S&&L0S6 `03  00C SK             0S 00C S'X            00&\ P%00C00000000      y0S $\NK @D@D0, S^K PE0 0%5 R $\00 PO$0SL0 R$ 4 RO$\ P; 0: S0   4$009$\R  0.S  00l PS L0S|3(K4!  `0A?( K A?(K KK C}$\0 0 Q0hNK0ᴀ$00$03  0`0C0 i@@Q @T; Q 0S+ 0 SP $00$0P "00C0"m>KMK  PH"]D000.S "Q pnP00L Rm `0j 0Sg 5\@P^>KMK @d$00$0@1  0`0C0 崀=@}?P|P( s50.SR 00Ph L0S# `0 0S 0<0P$0 tIXI4IIIIIII$IJJ J0J}IDJpJJJJK8KPK ((0c -!0L1pCW:@`V QЀ Ȁ0 R 0pGW*0 R PQ 0 R x0 UP`@H000<0 00C000(0 0-L8M`Q QT!00 @D H0 @0 <0 80 40 00 ,0 (0 $0 0 0 K0DS0@T0@@ 00CS.<\x 0QP 0S P0  00F)dHK HKmHK4 00  B뜌 ?pK|KPK -`LVP)P>1 1ER# @T 0S @T.!0EX00C0`FVP 0  @00(Tꘌ -LuM؆0,0 ( p! (1PW1 1 1  6 \ᄦP  (` ,6&2Pv !,6"! 0&&& e&a rK] f?K^4 Z(@1^*P P ?> P  RN+ 0`F<0^:6^  ^<ş 0P<,5% \?>1/1L.QAN 0 40\1嬤 01 0S  1, 0 S  0\` pK_K<$1ᵒ,6 1R rK P0S#1ᡒ& ᒉPh0SR1#ᒒ&჉P86 P90S 0S % T1- 0S 8rKH Pß,0 S ,"-C1! 0 000S  ReK& P !&^001&5P hDT>eK P & =!00! &Pu #1{ vi,6KQ01,&K `,6|AQ000P0SH1 SDH0S%1 S!.0\!5 2! 5:? >PN0ׇ? >0N0CS<,@@@,101 ,6 0q ,6!j tX@0 H;XKKKL,LhLL8LLLL\L -PULp`:4C@$?@TPZ 㱶U:LL 0 00 --L d! p-PLM@P`l0l R ÎT D0 Rp80 t 0   H2L --L  --L  -LM@n hL= --L   p-LtM/P.@TK P0: S p0`rS{ ̏ 0-/L@PU+D0 00x/00(+n+n00M -LUMpPKPP@lK80S-0: S  SU ՃP U@P P@0 R000K@P h1: S@ Gc$^( M@MPM P-L %P 9`M -QLM@ &P T (%pM -LLP M -kMLM7 6@, @6K0A䆟 A 6 PIP6: S 1PK &P0S| |6 Rq 0 S i\0Sa L6L&@HfHv@@ @@@@J%0 0F%0S P5P(0%<00PC0S0S X5 ,0S ,*L%e.K B BP \P @0@T H6<4"D0# sP@0@Tşş%5g@0T06 v4 RД3S (0 త4 @@TZ0Q $R |P0S (4 R &6$P, ,4@ &PT6&  S0"",3 0P@ Uh 6T#00/>10@ц3PL džx3PTChG ༆T3P= ⴆP03$- 6SR ,@!0@T00 "2 㒆B00㌆0"S P yx2ulPP\Hd,(PPO@p^T J/ cv1  LPP>, Zc&R0S%"0!S$l pu}PL[~yl ,S ql K뚙?A4 MpG,$0M88MMM N(NHNlNNNNNX4 O0OHOlOO(0$OO\O0P@PdPPPPPPPt -L M, Zß ?lv3弃 ;WP c+ B#x3R,p / pW,P  0bW@a0EOa.6 0@Ɔ& 6F@VO3 ( &$6Hr 0(& 0DN00 IB 0+00 0S02PU D2 00  0 0 00 ,0,0 00000 330330 33033 @0L@0 D0PD00 550550 55d00d0d0d 0 d  ` d0 1 R,d0\ 0+lP 0 R,w6sP@kU*0 Q@tPU:aA  ,0 ,8XSPP84Q0QdQQQ@-@0 0   0 0 0$  (@$, (@0@, 0000 D@0HD LH0L 330## 330## 330%% X -PLM@ 00 R$hk$QH2 -LMp@t`@v^ Pa0@S pd1P  0PUK T q,10  00S 2W~Cp pG R R0! lc.،`fP%UP0FOa.U&pn  0 6 & p@щb0PV6@ȉ $8PR|,R -0LM@H HzP0T .j! 눃edA\RpR-L0(&S  d0 P0S\P P1 Pa S\Q 60QX -L: S  S  S H0 R4 S S  S SR -1L `R_tP@@ Td1 RLX1 RHL1 RT ,1 R $QXp၆00CS0X0@ӤX0& T 00CS00 R0 0  yTYT nTNT ڰYT00yTP w PXGw@4P([$pG0 (Rl RRR -0 @LM̀@@0 ` @@``ֈPUPTp p @ P00TQ  p0WD0@@W،܌XxXS 0-PL@T 0&"0S @T@T# 0 @TT  d 000X 0000 0 @P@0XX܌،4S p-l0LM@Ɠ0\S` @088 000 0 `PpX ܌, p-LM0@S` PU 0 70U P 0 PPt0T p 6 Ul`P6@ S6& "," Z 6T ꔌRR8X  0-L0P LR @  (X$P 0麯 $LSpG`S -LM8pP(2G 2 R b  ? @_rTo 1 RP a@T T rPUp@ U QW!0Z00 lQ3L1 R% P ZD1 R 1LoI 1 !@Pᆇ0 @C@0PP  ?7r@0@ 0P PPUgH ,84$XxXtS܌،SSS8S -L$M0 !0P@`_ᖄ@K &" $"40 D @K0, /Qd4 ,4 P[ 0@0K,0QM@4 8@ Ha4P8pT54 , R0,# @K@_@K0  0`Q 00Vs# @߆0P 188 x 4@0pW 㜮8@Ɇ0@80 0ꔌST4T@THT -PLM, 00 ]@_l!@K0/a,@@K,< 裃QG 0 A0PP< ,@`K 0㒃Q.0pZ oK &@ 0R  @@K0 `@0PK_tp o b,\0 Z<,S00 ,K锌PTXT@THTp@-t@00CP`P``?>!@\1 00CPp010  p褌 -L8M 0@K0 ,0  -RSL4M@ Ppl h\\1  BRH pT 0, P \0 , K X T L H D @ < 8 4 0 `HH\KP@ 0 P0 X T0 PP 0p  0U0?00f fᆃFs`` ~/00f V:TPU L0L X0 0 TP  U \K(fh} -L  - LF0  hLwTԌ -LhBwh>w -LM0@S AdB\BdB00S lh0 R \P0008^똤$TTT -L`P]^똡嘁q@!pb@1 PP d,PU V 0 Sr,200000S LkP m \Ph0 r1000P^ 00S .\  AR #  Q  tAR #*~ dk j 00S P2  p,Z  kP% 0 00RSY 0@T 0R @0S 0 0S$0S 0p0SPU{,d?VCW<<( t`o a(aȏL\Y4a -Le0 ,j(0( ppe Lzi La -4L ,j(0( ppO Lyi \a p-L M$@K DQ専08 pp$ $P`  $0 0 ` pp! 0$ PS 0@UU0  CR 0 R00ꆧh 0PU@H00CS00  ä0 rpxi laaa  -L0LM@@0@<0^ ,0  xH -0L0  -0L0  -<0<L00, p0ShTLi a -80L4000 0p0Sh>Li a -L 0000 0xH -0LM0@S/ h00S00S P00  |,0T, @00 0 0 0Hxa -$$ 0L00   -L(Mp0@PK` @ 0 + o0S Ni3[x DT 0 T KoP@  0S, Li `i b$b Qd0d0A00d0__ -L M Kp0,` 媁$P@\  0哉Zt0p00dS Xi0SHD p@h h$ P0t@l0@B0b_Db_ p-0LM0`0S aP wP!K;P@T 00S hP 0S 00S` @TV850?=pDb<`b(ab -PLM`@Kp| `$h1 @`@0 DP 00 ,(0n0SLi bb -PLM`@Kp| `$Th1 @`@0 DP 00 ,و(0n0SLi bb p-L,M`0@PK@$ 0 i "h0S k P0r00000Sp  ,K hPX P㝈H0Gnp8У 0S(pbi$c4cDc p-L,M`0@PK@$ 0 $ g0S j P0r00000Sp  ,KgPX PXH0np8 0S({pPci$ccc -LM@0Pp`P  R0@r1000xSY@Qg W |gPY r10000D0S  rt10000D0SX0UYDDdY 0- qP100000S00B R00000ӑW0C q000000S00B R00000ӑW0C0@00W0\R00S gP@00 `hV f]`ccc p-QLM@P` 00S R00000ӑxS T0S r000000S r000@000STT T00P0SPP  ph8@T$@TpdldD= 0-L0MP@0K; K @ h@0S`  @0[<0KfH0H <0K0lP0 0S ^0Li d,d 0-L MP0Q 0 @!K  K0Sp x Ky0@KL pf@0@ lp0 0S *08diLd\d -LMԡ0``K@8 PpK(0 ~@ ~0tP0 L0 P` M 4P P0L` K4 MK~TW{x0SxSZ@I?K2lK1ppK01@T` Kjp`x?Z`tPP@1@SPTUpPl r 200000S 0:SP Pl 62PPU t @T0, CR 0 R00ꆡp0K1@S\YU@ T 0 CR 0R00g8!R0S<1S0P [ 00CS00  ä0 XH00S"0 ,0Sp,Li i8iiii (e8e@eLeXe`ehdtexeeee ->MLDM10 ,  T >KK(@DD@D `{\ cL iP`9>{KL@K(pG $pG>[{ { 8P 4p c iP@ <0S <0TPE, 0 0CS00ä0ɠ<0@T|PY\Z& 0 ,0S8,*$ai i|ee< ee 0-x0LP! @ T @ 2| 0 CR 0R00ꉠ@x0 |$|R d0SB0S 0B 0 CR 0R00Z505P d 0 CR 0R00Cx070 0h08e @eLeeffff|f 0-0L0MP0@@K( 0 { b|0| iP:0SX0 P0 H00<$ I 0S(s06i(fff 0-t0tP0Lh@h  \0\00 00b@08 hP$S0L5i f p-LM@`00X`PD 8@P$NP^Ppf g8g -Lqd0d0`pT܂0@#nPp@@Np0 ̂ 0hgg -LM@KD004 (㳂 00gg -LM@-D004 (㕂 00h,h -L M0p$0  @pp`0h\p$KP`@tz$0@@S `Xhhh40S 0S0SZm-L0S 00  S\0SHZm 0-@PL0 Np0 0HZ,m 0-@PL0 9p0 0Lm -Lp6PP`@l1d0p0`@0 @8l@T(  ahmDT] p-LM0@S`P 00  S.Pp@0Sp -QLMPp W@cX0$  A0S 0 0 SP @0S@0S$ 00 S0P QWl`||Xt H H00p@0S% 4i`omm]DTmm -LBM MLCNK@DP0 @D/㋏KKoK,0 PPx `1 fPp2(K 0Sb 0( K @<PP@rP,`(0K 0(K 0QpRKG K <P@P{rPP,k` 0D( ,0S4,(KiŒmmm -LM줟0@(0 4$4Q4QT00CS00  ä0 T 0S 0S yXp@K DdZx `0K( `0 RfP`0SP@K( Cx _ =fP0P< Pp 3 ,p 'fPx㯛p @4 @0R0 0  CR 0R000( CR 0R00 40) CR 0R00`R00CS00  ä0 880< LSH20@S& 4Ÿ0S @0 0R 2!0S 2^ 80 00 30S1@1S^$0\0CS00  ä0 8p10S P00@T`10S V8`Y 0  t00@T PU X0@T  @0S 0 0$0S_ (0S(H2l(nDnn ni n6i(nnoo]^l7|o<YL -LMX0Tr$0 0S\0+S (定$B$ ^4PK t D^ D eP 1` 901S< vA0 x! dP #01S Dv\ 4 0^\t<X 14 8#"N0! 40K@  DdP 01S v| n^P -t)00CS00  ä0 d $0ST$\L0o%i ؐ0 CR 0R00pphdppp  -@L x`A 0S> 0CW31 V ,0 CR 0R00@ ` R"R000ӑ0 CR 0P R  U 00# R0 S0 S0S  p-L$M08@K`  Qs4 <0K 0 P c 0:|<0S  l1|n0S 00S Q0S 1#$0$ <'pXذp -LMK,p0 Q`t 0@S {W0000T00TQP  s sT@D0T0T0 d20p@-^@ 0S\\  P2  RR P2 R\ 0S\ -LM@  Pp -L(M@q0D@K$ ,a 0 ;s$ Z 5apg0S3 c0S/ 4P%ljP0   ap㥖0@`TUZPPE Vt` h@00U00SV  0S, x i$tuuu`otu - @LM0 rn 0-L^t@TlPll 0h銖Z 00404 `0S 0h0Lui uDDZD0D~Z0@-@@@((0P\ P, ,0PRP0@00@-@@@((0P\P, ,0PRP00@0@-@@@ 0P\ P$ $0PRP0@00@-@@@ 0P\P$ $0PRP00@0@-@@@000P\ P4 40PRP0@00@-@@@000P\P4 40PRP00@|@-@@< <0@R8 80R < <0@R8 80R@`@-@@< <0@R8 80R < <0@R8 80R@H -LM`p>l P8 %00X P5帕 P@ %< 幥p< 10@GS񟗤 DPt|ȝЛН؝4LT\dpxD4T$P@@H4@@$4P($4@ $P@@@ 4333 3#P@3#3330ă80 ;0u3h#@t3P@@`#`3P@#@@x3,#PP@d3`3\3X#PWP3#00Q 3#< e<J2"P2@@@#0Sq`a%2 R2 R 2 R2 Rh"0S0S\2 R42 R0SX2 R 80S(Y 0/;40 "0S9 !0S3 %S" !0S! 1 R!0S!t1 R!!1V   y11 S41 R!1 Rt!t!p! 0S ST!S0 Rl` g0STR `Q0SK R pGꭴA< 0XwT|x|H|||}0}\}}}}0 ᔘ\ -L(Mlq0@PKda @ 0 H IQPD3[1 ,,!0vP"P  0 S  00 0 x 0x 3K QP>@8T 06@8 0\i dw}}}~ ~,~i T~l~ -LPM∡0H@Kp|P `(0 HP DP @P (, ꏲ> ~Ii w,0@-P@U>01 0 R 000 ^0 0-@0P0LS60S 0' ; 0P)P 0x 00P 00A>8H 07>$ w`M`|D{ -!LWM0,0  p᳅PUaKJ/ `d HT NP=WoK0PS @W 0]KS  @P U00R00So0 ,0S ,2 \\ K.0 7^0 S \ ɱ1>D0D @(> 0$ 7TJi(Xwh{ -LdM☑@q, KⲠP0K0`0 ` p@ 0K K` `0P` 0 R  )000 PPPP0  0S 0 0 .0\ K]l`K@ [0 0p 'P ,0S X, q[@N=0 `w4| -RML 7 M(% 4%  ǟ7 ȟx,  ,  0 8 < @  t' 忓p. H0@/S @LX$8H$4@`l0:;;@00S lVA0C2SE0<00S|090;0:0;0:080gş80:( 8 07gFKL L4EG.Kx t :  B0p l CP 0 Y5 09N@ `g0:;8< TNKA u@ 10S 0 R 4%RQ #NKA (D4P|ß0 R 4 R Xh 0@0rP00<0,0, "NKA 2\3 R 4 R0 S  "NKAl2`P0S2 4 R.". P"1@-0 2y/ 21T 2P00(.10 \rP <T rPp!NKA P L0 R 4 Rk (`rX@@ a080 00 V00NKA q1Pڠ0 R 4 R Pø;d0 0:;7/0<0:;:?.A$pD`| ԁ'' h3(Dd 4؂0 ԹL l8؃̹ęșx@,H`'uĄЄ0hHh00$4؅ 1 bZ bZW0% 1PGFKL@ L@@@@@@laG~K@pGx t : 0p l P0 R11 P0Q5  LX18@P50 ,%R0 KL@ L@@@@@N>K@0C, @:0C D fP$0S \0 0 )qZP"0  NNKL2@D@DP)` 0T `ZZPD2) 0`OZPl.q,q߁4 0S Q0S22x 0 .0% >5 P$  #0 5@T @@T ^DTH$0 00000000@Y@TP@0D @E@0 4 R1 @\ O>K)0C* Yps $KNK@D0$% R44:0  4 4: 0 YPPX0 8EP00 0 s0% 0% 05S8%R 454 00) 0l0   ,0S  < 4 (%R <5P(%`6 0s 400) 0   0Q4 ZQʘ&0) %R @0SX&\KPEd&@0@YYP6&0@NYP&ONK@DP) 0 P@YP6) 0P7YP(@ @l- f' 50C5 峭| @ qJJ (0@ ,x00MKBKK DhDKL@AI L@ A 0IH D L @TcPU\0SV(0 NH@0 5 @^P> Hx804 =KL0Cˠ 4 $5 4 HD5 D 4 剏P L%$Ed  R 0S9LPڔ0   Ꜭ0S 垰aXꓬ0S t P@,'J:0=KEK0CL0C 0 0XL: Rig` pK0Cɠ@ 0Ch* @YX ~05 PP:`@ +0V@0 )0 5XPL%^PhO.K B0 BiPi4IP4  `J@TO^KPEPE 0 P@540SIP$zT4 JP~ LnOJT`<Phd p04 -|<@O>K0C)0C D WP [KNK@D Z<)O>K0C Wp F-N>K0C 0C( W8 <-00 tT ~$"`=` |Pp % 1 PP JdIP 0 I,%0b-PP0  P$ 000P ęș -LM8P |0 R 0 l00 d.L /,P 00 @4 @ @ @ H K kW@@P<00    0 0 -3L$M R 0SS@@@@@@@@@pp3  V\\!00j0Kvg_3 3 .$(," \"(!̠0!0 `.2 p22@80K8P  0 0@ ,@ 4p 儍0P0?@ P`2 X00P 8 C~,娮@Kj<@@<4 Ġ̌(<"4!Č ̌$ P3 K P- 8 P0 1P0 21 .1 +|1 (p1 %d1 "X1 L1 @1 41 (1 1 1 1 0 0 0 0 0A[?[0HP @@[0G @0H P 40K9K3K6Kd<@T KH_pp (0S4(U<o p-LMP`0,@KHP 0 s3 ^)G 0S/p -LM@P  00R0R  00Sh=( -LM@P hj00Sh( 0-LP@P $00S0h( 0 -L M K\9P@![A[R0 ʐP 4x0td P00TT0@LP 400 PP00ht@ u -LM 000000000000 0000 `0`圢0A> 06 pIpq QcPa 4S4S 4?0 @pP@ur*`0A>@t 0 001 0*l (pP|Q*?T A.0O0P000B>0,10S 4PU/0K000 p*=C040 00S 00S" 00 0000000`0` 0 0 0 0000000 0000 `0`0 $4SY*0X Бܑ  -pLM@ 00s)0@@-`@? 0"00\ 0S0S000\ -LMZIp q  Z0Y0:H!O 4  6y†04 S4 S* P%0 4 S4 S0 4 S4 S*p 00 0 4 S4 S:T0O YA. P ` `6& 0I6Y$ -x0LM@ 4 BN@Ap@0t hz 00Np 0-LgP" 0P0Q  0R 0R Q(00A> 000 $$0(00S00B>0 @-(0A> 0$Đ6I  -LM@$0AR 0  0R0$$R 005:| L0$$R0$4 A  0@0 0$4  0-PL $4S0C! 4S4S 4 A> 0@0P0 A 0@d0 $4T0$0AR 0  0R$$0R* 000hc5=?0/9P6 0S000  p- LM 4B>0 pQ 0P@00QP`@BN@0 A>0A> 00$d0(@K B>R0  40 40 0T>pqph(p -LMX;Px 404@0  0000 0 00 0 0 00  0?\00 -LMX@ 0S 00 0 @0S0 04h -LM@0 =pq @ -LM̀p`P@TC@!:A>B.A 0 0$D4 dD P  40 40 4sto 0-tP@0L 4@ 4@FR 40 04T0@0h000 pD0 00000Sp00000S p0 000  -p000L00 0S0  Pt tBP@ qL0 0000 0S8 0(0$ B (0 $ 00 0   -L 00 0 p-LMP%u-$`$@000n-000pf- -`Lp00S 0P@U-x 0 0S %J-0 0 00(`S@0S0S 0-L@LP 0LR0 0CS00 00 00 -鐠p0 刀0b? |`PUL@0S 2-0 P0b?U0S( 0f0@m -錀p0 儠0b? x`@TLP U u,0 @0b?TU,0@ 00c0m^ -PL0`0pS @, 0 R , 0 0CR00S 000$,000 p-LM|` x0RR@,`0`P0 0R00C0w,00`00S c0Sp 0-p@LP`,`0P0X,D P:00@P*0P0 0-t@tP0LS 0S 0S0800 P0S00 - 0L00S W 0-xPx@0LS 0S S0S0S S 0S 0S S 0S0S S0 -LML@00 S00 S S 00 SS -H0LM0@S ,0@$ 0@]00 00 0-L@dPaa``$a`,bbaabb4b4b4b4b4b4bb4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b4b,b0h0hlA00S S y00S SLM0.0?.00e=@]@0 S=@= +=0S?0SeXC`0SeX@e dM0S P P 0S#0K$`K$K P P 0(K(0 F@(P]T0DcS&xsruhwrz }{zusDr0u,wvu@{x$y4v|ywuz{vs,tw{rr{{{(zxlt{\|ww,xxz } }tvlz{{ } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } }@oH 0Lg,+0S0S ; K0S0S-:0S:  *0S0S : |J0S0S   -L M@000 p`P00T,0  300CW 30SW200CW 9B2 R 200CWUV T0S x20S \,UVP i; R R F20S pWWJZZ`P#p`Pv0X,0 p@q>P ,PL1AP-00Y000 # 1 00S0uv   00S00S0   00S6 00S 00S-pWZ00S0   ,0S 00p 000 00SYk 0 o~ TP̔  -LM@`PpTW 000CT0 @T Jp`PvY Z@@TZXZ!o7  -01L M0pS` 10S P; i9pP@+u)V 0AP 00S PP@ 0pP@u l0 000 00  -LMp`pP@uV iE 0S<00S,00S 0 0S00C4P'Iܔ P000P -P0Q0L00 00 000, - L00 00C0, p-LMP`(+@0  000p P0-L@P@ 0T70h400PP0PP -LM@0S00, p-DPLM@`T Pp@Tp 0-LP@P000P0000000000   -pLMP@u) 10S1!00`Q0 #P+ip@ VP@< P00 P8p0t T >  P 0`V00S;00 P``V%0P@` P@@P%@Fx00S00 S 0 P@ P pDP@h8 | 8< -pL MXrPp20S200QPW0 P@P v20S @ T T10: P@ P p1@0`PP` x!0$ P@ p`PP,  0,0 @7Qp@ 0000  &0 P` P l @0Q P 0Px00Sl00 @,@ @0PU`XW,x  h8<| 8 p-pLM`Pv dP<p P P@0P`40`/@0P`p P P0`p -L0SH hp0 s 0 0  Bh -LMp`pP@u P |00Sh0 tW V P@(0 f K!t$4 -L M@Kq O p-LM`pP@uxFpP@uPph UT0 phTp$ p-LM`P@P  P ptP@$00S/ pht -L M`P, , SP,0@cT A dxvP@ Ho1pw0x00XW0A ,0@T)y z  V0 U0 1 ,0c@0;p`Pv ,0@T| ,1 ,0@d@ 0@ܠ,@00CT Tp`Pv XW  000S o20@0CTA D0@@Y 0 0@@錕t -hL7` 0S 0 0S<0040   0+0 鰕t048 -p嬀0L`PPጠ @T0 0P0O  c\,  bW,P@`804L0 0DS@0 80 40 00 ,0 00 0 @ -L M@@0 S( P@p`p`20S, 2Ÿ  00 r0s 0SR !0S0S1 01 00p 0 00 0S/@@K 0 $1P a,1UP0!c0@P+P 0 0P00 0 0  0Rph0 00d0 0000 S 0 (0S8("L@048vĕ p-LM0`SQP@0SPE P P@P0SUfp0SQ 0S0ASQ 00S0 0S  -qaQL 0@ l0T@lT@S   0^ࠡ0nP 0 000 h0 00000nP0<0 0n d0 04@P <4HXP$0 000@P ꜷ$0 000 p-0LM0@S 0S PpP pp`P R`000SP PT R ,0000SS Pp4 -@LM80 00 B0 @00`004 -T0LM0@SJ@000S P @TZ0 -0LP -QPp1MLP0 0``P!A0P000SPh0S `1@HT1@0@T @1@a0 0CRP  UR1000S S 00@0TS P0ø 0D Rڴ000SP W00P00S U PT P00C0LL0 0p<0 0P000804 -0LM00@0T0p` Pcڴ10U 010`@&P`  TJ1U RZT010Pe0 DPPE0 0U00< -p@LP`P 05P  T0P0@` "l@h 0RX0X 0 ?R D0@0 000c  0 P-L@p`5PU U nU"0 Pa50Sa uꈥ\ |0L 0R 0SPUQL0   RRyxw0 P50000050Sp 0S 0S0STQڨ0   RRPO0 P0 00& 0SI 4Q!0S 40S0ST0   RR(0 `P000 3 0S R0S300PSU T P0 :P000 ßS0 0S_T2QW T g 0 P_T$0S 0S a 000S|2Q00  C\2LB 0 P 0 P000=_S0S 0S  0S  0S 1 T "0  P  T  0 P000 P D10SLSS G >PC <P2 10S ST0 )0P0 @@0@0@0TP 0 PX 000P 0 yP  00004 0-@1@LP T00 P0S1b Q 1 Rb\0 00R 00S 00S00S 0 000 00000 00 p00S d00S *00 00T000 04@P00S 00<0< 80Q0(000000DЕR400 0  p-pLM@0`t mPPDp@ p/-@0t T T000CUP800@'P@0 V000p80 -@0LMTpP.P $@0ꌀ0P0PE) P@ p U `ZP @0<0Pfv%(0PE0@W000080@-p@T* R  :P0b0D 6@0@@0@0 0< @-P 0S 00Q  -L``P@ T 0S0S*0 S0SB @ T 0S0S:p R000 0  `0St0 @ R0 0S0S@@0 S$0 0 0 0 -L^ 0 ԕ -LMH@0S dR 00 000P0048 -2LM0pS px} XW"Z 0S 0S *Z 0S0S:0S0S0$2Z 2 00`PQ PU`R?Q=PP;1 `XW f1`P0 00pv  0x@0XW4  0 V;U9@04P 0 `VU a0`P0 00pv  09@0VU80   L84 -LMZP,"PU 0 S 0 S *PU 0 S0 S:0 S0 S01U 00 p ` Q `VpR+Q)Pp5P(0`ZGYE $1p0 00px  0@0P`Z,Y)p P ` V U x0p0 00px  0@0P` V U0  -LM P@p` P@t0u00X00S T00XtuP@tTU@0 -L M0-S fGEC_,  !73`P !LPp% 0S" 0SJPP` @@@IP 0`#lU0S&P#`2 k! 2Y L a40 , oHR 2̰ 400S APa0@S<0 -A @L2$0R20< -'PLM! $P .P ^P@0 00 aP|@000C 0`@`000T@P@ 0s0s(< -LP 0-LM@ PKT 00000 -L M@K0,sώ0s 00@3L -L M^@K |0^0s 0s\0000 H00 0400 S P $ -LZP ,0, 0S (@-, (02 S@04RPL 0-PLMP0K K@XP# 0S00R0S$ 00  0D P-L0 h( 0-PLM@Y P 0P[0=0C:SG(DDDDDDDDDDDDDDD DDDDDDDDDDDDDDDDDDDDDDDDDD0DDDDDDDDDDDD8lPhPdP`P\PXP@8P040K 0(10 e0HLPdPPP0HPPP= -@LMTd ThL0 !@<840,hhppԖ@ -LMЁ0P@$0 * TTbA`@ 00B S10 0C00B S0hQQ@`-0,SVVE1C B(1`$1 <qK 0S#T`VPK K @ 0@1` !0`V@Ks 0@o  `!PKh @e P0@`0P !KHP  $0S4$6@<tDT: -PLM! P P( R0 0 0S 0S l|T0T Q0000K (0,0 K0K00K0K0 eȗ -l0LM@QT T@ hN$0  h`ԗ0 R00 -PLM$ \ R 00S S  P$K ?0000@0pS $0@ D$0 0RV``````````````````````````````````PPPPPPPPPP$ 0+SppW0$0 q1 +P0 (K$( $ 0+S0(0 1[`X$0z@0C$0 6a0DPS``-P@<0K0P 0(0 000CS4t( W'P000"W $00Se S$0 $ 0 S 0$ (K8$ $00SR $K 00S($00SH -LMP( `P@p@@P0U 0@ 0$K$0 1U0  0 0S SU(00SPPU`  000CSWD<<<<UF U IU F 0 0 S008U4 U 7U 4v1 0000vp1 0 00X0ESDU U U (K, K,0S 0 000S U(U 0 W000CS0010$K0$0 U 0  0  0LhQ PP -LMK@0 = -LP0 0S00 -LP  0   0P -LM0K0 =鼘 -0L0h -`LPp@`0PSE 0$S T; P80 0C$S'htttttttttttttttttttttthttthtttttttth00@f C 000S -L Mp`P0-S@@000C S U 00V(KX(`  00B S10 0C00B SU0@0X`ؘ -LM@ R |00S dR 00X0 0P0 0H00 R 000 $ Rx\0S R 0 R000000ӑS$0S A0@Sa @0R0-P00 p-LM@P` X0@0P SP000000SToo0Sp   -LMK -LMpZo`@@@- 0P`ذ -L  M0KA 1@ _P1$a0d P@00KT0d  U0K 0  -L`P@M\0K0 0鐆P@ !) 0 K4\0d 0\ 0 K00PKF" $0K p-D1LM00@`1 (1 p0S! 0DS  00CS @HP\X@T U7`KPP0DS  0@p p-LMD`DP0@S 00PBP0  Pp 0-@ L08PS@00( 0R+0@00 -LM@P P -Lp`$M姯Z, H0  `vp0.0K.K0 ]0 P@0@@hp`0Z-00hH  ,0 S ,d -Lp`$M姯Z, H0  `vp0.0K.K0 '0 P@0@@hp`0Z-00hH  m,0 S ,. p-LMP0ϰ0 0@` 0K K\0/cC!b10@00R0a\-00a D 0Spgfffȡ 0-LM@P0$@K 0 O 0S 0С 0-L M@P0@K 0 }7 0S ն0ܡ -`LPPp% %P0 `p`0nS dS sS@P pPpP -LMt qP@g T T Tt h -0p L \ `P@ 00S 0@0 S @ \00ShLD000@000T(0 h 0-L@Psj 0 0( p-LM`0PS@ t00SX 0@S  @00ScI(0 0S0 >ppT00C p p000C 000C?001D0@-H 0\8001000\0 010D0@-<00 CR,0010 BR0 000D0@-8 0R (0P@0100 R0D p-L MP` 0@R$K0S ]f0 000$0s 0s 0 01$ KpD0@-P 0S0S0X@0^! 00S 0SN00^0D 0AP<00 r0s  PD@-p@0\`0 0r0s 00000\0 D 0P PPB@ -LM\X@TLD@0 840 ,(0霎ЎH؏L(P p-LM@@`P8 0S BPl   ?0  ptt -0LMK0K00K 0-L M8P0@K 0 . 0S 0 0-L M8P0@K 0 N 0S 0 0-LM8P0(@K 0 n 0S 0f -LM@u q0r00T00S 800T@qr  -LMB@6P񟗓$$$$$$$$$$$$$$$$$$$$$$$$$$$ $$$$$ DX$`$$$$$$ t1 p1RDT10SD1@18cB01$1@0S, vpq' P0mp@q bQP@@ U0 SPO@@Gp q  (0\Pt L p-LMB@6P\\\\\\\\\\\T\\\,\\\\\\\\\\\\\Hht\P\\\\\l\\\\\\\4pP@u2HP@UʰP2 R B@0`PP`VUP@UʒPL2  B?@0%2z2S P@@r@0`PP`VhUfP@U`P^ph\0P@t0 u SR?P@09 fp0 s2  0 _0 S*P(Rph=Pp0 s ph| |0S0S S00CS00S S p@,0RP phph-p tK 0:S S@.S ?S  \SR R 0-0LP0CP@ Sf0B0C2S=phx`0 00 0 PE000$ -<<LM0pSP0:S %S .S) ?S \S / `V $K00!c(PPDP`VPE $K@@!O(P (0S PW00P:gt0H -D0L<080`00 ,0b A0 d(0$0 0b0c0A}P -0LSPp`@7  r000000S R000@00ӑ0 T00R00S@D 0S 0S uP0S000S&10T00S 0T S@D00\00SH00S800SSS00S0S r0000000S0S000  $00S00Slh -0LM0@SԀTpW.0000Sp頠`00CVP@tu 0 0S 0`0CVpx -$LM0s0s@ !1 P@R00or00SnP`00CV)pP@u XWp q   Q0 P0  Z$`00CV -LU0S, ,h0S000hVx -PlpL† @*;0SX L0S^E@0S0Plh( -LM@PGE0 hl p-LMP `@ (0K l0 0"T\b`PP (0 00 plh 0-DPLP @巪T000  00T|@-p`P@Q|0s 0S 0S tu' 0S$\!:00SP00S0Q 0S 0S tu 0S0S*Q@hxT@-0S  0S 0R0S ^ 00S0S:@T 0S 0S 0R 0R@@ -LP@ M`, K00 p`PWY Z 0S0 S` M Z  0 S0 Sp`A , 0S? 0 S, @0 P`R @0P`, P,0S, 0S @0P,`00 ,  0S0S , @0 QP`R0QSW -LM\S\p`@0 :< P @0R`@00hï @ 00 0hï @ 0<K%0SP0PS @K 0P<K 0O<\ 0 <0 <\T00S0 0 T, -LM@K=0s0s n0 c -Lr 0 0S0 hhx -LM@P  pP@unP@0pX W``0P@,0`(WP@  hpP@u|0`0VpP@u p u `VJpP@u $ -L,M@@K `Pr@K` ph200 <q8 r 08@ T<\  Q R`( 0@0C 0, K  `P @0 8 ` P @0puv R@0KD10S D@0dS0c S0 P @,0K4 K0,m@K,#0"0P00S`0P00S Q   H  4  , 00@z00CS0uH00So4, 00  @~@THLh -QLM@P` 0S!-P 1,0<R A0S* 0S!0S001 &뀁p0S  PP1Wp 0S  01A 0S 1 0S{  0K(0s$@tm K>0 ` PP` h P00 R00SH0  0K 0P 8hx,X$ -L4MP@pß00K @KP  R0S `  D `VD r0s tu h20S R0S0S *tu $200@_0 K0tu 0S0S*100@_10!0S0S00 ?SRp00pWÏ0K D1t u  y0z 0 U T P @t u  U0T0 " 0 @0K@  Pl q0s  ,0S00S0K@0K0 K0@ K 0|8p@-`^@P  \\ 0S 0\ 0SP@Up^p 000 000 000 -@LMTP oDl< gdah] 8 -81LMXH @@ K}C@4*c:oU0  @`Pp&0S0S 0 0?00`0  X 0S L0DS$0   i Ll -LM0$ KK 0 0 P$ - LE P00 2 -LML0K Ap@T0[S00KT[ -FML M7GNK, t7t@D @D0`PXX P D'NDp 20@FS""((((((((((((((((!((((#((!(((!(h#(##(((((((((((#0$D$P$((((\$((h$((t$((&&'((X''6 R5 j5 R0%<0uKA H$P00Q0S Q0(8luKA 2$P00Q0S 4; 5p$5 k5 gtKA $?Q0S 08:$000N000;0@008`4 R$ = KJ p pGJ HL$ 0 Ps /P* P P $0004SP0;000@P P3 R3 aP3  080@0 P8  Pd3    P43    P3 R0"< P P070$H P P060$T 060$P 070$L 0 70T H L 008rKA e$P00Q0S  n0$000qKA L$P00Q0S U0,0|qKA 6$P00Q0S l?0 0$qKA $P00Q0S )0001 `bVQ$B~KpGpG`zdP  2P $0P _0-S x 12'| <`$p|x̤0  -L4M0 4 00[ ,0 6ZP@K0@$P@P 0L0P 84 R 0@ D0  @ D t0H0 0D S ;0 oR04  0S00@ 8#8L0 T3 M 00CS0|S0 00P@7*@ 000< 0SC0S #0P C_000 1zL< C444 00 0hBD@0pxx1Ud2 R  4@ 0SZ ,K00D %PPJ >D080 ` 1B< @K0 00!P@$ P 1 xRe1q@ R xHd[1`1 RH@4@0Sp $ 1 @bTQ04  0QInK`F`F04 XPDDT0 sT SpP, MK@D@D 0E0 )NK @t娄pY ,0 S ,0  p 3MK@D`@D>/,]ムP XZ W\ pޚԾ$pD $l -LMp0R@ 0 P`# ]TP t"^K@0  0 S , 寥 \184@ -OMLM|B tUdr  , u > ?K@KA S%0 B% 0UK 0 P&\OKH H Q *c_\1(K R qP0`S @0 @PXa 0PS@TPP01PQ? v% 5P P P 00P@00P0S P p\ 0, BQp0  ,|_\K@ ?K2_4^Tt (f -GML M!0p,0  $KJ`J*K@_ ?K0 K@_0yp^  0SS?A pV`P$ZW0 ,0S ,婤 P-L@ p0 Sp p `P 㱿P P4  0@Sp0!R -LlMȀ0@K pd$0 `0S" 0`C[P| [0@` @|.P[Pd t. $0S $Kl H -LtMpp, `PKY 0<< 0 @@"^W ^!d<P; ;0W0@ 0[?S. Y  KP 0@ S @RT00T0ST00T0S\0 ,0S X,L]@]@F Pdxl  p-@LM]X`D00CS0X0ӤX0 PpP x@00CS00Ӥ0 Pppu YUyUpTQ r l 0!400   00!$!Ƞ ! -AML M , @t4D 4$ 0D@4 BnKP4`F(K t0@Y.@P?/@@B@DRPN`,0 @`VP$@Z -@L MX z&>opn003X$`pZ p-LM&> @`@Z ~NP PwU$@p -LĠ[D 0Pp`0 W ,"| P00 -LĠ[D 0rPp` W,  +0 S -sd -GMLM 0`p,0 PMK@D@D 0Pe0 )K SUd -`q00 L 0p0S2 @~ PFP#Uw 11>p V11>.QQ$ DU<AS ᫻pU| 0-LM 6P R|@|K  0S@ ppX pS@0TD  <S| 0\dt p-MLM`@0 0 PDp* AK@@+0>^P! T*AKAA 0r00000S  r\00000S 0S@\:Ό0 Snp-Q* rh000000S  r@00000S0S QQ: p-PLMU`x x0}d Xx 0@0VPP0P0p  p-LM 0@PxU0`0X0S 00 0 0@P @ p阤 -0 SL0S S h0 hr -0LS S h鉸 h -LM0@S S   ho -0L 㘏됫P -QLM,  10S 1 0 RA000i,  00S Sp1I0S; `10S7T1,@<T@@@@ ! 0Pp`S@1 0p^UPP$X U`00Q` e Xp, hP PP `phP`0`@H0 , ,0 0!0 0 000xO(,04 p-LM`!P@P 0 SP UT0  ]KḷP00@  ";p -9L M 000`fS eS gS )))000P@00GS񟗳iiiiiiiiiimmmmmmmiiXjmjjk$klmm,kmmm@km\kHkm|kkmmmmmmmmmmlkkmkkmklmm(lmLlTlmhl\kplm mxllllmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmlm mlT u$6 0 00 R6 5 5R95 ! 0 B 5E ,K厸0, R( P00R0S p AWp5 pEPX%00T%6 ,Kq0, R P00R0Sp54u44  44 4 G$4 4=$$000k0 0 0( l4]hh 0eT4SP4QDN:30000E3 4<3   83 33/3)3 3$3"3 3338C}PD3puP XnP D<3 c,3P0@S@# 3 k1pp5X2P2U0`c ᵒTPV20S= "0S`F@1x0@S$"000T23<2 82  "0T13 0 d1R0S000  007P X1 u"P !L0 0R00\h0 : -00C0$ -@L`P1T T0q4T0S` 0U  R00000ӑ00Q000 Q0 Q0a !00S  R<000ӑ0!0a00Q  -LM@Ppt ttt00S$S 0,p 0 0`^S0p0C0$3t0 S 3 0S00 B B0 0 S P0@ P00C0044   0RI r@200000S r2P000PU0_S ,S ^S $S =S -S :S /S 10S  R10000ӑ0.S 0`?QXZ, ꛎP0Q010S$10S p, R X00b0CS0X40h0j`C f0Q0Q a01 p00S  Rh000ӑ0!0a0 Q4S  -LM@0p@R`,@ *$R 4Sf 4S P`PR S Y7Kp20O00O4S  0 0 Sr400000S00S_S   P0S r4400000S0_S 0 S 0R r300000S0_S0 Sr300000S00S_S4SPk P bpW00cO0O4S @0 0 Sr200000S>00S_S:   P0S r200000S(0_S% 0S! 0R rH200000S0_S0 Sr 200000Sl00S_Sh  Us 0b00S10PcUj~pZ0O00O4SL @0 0 SrT100000SA00S_S=   P0S r000000S+0_S( 0S$ 0R  r000000S0_S0 Srh000000S00S_S@,@  0 S 0 b10PU, -L⦌P%  -LP 4{0@-@TP* ^ \00S.^ H0 0S \4000 ӑ^ 0@T:0 -\0Q 0\ a p-1LM0`S@PP10S U t0 CR 0R0 S 0@00?,KP$10S U 0 CR 0R0 S 0@0"0KPU 0 CR 0R0 S 0@0TL@0 W00CS0 ph0  0p : -LM@PH`p!*pF@K 0PD,,,,,,,,,,,,,,,,,,,,,,,,,,܈,,,,,,,,,,,,,,,,,4` 1p1' 0`0 R0Y00 @b0Q T00S J0 R 0 R V @PG0P@S@0$$p<840  p-LMKP @P`J011QhTZ P@Tj_EZpD]P TP`( -LKM MCNK@D0@D,0 pKKKPPPM.KAAkP@4: S  S \H,0 S <,pmK`F`F P@ PP  &P@h 2 R_2 R BPO P4S 0G0@$<@ 8@ ;0K4@ 0@ CK08K MKKNN( 0<K @P`! %04 1D MNK !0P 0 0xJ{p I@P p @WD@0 0Pd : P $$  pV:0P 0 2P T]] (P@T Ph5mK`F`F P8 40<8p@tLd -LMp(KPP3 @T `W@ W Tjo(TPZ ( D (00(PZ ( D (00T J 0-x0L0PS0@Q  P 0S(0 R00 R0, P-L` 0SnS 0@ ,EP@▉l0PP@p` ,3Pp@0oS`  , p-PLM@ PPpP . P 00ةP @Q T`ϩP. P 00éP 0Sp4 -L 0KM#+ -L 0㙃 -OML Mh3PJK@@| ,  K 0CPDP P| D0$\-PPL 0<1 㳂$p \ċԋ -LM@P T  Q q0@0  R\ c -LM@P T  Q q0@0  R\ @Ҧ 0-LM0P00CSK @ 0$ ϓ0 R  $00@ $p -L0H #6 -LM`PP( @(K,pK 0  (0@S+ -L M0@p00 0Sf FPP 0S nSW =4P0`0@Q P QIQG  0V0P . 0' Y0  0000V 0`0 ,KᎬ, ?R0S@p @vC0"Sl 0Y000 LPH00D 0oSP uDT(D -L$M<@K`PPD & P40K,PsC圃 -0,0K * K#%pr ?0L:Sl\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\0\P\\0000S  @@Kp| @ <@نx2000,K +K+0Se D 00y!0`VQF `Fv  PPp   0z`Fv ;P@ pP P P  P@D0S  Dp\0l 0 ^_F#40K`Xl(PH@($$p|  0x,؆pȟ<`M -LM0@S\ PH P8PP x,؆ -ML M$ß0`@( ,0 @2P`d088 B~KpGpGP"04 0X 048"qP0 T  QPP KA >KA B0Ch048P480   ,2X("@  0 E08@Tk |tp@^ P+ UÅX@ 1 ,0S ,KAA DP<8C4P }  XLE08QNK@D0@D(!`4CzA0S Y yE0SnA0S Y  jEfEbE_EU c48tD08@TBeTn ą$( ذ,Ї  0-`0L@PT  >P @T(0 R00 R0H 0-D0L@PT  P @T 00@ p-LM:`sPP 0h 0@T  P @T0 ph  Jp@ -`LPp@0   0@ -PLM  0SlnS `0 @KTC0S@ @ 0oS0  DTH 0-PLM@0P L\ y TU0釄Kgp`M -L M0 40 (KP`* C2pP@0H U0S -Sl01=P APAP@0P0$`P00`40DTȉ -0L rm~됫 0 8@080< --L eQ~ p-PLM@P`l0l R T D0 Rp80:C  0  1C*~@H28L --L  --L  -LM@?2 hL= --L } p-LtM/PhG@TK IdP0: S p0`rS   0-/L@IGPU+D0 00/00(++00@M -LUMpPKP dP@lK8d0S-0: S  SU P U@P P@0 R000K@cP h1: S@ Bc$^?<( M@MPM P-L P s`M -QLM@ HP T bpM -L0P TM -LM0 $40  8 Pp  qP@=  PP a`.W X X0SV  0o  88 0SV  04 P8 W h AW X0 8ßR030#00 00`QX0 ,K pz Ÿ@T 0S @TT ,  B4pp PX^^K R0000 0W 9 00,80 080  0PP 00  B 0S00C0V 0R0R`V` 0S 0S4P  0S 4P 20.  0,<P]p  0 WA, 8 R" 0PU 0S  0CU  0P4PU884P00`XKc9LLX%PXHD@\l7R -LP%@P : q00  R.@P*`p@T  P0 R @Tj@0 0 000< @0@000eP`*PH 0-T0LPU @@ @T ,@@T PU0P4`o -LPp @`T P @T@74 100 00 @@m@ p-LM @`P 0PP ,0 R p 000pD -`LMP@4010Pp`!0s ?S mS 0Pp, 0 PbQ VU UW V  h{ 0 pR0`0PEs\d$p h -LM0@0cSZ bSZ4 `K ٧ 0pR R  ˧ 0 P `V | $40"WĂ,(0 ("4S @ P | p-LM@PP`p%P$0S`K@꘤ -PLM808 4 $@, y upz됫Hm - !L$M0` ,0 pp@ PLK2  L@ H@ D@ @@ <@ 8@ 4@ 0@  < p`;0$SPUl?;0S ;0S 40 ,0S (,/5zi Pd -L(Mp0@PK@`  0 @@ <@ 8@ 4@ 0@ ,@ (@ $@ F 0` Tp@T L ~0s Y 0S  i p|-0 R 0R1!\ 0S \\0 0>0@ 0C^!\ 0S \  -LA^K@M PETMPEp` | %0 S\0 K`00A>K 0C  \l] -LB^KMMPE@p`D 80τ KBK p7G -MLM`p ANK @D@DP8 ,0 KpA.K B0P0& R0-P@L4 @\ 0 0h0 @0 SA@Qa0@7 @SW @  -LM0P0S 3 ٓ-0XSxS`p"W` *0@B@@p갠 -LBnKM`F`FMP@!^ ,$0K +. dB>K0C\p % I0$K0, P00S  P Z ʖd0X $K0\#0$ K0@x0XSxSPHl -pL`0@TP) 0R q0 0 @ R T^ hp=0@TTj=pW`4a=0@TX=D= -LM0S!Ƞ R 0 S  Rl l0 QAQ 0H0= 0,(=R  0-PLH=0@0CT]0h 0 =0@0CTp0 0S< p-LMPp<0@00CT`Pph<D< :00CT@00CTQ  pD= -00LS  S <h<$8L -AML Mp0   p4 0}8 ß3( KBNK0@D#̠(0K@D1p B^KPE`PV00(K8083( KV0 9$#0(0K0h3Vp2( K0̠0(0K pi V2 0Sp>g 9"(K00hWXP! 00 x]<pZ< @ 0 TP@P<DM<<J<0 ,cD<V] 1SCV& @0 S; S6 7S1 nS, _/<-<60S @ 0 0@00 R  <20 S|i94!(K0p0hWP08$44j ;1 C9;;1;10@ A`; 048 % &@@@?81` @ Xhp @\dt| -LB>KM0CM0CpT"PB`!(0K BK'I"ᰠ (0K+ !尀0S$ @P!, 1 (K r;00CS~ @ 0SX) @!0S% $P!<0 (K H;0@0CSLp|TR P 0S,(0K 0R000'G H 0-LANKM@DM@DP !}1̠ K, :: :::::::::::::x:p:h:`:X:0 Dh4Px0Xx -MLM!0LPK@ K,0 L@ H@ D@ @@ <@ 8@ 4@ 0@ (H尀H X0K<0 P X@ T  p\R T PKX@1P8!8 g:X0pT0 2@P`L L0`S: r n j (""( 00CS00 ä0X0pW 80 ,0S d,. $:H0 pi @  (<fDL`l| -0L t됫 - 3L MP, 0 8 4 < @0  0-S 2@  4 ", Hp@g TP r0S `T> TP` 2SiT/ LT8  8  T oT00000  lT<00<0 vTzqP0S 䡟@ o2S P2S 0" 0 4 R㌡@ pTx 2 TT 0@0C0D0q810  00S !P0S @2 PR@-2S8 R$<0S8 R000 R00S <0S 0 R00S 80< 0 Ft@@<@@}+P T$p p-L$M`<@K0P  0 <0 80 40 00 ,0 (0 $0 ]@ p 0[S p i ` -L(Mp0@PK@`  0 0@ @@ K<@ 8@ 4@ ,@ (@ $@ 0@ qp 0S  ~ i b -LMR@!x 0S   8@] |Q<0 CR P000S% 0CW3? X 0, CR 1000 \ `0 CR 000 \0S@0> CR 000Ri 0 Rd \ 0R 0 S0 S0Rpp  -LM@e0S \0Shd T0SP N0S@ < GP0  $lP`l_l P-L 0c,0, ($9 0s@T -Pp@LP'`8"jpd@" P1`11111a Q@b1n|1 RP xt10sL P . @*P8 00tpr00,(($  $ -43L$M `R@P#TTP0-S & @P񟗩 2 @@KDKp  0@ < 8@ 4@ 0p ,@ @@PPDPn@0S_V V@ *0SR 20S@T:w1LP0S   RR 1 R001 RpP%|1 R\!0S0  D60S0C00 6-4 7640 R 6HwP` 0  @@`PD0l ^ \L X@s$  ((0Tl -LMA%QU0<HT`lx@0  Q 0S  0R 0000᭕l@d@\@T@@L@D@<@ 0,| -<6L M P,R@`,P 0 4P {0gS 5@DT%U0-S 50 , K XP5 R=P xxx%500@DT`5`%0Q4  S4  040 5 s 54 PppRp@w200 @PP m203S i20S4 R0S ,Q  0S ,0@ 0gS J204` R4<4P8$ 00050SU V Vt5U7V  h5U00T00S 3 R3ZV5(0@S $3 R 0k\G5X2 b0 0, K4 [0@,SAD|L|T||(0<(PXd|lt||0 0@2 z|@T , K?4 0 @T  2@T t!00000@T  @T 00 $0 0w@T {$1 1w @T  w{@T Ndyyph0$ @T {|o$P(X|xTx5H ,, -PLM@0P@ 0-S +@P$$,0he000 -P000 R b0P P51:P13:4S<4<,!4$ <,0!$d.,0 00 0rS R0l008#8S PX 0-LM@0 S  0S 0S0S0SP 00 S 0 S |y00 K 0 (0 $0 0 PDPU <P , 000iXhBP -L$M şPpP5 d E0@00R0Tlt|TH4P @ PU U ğ 000U000DS񟗽<HKLK`d 0D@ H @ <` 8` 4` 0` ,` {P5L R-0S  *L划 R R H0S U 00S0S 1#$0$0 0 00Sh P 0H` {P Z00U @ P @P Z0 1`V@ 0a P P 0 ( "# xP P41 R 8  $00dS U 0Sw0S s0 000l\`\@TL;P0$TXpx,@X,TX -LMPᴑ@00S p SpBT  0ϒ005Q^` ^ T0 U   V CR 000RhB0 R \90R \ 00 S0 S 0-,@LP0S P@0P 0-LBMQ0 0C @SO ]-xV 0S dZs0R L  4F/K<W   -0`PL@ p 00B S0B a0BSWBA0BS7BR@P ,<<` `Q:0e0b``` -L@LM "00.P 0;0P -LP$M@KDK`@  0@ < 8P 4` 0@ ,P PP{Pp-DP NmPP$ 0  ppfPD0ph*U U@ *VL0 0S 0@T:cm}   -QL$M@DT6 T- T$ T0 T0  @ 0@l,0 R0 R000 R"x0 R"ddd@ `D0\@H, D @0B,8@HPTX d@-@T<0 1  0B0R \ -L@Mq0P 0 L@ 0`S os \ K\@TT9 0S0N 0XS0@  $H +(AQ   +$0  B LR 000K+00CS00  ä0 0S q dK0R PDCP0 R0080 R0"0 $,0@ S)Xt|<0S88q+,0(0$0008uD\hlx 0-L\P@ "10Q0S aT0 R 0hD+0 0h>+0h:+Q R R  00S "48<#800000S\v`o p-L,M` 0@@KR0 P !KT*00 R ^:00* 0S pp p-L$MPŸPb0 S @0x Rp 0S$` h 8 h h h h h h h h h h h h h h h  h h h h   r0 S pp"R 0tt!d` T 8PK0  0 80 40 00 ,0 (0 $0 0 S08 K70K o0 [R R/0[0S Q"[-K"48<#8 0 .K/0[0St,`妽dP0މP 00|.㏽P ,ᒽrd$ 0-PLM @ @T T ,|wt06d0 RK 8PP .[P@  wP@$ -T0 ML\@4 <@PP , & p-<4(LM<Q"4 L0`,$,!$#\@!P0T0Q00SA1T`U ~*!P`V ,pU(UU $Ġ$ $< P$Ƞ$$< @|| P@ P$Ƞ $<X HP$<< (PP`$ -p2LKM@PHK ,@ `Upp 0@CT@#V@PK^I \`D PP@PK00PW @0S <0S80S40Sx V$l1ROK RH[  <P0,(!p1 ,0S ,1o qa0 S- ʀS S `V0 00S SpppS SpS Spppp$ -LM0@0CS 444444444444444,4444\dhh0 h!h#0@-d Q00XB.P@0L#"\ 00  P0S:00A0h -L(M 0K"[["48<0#Q02K4 2[S2[S X Z4 0,,,!,@K P qZA <4(<"4(< p@*4@8 <#8   Pp p+[*[)@[(P['`[,0[p P@ P`}00S W*00SW:t2 D$ -0LS00S4  0S hIh0 K@S, p-PLMP@a@A 800!S 0 0!S0 P0 ԰ 0 p@0S "P 0S0Sx0 廰 R 0S lZ`VP 4 @0 <0 p42t$6L6 -pP0@P@TL`% 00000S 0T 0S0S\hTH 0S 8, P@`&d6 00V 00NT 00Fl - 0 L60 425 L6 - 0 L&0 42L6 - 0 L0 42"<L6 -PL0M $ 0 0p0 0pS`! K$K3P 0S@! K$K3P 0S$0 1$0P05P0 $ Q 0S$00aSP 0 0QPPW 00S  $000S $0Z $0$0QR  0F$0Tngdp|42L6X +1 -CML M% P` , \ EK@A@%73P`4 5~5 T`4 |5 t5 d di`50S y R<5 t 050Sp `4<4Pj 50S0 0R r40000S 0S0BKAAS0 0r40000S R0t4000ӑ00S0BKLLH40S 2 040S 4$4Q T30Sc0 0S30S S0@03P0@00` 2P@~dH43@\4XT30SD30S `43P 20S`4 `4 20S d 2@`4"2Q\20S@Xb0 F0Svh20Sr TR0@P0L{3P0@00eENK@D, `4 0UPX4S`4MHTUH 0SE 10S< `4P3P6 p10S { T10S  <14!41Q ^@10S@p0 0S00S `0@03P0@00P 0SEK@\4XLd㋿@0  ,0 Sh,&k42L6$(+$"41(1P6+1X 010 - 0 @ 0^ 0` -AML0CMP00 , 04 4 0P004@@S`BK@ A@"1P 04SBK@ A@"y1P 04S44 2彭443PX2 4TpJ <20S2 0 R r20000S \!BK0LLS0  0 r1000 0S R01000ӑ00S044T d10S 44 44D10S 44 44V 44BKAAEV P44%"/K0 P 443p 4SP44  RQ  0|@_h0 Xd0 ,0S@,)jpd 42L6P6+14`@H -L7@00CS00  ä0 0S t00S h@h0hP`0Xp01P@`p`p0$042$"01(++41 -ML M" P4 , 0 ʂK@ A@"s0P 48 2庬2 48K t2@ l2@@@%PP H8 @国p R 2 k 20Sg KAA2P1 勬[48f1PU 10S  BK@R@ r100000S0 R0t1000ӑ0 RBKA00AD10S l ,10S  Q10 S`0 ppo0S00S @Pp1P0P0004 0P@8ㆽ80@ ,0 Sd,"iP`42L6(+$"x$41P6+1@01(10 S -LMHCD\ <<3|8#0 , 30S@$0S 2 ԫ٫1$2r20 \0彫2 嶫ŸŸ"2孫2x2`l2P`2@ L0藫<242@ 0 勫2 儫21@{ 0x10S !1ot10S !1bg1`X1@T10 |Np1pqHh F\1AT1T \|00<90S(<0@T Q *0@TP0 $+42("(1d 1,4X"l5 6+X + P6\6 +@86$ \1l82&&D+$14+10h \L6 p-PLM@P`0S00P x܂P00 \ԂP L0 DªpV 0 嶪p42<T -0L 0\+L6 - 0L0 0 hL61 -0L 0|L6 0-PLM@ !0S000)P0 zP uP0 K )P00S0 |0 V |0 0T0 HPH@IX G0S40 8@0F &42$1L6 -0L D 0L6 -0L 8 0 4+L6 -0L , 0$D+L6 -0L 04L6 0-PLM@P\1 T NP@!0S000!P P  P0 T很0P @, 0@0 @0S 00S 0Sh000`0@0 P\04@天0 00 042Hd |1x,4L6 -0L 0L6 -0L 0 L6 0-PLM1@ "vP0   nP K $P00S 0 S0 00 0S000hPt 0@S000008,0 D040( S000042&L6+ -PL M   KK,P 0S0 0 0 0P|@0}S t00S\0h0\P H0R@0 P,0  8L42L6hp&,1 -MLMp0P 0 00P0P 0 Ǩ`.P0 Pw  ANK @D@D!P X0 \姨Pd  80 Vf` 0S( e42L64 -PLMd   KK2,P 0@S 8080 u(0 0p42L6 -PL M0 , ,K0K0! ,P 00  1T1 00 1 0 婹4 >$ R0  0S 00-0S 0S0@0S 0P0-P0P000 ,P0`@4u@P`42L6$(+$"4101 -PLM   KKʨ+P 0| SKKʟ+P 0\S T0T0 D0 00S$0 $42,L6L -P0LM0P01@0P1 帧p 0\``P ,P0 PP 00|S ,P p,Pp0  X0,0|PE_U h@_42T|L6 -PL$M0 , ,K0K!+P ,0S ,K0K! +P00 1P, 001 4  4@ 坱P 400|S 4K,P 4\,PP1 00@ <1 41 劸< $1p0S. ,00CW*Ww0a050K00`!50K4<0pS0@0S 0P000+P0P00h00S ,00CW<P4@0 P,0 ^Pd42L6$(+$"4101 -ML Mq0$0 -`)P6P@P@@"T|yPP 0S`Q/"P@Lq@BnK-0 K@`F4!0۰ P+0 K0 10S A啦 X00  60  mXBK@PʷǷ`Pt00P@ $0S<$^c̰&428+pL6 -L`M|q Px t `tKxK\!)t0x 0CSD1 <.81@0P+t0S x0t00t0 x0Pt0SPp@K  O,-`@x0 @t00t0 x0 `P \0| Vt0Sx0T  P0 0S< b42L6 (4<l HP$+l 0-L@0LDP0uP 0000}S$0ʥiP0`L6d42 0-LMMlPANK@D0@D0 P DD @0塥` 0S$0 b042L6 -PLM   KK4)P 0S |0|0 wl0 0PH00}S <0<0S 0l0$ 42L6 -PLM   KK(P 0S |0|0 >l0 0PH00}S <0<0S 030$$42L6,X -PLMX   KK (P<800 (0  '`x42L6 -PLMX   KK ʠ(P<800 (0  x42L6 -LMM0BNK@D0@D`+,0 V+pPP00U00S BNKB.K@D BQ@D BQ 00Q+a ʱPP00U00SBKA0A@-0K=PP ,0S,a -PLM   KK'(P 0d SKK(P 0DS <0<0 a,0 0=42L6 0-0@0P 0 0RLP0 0-0@0P 0 0RLP0 0-0@0P 0 0RLP0$, -LM4@0S q0SV$+ 0-T@L0LPSH PM40,0P 00$+?4(1T P- L<80 ܣ,0  h{<42L6TH -L-800S% (0( 0S00㿴(1$+6 -PL M0 , ,K0K!X'P00 1埣=00!p4 tAt坣d14  40SDAL 4  0S$A0剣{vPٴ`4  0S 0PU @pbô0 PP@z d u,040@ L0 P0R  㟴̊`42tL6J$+,"6 -0L A 0P6L6 -0L 5 0\6L6 -`VLt Pl@lph000000H000;V ,00h1+L64286$ @-p0@S @ T00R00S0S `P0S  0SQ0ѷ  Q00R00SU000S 00$ |86 0-PLM  1A00嫢 P KKK&P 0S 0 0叢 0 00 P0 㹬0@0S 0 S  @孬@00D0HD 0 S , ,0421 L68+(182& p-LPlM@ `K01 R R; 0S8 0$S \S0S@+0^ 0R 1N 10 1<0K  R 0S`0K  0R@T 0S0 SR 0S0S0K Ac000S 0[S@ $S \S0S0$\( r$300000S 00S 0 S 000S1C0K 1SQ <0K`K ! 1R 00 1R@D0 S,S : ]S8 0\S- $S' rP200000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R0S 0 0S,S ]S0SU @@T0 0 RK ]R \S0S0 R ]R0S2:0,Sq ]S@n) r000000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R000S1000S(0(5pp82|&42( -$0L \0020DL6 -0L % 0TX L6 -0L  0d+L6 -TL P D00}S8080S00( P 0  tL6|42,1 0-0LMS0 lK'P@tPu @0 \ ,0Ġ0巠00042`W 4 -L MTr0$ S( D P8"$K(KL$P $0S (0 2吠 2 10S1(0a 㽪0S1 0 1|1@0 P00E0X1 `1!!00 00T11 PU @!00CS00@Ӥ0@t0 S@  1 0U UP 00PUP00CS00@Ӥ0߭@ T tt 00CS0Э P0 R0@0<lx42L6h !l  0-PLM   KKʨ#P 0S t0t0 d0 00c%pP@0<u   P֟0@0TM42L60 -PLM   KKs#P 0Sp0p0 嶟 0t%0sK0  8Q( 0   壟 0 TM42<L6 0R= DL -LM00 @P  0 0h速T42 -PLM0 ,  !,K0K!#P ,0S00 0e0 8 $P0 P  0S 4Kp" `0 p吀@ 00 h04dP_d4V00080SVTM42L6\|`&@ -MML M<ğ P,   % OKAOKA$@"P4  S0X C4 ɚP@ 0X30X 4 33 NKI I tt#1Tß5 01 PU  r@300000SP0QcL 0$S \S0? = r200000S@ 0 r2000!0S00@C4PE0CS 4At"0 fը4@iQ4 Z% P 4("  fè4 禫`000SP0S0q000p`1p1`CP 0S 10SX1_P1 1h10S ,A0S 010S 1U! 0ؗV BNK@D@D0!x1 @4 < 8  \ACKX1APA@4 PP4CKSAA4$ 84 1!0?2cS D40`4 lOD4`$0RD4 D4HSD0`$0Sr` ,0 S,T0$+|P&42 ,1$LL6Q8 P-L`7 NP@j 0pSP' +Q 00 %Q r00000D0S  r\00000D0S PP0pS@00g(p000000S00@ p0 00000S70@W0@ 20rP000000S00@r$000000S70@W0@ -LMl @o0SX  o0S<  o0S$ 0P 0P -$LYM0@,0 4p@` [K= 9p4Kl  0h d `A OVpP4"0L@KP P $LK 0P#LK P0׸L0[S LK 0)VPU u  ᡨ 3 p1Q,,d\pAP#P3T N p10S S_K <圲P,2 GP`آ* PP 0S U 0S S_K <qP`,aT  P <P`@TV  1 p wlcQ f0pt1 @ll]/KpA aP J0S x ^?K 嬵P xA00p0dQS PP H10S 08 0ȕPPP | _?K,wP00Sm p0\0  0 ,0S,R19|PT:\dذL6("427Ą8?&H5 -LMd@ 0 0CS00ä0a((0 0 S b42X\7 --p1pq0LS00`& TATNH P8 4 P< w.00CS00  ä0 P@T\0  !w @W.0 |]P0PSTY&X42?L6P4` 4 -LAM M8B>K0C0C0 +, W %@$ 2 p< 8 4 BK J4`J U0@S񟗾XX||DP 0tDPp 0P壔垱u04S440S (D(嚔匱$ U; #0SS5V4X24UV 4V00V00S30S#30S X X0Sp3|3 aX30 CR 0R0 S 0P0Xu3 00000S "01000C0W2 0BSpRdppW00X00S u2 00000SpW)0U0 U00S@$p0 @<2QP4@ 5dW(UpX-U848S1  8 V-0K`ZP4A PP210SS5V4Vڐ10StA0 CR 0R0 S 0P0hа4$RB>K 0C c R+#$8Q 00 S Y44044 1V 0  < 0 YR$ 00S <$`0RR0F<,0 S x,P< 0  PL6?842@6("8;` X -LM00 (@(0 ugoX42$"8 -JML M0͟@,͟KK`$͟VSp=͟N_N=,p 0P@004 <P@0< 0 $ 4  Q 0-S<$2TU< +<@T $e t< p<R`<` D D D D 4 P`# <<0S $$<0SLPf004S]4S X4SS;L04 G04 8PL; 4 R`T0|S 2$0@D4 y 4S$ ! *0S:`4 2m 4S  k  d:IK4 4AADP4: S 0:$p吒ܟHE>K0C 0C)00P ޣۣ4S ֣4 S9T 9Pz cPpI 0SG 嶜P 屜P=D9`0S 0CS0m` 4@90pq `v  4S8P@80<HP 4TSd8P- 84 $R P& pm4DS7@$P _\4TS7P T4S 4  4S  Ad7 0S k0CShppS7/4 Pp``@VH70S> 60S 60S6&4S.ʸ4S 4S'4x6# 0C\0\00(K.K 6 B B Ɵ0O4Sʸ4S 4S5zBNK4@D@D+)P`60S7 50S |50S/hşP*0S'450/P0S*,5#0 CR 0R004 00CS00ä043VW0 S|4 VOh4#0 CR 0R00(4 K.K3 B B0Od40S 30S 30S #4Sʸ4S4 S440@3 0 CR 0R00n<3P@ 0 CR 0R0 S 0`0U2P@ p` 30S2 20S 20S*x"4Sʸ4S4 S4P2#0 CR 0R00 2 00CS00ä01|40@ :40@ .0 S11 ,4$St1 4峝w㽡㺡4S2  㴡.㰡㭡4DS0@ 10S$1 "@P004SG4 S0  4S4T 0S0S ,0 S,M$1 +,++D+42(18` TD@l 4L6`(& -LM00 (@(0 լݠX42$": -LMϟ@`0 _X0K, 0` 4` <` 0>Ο0Οp0 >Ο0p0 P` PH H0S > 0RS ,0S X,00-S \>, T叏Q@>D 8>0S H0S ,  .0 80 R@0  D0 H0 S  L hP! =0S =0SNP00@0S@<0S<,= p ,=p.L㩠D0@0 夠< X, 哙PS ,00|SO ,P@/, @0S 0 S , @〠<}= T00,0T|  T,p ߹T/0p0WP<0S 0 S,FP<0S 0 S ;0S ,p , ,0S HQ;0S I ; ;RAO@;PL ğPH0S \ 0S H fP 0S  ( ] YP@ 4 40S pW%,P:00 l:p) ,00|S D ,>0 00S,|  *0S:d: ,i0 00SD:, 2O80 00KP0S;0 Z0 SiP$FEP0@0 @.0: S )0S009 H9@T 0DS0 0S 000QppY90  {p@0 S pWPdUQLȟ80OP< 80S 80S4(T0S,T0S X0S%X07# 0C\0\00x|7XK |ǟ0OT0ST0S X0ST7̪4077 &P`PpÙʈ70S7 60S 60S/ƟP*0S'60/P0S*6#0 CR 0R00(`6 00CS00ä046優V>0 SA5 W W,`V 0S 0 jPPU 0tp P@0S@0 jP,80pS,5p05 080 VP00P0  V[5#0 CR 0R004(4XK 0O 50S l40S p40S X$T0ST0SX0 SX0$ğ@04  P`L0S 000@20 0 CR 0R00|V v V 00 CR 0R0 S 0`0d<3P@ 4p`P0S CP 彌|Ìd30S2 20S 20S*"T0ST0SX0 SX02#0 CR 0R00$P2 00CS00ä0$2倩400@ 80 Sp;1 000@ ,0/80 S1p 1p080@<㾝D0SD 4娙l@ RH0S R0S10S 8 d1Rp 00 0,K0 p{Ku> 0$, !D0S`0d0D xul00S70 @ k<h$1D+T +,+ +@42(1\6:` @4(+`( &`hxTL6,+P4 0@P@1@80S 00S08040S4l 0S0SJ@< -LM0 S 01 `0, 1 a 0 S00SS  |0S$ `͟lP HP < <>ݼ00= =0 >K +P %0S S0 L<0S$ L0S la < QH,! 2<1 < X P(:$:a?B1cSQ8 PUQ  U@ 'jKiKKgK qK mKo/K=KnOK@> PW1S_1S\1SY 8 !1 (,10$10 < ȟ4<K^ 4"<  0jKiKKgK fKeKKcKbK aK$K(_K,^K0]K4K8[KK ğpL0DS  p㼺 P1S00 0Sd >KP@0S S >K  P >K ) PLC P030 >K ΨPxXC0r/K1 hP@S|PQ ZOK3(`K0S S 220S3 20S/H3(KKoK\0P1 \ S_K <@@PP 0hP R `2 0S82  <2D幈 QA Q^ ^ 8 0@X@A)0@0 0  $         $ ( , 04<8@@D  ! 1S0s`0a 0 \^$1  0S >K  P X@姹0P00  ,0 S,;E7 9T+0 1H L6gfff42P &x   !     P , l   }~ 94+  0 $4ĄT \ l    -0L,MP؀0p0U$0 D @KD K `ʪ@TH00B?[\H0K @H 唧P< $0S $D7T   -LMq4 0S@0SAd@,+ -L 000X -|@0Lp0T\" 0S0LbLr0 0S 0b(r@(2(R  Q ,BΆDQAφA@E0<1 <10@! @10D!D1t00lH1 H1`0L! L1P0P! P1@0T! T10X! X10\!\10 i e ` [0+11b0Rb+N +I+D d0S00 X(1$+("978?` X ++P686$ 182& -LM`@00CS00  ä0 cˣ, 0$0000ʗ4287X$" -DL$M0D ,0 H 00 @ P4@ 3#3Q040 3@T 30S 30S@@S0S:P 3哆t30S \3d分T3 0S44P(hPP7ʗc0@H ,0 P@ ,㽗ۥ00000 4D P`B000]Y,㟗82`D H0P3㒗4"0@0傐P 20S @xP10S {Q0S 0@T4D PK Q0S1Pb0S0@T 4TD P T0S. +0A0S1PC0S 00<K0  <0 KካP00S0  ?00S" 0,0S@0  @+\ X6 42 $+ L68  7(\@ (1` 8'8 0-h0LM0 0PK!K0  @@T0E(0 T08L6 -/L`PPU1 1U8U/0p0W 0^@+ᎏr.0PW0PdZ 9X0l000Pp 0X0U.S100E 00EPEW (442X  -LBMAq0 S P T10S1  RAnK `F`F0X!PN0 0RfP0, 10U B>K 0C0$  0 K(4 0BK @@ 哪Pʰ00S0  HU 0K0 +PP@00S 0S8 A? 8L68 8'  -BMLM07,',70 $'$7$ H , Y'P  0 S606+ 6PP6@P6vP6fP6І@6@@PP6 6@6@-P@ 0S 帎PP t屎P \媎PP H夎PPP4060嚎P5  &P 0S50U0S 50@Tg@PP@ 0S tP oP jPP|Et5P 5  `5X ՠP U P e40NBS񟗕px4 D  4K#00#0H3=0 0 0 =l343 5,3 <3033 P#h3% '2 2\3 2L30 rH300000S 3Y 3 >3  l2 0"Hp]2202 2l0 2H H <P ZP BNK@D@D+pT2@ D匔04SBH42P 10H P4P@ 5p mH@1 0@$ D4 < 8 4D 0CKdAA A0QS R  1h1 o0S 1 (ܓP@@T < 9@PT6\"` T$1 !d D+`61p Tm0x   1 @   l 0142H++&$p 8  (1\64+` 0$+P  -L 呓0 p-LM=P0` 0S @0S Ə00@Pͳ00000S T@0S 媏00$0 $ 00`p$+?T6  p-PLM 200CS00  ä0 10S A1#AQ C[P AP^ @0 SP00U1P`1t0X!0CS00Ӥ0 PB p?0a0S Q00Np@ P 0S 00S00  00S 0S d00 CR 0R00Q \0R TL ph4201,"l  @+`6t$+++Pp@-& @`QP 0R0S  0R 0S 0`S`PQ^ppp  p-d d0LM\` X0X PPP0@T000p,"*`6 L+@+ ?p@-AaP0$S!S0S S001  00 h!h1!Qp0 S S8  S0S00 S0000 S S S "S \S0S 0 0S "S P00P p4 0S00 S000p*  ?8+H -PLMp(M1@ 1QQ! aĀ0p2V*Q 0S 0S H0`2V:6 iYP@U@p`0` l P \<啀0< 區PEU(142 La  4P -,0ML  0rm2됫\ -MLM , % 5 %P@ " 0S | P:?u |B^KPEPE0d%ᑢT\[P5P0S4<RNK@D@DVP,KR5( K·.]P褟 P P  QC Pd XP TXP .>P@  XP  `$XP00c0S .)P@ WP@i  XP0S0@S񟗻P %P^5"$P P tP L3YK0AAbP5?P %0S^52YK0AAJP5?P{ 0Sw{^r20S} P Plpp00 P  RqXr0So Lb11@P@U zpP ` 2000 pX 0 P0 1gpO PpK 0S1 0 0D!!00!!00 00da11 @`QT $1Cp+ 0 S0TS 00@T1T]GP PP6@PP0_0 ><<0M0 ,0St,;("8(1h !D`|<42,` p-LM a00` p 0@ PS,P ppP"P@@\P0 p "P\P0 p P P P,P00Ppp8@0S P 0S p -LM 6@TP 00006P 0-0 L0C@R PK6Ph 0 Q000 P0-L@ 0S Q 0PU*060PU:60h50 -L MS( 0$ S 33 P$K(K"$ 0BS (0 2~2 B0S22R(00S(0 2P 0SpШ+P 0S (0PP@20S 202 }@ @2 @2 @1 @ 1 1P0S1@1P(0 z1d0S0`0WPV  ݇P@pl ևP@ 0T.S@DpP0@4!}Tp,, ^yP 10S11  V  `0 {} R00 V   @yP0r} `$+42$("8PL6d T61l!5  +K" 1\>d6<+6&4 ;;(1X6\  -LM,Qp" ,   /K?KKP2  2S 2S&20S" *NK"__K┟,ᐟP Px202 ~S2X"HL2WB 2  @22 2S&P`뤼P`V   0|1||@KP!O|PKUP@|0[S@TB qP@2S娲 |eP@ 2SX囲 PX@TXQ $NP W00S&p0P  ͆0 0h` 0@P0 P҆P@P 0T,0 St,s9L6H+!8lPp42|l  4TH(1,"`6@+$+h 8 -`LMpPj0@T0E|0 6| 00@dP PUP O@T0P S00@@0 800P00,"42l @+`6 -AML83M4ß@0T,0 p0 3 0S 3@ SP F@0S 0S 00@T@0S塙P@ 0SB00SP/S  0 S R?{DiBnK`F`F+00S/S/00P+eᇙPjP 1X0Q  \ 00 1P0S 00pSh1h!0?2cS XL100$R 1PBNK0@D@DV000SX000`{ |P sTP@埈@ |P0@0x0 ,0Sh,A8$" ((&(1L6Q;842` -MLMpp0 S( P`L Tq0SHHA0 @{BK@@$!"TP9 1$K R01000ӑa0CS' 0t0z 0 \0zz(0 S4(7+42l  0-0L0M0@PKS@,  $0 h0S\@0S 00tYP  0 -LMp0 SԀ0@0P`P 㠄P (K⾪(0`P R rp000000S`P T 0S8@,Rz & ;42 -LTMa0qS!0PPPA[ 0r10000S@ Pr1000PU@p uP \1\z000 00200`KdKhK\0KX K T@KlK , rl0X T0 h0\P0 d0v.BL0 `0A BH0 0D @ 40 gpP X0S 0h y00P X 0SH@8y u0&L6;42 ` -MLMBNK0@D+p$0 ߃(`P ^KPEP@Nt0 K0/S ᪆@ QuP0S/S$0 S$x6 0-LMH@0Ps0 Kp 0SPP0 wt@ -LM@P00s@D+ -LMH H0q,0 F6&6K60S |&Qp6\Ɵ  d@ ( A@ _P$ {@T@dTd@K0 %D50PCUڔ5 ra@ ş@ş`g0%)p `P`Pp%5VF%T5UWPT  @ 5@` \ B0%@P0 04bQ c<" =9 B =<" $8 82 0 S0S*<#NK\<8" 0 T< 4020bS aD"  BD" @2 =9 =D@2 \jP@@Xj/ p0 Ko%KHP;%.Krm3/C0ur ህ@ ᅅ@`0#妚 |@ y@`t#ᛚ%KSmT3OK0ua2g 2crBe0@a #? 2cc#aw0S0S%NK/ /)PڄŸ0 S 0S* >@ ;@" <2S 3@ 0@d"`RN !P1P@%K p0  p%K nl1Po0uv @ @`0!' @ @`x!d1OK0uf2g2crE0@8!?` 2cc,! GOK؄Q 0H~ HP 00CS00  ä0 &厔(,0 S,4.A  ` D++,+6QLųt42 -x3LMp 0@@,0 KH3H0b0P a  B=9 = 0 &iP@"i/ Zo0 nKW KP@/ H(P @K CoᇁQP0吠KS0SLŸ HŸH2@K00 +Y~/ ~/ n"ŸP@Y00 d!pD\P 0SL0SI@K]/ 'PBڜ R>1 P@@PR50S1:PP@ K n0 @Kn mk 1@o0ef2f2c BDۃP ؃0Ϡ#PE0l 2lADd`0 @@Kƃ0 S00<@,0 Sh,3.A>P? ,+@ +<`+`ų42 -LM0`V *0珃0`YV@: H1 PUP@`VA0S,0 :p0AT0Mv 0S :000CS00  ä0# ƽ V P@| 0 @0 C\0\00ꬽ T,0p0S,0 `V642 -L MD00 K4@僆p( P0 1[SP00@42ht@6 -0L M@K 0 K  ԕ -$4Lp/ p) Mp@ TX@KT0 0T0 HH,! 1Pi6r$ vP@ Q " uTZ  ^T\" iT ꊫ뚴P@@ޖx Atl 㩟?} & (0@`}pT -000 (P$0L0t&? p-GML1 M a !P0@4 !p ?P -K BoPx B dh1l0@cTQZANK@D0@D4 P= $04 04 =K 0C P300CS"L\0\\\\\T\\\\\\\\\\\\\\pt0$h`\VtD 8<%& (pl$pąċԋ -L0+ & -LM`PRP( @(K,pK 0  (0@S+ -L M0@p00 0Sf PP 0S nSW = ~P0`0@Q KP QIQG  0V0P . 0' Y0  0000V 0`0 ,KfP, ?R0S@p @N0"Sl 0dY000 LPH00D 0oSP MDT(DQ-0N. S$( ( < ( < < < < < < < < < < < < < < < < < < < < < < < < < < < ( PP 0B00RQ  Q 0B00R -MLM|0$0 n`h2^KPE+a p@0S T0T0S}0 0CSx` hq0 %Sn@{Ph0SX PR 0K @88 ;`^KPE(u"PI0H0@T7 (d"P@T'T$0 05R,:P'00S# 0V 0 05R01Sh0 05R X2 D00H0Q@  |$ $0S$$/NN N!! ! -4LM@P  QQ'P#LLLLLLL$LLLL4LLL<(4 $4 4  4 44 )#pc@30@cTQ\cP/ @H0H0S% 0H@ߋ 0H0 6Sl  H|PP s0S0804#ᧈp( Z 3  C[Pm n2 0000C<0PTP  qю /̎ Xڌq#L90SX. TqP ԅD2p<0 4PP$  PP ,Kp (,Z,(1" 尅p@ DHAg 0H0Q 5  θ1p0pp!d0p\x XspPs P )P  P P尸P \s0H 00I 0 鐫$pM0! N8!D!0X!t!!!!MMN!!!!!!1,"ND"`"!Nh" t""(""|(N -,0LM$@ q q"됫"" p-LMH P0S 000` ph`H@G,H0LH0000 H04 H 0 &080H0<`phM -LMH0@H XD0,0H00H 00(0 H04 H0 &080hM -PLH0`@T Vp,<l  0S`0 $W@H 0V0H 00h1HS@`H 0 = 00H0 00}=0H0  00'<0 0H 00h|00H 00 H04 HD0 &080H D0,0h]$""M 0-LM(PH0 ,0@S 0RaPzH00SS S Sq$0r+P 0hjH0 .H0@Pl100 W!H0 0S10H0 0;S<00H0@2S0?00 ?!H0@ 2S 7! 0/"/0B1 0H0 000H0 0S10H0 000H0 0S10H0 00 0H0  0S1 00h0##)M -LMH0@<0 ,H0HP  P !1P0,'H0Q 0SH0H0QH0P H0 H00H0 0;H00 0 'H0 H0 0@ cH 00h (#0#8#@#H#P#!@MX# 0-H0LPH D0,0H00AT 00册H0@80H 040H$0 &080H 000h7M -LM0p0S"(0H0 &|0PU  `$@0@P 00$hPPUhF,# -LM0pS S S 鬀嬠ꨀ娠꤀夠(0H0 &0PU  `$@0@`P 00 @ mPU###l#,# -LM(`PH"2PppQ, 0R 0RÇP@$0J 4H 6;0S &0;0100 S+h0SH0@T 0S ⒇Ph@TfP@lh1S00000H0L<0,08KH,1 &P 40PP^p _  `PH000H0@H00S 000SP00H 0S@  0S 0S@h0 0bSpWhI@ 8h####$#$"M$ -Lf%PP!P1`0 pR S%P@8R 40 0 804 0 P@H Z0 0 1S 100,0S A*%P@$# @ ,$ 0@0$ P@$$N%$@1S 100l0S %P@( \ D< lƊ( 004 $H$p$$$$ 0-LM(@H0 ,0PS/0 S (P $H00SS S S$XH0P0S0hH 00(QH 000hN0$%) -LMHD @24 0bXP@m0S 20S H <0S0@<0H<0S 6!@0 <0H0<QH0<jPTH@ 80S 6!0 7H0 8_80080H`Tq 68 0RڣO&H0  6@M@8@80S 6!080H0 &804 0 S0l080X8#8#$H@0$ ࣸ$H0`$p#埌 !4H88<#8hH\0%0@@H0804 m^M(%@%MH%N$ p-LMH0@PH 0S 0SDH0a 0S6 0 *H00,H0gH0QbPH0  S00H0 0XbH0 0@000<H Q0 0H0 H 0S 0S R0 0H 00H 00 0H00S UPSf|H0QT{H 00H0P & 0D00 phx%M%%P#!%@%%!  -L M00PH$c(0 04 SSpb  6#0WH 0040S<0S 0,Q Z5PH0 , < H@0S 0 0RpGH0dH0QPD:H0Q,H 00u80S 6"0 ܊H0 880080H`! 680QڣOˊH0 8@@8@H0S d1 80 0S0`0808K ֍H0SS 1 0R0040 070K080KC<3K0S0``0S3 W08#8#$0$$43[4#DHL($H 0H0%@~H 40880  (0S8((M)@%(&H#!`"0&P& p-L MX`0P#DHL$H 0,PH$0%0@@GpM`&N -L~KM pGMpG`P@+@KOH!@JH0Kt6 xF 6U 0h dR 0 v>  0hOR 0 v>  0`ohTuhif? N''$'0'D'\'p''''''$( p- LM0Qq`P$0  nu$ 0 0 iu$0000  K@ $K $ RTu(K0 (0 (  0pN -p`0LH@d0&PR60Sx6 pF6 6T0S  &00 << U $(  hN((P(l|   -ML M P, ß  < 0BS8@<K,<0@pK@0 @G 00T`K0T0 S" D 1 S@KHK0hPK0h0 S Xi ( R $ R pzl` Pg '@H &PR 40S0@P 18SK|;;;<8@4DH0 &0@冡< 40!1ZsNK@D0 @Dᵄ4 H08 6 64 1d1Z`P1\!sNK@D @D8ᚄ'H04 &0!琄0 04 R8@Z ZK'P  0  '7` 0V' P7 {NK@D @D0h L  T,0 S@,#Nt(((TM((((:(( -LM( 0R@40 ,0 00  s, $P s0 X s4 , K 04 (pK0!=0 ( $0  `40`V0 Zb0  P  ,K (, 0K $0 4K 4 `4 84 `V@Z0 N4N -LMRb0 @ 0$0 @ tp$`KP 0 0 $0 $4Qc 0( S_ (K( NN) ) -LM!b0p 0H0 &f@ p $@ 娎PP=(p  (KNP00P@@TP @,(@ $K 5 #([N N <)H)T) -1L M0H`(s6p0@S 6  aP610=S 6p1S&P 0AW2PP@FFFV6 1 Vr@ r0@r@@O61S @0@$S `Sr0T` : r@ r0@r6@@ 0 Nl)))) 0-T0P0LH@60S 6K&016P1S060N-00S ^0 0-S_0 000S0 0 p-0LM0 S@PTl`d0P@:pTT 0s 埖00pM) -LM⁁@P4 8 0 4 8`@U(IH(IHHHHHHHHHH(I(IHH(I(I(I(I(I(I(I(I(I(I(IH(I(I(I(I(I(I(I(I(I(I(IHHH(IHH(I(IH(I(I(I(I(IH(I(I(I(I(I(I(I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I(I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I(I^@Th0R0pW 0<G 084p0>00*$*H* -LMP@T. p, .T`% .V00.R0SV t0000PtX0000P-T_T _TW$pV @h* 0-LM@P@ .R r0\00000S0S0 S0 S K4:PP 0 -PLMpQi@0T1* Rr000000S  0RQ 0 嶅P`F0'S"S $S `S \S`F\000`F0@0T:V00?*(*m p-L M`Pᬋp P ,?0@凔ᅔ PK0  ` 1Kψp@0<ST 0 p*N** -1L M0t!H0 F6 <00 0< D1< ,00(1   00 1  1K/ P 0`P p̌0\|0 00 00`0`0h0=P@ ,PK 0s > o@0PN  $HN -LMp@ d=P@ K r 40R ,Lo+ -LMc0PH0 pK F]  @@IP񟗫QRRRRRRRRRRRRRXRRRRRRRRRRRRRRRRRRRRRRRRRRPRQQQQR8RLRRRRRRRRRQQRdRRR R,RRRR$QHQdQRRtRb^p!0Wp^ !08Np!0Gp!0K )<K,Y Ot08 ;P ~wN 4+L+ -LM@$`Kp A?@0CSP ABAQ 0($_UP#ʦ :Rq :P $p l0Ph f $n RPD$~70`++++ -LMPp`$K@ 0PP ڼ0p  PP@ 0$69P @T T @` V  ,P ;P @,($++,0, 0-LM@PK 0P 0LkP {P `0P0 r }R o 0H,Np,, -2LM@0 pK`$0 {P IPP !500 0 0  0s$ KK }S ^ $0S9VHP @pT 0 S  yPW$0 H0  @TV$  H0 00H0 PH0P 0 S  0R yP$0H0 L3$0H0 0 $0H 0 0$0H0PNp,4,M, -LMP `K@p7  @@:PuYY0Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@ZY@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@Z@ZdYZZ Z@Z@ZTY@Z@Z@Z@ZY00000: 1P0@ @jP* $P!, ($GC ?4@ K ;P H,N, -+ -BML M4%0P KL @,0 5`PP@Pd 4pP4HiP ZZڼH劑00S 0AS B0C2S]^^^^^^\^^]^^^^^^p]^^^^@\^^^^^^^^^]^^^^^^^^^]^^^^^^p]d\BKAA+f` K@/ h3@PHOl@0 S BK@@ H|` P$ CNK@D@DPP @$@ TBK@@j|`y K@ 2@P CCNK@D @DH  0  K@`2@PCNK@D @DH 0  K@2@PCNK@D @DH 0  K@1@PPڴ1p  PppW  ;TB ?H6P H6Pt1 (K dH6P TH6P81( Kp4CKA A 0S K@0@AS,P ;P S P IP4PLP@q BKA A{L$ `0 ,0S\,],-X-l------L+--.,.T. -LM0pS`P P0S P0S (K!0P(BkP@" (:k( PhU00@@,P00Z00SP;P  h..+ -LMȀ0 0$ H0` v8@K!0S nPU 0l@00<K0P,P ;P @  $0S $$N.,+.. p-LMPK.;P `V( 0@T gP 0S 050@0 zD0S @Th  gD@`VD0S8 id,0 V<p./e0  -2LM@pT @pTP`^ @TP 1 0R 00 !00@0c|!S0"c1QP@T Q  D1RT0S000000@T^$  ˂p 0#S 0SX X@T P0  0Q0  d0RT0SL00S@PT,0 $N$/,NM eD/p/ -AMLMPzK @(pGkPl,d 7kPXpqB@01pB81yBd1fB@11`gB1d?wB 2vB 42 -LIMPKOKPmK 0, p@ 0  @10OK K0C 0C1 BS 1S@T0 ,0S,\44P0-H0@0 80840400,0 ,PFp` T,P 0S@p @8+,Pp $,Pp@,Pp,PCp,PMp@,Pp+Pp+Pqp@+Plph+PXpT+P[Dp@<+P p$+Pp+PERp@+Pp+P6p+P/pP+Pp +P@+Pxpt+POp@X+PHpD+P4p0+P p|+P p@t+PApm+Pp@e+Pp^+Pp@V+PpO+Pp|H+PKpdA+PTpP:+P@p<3+P,p(,+Pp%+Pp@+PQp+Pp+PEp+Pp+PGp*Pxpt*Pdp`*PPpL*P<p8*Pp *PPp@*Pp*Pp*P:IpP *P@*Pp*PJp*PSph*PXpT*PDp<*P0pp*Ppp5O0F56̦=5?(5M8557H59P5"d5l5t5*5I5C55:\<555!54g5N55Kc%6'6t6A,61܊86H6; L6BX6`6#hN(l6&6GDp+6+66.62636>}Jd6 66666/)77E7 D:-(7Т|747H7 h75x7 --LM @0| Mxp S10S \_T 0H ,<C10S ,,Q$nIERd/7 --Ll i0T TMLD 1D080S ^$  IER --Ll C0T TMLD 0D080S ^$ ֘ ҘIER --Ll 0T TpMLD 0D080S ^$ 㰘 㬘IER -L`@P pR %R0mS^Q0L sp` PD"@`PT@D ń R00阤 --L@ 0C<0 ]/P@XGVP@`<?T"0@@0 J/P@4C P@-T"0D0 8P@"T"0H0 -:P@'P@T"0L0 :P@ hP@ L;TTt"`0P0 0` 4` ;P@ <@E0L!!!?!C!c,B^ B^DHL@PP 010000012c12c1 C @00012c12c1 C @PHpHlHHHHI0I\IL+< 0-LP~eP@4 <0S0p P0xI p-RLMP@` 0S(0 h000pI p-LM`@ 0 cՒPPh u 0 0bU *H{'0#S #0S uo *ph'III -Lp`P P@HY tT<U;t 0S 0#S hHIJJ -MLM$0KA ,0 `hQR Q Q d8 S)KAA ld8 S:qXlPP dPP0 l(KA Al K+B 0d(0Rp8:spP@ dP@ p(>K0C0C`#8 Pmd8! SD5;<#iKA Act(d8!M@S:rtP ydP t( JKA Exd(0@R:q|xP [dPT x( ,KA A&|(d8@S:r|Pp =dPpz |(PゎKd8H@ HS( l;KA A01(81(Rd8@ST:rVd0P1(M (PUڈ< 8 M  P(1S>K0CPU!d8PS* 0 ( hX d8 [P@t KA kKA A e{4 0 ,0S ,,J`14xIHJlJ 1 P-L@' 1a 0Qc 1 &PVP Qxh!0 xPTP Q@ 0O  q0 Q@L00P 0@0CS0@0 0Q 00CS0p@0 0wQ< 0RPNdNlNhN|J+J -LMPPpC 0@ S 0 S`ev 0S쀟쐟0 5cPP 0S l3 d3P`4X3 >0D#S4,#>ubB0 W0S2 2PR0 W0S 2 x2Ptl2= E0P`00@iL2 0R Sy 84"P0`00[ B=Z[0ST !=O,0 S1  00 Q,0S< h1 xW00 Q 01 R.c+p009P 00P 00 !Q 00 G0 RNKrP0: S  0Z 0000 <P=K디TQPQM$p D%%PPMMOO\QM`QMpt4MO,Ll  LMl' -p@ `P0L0 %P00 00 ,S;S;S 0S0S0 0S 00p\QOOOO -LMtD`ğ0 q00  R 0  R3 P 0EUS00d(00d0000<000 q00  R 0  R10q10  00S u1  00S^U-U`F`u pP ^U-U```\kP 0  P`P 0.U001``P  pP`P  0 ;U0 0 0  `0S Vl0 RP /UP` 0U00\QONJOOO -`OLMp0 q00  R 0  R?0P E0pR                                                         p       LL               @(H L(<   ͟ 0nS` lS0 P 0 R0= R =y P W`0pS`0= = P@=  P<= R8ʚPp̟0 0nS` #lS0 P 0 R0W0L \< R @L; `0pS`0X ˟ 0nS` lS0 P 0 R0;T R;;己{ `0pS`0; Ro0q:0  00S` PpʟX 0nS` KlS0E P 0 R09: P1e*P+P&\!\\: R \t P Md:)9@ {  D k`0pS`0 ] Y9 R ɟ, 0nS` lS0 P 0 R0 (00cS0 (0S  : .`0pS`0"8 R0ȟ* 0nS` lS0 P 0 R0 (0S070S700L`0pS`0 XIPTǟ1 0nS` $lS0 P 0 R0d7 R 7`'A PPaT`0pS`0(W PdƟ7 0nS` *lS0$ P 0 R0t6 R 6p& P T&00SPALy`0pS`05 R 5 R5 RH0q(50  00S9 Pp3 0!Sğ* 0nS` lS0 P 0 R0 0S E FC*`0pS`0p4 Rß 0nS` lS0 P 0 R0 D`0pS`0s0STß+ 0nS` lS0 P 0 R0 d3 R @Pgl`0pS`083PtŸ/ 0nS` "lS0 P 0 R02 R 2"P. P+M|`0pS`0r0 PR0& 0nS` lS0 P 0 R0T^ PS`0pS`0@G1P* 0nS` lS0 P 0 R0 1  P``0pS`0OOHX(,ptPQ$pN0NKDNNJ`NOxNOOONNOONNĊ\QO0?PR$dPPI\0 RA pW0 RX W, 0nS` lS0 P 0 R0 41 R PBd(`0pS`0|1P( 0nS` lS0 P 0 R0 1$" ; P@_`0pS`0H2Pp( 0nS` lS0 P 0 R0 2"  P ,`0pS`0,3 R4$ 0nS lS00P 0 R0 3 R 3 RqU ``pS0q40  00S[ 4 RD4D$Pp8L 0nS` ?lS09 P 0 R0-4 R' D0S!\  @\0S 5\PH 05 P C 05 @<^@`0pS`0U 0gS S 00C S pP 4 6 p W 0 Rd6 R d6   0 S 0 S W0006P  PP &U P6 P7 00CS0W0vqW8f '0S00000Y00#000# 00 0nSK ClS ; X L7pPt. 0nS` !lS0 P 0 R0(0S 08(8 P`0pS`00 00pS0 000ܨ p P 0ꭇ9Xq00CS08I00p |  9  W- ` ppS rS0p00p0p9PJYPA9 R9 pW0: Rd ^ 0nS` lS0 P 0 R0 : R JP ;`0pS`0 /; R# 0nS` lS0 P 0 R0Pt  `0pS`0 +pWE;UP=GUgU>P3VU00GUX $ 0nS` lS0 P 0 R0 ,000gPc `0pS`0  qX QX} 0qD=0  00Sn _Pph L= R|QP=- PT 0nS` ElS0? P 0 R03N0S!\  >\0S \>TTTWU 0d HP0P > R > RqXG ?;`0pS`0+? `|? R$! 0nS` lS0 P 0 R0u|?`0pS`0? ? NPD010CS0 0nS` !lS0 P 0 R000  Q0 P|`0pS`0< PpP0000  OOONN -`0` LRTLL0<SS,0 0Qڄ0OOOJO -LMܠPp@* W* 0 0S@@T0TbW`CPP l0 R   0偠P 0#T 0EE@\QONO -LLM0 R8Ÿ" 0 q00  R 0  R1 A0 Sd KP& 0!S] 0SWʬaQQڌ 0  Q @0 0 0 S 0  {P,q$Q0L00P 0@0CS0@0 $0:00CS0@0 0`00P @@0@ԦOLM +NO -6LM PR,P l,K6\@Pp P,0 Q@i0! ( P0 S 0 !R %R  Qd 00P0\ST 0 R Rʤ5 O5 P %Q00!Q`uTş0 R`l00P 0 0CS`0e0 |809"00CS0D0e!0 0 Pdt Q`l000P 0$0C`$S0d0 =|00S? h@>3 , Q@p,  0 0,0P0Cs,0 0 00@b\s Q`l000P 0#0C` #S0 c0,0T5 2`V0 0 P-ꈂ Vp|000PP 0@"0Cp8"S08r0 0?9l00CS0HPI 0SF q0 Qʠ0 0@T*0 0P T:0@00Pa Q@L000P 0!0C@!S0A0 x40800CS0u`匐0 QP\00P 0T0CSP0PP0z Lw0OO($XQOO+NL -鼁LMⴑ崡`0SU !@PO 0 SdP? pqP0002@T V T (1 BR A0 0 [ P`00CS0@000.S0 S&P 0 S R@ 0 P0`00\QOOOOl  -43L M0 00,  R W,T P@` <PpX آ 0S2M0@` T QڐR2 Q@L000P] 0P"0C@H"S0 0 Px@P 9PGOK 6H ,0 $eO@OTQHO -80L R (@ 0! ~=>PP p-L M@%dP0@D`P K`<P 2[![SC$0BR0 `pht@  -`0LM @R 0D!S 60S/$^k6P}O -L P> P4 000 S/ S- @PP pP `0S P@` @@ sP|0p p0Q@3T ~,@P0$ Op'+POK -LMq@P0S S  [Rb \RZ 0S  S0匡Pc Q| I `1 @ RD1 0o(0 Q`l00P 0`0CS0`0 0|300CS0@000 SH@P@(OO+dO|O ^R ]R 0]S S [S  0]S S]R.Q =Q:Q R]R 0 S 0R]S -PLMPP0`@p T/ 7P* 0 S0 S00 10BS gR  00 p00 PP 0P0 P ONlQ -SLM p 0%S 0 R ࢟ Qx0  P0 pg \PG 0 R Q0"plR Q@L000P 0,"0C@$"S0B0 0200CS0A000 R0 pt1 RlA8P X1 0R S 0`00P 0S0BpG0` Q@L000=P 0 B0R@ q@0k ho0,2lY00CS0@8h0SL(@00Pi0FOdQtQlQ+Ol ODN -2L M0r0l^L@4 , 0 000 00,qP`0 0bZ4 @R  P8(PnP!0@00`T@T# U T00CS0@0 4 @ 4 0 zPP00CS0D@0 0OO\QNhQ -LM " P2 P@" " q ğ0S   ?K廖PW"R 20R2 84bPU$0S4 F"0S \ 2 1    ?K化P 3 `d 0Q,V,K 0S 2Pß0SH# xF030 qF\ 0 0%rŸ0 QP\00P 0"0CP"S0R0 W00P00CS00B0 B0 0o࡟0 Up|00P 0!0Cp!S0Uq0O L00X00CS0$b"P U" 0S  E0 K9P0x 0uꬠ0 Up|000VP 0d 0Cp\ S0Xp0 0" 0MOpQhQRO+ -L MH0 @\, P40 p( 0&S \S~ 4@TM0 P0p 0cS3 Q 00c Q@L000P 0t#0C@d#S0\C0 n*0/(00CS0C0W0Ȃ T`l000P 0"0C`"S0xb0 30/<00CS0 00S|9Sz400CSv02 @`1 d Q Tq, 0@TPgꔡ Q000rP 0\!0CL!S0D0 0a/00CS0x0 `@0 dQ T2, 0@TP(꘠ Q0003P 0` 0CP S0H0 e0 lQtQhQpQ+ -LMؐԀdP`01 ^, p@PP@ @q0@0 A0@0,A0 00.(@@ $+ -LM"0 s8 < 0s BВ0S2  @0T00@D ڄ0r 0S`>?@@00 00 0 T0@D0#0 N @0?T@Dڄ0qa4PK0 d 1 0C 0 d 1 0C @D /\ `Fʀ1 R!PX D0 80!0C,!,<S0(A0000 00 0@D0 00 00 00  00 00 N0G(\QO,$OOO -`L0 0Cs0 p001 R 0p 0Cs0d0d 00T T00@PT P0@T$\QO(, -LM@`먃0#sP 1 0#*|pP H0@*SHB\C\C\CB\C\C\CC\CC\C\C\C\C\C\C\C\C\C\C\C\C\C\C\C\C\C\C\C$C\C\C4C\C\C\C\C\C\CPC\CdC  0 1 "P00Pp2QB00X2PH2D2 @bTaz("0S "0S n ! 0 g!0S ZY [1 y1@DyQq+/ PP*c20S0E= 0 0!K≽pp-0S?T%w  r!0S 0S  BKl1: S 0S 0S BK[v0: S.  0 0 `Od HO <jQQQOl QQ OQQPLP -LM/@@P 0SP :0/S P:0/S @P:0/S@P:0/S  -0L|M\$ ~P  00 PP 30CS$G8GG8G8GG8G8GG00 $ jj00S3 3S0S$   |` .P$ $ X 0 pi/S @ 0T/S/0000a`0 S j Z`K✼p 3S @0 Sm 0: S 0: S  0: S9 ( S  S QP00{D2 R QPq Q1 R Q S  S S-mQR1 R1 R 0S 0: SA 00PW6 1 R,0  !0S bT`TPH4嵚pKWP  0R1 !P 坚p P7T5T匚p|凚)T%Tp0m0x@0Sa  (D,$mQQQl xQQQQ -LMMpA^K PE0PE` @ 0 bBp 0T0 彚PxphHP\0P 0 S @ w@()Q QQ,Q8Q -QLM@l 0S\THx0S@4 40 0Rh.0 QDQQ -QLM@p h0S`X H480S@4 40 0Rh֙0 QPQQ p-LM0AP: #:0$ h?`L3c0(  ,0D?B3c 0CP@BV;  {P 0S 塙@0<0V$ P 哙@㊕0V0 LGP 0-S xl偙@pL0S LD8C4h Q j@xQMb\QhQtQ -L 8MEPO0 R  OQ 0-,@,PL $! }!x됫QQ -BMLM;;BK@(L; L , @0gS0*K`h[K⼐帐 p00P0D<+P(0 00;  0uS0nS0 0 0BMK(@D @D+P +P[K@ @Ze+0(K 0>BMK(@D @DP B}K0(pG(KpGd 06P@ ?hB]KBK0T(PE(L( PEL #%-*016P@0C0B-K( B BS1`@ 10DES񟗾VVVVVVVVVXXXXXXXXXXXXXXXXXXXXWXXXXWXXXXXXXXXXXXXVV W,WX4W2 P@040 S" ؕ40S :P 30SKL  KLP 30S9d\O0 PR(K  0|L PpD30S8@O<3@T#, 1P20SK 0Ly eP 20StIK(@D@D9K)L0P U ʥ?Z00S (20S Q0S0 L cE0SYK(PE PEK0LP Z10Sc R1(K0ASKPd1(0,  0$   0S \'P00ZK P P y NP Z00SZ$00S (K0SKP(K(00)KL h00S )K( B0 0C00(K B0  ,0 SL,UUp^^UU^ذU\U^ p-PLM`P@S L10SO@10SK410S p 0@pp00 0vP 0S0;0PLQ >P}00S$, p0Ϡ/ (@@#bCl(K( $ @  4>P,cpUUU ^^^UMb_ 0-@LPd9P!  PD|00CS00Ӥ02* Pp@ 0@ 0CS00Ӥ0$* PpyT0Ql  -pLQ  ͗P@ XP0@S &P`PD1SQ$_ -Lp@`PU 0 q&0f0@L&0Sr00a000 z&Pr0000D0_ _ -L$MB0, S`20SŔːY0, P i tT&\2P, 0 , S ]0 S0 00000  0< 00  P0K %n/ 0 %P% @0 ?@%0 0 ,P@0K0<0 p媒0( 0@<0@ 0@00S(R&SŤŒ˰0000P%T zP@%0 0P@ D0phY@QU(_ H_\|__QQQ__ M-LM01, 0p`S  oL00S PY% 8P@ Q%0 F,0 tx&p `0pS  0S P@P@0 ,0oY@U_U_U` - 0LM@ 됫8` -`QLMY0rSwS ?RPPU Xڕ00G 4P@@ 1,PP10PP4PPPPPPDP 0p000wS  @0P` wH0090a`0wS  0  P  0 @X@H@L@P@T@` -PLM@Pp`(0S 00wS` rS`U |0 0 0l000d0000  VVK`KT@H@P@L@ -LM 0K# aP p-LMD0@S PH`U P){P0 D0 ` 0C00  p 0-LP@@0D0HL0 -RLMP` @10@P]T@TSQT1Tq 00 @0D00@Dt p000 V@O@0P00 V4|p V00 0P00 lpX  ec8 000DP  NO0 0\RH@L@ -L Mp@  T,KPt $+K*K < ^' K)K&K%0K(K  ^  $ K` 0# KT, K< 080  4@ &0000 T  <KL0 0 pS RL@` -LMD0PSp NRL @T @H@)ヱP0D0@ P`.  gsp0P Ό 00P Ō 00$ 000 P@D`  L`VD0S0S$@  g<0 cP@L@ȠR0@-,ȠP @ 0"\LL ^NNQ0RPBu 0PEu |2\x2LL7&c2c0T2RCV]EH0PE0 0  0  0  0   0   0   0  P @l1'7c2Tb"U cbUI U30 0  0  0  0   0   0  0  PE U @PEu 0PEu 00'7cb2" cb0q[ -`PL p@#.0(Ã$H7c"( 2'H@`c\@^B^BN00QA>AAQAAq 0S 000  b0 QŒ00 , P080!Q,000S0^RQ, -0L0S,Q p-QLMP@`p00SV@+00$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$01`FV$D#V 0 0$01`V$D#p,QQ  0 " p-LM`P@@Tp -`PLCM p4 7 0 (1 0JK1 R0ڨKKK 0SK p ?@`PK  R p ?@`P4!' P@-P $ RS΂@ 0p`809 PL0  (,08<lPP- $P Q <01 Q0C 80<<ࠓ80 p-RLM@` @0S01RPPU pPp(0 PS00P(0,0S00,0| (PpVF20`f$00FPS0,0$0p040$`ph  0%0 0X00L0 0T00P0lRlZ -$@L40pS` $P0 (P4(Q$ 02(0,00( `cV:4b3(0,0000004PcUP!f 3`V 4f 3(00` 00( 0S00,00`S*0,0 -PL,M4 8 ] $`VZ 0SW 0S0SQ0 S 00440@  < 8 0JpWh: 0 Q7h威pG:hQ D*00 0Rh S.0L T0l pl0T/ PP0L 0Lh 94 094 000`0  h0S*T0 #L B ,K 2+[0SZ0Jp[PW*Z 0JpW:+0[h pc8 VP0W*Z  0JpW:h +0[Rpc8 00P(pG*P0W*Z  0JpW:+0[8pc0P⨁pG0W*Z  0JpW:+0[8pc0 P⨃pGh` 0S|PEu PE0u h ` h0Sw:0S+ S 0l@LT0l` T/^p0PPL Gl0`P00X0d 0XpPP0L 0 64  03T 02L0C0,@K W1+0[SZ0Jp/,0[S ,000 /[0 [0 20C"[0L3  81/ [+0[0SZ0Jppb82[+ [@0,0[pbS80  0@54 00H000HQ W*Z 0JpW:01@ 0C0 @ pa800X 02P0C0,@K 0+0[SZ0Jp,0[,000 /[0 [0 20C"[0P3  0/ [+0[0SZ0Jppb8,0[+ [@pb8&2[ D0,0[ 0H0HQ W*Z 0JpW:01D 0C0 D pa8H,0@D 00lR0034 0f@Qt H D0PaS<@P c 0 PeU(0@Pb40e0eU P@@0UP!0ee@0@ 0<PU0< @0S @ RK @0< B0< @ 030S4 WZ< 0JpW4H@ l0@H 0Q00 < H0c 48(4<,(<4 <@SH  14 000p00 L 0L0 <4@(08SR :%<,0RP0 e0e 0L P0l0W0e0l0 $0 4#n.4p$`0% -L|Mp t x0 p0pLK W R *t0  0 Z00: LK00SP Y!Q | x ,@K0P00@0,0K0 2K+PK).x0 00!.P|00SP| |pY100pcQWWQڀ p0R0P0SKKplK 0p Wj0K Z*t 00S 0 000峠 Z:p\ \   T#T3̠ 0 @@  9x0 p [S\!`0|p  0 0 l0 Q0+K,0KK `0,0KպKځ 0,0K0 "K0 | BPPd06 ,K -U G0B @T0DLK `0`0C`0 W< 00t 0p W0^ \ l0 R|00  *00cQ0 R:p [QR! C x0  00 0bC10@0 V,0K+K"K# \ 0S x  p +K06  ,K - G0B @T0D```Vx010 BYY[\` 0`@\ -LH -L4M@P1&v0oS000 gR   0尖mS000 0fR   `X0 T0 P H p&epH0@ 0S񟗇Ԝ0000000000000000000000000 000000000```H  P 0SB 8 1 -R1 0@cTQ6H0SL P R/V``X00L` L0 @T 0 000CS00,K 0@Ꮒ0S0 t,0 R0 X@ 4@ PL hPP `iP@ 30C Sꤞ <<H RI 0S 0S @ R4 @4 L00L0@8 L00L0@ L 0P DC`0S @0SD UP Z 0S0SPQ TX 2P ZTX T>@0<6 gjs l`T0Sg <`~T0SP 0!R00Ss ?T4K8 K0K0P0 #80@ 080 Y`V+ `000CSЁ,K@ P@ǁ0S ,0 R D@ @ = P 8@  T봁"006P< @@ +0S : @P` _X 2T .P@ 'pT IX 0S0S0L04]@8᷿UUUUa aذ vab -LM0@Sp LdP`^0   Ks0 R W0]88b -L M0@S ?^ 0 KM0 R 0:8Hb -t0LPd0 R X0XP PP00LM H@0( 4P000(UUlXbUb^b p-LM` `P0@0@\  0S 0S 0S p ] -LM"00Qp,0 w$Ps_`0@0 P`O 4d[$K4!04  PN \P4 T勏K` =*0S0 0 (P  !0S0 R0 0  0@ f* 000'P0S d0 ,0S \,0S 0QO\l\x\ -l2LM 40pF ;;S0SQR0SJ R, 0,0  0++PR- 0\ )0S(dP! ?;?00clcQ/\ 0 8&,0 X0000000S0S0.P@0S0 & 0 X@0@@@080   0 0S}z\?0@-@ 0!?;?0c\<`?* Q< R:8\0P0S000 0SP P Q!0/S0S*U 00SS 0 S /S R0S00\l\  -MLMp0P@AnK 0 `F`F R 0w%U0 U 0S l n@p!0S D 08: S0  `o?\(?4?K0CB4  0D0 04 01@DpPÏPoD \ 0 ?00S00X W 0t/1E $$pWR`P1 ,0S , 0 P  `0S@zP1)O  0g Ppz@0 `( B0B!Oz0pt00 S 0l X 08  [D@ 0(@_R:0S:P h0S\AAA B$] -MLM0lC\\#, 4 @(  P@[,4(0 B04(  3<  400T` t00\F" $p`"0t/AV#1%Y X @0 0 > \2R_ Q$00x($@0 \BU\\ - !L0\01 \\/:`0`@`p $0 0 0%P#x$` 0dR\#Pt0t0l h d@d0 0$00008]@]H]\UB\L],]D]0]<]4][ -0 @00 85H :`Ƞ0SP`L#묀p#P3@00 00`PS L@0Sp0S勻P,<\U@]8]H]<]D]L]0]4],]B -LM@P00騻4] -81LM0 0B`?P7 P@@T1$(R`VРpА. 0AB#0 U00`0 (0 000 @$P!0 d@S< 0 a00偻P@\[X]T]th|][h -P0LM@#<0 P 0S P|][DC p-LM``0S TPT 01@CT*000p0T*[[X] 0  \ -LM`P@VUpᰀ 0S_P 0S 00C0d  \0 iDiw80  \0  6\(\C\[ ]dC01 D@!T  `,0V04 @@OT Q?>1 D@!T 0 T0 0̀0P( X (0KP L H D @ < 8 4 0 , pC뜠0 0P,0`U0@T UP@XKP 0 T `,0V00o\]p\\V| -LM0 0,0 0p:40  6 6< 00`<0 @0R)0S&6 RtF p 0d 0PP 46 ,0S <,0 ,  n u4 0S R1 < 8 0 B ?_ `PP@404 S S` Q V@1(@Q0 T `FV@ 0%0tP~P`@T1X@QzTP $0000 00SW4 Q4  A 4 4" 4  R 0s 0 p00t 00pPd4d$00i4 00$4040$0h Rf   #0S q 0p$0h0fPR <0 00x3t3   P 3 l hP3 R! HIt2 R4 3 R <0 R 0SR;Sh0S)|0<(œ R:0S:\4h0S1<  0@#? S`& @CT`0t0@DT `4"80d a( Ÿ.NP^1 R  p (Ih0<0 0<  0 0Ps,1 R 0tslP  0p4< <0/410r($0 P X P0S 0S  hP P0  } D K G \]d\ ]F\Ci[G\\][x\VVGDGl[TGpG|GGh\[iGG \<\Gi -LM@P.Ppe`VWY!?> DR.000 0. $0`F0V$0@\ P0 S00*㽳P ,@ R0 0  0R 0S R0R0S ;P  0 R RpPd ]\0 S00Hō<<( ]p\KV\[HpG,H\DHkVPH -80LM, ,0  @P\Vi -1L8M1q1!00( T (0KX P L H D @ < 8 4 0 , ,0@Q 0PU `TP@  @0U ,0X00P @0P@ XK0S S [ V\|V ] -LM`VPڴp崀.@PT 0S  0T @T R 0S `FVP 0  0P 00 V\K -LM$$ @0 @sPVVj -LM88 00 @`0Sh3VV$j -MLMTTE0,0   BR$d((l !P % P80  4EKI I4Z0ğğ q`$aA4( Kpp$p4pğV`$ 0d *MKJ J0P000Ss`V:ğ $`0V0 *D0P00\'`V:ß0 q`S00*PP V:MP,0 S |,傷0S 0 P00S 0 S s S $#P # 2  00C0 "~P  000 00C0  SV;;S T"9(K00MKA@AKK@ $@0 \4  X$ iBNK @D@D01 R" 0̠ ~ A0S0?0?00 R&P0 @`>n0̠ L8d 8I   0I PP; PP 0:0 ) g ]HH[X]VVl]HII}ID[Dj?\t?h?lj4IhHH@pGHH -ML08M (8Rp, (`  Q 8 Q753 575$\C0S P W0 41 R77 (K(K  (K0AO0KKl,0S`7(K (K ( K(K0 00RP^^x>KMK [P$ $\0S#  R0.S $0&$00\ &"F 00CS񟗍0$0SX ,0 S ,,00  & Y5 R E0 S %G 00P%00C0 @0S$ $\NK @D@D0@S^K PE0$0%+5 R lP $\00$0S0 R$ 4 R4 R$ hP 0: S0   4$00^$\OR$ 0.SH00P[S0 41 R33 (K(K  (K0AO0KK,0S<3(K (K ( K(K0$00\P000 Q0hNK0ᴀ$00$02  0`0C0 @@\+0SP $00$0P l"00C0x"f>KMK RP8"V4_00@6P \ .P !?G0l!00S 0S ,0D0 P>KMK Pe$00$0 1  0`0C0 %崀t$v@P_ l0S 0x0 P\0 R\ 0SY <00M0 x\\[tIl\II ]IIII]II\jJ[J J0J}IDJpJJJJK8KPK $$0c -LM$$ @0 @PX]Vj -`!LMX0P!1pCH1W0:<000@`V Q 0 R 0pGW* 000 R PQ 0 R 0 UPy`@uPl000`0  00C0`0 0@0  X][ V ]|](]] -LM$$ @0 @P] Vj -L4Mtq lPhh!0$0 @P T0 L0 H0 D0 @0 <0 80 40 00 ,0 (0 $K# a Q @L@ 00CS6$\| 0QP 0S P0@T000  00>xTK /TK% 0STK@ <0 ,] V ]][?pK|KPK -`LVP)P>1 1ER# @T 0S @T.!0EX00C0`FVP 0  @00ޭT][p\ -LM$$ @0 @QP(V$Vj -MLM0,0 K0 HK0?(@DD@K8K @gK ,? _R@X\$UU?(K1 U5U3HKKQ, P0@@?|\ ``N A$e @^?AV@0p`R/110Sr(K($ULqO QKPTPK XP58K1\@@?NA`@ 0|0l(K0!?K!d $5dKS@B@h@$5A@l@0` | ?KAd@KK\ d0Tb 8KKP,=aHK0(K( B@B8KA <K(@0@ SHKAX4 ZK(@ @K!HK1  0 K $08 00C bpX L?>1 H!X ,;+;HK ,0PK4KKT K!(K0 0(K 18K@T;@0 0 0! d HK @`˟0 S 3 S (K EHK@K0 $K00HKP 0,0@0CP(KTK_ (K 8K1e$5S8NHKApKK  $  (0,KS0@0^ TKHK(0 , A0000@K  0RP04080<0@0D0H0L0KKT08K !L5KsHKɟAÄpX3D Ϡ0.0CS      K000KHKA 0 I0CQ(K!HK 0A\00> 00c@# XpK\ K(0SK.!0\0@0> 00c# K 0X0C 0KUB8p WG?>1 AR!?> p W ^# ^"KG$0KQ0$0HKA`0.!008 > b0Q0cP8K! 08HK@ Z $5S,Kl p@h0PX`P ^ $%^ࠡ1(K01!p@0SX^ $%^ࠡ101v(0Kf(KHKA쥟8K$P @(0K 8K1HKA (K(K0(K0(0K HKKAP3P B P5 R9 K8K DEK,0QK^$PPL5Ks8K0@P5 { P|,0 S ,6(K P K0PP0K(K8K Y PHKATğ0 S(K!KT0K0$SHK@TT08K ? P HKAh P3 R KXK8K1 SQKHK\0A00RKHK\0@00?0p00S @@THKAK XHK@X(RRKK`000QpKK`000?000S @@@THKAK X@BQKK\0 2RKHK\0@8K  P' HKA4# P K0S(K K\00SHKA\08K RKK0?\04000S4(K08K0 RKK0?\0000S4g(K08K0 \K8K1 `K8K1 [j(Ajx\]$V(V h ]Lk[ k1 @  KK 0h2RK`00 ?> 00c# 8dW"K0K"0#>PK1(KTHK 0AO K0@ P54C0SPXP 0S 8KpP0@@?|`N A@?$%ARP `A?AP=L0@Po4D P  RTJ$5SDD0S Pf0S`P Kt4 $ X\60  0 00 --L 㭢 p-PLM@P`l0l R YT D0 Rp80g 8 0  gㆢH2L --L  --L  -LM@&d hL= --L W p-LtM/Pk@TK P0: S p0`rSe b 0-/L@kPU+D0 00j/00(+S+O00,VM -LUMpPKPhP@lK8a0S-0: S  SU kP U@P P@0 R000K@=P h1: S@ fc$^%d( M@MPM P-L RP 5`M -QLM@ P T 5spM -LP 5M -^MLM= =@, @= _K A=A`PP^5: S  PP PDx-0S< l= R0 X 0S4= &D ef40S 0-@,=@(-(@@@ @@ަ0 0ڦ0S P ,P(0,<00iPIl0Sd<@T 4,0 S h ,*(,-K B BP 8 HPd5Tt5x%0%#,0106Pd5@T˟˟+; ed5T `m; R0  V$+0S 0h$ p , L+0 t'#Po70Cɯ5@"%$pWZ0S[0<cQM0ZQڨ0Qڼ /0@L@0S b0*0S2 P. 0$J QQ\  000S 0 b)0S P  00H0cQ  000cH0t)0S b\0S P  40L0cQ  400cL00S ` b(0SX P X,5S05S. S ( 0S>0S b(0SbP 0(<Q  <0(5<(0S ub$0SKP{  hH080@_Qn d H0S.0O 0S Ub'0SV+PR  gL0@0@_QE p L0-0O@'0S 6b(0S. P* 7 W0S0,%R0S0L%r 0S 6 R @P `P3S x 0pVPT085"d@00PgS0$PP Ve 00 pWD&00/>10@Q\6PPF 6EE46P(@ ;6P6 3P5& 0%@U5 @E000%S P 4|5    d:d L``P` `$h (4Lwa(0S? $0 00L 0P5?T5 V>X5pP0@@?|PN A@ ?$%AR㰠 `A ?A=`L 0D#D3 P 0S U0 00,%0S><0(5 H0S.0O "L00O\P p"000D5SL000<5S,2  2 }000a45 SJ]H0S0O L0-0O021  1 *1  1 |000h1@@4P  0<0|P 00t!0S0Dc[ 3Ut0P2c_P d*c_H H"c <<`[|\]MpG[\\M(]]\]\M]h\t\MM N(N$llNNNNNd\ ]\Dlll0PxllIllm1 1FR#  800g\0 8 a@T^ 0/.!1CQT^@P 0 0 ! 0!S 3S 0^P @ ?>1 A!  ?Q>`0 0 ?> 00c#^ \0008 W0$00C0g0$0^\\ ]]U hp\ -L8M0@K00 ,  -RSL4MP @`t pq\d1  BRP $ T 00c0Q3@T TX0X  0S  R1 018Ġef -80L0CS%,G TG G hG G G G G 0S0 #Q00 L0 R0Sp -80L0CS!G H HH $H HH HH HH G 000 10B0  2 R0  00p -80L0CS!H H I H I I I H 000 10B0  2 R0  00 p -80L0CS!dI |I I I I I I PI 0S1 S20#B1  0S 00w0p -LV0 Hq -L -LM@@,0S  h -LM@cup$ pQsqq -LMM B~KpGnK0pG`F+`F(0 v+rrPÏ˟ PP"KAA NK@D,X  4h 0X U X|,`4 0X X`L$BpDa008 XP6KAA Xp@U0S' T 880S@VT 0S 0@T8800 |  SplKT(0 SH(Þ}qq\ rLrrXR rr P r p-L$M P`*4@K P 0` ,` 4P N J*10AS1 0K(0 $@ ` :(KhqWd\ {p H<0! lXP8K cXp@ U0S  gpIT80[S [@UT80SS S 0 0R0<0 <K`A40LLL ]DpXrs$s@s P xs\ a s}Y 0-LMP0@S P T(P 0@PT 00]ss -l0LM@ 0K $0  K$ K 0P T0 ]t -X0L M00 0@0 K P qT ] t -\0LM K"@ 0$ KK@  P (K0$(0] 0-L@<PeP@ ^P@0\p -LM@80S 420S . ,h) - 0LP`p 0S 0S,ܗ@, 0ll ppXO& PPV0(0 0$`$`@(@鴸0!] p-LMP`P  0p"& {P@Η@p0S PŗP@Pp^P@ ,屗@pp(!0tPtht p-LM`@PT 0S[(0@VT00P <pbP@0PS Hp] P ^ -LM@ r`RK !['P0 U 0 ttt -LM@e 0`p`(Kpj pPP V $(K wP( 0[ 1S00 0V% (!qpP S0S S0S S0S$ &$) $&$W0`S|:0S p0 ,K,0 U0  9uXP$uXu p-LM`0S+ SP@'  *, 0P00 $0( S ( ( R$0$0phoUp, ,0 pphp]_ \@ P&p^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ x^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ (0$00000\_ c Xa a p-LM`00P 0@T PU 0sp00 0b(@T8@0S vUph0S 0p\]_ -LM`@pT? 00 0(@T8@pT`/ P `(@T$T" 0 0R 0 0Np 0 0S 00 0 P < 00 0R YPP80@T 0  R (@T ]u0t^ (0 R 00 0( R]^ 0 ] -1LM@pT 000 0R(@Tw4!p4 Ip`0 P#(@K PP $` ` (P  {,[$K v !1` S 0,K T,0C40 Sp@0LRpUQ0S P0 0n Tp0SCQ0 S?Q0 S @T@~4]&u`p]u P 0-L30 R 00 0( R @0Rp Q0S P0 0# DTp60SP0 SP0 S @T A0]&lp]u P 82P *0P ": -LM`PP( @(K,pK 0  (0@S˔# -L M0@p00 0Sf SPP 0S nSW =P0`0@Q P QIQG  0V0P . 0' Y0  0000V 0`0 ,Kr, ?R0S@p @ZP0"Sl 0pY000 LPH00D 0oSP YDT(D -AML0l0SKt00S0ژ0SKt,0S0ڸ 0SKt(0S0+0sZKtP40+0SjKt`4S000Հ[0S0S0 :K0  0K l \bP FPLd  ,~L\  oFjKPt Ktp @*KP|:A}K(pGpGwP`)   P `V:JP @`0Sr0@0X0S RP  T Y0`Vj?0ZL   LL  D!1#KA*qp !h1p PNK@D@De/> K>K| jK0C^(!t@P(`K1( K,@0) 9 0 ɠ$ (PKp , ꐫ(@_l4_u,v Hvlcd_tvvv0_L_v(vw@wdwwwww xDxذ08lxxl_ xxxP_(_xtcLx<xH_,_xPyX_0y8`yXxy\y\_y4y<_y@yTz4_hGHD4z,pzlT_zD_zą`_z0z$p8_{{<{L{^KPEPE!0kBNKK@D@DP0!81_KNX!X1U*KMx   P>K0C0C``11 K00aQ1PF@1"TaA2P(xa882PDa.X2Pd"000xa2Pb2Pմ(b 2PչLb2Pհpb2Pէb3P$՞b43P@b߭P3P\Ռc֭l3PcP`0cʭ3Pՠw0S d3#4J|cP#000>P3#5 2c埭4P$e(4%d唭84PDA,d勭T4P`8P4hnPP tdy4P՜&dp4Pdd4PW 0  00- L@bPpP`0 `R\ 000ODP@< 0-N(]edAtch_Бp p-d0LM0`S@P p84 *0SaNphh_gdd{t{ -0-LPP@ㅈ$0  ꐫ 0-PL0@S00  l xl0O R 0TST 0S S 0S TN4_~~\ -LMPp`p@? P. $PK` /Mp $0 P  c0$0 ~$C40S$0 lQd U PDKP$  ذ , -LtMK@BnPx0  P P P  4D -L2LM<2< 1  424p, 1   p `PPR K Z C/K iU@= W3T#1 ,0S ,娒Ȍ 0DP|TMJP㉇TJM?P 0,V P 8>P NKD0S p_.0AU4ʨ> >p#  l> h>Rd.`p (0 ,50(5P , 1> @, M^00 00 Rڨ R= =$ $RӠտڰ$RӐպڌ000 0400 Bd40AP LL0Q 4 R(:R8îR0H0400cL0 H0S.0O L00O PP00Z4\ʠ ZP00P0 0T 4Zʠ ZT00T0˟ T00S1800`0 8Zڠʠ Z`00`0ʀ P80Sp; P%00#1t0 003x0@P+4.|0d0 |Z;ʠ Zd00d0JX;\` 4@8@帊@ ԛ0P4@8@@00" 8 000P|0@8@@000 夠Zɟʠ Z000 0B00000S010CO 00pǏ| tSΌ/1`G P$p`Z`Z 00 0` |02X3 X3嬠S  ʠX30X38 X3S H܈P0`x@ @ⴐ z00)1 @@ ~` TBP u0|00  0  X@f @a 0 H 0S S0$5P㸀 0P @@ ?|`N A @>?$%ARp0R`A0?A@T0 S< R7`P0@@?|pN A@00$/>AQ@0P`?P?T0 0 00S000ʠ $FP 剐X3 0X3@ 0 腟 80080`00`0 80Sڴş4 00RR 80080 `00C`040040 |00|0l0 0 E0 PKOP?u UpxP开 0Eo0 i50 0ЄH5P0`x@!@@^Y l 80 Si  Vg  \Tbx0$H<4@ ɐ00 000@80080 `00C`0`0 PP0@ @?|`N A @L?$%ARp0Q` A>?A@TLßPp @ PK0?PxP0Eo0 500 0000000 x@83!R@@ ऀX ʸP B0VHSHP帀PP2 @B 0 P @3 RRR0S 5H聟 @ @0 R0hŸ  Hp@ PK0?PxxP0Eo0 5P0P10`x@!@@@Tڴ00i 0p@PK 0?PdP0 @?|pN A @?$%AR㰀G` Ay?A@Ti0 Se` Raڣ?/0 0 ddl!xcd4_(_L_P_d dt`_8_X\Ā<8 HtЁT`d_VUUU <\|\_,_H_Pp̃D_<_4lc$P\ĄD_P@X_LT_Dd@Tl@_4_T(_dPdXd ( ch(`P0@@?|pN A@00$/>AQ@0P`?P0@ @ 0P0i0p圁PK0 P?xP0Eo0 50D@ 0|0@ `|P06 T DHR0S T0T p" 0@TF0F0S0p P0@@?|PN A@s?$%AR㰀 `Af?A=`L0`d 0S2$0@$ |0OP| $ Q0°0Pè Ű RD3 3  3 0L5 @5LV>00h0Ph0 S:h0PŤ0S0X36 Xc0PE`0|pTV V> T5T50X5 ^ @`=LP0OOT0p$$0 $@F4 0X3@,@P,00,0@`0xQ0000, B` PZ0 "@p0`S$0bZ/0A P+U 8@P  E0|  E ,00C,0`@{@`@P 0|$ d$0t&10XFP0SPPU p0Sj `00 ,@5L20000# jl 0Zp0ڴʠ Zp00p00Vw&PA 7P'\50\'@0h'<l7P0X0'\@/0"b7D 0 0 0 0 0000@0S 0S 8P ,0, Z`(\H;0pKS(d d ,0X0Sy 8 R P  0 Pf(0X 0 8\łI  "(9\5 0Z8( P,0X \00@ d0|  ,0X) I9 P0 0 ,400 80 0 + 0Q  , 0 T@0d jZ Q  00 Zl AZ00@`T#d0>PcUcP#u  R)  D Y|P@ ;9 A6+$0| < D@$[P4X̿>. 0,0p`JP4G뻿/ p 0 iDx긓pß0 d|P  B H0lcVD80|00$#8P@@d AD0"X53TTX>ąD_<hІ<8$H\_`||d<؇D0 0Q 0\\hC0d40 S$||]C XCUC0S nWP T?/0 0 W0  0 ,5<0 0?0 004 Ϡ΃` -LM, ,P@, 0p0Q"0$ `,0 V` e0e\0 40 40@44 ; :,0Œ8 jʟ0p:0 , ,00CPʟ+0! * 0`e<` ;pʟ1 <0P0 `$5S@8ip 0T0T0 1X0 PX00\0 0\0/>`$5SYڴ 0|E/`010Ch0 h000h0h0$%10l0 @0`|(/l01d0 )d 0R<ʸ 0,0\ 0,p8.!Q0σ\00>00c 8p W 00C 0pd(@`0xQW%00PUDh% *l 1 D, '&0000| 66 ƟRT000T000@|0嬠  bP`x0 X0p TPej<@6Pp Ri  `00050 80 Y0 (00(0%540( 0l ( 048@#Pp- | `!40040\%4800` \@4 45.!Q0σ`004>00c 4  P $00$044 80<0 SlP 8@4 R`0 \0$%R L$?>l 1 D, 4$0000| ß3 RT000T000@|0嬠  P`0 0p PePT3Pp R  000 3< 800 S<Y#0i14  4 "2.!Q0σ`00>0 0c x2 <$0 Y0$0L0$%R0<0 plp h@\P@" \ !0$%\ 10 10S1p p0W\ 0$%\ 10 1tt!0 00T1T0$ <08!00 001 0008,0 0 0@ dP0oU X@@@V X@@@ 0|/`01d0@]%dddU xc -LA^ p t00 000 R6Pp04WP㌠(p`͇L|0P` 0O;h0d4 ND400pot4_|cP_cddA -0`A VLP|`A@00000 &0`VpcPBO ` p    d -L M0 d@Π , ` t3 R <@T 0X3 _R`0@P08. P0 8XP43 03`R`0XA  $5S ?l >1 D,  00C0 00C0"00C0 000000|2 0000| D2<2 RT000T00C0@|0 4 40 P`0 0p PeP1 pRU 0400C0@, 00R> 4@P180 0` @80 0` 80$ 0` $ 800`4  4 08 P ?Q>`0 0?>0 0c0@8 T0 d 04YX@@@ ;ddU 8Pd| -LMpQl0A d  al1 RO 00C 0@0S\0000 10 d0 l 00C000C0P`,0W**0 0 0$@x`0d C0XKB$PE 0x 00 6)   ddU dЈ -0LM`pQ  X0X07!hy<0@ L 0PsP " 4_(_L_d -0LM`\0p l0 P X0XN0P^P ,0007 h> $ 4_@_(_ dL_ -8L0@S%D l 0 0S0 #Q00 L0 R0S  4 -8L0@S! 4 t P t t t 000 10B0  2 R0  00 kL -8L0@S! <  < < < Կ 000 10B0  2 R0  00 9h -L M@H K0s4 A[TP @TP@ht@u -LMP@ξp1儑儡`px!lpP@4 "P- 0`0``p0 PbUA20Sh0wX0W 0 Re,dd(d d 0d$d -$bp0LS2 R2 pRpW vPPq Сy P@c #0B SPx x x x \ x x  0lF0S@ bP v! 0S P {  0S R R 0 R P y=P 0S<80S0S@ "P #W80S * d(d$d0dذ,d v -LpMP@T `KP 0 R 80S <0S@: S! p0S : S 0 R !P =P 0S- P (0 R 0dd,d d -LM쁟0Q@(0 Pp`i 0: S (0 S (媁 0S   p` Krp 1 S!3 |PpE 8@ IP  P 6<0  7|0  ,P  P0   P  P| MKP  L 0d -LM@`P  Vp@0V U@0 @n PPU`VUU -1L$M℁PUp$ `Sd1 R 0: S P$0 S $$4K I@y+[ Q003 Kp@`D00CS00Ӥ0 PpP @00CS00Ӥ0 PpYU00yUYV ,(d$d$l  p-LMP`P @@P0/S+ />P0.S P0S@p0S .S0S`V d 00 Q P0S0P,   @@P0/S 0d$ -0L Ad#P000LP< CR 000Ri0 0 Rd \( 0R#  R R0R pp  -40L R(0$0$   ojs(*(YP( p4  Q Qq00  R( 0,S00\(   Q Qq00  R( w(%P( pd  Q Qq00  R( Z lxhXhԍ؇ ,<{ ذH\| 4 0-LM P@U W \UXQ UM  0S 0[S: \S1 0\S \R 0S 0 0 0S000 00\S  0S  0\S0nS 00  0[S KP@ ($0T|O|@-@000^S00]S00 R ]R0 0[S \S 0 R ]R00]S 0nS 00.^ =^:^00 ]P P 0]S0PP -LMMpNK @D0@D` 0 BPU 0 K0S0 t U ^P T0S5 0S 0 }x ({ -L M@X, 02 ,0 p1 100 ,0 0;P0S4P  \S  RE ZQ@D0S4 0bp00 g R AP\0 00 VP \00, 0 S0`B 0V, 0S`:\Q&Q\00 S SP+ 4  0bp@, 0{ypȏ  -LMr ` 0 ( P0 (PpŸ  Q Qq00  R( 0gS} 09S,1SUK A A wpP@P@(S S (0(8 0 S  w;SpSF wSP( <  Q Qq00  R( 0NK @D@DS  S ( 0(0S0R0 E0PU ( op .p 0tydu00U0P0h(Lt̐{ ذܐ -MLMh P( 0\SSN ~KpGpGPP(A jK$`FP@ `FPP5 0Q Qq0  00SP@T 000S0S   0S(0 S H(v8,$Px -ML MD!D0 ,0 낮KJp`J  P@Q ' Q Qq00  R ^ \R 0 R0hQ` 0f Sʉ kp00w@0 ,0S <,{v 0S S 0-LM0@9SP$0S$S /S  0P@  00Dt 000 K4 \S@ȑ R-`L@ ( 0pS S ;S p0 0 0 S S ;SR 0gPV@ @F \20pS S 8p0 0 0 S S00 p-PLM@P& `0a0CS4 P @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ 4 @ P @ @ @ @ @ @ 000@Tp 0S0 C0S40 tp ${ - P LR` 2P R 01@pT 0S @Tm0@00` 00 P |x0 p-LM PR` 2P RT0 AT 0S @Tp0 P0 0p|x -\pL`AT 0S<P pU@`V0 `|xH - rLMP@`!p?@H /P< 1`1`^ 0i00 0AQ0S 0S|0jp Pl+ԷP n@$p{{{ {  -錂LpP0xSM @:S=d0SX20 #R. @U<ŸPE$ R R 0 0  00 0 0 0 0Q00 00 00 00nS1  paP X1 0S7 S Ha _P@  00@ 0Q 0#S0nS0@0 hP0 @0  | L#d0P@ 0X 00h*0 0%{zz{|zz { ذ -LMb0S!lRhPdr 0SX2X0{ 00CS0r2  p0 J80S 00,Kt0@ @C,  02!刁000 00CS0 0Ӥ0,pXqHQ$Ԁ0S P R" 0pW ` 0@ ,0 S0 ,1o%0SF P%2PJK(@DP@D *01\ 40 U0z{ z -LMr0@s `PR |R0VQPq`20  00SG \PD 0, CR 600`0S0$ CR "0000CS00  ä00@e%0Sʱ Z% \.0R)0R P(!0\ CR #00巻P 0 C0 b\ 00`0\ Pf(`0Rt%`vdP fL$ KP2[S<00Z ̓ؓ\uht@ -PLM؀`pP@) T 0 S R@D @00U00  0 mP P #D <0S1z {({ -LMP, Up & &U0 \Ud 0SDb p9  0r1 P`0@0S*,0   000PU@0S*00K@ 0@ @K @ 00s0s\U @0S*P000K@ 0@ 0&S\SPq(00  00S00@ { -LM@P P`p W00  0 0  N P0-L@P 0wS! sS @T0 p P 0 0#S0 d[{Sp P00#: 0CذBb00 0-PLP @gT000 0-LPgP@0 0R0 @@0G꼡 0-SL@p  P`gP@4 U@@V@G h꼡P @\0000Q00}g -L,MS @D ||#lp LP ?PPP4#0SA $bGˆH 忈L Q 0S 0S"0S 0P0 "PPe唼2p D 匼2`b`" @ 82@ $2$ ; 00 , G00 080 4 q냉!0Si~V `0 p00 0000B0(\T@0!00CSQ0@BPڛbT cTp@@rT @ nT @tT @ vT @ @呷P000F00C0APU? 0-S<0S9  0S nS eS ES 0SPpU$ 0-S!0SRꤢxP -LM0#3pwQ@@`wQPPt ip pP ?P VPvPp 3U 0a,0 X0?0,0 pX,00,0 0*W0S9 @T6 0(Y00SP0(U00SU W 0BRSh E 0BSE8' `' ' (( ' & (( W,0*W0S 0*W0S 0S@ DDW 0 1DW D0  DQ DxD0lD0`W 0$D1DDY i$D0 W D0S00DWD,}5PtZ{ {PP 00PeM{ d{PWĢxȢܢ 4<HT`t0 -L$M `0pe0C4` 8` 弇@` S) ) ) ) ) ) ) ) ) ) ) ) ) D1 ) P1 l`hG 00< 0L D hpDg ?0@P9S;X+ 4+ 4+ 4+ 4+ 4+ 4+ 4+ 4+ 4+ 4+ 4+ 4+ ,+ 4+ 4+ 4+ 4+ 4+ `+ 4+ 4+ l+ 4+ 4+ 4+ 4+ t+ 4+ 4+ 4+ 4+ 4+ 4+ 4+ 4+ 4+ 4+ 4+ + 4+ 4+ + 4+ 4+ + 4+ 4+ 4+ + 4+ + 4+ + + 4+ 4+ + Y0`+`-YWX040 \< X @ [PWP0\,0  ,KeP <0S000  <0KeP 0 1S +R-R0S004\ 070S.0!R g i9S4i0S4 00P7 84 Pk04\  Cz&) 3P 0(0 00 @  ğ $1 @wP1S0,0叇PBg4 PQ* #0Z {`@T U 0@TLZ-Y00  4#C ß # @ @8ß0Z z`@T Tp  0 RW  20S0S@LZU 0 T 60 @T/ @0S 2 B 60  B-Y BW0 ᠄B0< S hBBB  =7 1+ $  B0  B B B B B |B xB tB pB lB prAk(8 %ꬣxHУܣPt`o|  $(08<@DH -LTUM 0H%0p ` @, 0 4 8 0 %fp?@R 0-+9PH3 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 P3 2 2 2 2 2 2 2 2 2 2 2 2 2 2 <3 2 2 2 2 2 2 2 2 2 2 2 \3 2 h3 2 p3 2 2 2 x3 4,0  0  4 `3080 0 q 0S +R-R0Sp3, RV X 0S TA4!f@o@T,qyP@T 800<0 < 00S 0S@@TT =bPP` 2d  1aP`Xx0(U00S 8 RI ,x0(U00X  S@ U00S 0 R0)XP00 `0 000+Y008 8 00U0 10S@ 1 0I30 0X ,dxP@! 0 40S Q)m+Y Q 0 A= 0 ^fA=lmA40S`m+Y Q 0 A= 0 :fP@O=l8,lx08PH̤Ԥ -pDaL MP44!Dep dP ?P aPtP`` 0PX(PKXx[xP@ 0 00 q0mw wP@p 0L 000S W00x8 p-LM0@SP P `K 05PP 0 RPPSp? -PL@`p dp nP ?P lP`pP` zPPPP 0P FPp F0PpSx -L@ pPPP0S{?` d?P 0P 8E0 SU0S 'E x -tLPMB^p`L  0@ P @`l0 @ Pꀣ , -LM@pTP 0-S c@#,dp lP ?PsPxPpP?`W00S!0(R00S l>Xd R $@KeaP $0ASA2 A$ R20S`p?1S2 R hBxR` R PdBd`VZXX?V?0D,0  P5?BQc U`, (` ,pKPB0 R,0 PPV`U ,@0!@dWpp@R 0%S# $K`P $p`mP`ATW忦 g>A`>CP  0p00  00S& @HwPp6 P`7d°P`2 x8<LxXtgfffH(; ذ 0-@0PTL 0Qc@@0` -XRLMP"@c?P 0A`V PU / 0S 0S =1 LPl 0S0@  $0 S  1SqQ0S 1"0Sl= @P@b?0P0P00S` 0+0 0K@KKV0?0 0K00K?V00 0@ ;0 Qᎃ~ Kr0P@@ RV  0_ \ @, 0S0=(xԥP`,4H -PL@p` mbp lP ?PmPp`t 0P0 PP =㦯0P0 0PPSxd0fP p-0LM` P@,b?P 0AT K03\0 S0 1 !0l p$<p<Px  -LM0@P,0 #ap ?P SPP,0 S ,b3 AT #0 P 00LS!00LS0B \L <p\ p]  Qf`  XIP@PR  Q8 P3 0X0C SF E E E E E E E E E E E E E E F E E E E E E E F E E F E E F E F F PI PQP'SP0-V +V ,Q@ 庮P \ \ =V1h0l姮P 0a0CSG H H H H H G H H H H H H H G H H H H H H Ispmk@hpU @@K`Pp 0 0=00 b200P B\,0000D<ډ<3x$(4@HPTt p-(QLM !@`?P< 0aV< 0 0Ks.P( 0Q0 R 00 0 S   0S  0qXPp P;P< (;ppxPذ 0-PLM @`?P 0PPKPK@P 0@0 SR R 0x -PL4M0p @P0 TP XP $ a`p, rP' ?P pPLK=PX L?;sP uP`PX  L Kq<PX L <);0T0 0P0 0!R40*X;$Xd?@yP` 00XPT0Sc 0 00 , 0 00R080 4 x 4`u U 0S C0 P0ŵU u 0  $0S^tP0;0 T0S H00c RHK[pP800c R8K[`Y U u P2 P$ R X嶿 P OX2 RP0\U00Su US 0"0  40VG 0S 00{0`71 R,4 ]}P# 0SdT0S Xu XuX <\00 000D7D<d  0-d U0S4V  V 00S`FV 0V0 R fPF\`0  @0 < Y@0p0H0 D 4:xX#P0` 0-lPLh @_0?S L0M0< 1 00S(0( 0hQW0xP| p-ALM!P^?P4 0P@ P 0SPU @Zpi: _d:rP``V 0-S PprP@P s0S,9p0S`xp| p-ALM P^?P`p0AT K[P 0 ! 0 rR @0S XW2@P00`h0 R 00C8S` RV 0  K9x4P  p-@AL M8!P\^?P`E 0AT00  K[P: Q40 R 08SS#  R 08SQ 0S 000 0 at 90bPKW L08pQ 0`009pxPp p-LM 0S@`)p K@ZP'0S !0P@PB Y0S0eC10C0@0S0$0 R0ppP| -LM`p ]p fP ?PvPpp 0AT W yP0 [ Q|~@T 8)Px` -LM\` PW  u`ONFd`@|ePX OD%BddW_N( FVe $P @ee鼧h -LPM@lPK`ᄀ!dK 0hp 0 0 0H$R -LM`SK@P lKK0S@ #3````0SS?KS?K0C0C0`G#S?K0C`VK@KQKm 0h  l0R=9B\! =C ` \1 `! 0` d 0Rd! =9B@Kh ZK KP T1XbL1Pc=9 A =X T X! T1 PVK0 A0@.U A 0@#U A 0@lahX 0 P< 0  40  =Ch! d1 h0  cl0Rc=9 =\! \1  A0` `! \10`! S \1 =9C`! =C `! \1 Ũ `0 cd0Rcd! =9 Ah =h! < d1 d1h!0 SKZKh! d1 w=9C ꨟ?BŖxԧܧ -LML@H Dy@B4 ] 0BDACTP`0<0 < KMP@ 1 1 P@T10 R` W4,'   <0S 0pP -@LPpmn`T@X00V00S0S P 0SD@P`d@@VLP\ -L2LM@"<2<4"42@,@ 2"2pb p2",K@@00@*C,P1 `!1eNp1!aP@C^ 1!T10n 0cCP@00pQ3 P7`1 R p|@!0@ 4@,01 06S 1 !pp 0`1` P P P0@P L <0cLd=IT{`{X{P{d{\{T{{p{0{\|X|{`|h{x{l{t{{{З|{{ 0-PLM P@0 K Br0K  PKH00Cs00 |{ -LD0S 00 P P \|{ -|p|0L@ R``P* ` ຳ ᶳ0 0 0  \{T{X{ -`嬠L@Pp垟P0 @ A 0 pS030#00W 00P0Uu0UX{l{{d{h{ -L -T0T LM0 Q<@ P` >A X{P{|{ -D0D L0\0 P ) \{X{|{ P-L`N \ RT LR0S0f0QE$@F0t0f0Pp F@Dtp 䀟 ` 00H0 0 c@BTT@@DtP @Dtu@ @Dt00X0 0PPu0U{X{\{h{p{t{{ -L -L -LZ 00X{ -LNy - 1 LP@8 `00Cs0䠟p- P P r0 0  R0_S $S@@PP P  q00 0  R_S $S@@00Cs0SXX{P{|{ -1L @\7 `00Cs0ࠟp- \  r0 0  R0_S $S@P\ q00 0 R_S $S@00Cs0X{\{|{ p-0LM@P: 00P:p0@ph`P0`P* 0B0R0T:pp00U0T`{x{X{ -LM@@t @Dt 0-@PPL 0PS0 P0 p(0  0 P00 -hP@L`g P Lp0T*0V  0S 0T*0V l{d{ - PLM@ pH 0 0  R ^xT@?hshh -D0D 0L0Q0 P`0TZX{P{|{ -D0D 0L0S0 P0<BX{\{|{ -p0 @L `P00Cs0 U0 T K @R 00Cs0(0;P@\{X{|{P{ 0-0PL@00Cs0 tϠ Qd0AQ 00S 0S0@0Cs00X{|{P{\{ - L 0   \{ -$0L;  -0L?鸠 -0L6T - 0L0@*|{{ - 0L0|{{ -D0L R80000 ,00@{|{T -0P LU:0` pUhi0P0@  ` p0 n` `0 0Rh?$ 긠TP{\{{T{`{{X{-000 0 0 bL1C 00NT{{000 0Q 0 R L\{P{{ -LCM`0JK $0 @ PTJ P/,1 P0' )S S1 S (0KU*0T0`pP@ g0^S@ (@T$0 S `$KU 00eU@  {P{\l -pQL@@0 @dT` :%PP 0@DT*d0 XD0@墛@0@^S@D} {TP{ 0- L^RP@ P00d0ႛ *P0 -p0xP @L@b\`00=D0 <0 40,0 !\{P{X{d{{`{{ -0L,\{ -0L#P{ -L -p0LMqP 0  0Ra a1 0@0b!0C01Q0 RሑF PU"x 0@S0P0cPcT<0 0CR& 0R 0R>P*Pt @DtP@0T 00t0T 0R P

R0@D?R0 00Pp\0 T 00 0S< ^00,P@0 ?00 00D{E{ P0-L@P T a$|0 0h S`0 ! XT0hO$H0<I$40 B$꤮{З{t -LM∢pQ, S d,@01Q 0H 0@:T$Pj a ,dP00S SYT 0S@ WG@01 R;0@:T;T 01  lO#00 RPq 00@ ,0T1 ?> 1 @  ?>1 @ p 0P ꨕP BC@, < ,Pd00@TTPUX~WT$ "{Зt{{L{̮ p-LM< 8!00( $A 0 PP Ġ00 PPUP` 0P4GU  @PĠ 0PPU㗃P@ D.P80  p,%PL{{{{a@-?>,1@LQ 00{{ -LM@Q  Q Q Q Q$ h0 X{{ p-LMP` R @0@0R@PcPbrR@pt{X{ -L0Qh0 X{X{ - LM0 0 p` P0@@cP0 PPXt 00p 0=L0L H0@ @0@p`EB T TP{T{`{\{X{  -Ls -Lk -Lc -L[ -LS -LK -LC p-0L$M` 0K K$K a0a(@K @?PP 0@ 0K @T$0Җ$0P 0S@@TPph\{X{P{  -h1L M`` 0(K n0n4@K0K,K @P@P? X04 ^00,0KpCeP00T0S`T XU U 04 eP00  0R/S \P(0J*00( d PF\{X{P{ -\0\X0X T0L0 L08\000 5 h'p{l{x{P{X{`{{0 -T L0LS00P0 S  0S0\| p- P PP0PLM`0 0@R 0 R R00CRphp0DS 긵 0 0 0 00C000t{p{h{ p-LM@,`PP 0S 0U pl{ 0-L@Pp0p0  0!0S 00@C_ 0 00000t0 @P{|{ -LMPp0` ` K"`7@T 0 0@0@ ET څ`P{\{T{X{`{ p-1LM `Vr 1 RPC0S S S "S 'SP0S0C00 R R R "R 'RP0S S S "S 'S00S0C0`@0S S S "S 'SP00@x@pP@U0Օ 0  R R "R 'RPEU  R R "R 'R0u0 S S "S 'S NPT{|{ULC -,2,B L^P r00Cs0e b^  q00 0  R_S $S0^ LUT  r0 0  R Qp!B00X0^2  r0 0  R0_S $S#UU r0 0  R Q 00000 r0 0  R Q 00Cs0Q000 r0 0  R Q DX{\{|{  -LMtQlh0h @ PT *Tp0Q`hTP*0U@00{d{`{\{x{ -tt`0@0LpI2@@PPt+ P4p$0mMP4L -LM0@S`p P$ ( +*(0  (0 P (PK x0S( 0Q *00 $0 `(0 $ @`DA A@ @ $ ( ` $ ( P p-L Ml`0P0@0 $K 0 $0 9$ K 0B #1P PpP p-L M`0@0Pi 0$K0 $ $ K 0B C1<@ S@  @ pP -PL`M@ ` `   /0S 0S0S @0  00 , &00p(0p 80 4 P@ Lp p p p  `K 800c R8K,>PW񟗩8   ` V񟗜 `X 00 "" " V  R X V X 08.0004, `@[0T. @0T* @(0V0 0 0  00 , 004 080 PL=@` DA A0@0@0@0T * 00 ᩒ  < @`DA A0@0@+ 40 0c0 0C Vm Q 0 R00S 0S,0[W 剐Q   l!0F]Sh l D T l   0   0 00S 0  0 0 0 `0S0000 > S<   0 0  00 @ {V @ 0000W(  0 8K KP ^P 0 UPuX p=40UfcP  @0T*  0@8@` DA A0@0@hi0`0  `   $00(   0 S 8  b R8Ka<P00 0S )00 HKPp `  000  $00(   0S 8  b R8K-<P00 0S )006 0 | dK@K 0$000 /^0@S 8  b R8K;0P00S00  00@0  KHK 0KPp~ WX  PJ ([ 3[0cഠ00@ 0 R00#0C S-D D h 00 ?00A `@0  (CXUl4bp Z C0  0A 0  00#0CSO p p p p p p p p p p p p p p p p p p p p p p p p p 00)  000p 40P]]  H R000 0p 40P("@ 0 ]8]0p00 0 40@U  e  Xx 0 ` t0|`0 r)` np H0`VH0 f R 3[SD0 RD0 H p00C0 1`VQ 3[S ` RD 3[S0p0 >QA ` :D  0SC' D 0`0V V    0Svv  D RD3[SpC0DBF `A F`pN 40 U B GH0`VH0 `Pク ,T Pذ|@D@ X@P08 @WPL -L MPpQs 0#S  `P@@:T 0ş00 `@ 0`S VPT`0@@T*TQ%XJ K#XG (5  0S8  @T000@ ğ0 @" 0 R +X 4 R 4R 00 @T+X l`@-X=X ?X @4R44@T0@@Z0=X[ۋP 0@S*S0]S =X Z[@00  #0HS 2e 0,0 0 4 *bZP 0/Z40 0`CA 2020@S@@~^,0\ *000 4  @0@S000MŸ  E10,0 0 4 4,0\* @ 4 b[0 @` DA +A@,@ 4 0 0 T`V T0S@`@@T 0`SFP[%P 0@S*S0]S( @T*T0 @ T00Q00S V 00 8080Y [l0`P`@aYL0 0`S`Z Z ꀡP@ -d1LM`p+DQ``@nNP`@ 0S $K| $xA@:P P   ݱ2M)00@0 R0PU 0S 00S 00`AP@P,0 UPXtx -L@Po@%Tp? #T U@` :P`T`T TU@ l:P@T0e  m8P@:p`p U:P`DT*P@: H:P@DT*P p-LM 0CP`CA)P @0T *00 TpX0 @`DA A0@@0@`Adph(< P -0LMpH`C P: 0@.S&  9P I0` cR =7P` w !0F0  Z1 0!P0S .S 0.S0.S0S @ @  b R 70P00/S i@"0S !`0Vdq5 *!00 ` 60q@` DA A0!@`0K`PnT U0U/S 0SU0U/S 0: S SQ 1: S/0 0 BKP0: S S@BKP<1: S7P -LMPp᥈P`2 @eT: ś@0S PgU * R 0S  0gSP:00 L{P 00 S0PgU(0304W  rꐯ -LM` ( $ p @P! (0R000 , , 00 R00RP@$,CT 0S  b R60P R 000SP@,!0 /R T0   b R0K5000S0 /R T :R:RP - L0SX +S -Q <0P0S$VW0Sꔔ` 0-L@L PbMP0 00P0  50 00 -L$M, 4 0 Pp@㭇Pp 0{SpW 0@0S S~ 0SX0X0W0SNT 0 S80 p 0Pj l< @P 0 S Rp{Q  8 @0bC<0}Q D $ ,QX L1.< 0P` @8 ᄚ @ ယD @00@4 0, 8 X 4, @0T*0,00 `t0@` DA A0,@0@+0,o0{S| }SHy ,SX@uP - L 0@ 㸜1, @@p1,,  AE8 00 4 1# R 80 R 80 Rc 80k`]ASSTP >8 1S p880!1P00>8 @1Sx<,8K_K/z PP`   $ |<xذ -L,MH, \00 p4 L H  0S 0@S \ |<SV QT,0`S ,0 R V 0S ,0S ,0   D 8@ RD00D0  1S4 `0 7# RP Tq 0ǟ0 ^7 0U>0 0 R^ D 0` VL@Q D0@ 0J 0!RPU7 ,0S 6 R /xP0H, , 00CS x ,4 0044 |6 (/, 0@3,0 R,0 R @ ,03y00 ~040 0,0 0-P4H P 0, , 0 @@ ,0  00x5 p0S 0@SLUD0 ,0  ağ#080 , ,0#20#0 ,< ,0<0 00⎉P@> @48|$,,#0< <00, 0< S 0DS     44 4 c. 0\.a,0 , 00, 000,,0 P,00 3@  00 0@( yx, 0T  F,0  ,0 R  : ,0cx.B\ 00 2,  0 p}00 0S B @JJ <$T,0 R X0T.:6QHR$ <pPV ,0S ,0 R ], 00D L0 W ,0 0H0 1RB ,0! Q5 ,0! Q7@4||!4pP@ p*TH  0 R H 01` Q H0, ,0S ,0 R 0` e0S00p000 PU  , ,0S,P |-Lx@|P0`<ld|_ \ `) x p-LMP`PQP@ 0ST 0S`@0 0@iow0 $ 0 0@Ȱ԰ 0-L@pF 0FPP$ 0h 1$ -0LMp@`T P FP L 0V0R00S@R F 0 0 P -LPp`+F  @0;` 000W ,M0  0S;0FV0 0lN p-LM@`P0=S\ *SZ +SZ@E qF 0 ` p$ -LM`pE2/πPP` @0T00SK 0 H PTF 0S 0 U @' TL2L2@ 0P ,2U(c.0 00 OP2P 0 PQ000Y @ @ Q0000 F0P9U&10T00S 0 PU10T00SPPU00S U EPP 0 P 00000 @0 PP 0`*Ob hNUU=  (|(0! 8锠ذP -L M, KD|0K PPP 0S X0@ pT `0ŸS0``pS" @T]$W0 0qX 0SB0S  z0S pB hPW00H0 U00 0S X 2 R0">0,K { 㻁PX`A00 R  0S AQP ,K {a X a 0,1!屗0  ,Kr{pa0 h 0 } 噗0< 㓗}9K,K O{lc,K H{T00 !Hꔠ$H||(|4PxPذ 0-0@ LR# P0\$ 0S 0S0Q RT p0phTd  0X00\ 0S@ 0S@|\HPX` 0-LMPK@ z80@0S 0@S z0锠| -L M,K`PD pzV`pUF 0KP@3 X XT ,40#00 V  @  00CS0<0U@T@T 0 t@T  z z000!(@ꔠ|HPذ -LM pK` hz@T P0S 0@  00CS0<0@T@T 0 H@T0" Az|xķ -LM@K 8.z00 \000$z 0锠|| -LMQ@P 0= S< 06 @`쀟40 0Qp@Q Q 0  T  0R@QT t3 0R0   0S 8)@,i$$|||||̷Է00 000S  0S$4 0S000|\ -LMP00좟000 SQr`勖0 SV Q  Q  00. 00 R} `2 Ry 0Sv QDbj @BuPY 0SN P 0S? "囕 0S0;004 S 0S# ( 1 1`@ 0S Q !|! Q 0S V PP 412  00S0  ^| 0  <V|}_0 `EP0h;0l`0P@j 0`00@0000@00Za Q_MH||x  -LM0` V 2 0S{ `VpKIJ뼠K  PPhڸpKḲ`V 0@T 0S @T`VH P|V (0\Q=9A =C 0(l0c (( Q=9 =p 0( 0b @(( Q  =9A =C0d0  ch  Q=9b @ =  0H |00 0S0 0SS000T0000 |\?B| p-LM P 00S QT 0PS4 0S 0 S0000 00CS A0Sa 8 R 0RS  @ a 0S0 * 0SD 0S$ 00S D1 R 0S 0S RA  C^ 0 0S 00S p 0S 0 U  ,00 000ppphP00CS000$ph꜠P|ķ||4@ -L`\MD0V ,0 x 0 #@003# Q Yt +0 0Y 0-0p0 0PU5 0@Sb d Hd d lK@ hV 00Ul t "Va VR tŸTp"p Q0l KPx "U 0S UxQ1 ,0S ,w"0 SVt  V  PU 0S0 S t\h10X"x 0P@LDTM"l0[S (!T100l Kx` @" ;" p05"V 0SlK~ lK@ 2"{0l0Kx @VT0 SS 02f 0lK2a R4P x X"|dpxĸ̸ԸX -8#0L` %^0?Sahf f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f f hf f f f f f hf f f f f f f f f f f f f f f f f f f f hg 2P Z0010S P  31 @T 0S @Tip1@PT 0 UXPX@TX Z 001@T 0PU pXP XPU@TZ 00Q002p @T 40S 0S @T@T 0S S @TZ0ꀡ| -p LP00 X R 0S R 0SRl|| -L,,0@ S00  |0SS 0SSS  000Q  0Q0 0  ` 0ST 00C0H0H < P000P00||\||||- RR  RRR00Q00Q <R 0S  R 0S | p-LM0@`TP 0S@Tp-PP -/LM0弟,0  ?@ 0@ t2 |" 0K/KH" 2 x pB e|20 2 ϟ? @p@嚯K`!200`d"  `` P\P 8ϟ 0S  X X #X  0 0 0.0S 2   hb  P\P Ο0S00 X V V0P.020c RK"p Vxm o \w } } ~ P~ t < 0 L = R 010!X00Sx P\P ͟0S0P0 PUf U00 UPP!UK u -00 P -U u ,00 PF u,00 @KQ PK P\P ̟ 0PS  X PU U U U P-0KT:"0R0 KGP; AT 0 !R 0$000 8 H [X @X*X ?X+X !X 'Xk V"XE \X \X$X   - P\P P˟0S00  (X {XJ [000@* 00X  " b RKMp P\P ʟ 0S  00   00X    20c RK$p00X  @00 00$0000K p P\P ɟ0S00 :X %X#Xi 2 Z 0`0 K Z 2 Z 0 K    P\P ȟ0S00 l  P\P ȟ0S00 \ (X ) 2 Z 0 00 0`d K 2 Z  0 2`0c 0{ Ky `X2 Z 00|7 ` R< R 0S BR RB B+R ' KN  P\P $ǟ0S00 $X "X 20c RKKpX 00\00" 00\X `X00" Z@ `@ K \X P\P Ɵ0S00 X 005 2ş Z  0 K  P\P ş0S0P0 P(U 00 ] h2 Z 0 K "`R 006P )KP 0@S " b RKp  00 R<4ͨn0$20 00 8 b K0 @ )X (X0000S0C P\P ß0S0P0  P)U0020c RKpp/KZ V`>X<XBVPW U V00W00SZ xn)X O&X+  X"t2 ,0S x,%(XT2 R P\P lŸ0S0P0 P(U  P\P Ÿ0S0P0 PU |X&UF ;X |X 1&XK;X |X0x"`|q0FSGLAb@T *Xl (Q dDzX0A0EA0US2 " / AE&2`A2&  I'P@ 0 0S 0S 80S 0$ @ 0, 80ŧ `PD)0 PL||(AE 'P@  P0R }R\ ◧ 300T*X 0S0 0 0FU0`00C >X000 P\P 0S0P0 PX< <X>U&P 000 0xWl1E` P\P 0S0P0 P-U0 0 0&U >X00  |U00S @0<X00>X'X2 JZ H ` 00C0 K"Xy2 JZ `00 K}X]2 JZ `0 K0S t~ L , L T (X( "X 'X @TS2 JZ `@| K p 00000)X \X  00C000"X \X0 0C'X0000C`X  " \X P\P H0S00 $X "X X\07/0S\X `X2 JZ ` KZ(X000 )X00CS0 P\P (0S0P0 P)U b@P a>w000( `p 2 JZ ` K\X 'X "X 0 0j2 Z   &`000 K"X \X P\P x0S00 $X "X X  \00\X `X 00` )X |X (XL 00  2 Z 00` K 0 00T}X |X (X0 00  '000 P\P  0S  CX X'00C0A p-LM0P0`0@V:`p0T:D@ -LM 0, !B0001 < 40 0 J408 0<0 @ 80,` pcP\P 1 R0P0 PUR W U p0U <00c R<K? @P`S UU( P\P 0P 0R0 P U<K U$ <  b R @P<00c R @P8 0 08 @@0 `0 00C00,|P|( --hLM 00CS08 00CS0$@@ Qx p-LM@<`ᨤ0DSl0P B    8 $`4 ( , 0 p<004`厤00,( p-LM,`,T- X 1 R$ R 00S  RXij  0S 00S 0S 00 _(1  ?sX0001( dP  0R@ S ,0@(0c aR(k (@@D0S i   $0S R;T 00S $<0 0 ral0 -0@L MTP@ T >,P-09,K- 0, 000 < c0SH0@ , G 0 0lPHL0, -!MLM ʟ` ,  PT( X8 \ d @ 0 S\ @0S - !KLLl Yh O \ SL p\P` !P@0 XH XQ ` R$ 0 B 0d(  h8S`` 0S XQ T(8R ,0`S ,@!P@ 8!mK `F0`F(0 c_XPXQd( h8S` ((XePh` @Q 7 R!0AVS񟗆 < < < < < < < < < < < <         < < < < < < < < < < < < < < < < < < < < < < < < Г <  < < < 8 ` x < < < | < < Ĕ < < ܔ <  < 4 < | < < < ؕ  $ B^KPEpPE0K K,0L+ A_`XP@p06B^K PE0PE0&tp6B^K PER$0#0pPE00AS00@SB^KPEPE%0 0 B^K1PEaPE0%splMl2;B^KPEPE`%02lxMl%;B^KPEPE0%`}[ P00{RPPU B^KPEPE0$s~KpGpG+[}[PPlMMl:B^KPEPE0 2}[@p{B^KPEPE'l4Ml:B^KPEPE$$B^KPEPE+[uy*+hrB^KPEPEB^KPE0KpPEd8 ,LPB^KPEpPE\0EB^K PE;KpPEd( ,C@lMl:B^KPEPE`#yB^KPEpPE0,B^KPEPE'.C[P0p0#4B^KPEPE0*xP rP@ B^KPEPEB^KPEpPE B^KPE pPE 0` K,0A+K0+0BB^KPE` pPE 0H2B^KPElLlZ:B^KPEPE"&B^KPEPE w ZP  ZP B^KPE@PE+Z ZPp)*@)*]`ZP h)*ZP B^KPE~0K+KpPE,0A+B )* TLP0/S)*B^KPE0PE 0B^KPEPE0 r0 S Sh`  p S \S0p)h8 d8S`00`8 xP:\`td`p\ğ(| 0X 0T -LM䡟䁟p@`P\P 1 R0P0 PV( \ 4 H l #U` 00``` 00c R!@P000  V[U(K8P/ P(0PS  b R0@00S(x0 P\P L0 R0P0 P0 `|P -1LM  0((0 $ 妟(0p000 , P`P\P 0 R0@0 Q@000c R0KP[T@` ]T`FTV T00,$ `V00P| p- LM0`S0C0Px0U  Q@@T0 AQ 0p$ P@ 080| p-0LM R 0 0P 00pphP0S`  0 0R@0 \T 0 0R0 P 00p@(0  0P 00p|| 0-8 P0@0L @=00P -LM0@=C0 0 ]P -LtMJ 0S00cS0P@$ T P0 0@TKPx0: SH K 0S 0X S `0S X ,'P 0@@}}|}0} 0-LpMP0@S|0lS`k0 TK  P|0: S\0 0 00隞ꘞ} -LMp@:``FPP :|X`PP%uXP@ 0T\S T 00U0L0 R T?YX@E[ DBo| P0-L@ P@(T DT0?괠 p-LtM@PH08`KJP0: S`0 0 0p鴠 0-L@D' P(,0P*0h+Lt -LM0S ( " 0QOK0嫝G/9p00 K⣝'g@%&;~&X   @ 0@S P@1PSlg@0S P@1PS4g47 0'}P& (000Z0@WPv&00  36 ! P PP @0 @)0SppƟp@P0PP T@)H.De&`v'0@/SP< P 60S,6T  'n@L&#(H& '0US Ue%5Q004&0@ 0S 0PP P5P` `PP"0S"P@T $@@)4p0P iPKoP2: St 0`@S@` 00DSg#02 e0L0  X$P0``P 0SK 0S8@T 0/%& R$P PUY00 0SH3  "p300`%&zP  00 0@TP 0깲 0S iPw @$@  0 00 k1p00 P P0c 0X1o1pSP00S 1SPG`@mTQ&#?VP  &0S 0S0Sy H!0SmKCPdK>P!$2R! 2R,1VPu ,VPptn@\ΛP x{PPa0`wK XP80$tqHn \px` Ĺ,T\HX`D̰t}ذ -TL$  @0 <0R4S0 hU%0j{ػpfğ -L$M< @ D0  00, 8 PH s @ R1@000  000  040 1!\P@. ,P,0 00S X00 4 0 0DS꘬ Ь Ь 1D R&0 R  @0S 0 @000 <00PU, ,0H 8 ,@,%,0@ L00S 00 40P -,0LM@(@@hP -LM, 0 ,0#  0S 04 80  00S2 < @ <0S2  2[P@) 0@S񟗙Ȯ Ȯ Ȯ   <0S@ \2 P 82 R ,0 R40S, 00,0", a2 Rh,08 R0S, ,  0 000 0<0SR,DP@. 0S40S* 0S' 800C80 8 R!d, 00T 0S ,0  k$1T 0S <0S 0S00$40S P0SP ,0  00Sy0@ h0 ^C,Ldy@  0 ` , 4P P0-L@ 0S PP0 R @P 0S ܱ ܱ ܱ ܱ ܱ ZT 000%0S TT P -P`LpG㸙P@pP᠙ P00 Q @P -haLPp0S  0R;" \ @0 R@BT0S80S W\ p0  h鶙`V#0 R!0 P0@CTT WUa< `h0 P\ 0P$ $ Px p-LMl`PU \ @0 @Rڔz T e0 0PU 00pP -(0LM@T @TP -,@LM0 01hP P0-L@ (P 0R @T0)\ -LM/@WP@rSP0 D0P0 -LM0P0@cSZ bSZ  `K ' 0pR R '  0R `V  $40"WĂ d,(0 ("4S ^PKH \|ذ 0-L@PP02H PBذ- X 00Q0000Q0  Q䀡 -La 00zQ0A 00ZQ0ھ;\0;LD<4 ,@$hꀡHT\`hl -H`0DpL0f@Pg00fgP@,} p-PLM`0P !U@@P 2R0p 0Q0-@PL0 00h~0 p-LM0`S0 00@ 0PPf0P00p p-LM<`P@1S@$Tp RPpL 0-LM@4P,,P$ 0 0 -PLNMP! p0PH1 `AT P$UHR?K kTQ?K-KAQH1`PH TP@<`0S 1<SP$U(꠽LH| ~ 0-L0M|P0@@Ktt0  R 0S $Q@000* 0S 10LPĽ - qLMPP0` 5 PP* P( 0S0P00S R 0V0U00S00 U 0HSx0x 0Q$`}`@KJ=};\V 0000`QR \ -L,MS0L0 0H S pP T W㸓 DK   pPO 40AU00#`B $?U sU00WP0P0 <#@0U @$T %T  0  koU<PP@ 2 V 21   R<CV<0  L0 T 4D1S +R-R0S-RG D H R T0 SD1S  H0 T R L 0S 5$0S LP0S D1@S @1S``!T RDD L!T'D1 S 1 SD  0S0#0@0-S /vP 0-S 0唐 @6@( 6PSl@0* P-PSLT@0@S 00$T000,}T}Lн l 0-LM@P K"0 S  P00 Q0 Sp 0 0-L@PP 0w  -LDM耟0QP`@$0 P$0 S $R0pRUP!P0dP@UdpK  OP40op 0eP -PpLM`@*0S @T:X00 S WP*U> ?U< [U) ]U" |U )UX IyWpGY00X00S |VOP X pX Y X R0!S@ R0]S@ꐯ -RPL MP@p`R *0U5#SP QT:U0S d?S^ *S 0TQ T PE0 P0PS:< S P, 1 0TPES% ,0 S Z0@00  00\ , 0Z,0XP , 0P,Q vP@QSSڿ0CS P, 0TPES,   U0@00  00U\ , 0Z,0XQE\  D0x U ;P r, 03Pk sP, PEU0  g 0@ P ,0X , 0PGZp@-@^P`D R6 R0 ^ R 00 Q00S @^0]STp0-S0S \ Rp0 \0]S[Qp0  R   R( !^` P-L@Pp`*0S @T: `)\ 0W0|\00S V  MP``Fvꐯ1 -LM, ,0 i?B10Q , ` P@BpU<:T P @DU 00 00 P  00 U 00 6HpG@ , 0hC1 iBS, ,`   P 060  PM 0 0     -LM@`Q 1 PU$ 0Q-P0 Q -P 000#0+P0SPU00 -P  0  0 0:U?U0r ,U00;UppWj#Uh  MPc :P. ;P, ,P# #P 1\ !000p01S 0!0 00! 001 p 10 R 00%1S00! ;Pp :P 0 00 P? 0?I00P000:S00P 0T HD0L0-SX^U0 00 逡0 0-LP0 S@5 0  0S0h0S 0\@ 'Se U 0S C  0  00SU0<0h4}PzP0ꀡ0IH -LMh4 4  , 00 @4q8 aPPP@aTX` U`V`P40cap0S0W<0 ^ ~,@\8   00@T pWP8o, 4 0, T < 0P -QLM@ ^Pp `PP*PU e*0S ^0S0@e PbUp:0h0 -L`p PPZ 0#S0@P@ -LM @cmP 00 WmP00 p-@LMTP` rTP pU KNP0  9P00T0[`P -`<LVM`0 0 /Q40 8 , P80 0D .Qq 00pW8p  8 R 0 S:S0 0S:S0S0g0 080YS 0/S , R 0S38 0RY 0c0 0 @ cRP @ ^ 0 SP/R/00040 M @0 bRP ^8 R00 4M0 cR@P ,],  P0 S/R/000.S0S/S  8 0@-S`G /SppW @/P/R7 ^/ .^ QP R/R0 00S/S /^^  .^0/SSQ000 QP@ Q AQ0/SQ.00 /R P-Lp@` GMP0 Ulp x]T X0T L0hFP 0P@@ pP -LM@M|0     00 K 0  P 0P/0000 `P -MLM0ܑ0c0SpP, @ PT? 0/Sb S: /IP`dU VO V> 0/ c 0 0c RPBNK ` P@D\@D` d_P0`(K P/R P PP X@,0 S ,|,0S 0.S0.S U0u/S U0.S~L`0/S  -LM@p|0`A00 0,0< (p0P NSP@20 P00S 0`` S`` og 0kpzpW@,KP -PLM`lp@82 T& V`0 0,0$ (` p ` P jꘀ[ڎx0\Ҏ00@0P jP PP PPPPP$ -pPLM`l@*$ T P (0S0W< 00$  `  j\ jP P PPpPPPDd -L^M\pP`@)T0㠀 0WB , 0 E 00p(Ppp PPP $0BRU@P5kpl.@3P 0- 0PSL@FP ~oPP0 , 0,G 0- 0PSL@ +P co 0P 0 P0 0-0L@P  0S0 0  00 0, 0- L @ 0  0 0S[ :Q0a0 /mZ0 P0    0h f$0 0 Ꜿ -@L P 0 Sw p   0:0@ #  = S , 咍@0  d0d@0 0 90   0p``V  嬄Pp``V@ 90 000S@ ;0 0W$ 0  P^000@ܰ$00&@갾 -LM @   0S9 / &:0  P 0S0 0S0:00;0墰0 00$ 0:p  鎰$00 ľ -LMP `p* V# @T T@ Z0 `d d0V0 pX f0;p @T ؾ -P Lp7 WpG2 @Tdp) @T!  YP @0a@T@` YpW00 V dP  X@U -LM @T 0S  0C 0 P 0S 5 0-L@P8 50u  0 Q)  Q000  0QS 0*A0 0 00: A0 PA 00 00Np  0S , p-LM @`A v" + 0`KS" PK  P P|0S   ;0s0 $0p  i$0 0\  R 0 B `0p   DX P0-L@P H 0h0 -LMP `pZ XS@T 0PI T@ X0 0 d0 `dpV&p" VQ@ Z@`T`d  塂Pp@`TV  X 0 0f0 0S 0 ;0 00$ 0X &"p --LM 2 -p-PQ LP@4MH`KH 0 0  @pꜿ --L4M@@K0B z  -L`M0VPD ,0 < @  @T %T  R 0 B @0D  D @T0D |8 ,0S l,@T 0DLS h h h h h h h h  @ h 8 H h T h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h ` h h h @TYT A0DS 0@%0DSSk 0 <0<00 <0 d0D,pK< S/ ( X 8 X Q a@ @ 1!10A00R0guT @P-0+0 0(K0gC Y @Ѫ30#0 P0S X i @ = ShC @ @0@X+YD D I0S C  0  0YpIXDD 0S C0 @0 HXʨ}D00hD0 h0S C0 @0 Xj-P+P/ P- 0P 0@0S# 0C0 00 DIYpD 0xS0S 0C0 00 D p ID 960S 0C0 00 DpID $0gX0000gQ 00SN 00!10 ! g@ \pGX0x00<0倠 8pK0<0 8 K:<0p (1Wp< E08@K8pK,}<00@0 <0@0<0 t@Xqhnlꀠi@fd0 b 0@D@@ @0  @10@00C @0 0@`FQ@ @E C̿ 0-0@ LP0 SlPl0  R0S RR 010000 }}} -L!PP@`p 0S 0|R0P 0 T  0e@aP00|P}} -LPP`p 0S0@0 p0T d0T 0P <T2P@X}} -LMp, PP0@07 T`( U FT&T &T 0PX W  0pV000 ;T`,0S U(0P 1@}} p-LM@0S( 0 ER p`0P0 Q@@Q$T00 0h 00`S000 L0RP4 5*p000EP}}LDh -LML0@S 80  Q 0P}} -LM$`Kp@H P 0b -(LA@,@ 0 4 00 @` DA /A@,@ 0 4 P  ,0 Ph0Udd)\'P}} L      ti 0-xL0 Sh0 P  X0U^ {U}P  @^0F0P}} -LM 4Kx@P  -@LM0S0   0Q 0Q X@0000P@0,0}} -`LM0SĀ0@0$ 0T@ {T}@#pP0S 0S U0Pp0P 00P @}}  -L Mܡ@. @0,0 0 4 Q0Sq00] (P0a0 4,0QC*00 4 R007 |P 4,0`Q`Q *@@ 00 `40 )0S 0 S } `c P0 @`DA A@,@ 0 4 Q0@ @dDA ރA@,@ 4 0 > pP}}L -LP 0@S x0  V=QT 0SdH1@P U0`0?(0 VPp Z 000F@|0@u P0P0 :00 0p0 p@^ 0p P{  0 z뀡P}, -LMq@?Q@0 0 R|a0$ ( 0P d1PH0S00?  P( 0\*,1  ( $ @`DA /A@ @ ( $ ;0P0 P@@T,($ 0`CQ 0\*@ $ `(   10 0 $ ( %i;P00 ``4P}}L p-LMP`@@P`p -LMl@ll P 0S0S $t0 00 0 0| 0- 1LM!1P@@ \ 3 )\0@S0  - P 0 S P0LSPKKK PK 0t `PE\X K0P <@ 0 0}}}|Lt@- 000}0} -@0LM@ 1  @     P -4404 LM,@0@D}} p-0LM0PS@TpaT` eT rT tT p\J<P`DC<P 0=<P 8<P pP 0S  08P 0S -LMPR0@SD2Q00@A62p Q`z T1s Tp Te T_ TY 0DSLTEQ;1  0BS51R1Ep`0T0 W P@0T*0p0@1@` DA ⌁A000 000P0 pP bP0`p V P 0;P`)Q``(Q``P H0`;PL0Q``,0 R}}LPh|^ p-LM@0`S0@ %  R 00P0Q* 00p@t0 @dDA A000 000P00m 0 }}LP -0Q0L0 /(0 0 0}}L0S  0S R   -PpL᥀@T`01@T 1?A1cX0P`+ @ TmĀQU 0   @ Tᵀ0A0 S R 02SP00C0gfff -pLP` 0@01@PT  0R U0Q@5T:P0 -LM0Sp@0< 8C80C01P`U  0R' V0aP6U0Sсd03=@ 000 P@ 00 _M00C0PN:P 00 0000CS 0 0P0 000CS0(: p-LM0P0`P@ 0T S0 0 R@0P@fDA 01pP  -LMaQ @ Q1!0 dT Q  0  褀T@tPa4p0 @0 P@`|hT@tPa4p L @< oꀣ(T} }`0 ) ꀣ p-LMD`0@TP PpOP 00@ O -LM0!0Pp@ `0P W  P 8<P`V @Z /P PU9P <PT *PF9 KP PP0逡 p-0LMR@Ꮲ`\0 @ P0  0S800 0Sx`pꀣ0 R(4 0S 0 0 R CZဣT 0S R 0S 0  R Q CZဣ p- LM@`T P0@0@ x0 P0S V 0 0SPU @Zp0 0` - p WL` 0S XX P< 0@Y XX@0  p 00<h~0  @ 0 & p-p0LMd `0`@` P0` 0S 0SPU @Zp 0-8@L P0#0 @ PUZ0bꀣ 0-@ LPP.0U< 0 0R0 00Q00S` 0h7 <0 R 00Q00 0000}괠  0-\@P0L  0 S 0P 0 0S   -LM@p PPP0 "  ` 0 R$V` p0ppS 0p(K (p $0 0 O`( K0O(0 S  00 0 } 0- @ PLt 0 0 S $ |$ $ $ 0  000 000000 ' 0 -LMp`XP 8C80C S?h% & & ' ' ' T' h' ' \( x( X) ) ) X) * * 4* H* x* * * 0SU @0S %o0S0SB @0S $a0S PU0 @ T&@PT 0P0S 0S@Z m0S ! 0$0 '@T 0#"#0#0#t0##P 0 p#\#T# @0S4#1(# @1S R 0S0"""@0S"d"0S0""0 0\"PU @"@0S \)|"0S0 !PU!i! P10!!0!0!yd!0S\  P 0}0DS + L, l, t, , , T \ 0  0  0i 0S|  @t t ` X X T L L 30#0P xP`o|  `0-0L@P^$$@0hS^$? -LP`p@ T- - - - H. . . . / $/  Kr Gr ! -PLM@ 0T0   R0 0Q [R P@ꀡ-0S00 0\00 Q\0[S 0S0 [S ]SQ䀡 -LM@P0 0S00 -LM@P  0S 0=S   -1L M q< ,0 0 4 Y ap`VJPU 0 0 S" `VZLY4,0Q *00010 0 `40 q0@` DA {qA@,@ 0 4  L@T   P000L@T0 4,0Q* 004 0X0@` DA OqA@,@ 0 4 s0<0 P 0 RB -LM@R $P 0 } -LM@> P h } -LM@@P:U U dV dV dV V LV dV dV dV dV dV dV dV hV 0<00<00 b0 <00 <00S 9B@0T <00< <040 0<0~`X<~ p-LtMPy@P (W lW W W W W X $X LX hX xX X X X X X |Y BPtt00㛪pXpp@ 42 p0<0A@ "@`@0<0p0<0zpp0<00<0A!0<0w8ps݇p<\0 ! P 0Ӫ0p p0  0 S0`PO0@/SJPKUP0: S`pL,p000<0D0 b< @0<0k~<~ -LM@@P-TZ Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z @P000hϩtol4d0 hh@<@P o00ht\ -LM` p,0W:00pPU 0SPU 0SU 0S  ao@  )0 A?U0@0 pP0@ 0 P]P [P P]P Ra -LM[@`)0Sd 0  h-P -LMpPH0`KW1S~ @1S圶T -LM Q#p`a0S  @T 0 S Ѕ@t 1 R Q 0T2 0T/ 0T! :Pۅ ۅ مՅt @ XQ ? 0  0 0  R X0 Q\@X밅 T؅Ė\ -|XL0@ S@_ b b c \c |_ |_ |_ c c hg 8h0Sr P0^@0[P\ XpR 0ǟS7 S 00BS7 0GSWW0 iPL` ` \` _ p7 R cQsQ CQ  P  700BPL` ` \` d` 6 R6  00P0S P 6  B P00 P``V10@<&SL00@``0  6p@p P 0 Sx @ @0 @+   5/T ` `  P{ p%0 0  R8% 01000C0E0 %0@00};10@S0 D0 0$0@0T0 $00v 0rp$0 0  R$LQl4h4   PY 0 $000 w($0  #0 00 B3  7 P00 PppWP  0P``V @T 3 DTS @ 0 0b 0  00 m@0P 0PV 3'QP  2H 2 RD 0 0S: 0M  0 0-0 @0 TT 0 0S 0^  0(" 0@$ 0 0 0 00  0R 0 @ꠡ괁1`V P q0@0  R`Fp1XV P q0@0  R`F PPEU q@L 0PE0`U 0 ` 0 0` 0? 0@T 0 R`@0 p0 l( 0&00_8~|~l\4~ (f<~<p ~ p-|0LM@`@P\\0P P0D D0< <0@#phlhdP0 0 .PP < p-xLM P00PPPU@C H4 R < P ,ğ0S0C00@0 00C 00  c = 3 ppß0 Q #0S0C000C0  0P0 0 ӷ0C 0 p0P 0P 4#0SP(3PT-j k k k k j j k k k j k k j k k k k k k k k k k k k k k pp2 S p2! RHR0 0CR0$b 82Q@  0 @00 R 1 0 S0 00  c< 00 0 0St1 `P`1   \\!0a00cSsS CS41@ ph`0 RA 0@  l G<0 0d c 00dR0c00P@$h@0S\0PpH0P0  c#<0  A P\l `dhd| -LMPP`0  @P0 04? R 0LyS{@q Lp o o

@h0 Ru M00 pW-00Ĵp k  0pWur\ԖЖ p-LM`@PT# 0dR 0@P0@pv0S0C0 vt 0S00v0S00<0 P bPv0S00ЖԖ -PLMpA0S_ PWa$K@0 (K,K @zPPB H1($01 $0T00 (0@cT  R 0000 0 0@@,0,0 {0S @TYP p300(Q 0pp @~\4  -PL$M@`P㼒 r0S㨒 T0S PV0 ,K0K4K8@K @yPs Ve `FVV80S940q&`@M,03,0!0{P00SP 1T0 S/R  P4y|1|!x1l1l!@@4@Py1UpU 4@y0P PU48 v4y540P``pyx0 @ x00qQk D0@@ P[  00D~ \4  -L$MK0 K @KK @xP@ pvxy6 0 RPP -T0LM @R 8 TT^hHuGu@@$Su@0P00 ؖ0ܖ -L.uh)u -LM,@0(SF^0000Ė -GML M<2 88@Pp`, $"Vdp fPp` iPp` 1 @bTQo*1IKaAA,Pp4: S TcſiBKHH+ P: L80Y/S/00@Tt p/P`` 0SP :0/S$ V:0/S `FV:0/S`0 SS0@T4 P  .P40`FV:0/S ا~ ܧ -LjM M(kKH0 H`p,0 DP;2Q !8P2 R2 RVṈP,0 S ,>0S  |6: S" KA ACP L6: S TP $ք6: S V `/MK@D @D;P9SuKAPKIP,S7P KA A9P]NK@D @DLC DC> P@s>1( K ! Q@10 ` P00CS00Ӥ0 Pp @00CS00Ӥ0 PpyZYZf`URp7PRL 8 اܧ,M$l Q -0L$M@  H0 < H@PPD@ <_@- Pp GfPbᏕ0Sp h ᬤ@T SP 4@ @僄P==@a=D0SFcP=00L᪀P)$, 1ϠA/ 0(@@lN#b8K@80 4 0@ , :-Py=P @@Ѓ<FP$<ǃ@ƒ0-S @広L0S @岃H@@ 0 R@夃@堃0;0<`H0P0aPrH D a@元}ЧԧHMbTdtا -LM0 4 $P; ,K 㩂p# ,0.C4 P ,K 㖂p ,0 C4 QQlxAl@ll 00Ѐ\68,$@4,4 00忀(}04 0-,@,PL $T  P K됫<\ -LM@P 0LQ 0-@LPU 0S9Q000 -LM0@S hp@-0PS00p-\@@T \ P`r00 P 0 R0ATap -LM0@SK P  00 -LM@08SK  u!p 00  P: 0-0PSL@0S00 RP0P 0S 0- L0@T  0P0Q 0S =S Qh0 `0 00S<Q  !Q >Q  PP e -L?5 0-XPL0S S 0@ S0 00 -LOM\0X,0 0P S ,0 S ,,=OKKK`VT QP W?K+vwPW?K \!QH1SD1 L1@\0P S Tb818S \)<\00S#\! D`K 0  \xC0[SD[0 CR 0R P 00xxOl~0 pW@X D00CS00  ä0 aO$p,  -0L 㸹됫@ p-0LAM @P` ^p sP` /0 @bTQ!P Pp㌹GOK PP V{.PPM@ dp -0L kf됫| -LMnQ@0,T  h {00000 0 000  -LM0p (0 QP@/UoKK/PKU  S?K\ 0SKK,L1 H1 D1 @1 <1 81 41 01 ),KL0# ]Nf8(0 S ( -LaMb>K0C 0Cp( @=Pv$6: Sg  SPW(0 S ( MBnK`F`F|!|1 )0S@aDPP$[NK@D@D  .P 82W>C R0 RW W7M~Dz0S @PPW d9~BnK`F`F+M0)0KW x0edA -LM@X 0s (^%^"^T07at -SL Mp@Py00!1/aP`!  @Vx y0S@ 0P^( P* )W@y?00 \@a` X0PD( P* W@y?000 -LM@ K K 0K @@&P -LM8 < @ P`pm 4KP@h 4 0R SB @P`Z 4 #40@#P0PS ,KL ~PP 0 eP@ U10  iPP 00S0 K._P 0 R ;;S SPP 8P GPP 0< @0T ;PPV $\008L -ML M0$ , p\ P`:x?000!1 ,0S ,+AwP@ eLP 0  5P x0S08x0S !0rBKHH FZ"0@CaPP- 0@S" @0S :0S+ 00L \ 0$ 0:x?000, 0;$P$\lp} -L`S$Mp0K,  Q Qq00  Rp0+S-S-S +S 0+S-S QN QLq<30  00S.^A0.S7 Z0PC Z04 "O1@K00K @0KD@H L P K 00K\ 10(O @/x "00Z w 0V 40OSl,0`( &"0K`PP, P0 Q!000ӑP PUw"00 P pL1  0P81@@K1`E% 80 ,,8 lp0@0KX0 4 W^0K J40K5 B"0@Z$$ `JPU *0 K0 GP00KU:@ K00K ,@ {V`})V` -L00K,M,P0K?Op#$pW4 @@K0 PX @P Oß$ 4Be!5P[ 00SCw"0 0 /";0@@De#%P[0SY8<!!O1@K0@ oP P`O$  !5;B S<0 8 N 0,E @,P00Q 8 0,Puڼ!@@PK0 4K !0% 0d|8^,Q@00 KPh BNK@D@D+ @0S :S SU00 0S S:SE 0S0V0 0S /S rpPJK@P@ T p0W0P00S@PW40 P t(1 ,0S ,1+b :|P` 0SPR 0UPE"*0SP 0SBNK@D@DBNK@Dt@D0l D# P:BNK@D@D|BNK@D@D,v(`e4 -$0LM KItP -0L: pP p-l0L M0@ KP K0KK@K?sP`+  0 000p -@PLp|cP p3 R %R XV 4 * R00cPE: UcU pP/44<oo̐gfffQ p-PLM@`PC ph10  00S H100PC r0 0  R1.\P' *\\ 0SU 0B8 S('08C?PPPڌ@PEUp pT00  0<0S000PC r0 0  Roo -LMp`#0P@ r \P ?\0 P@ -"P@2L MR0@K0 p` UsLz\Ō\pG   a 0a>Ìp4G6pGƃ??p`F R bЮ?Ф@A P 00Q00S Q b`.^L2a?@ C_`0 ᩯPx 0 ᪯P0x0Ńƌz(p , 0 KV10U0 v0 P@o0 0 z0 O? -L Mp`@P@d<K4K0H0S񟗦 0 P @ h h h t P h  P $ \ P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P 0 P @ h h h t P h  P $ \ 8D3#cX Q0@ 0 KD0  DK5P0S tq!000PKp Eiq!00CP3L#cX Q0@ 0 KD0  DKP0S Oq!00 DFq!002cX" 00D0 ?0PKQ@  DKP0S *q!00h D!q!00ŸH2D"cX 0QD0 @ 0 KH0S DKPq"00q"0020K00!1cX! 0QD0 @ >0PKA0S DKPpp"00lp"00ht10 KdQ814!cX 0QD0 @ 0 K(0S DK|PLp"00Hp"00D00K000 0cX @ 0Q@D0 00K DK\P,p"00(p"00$G \dl,0 @D@@0D cX 0QD0 @ <O0 KX@0S DKPx0 R Zp!00 CQp!000谭00KP0 cX 0QD0 @ O0 KA0S DKP01 R ,p!00l C#p!00x1肭00KQ1!cX 0QD0 @ kO0 KA0S DKP1 R o!00 Co!0002T00KDR\2`"cX 0QD0 @ O0 KB0S DKPb2 R o!00Z hCo!00Q2&00KR2#cX 0QD0 @ O0 K8C0S DKdP4X3 R o!00, :Co!00#300KS3#cX 0QD0 @ 0 K`C0S DK6P@3 R to!00 Cko!002ʬ00KR2"cX 0QD0 @ 0 K0S DKPJo"00Fo"00d20K00T"2cX" 0QD0 @ ?0PKB0S DKP1 R "o!00 Bo!0010 KQt1p!cX 0QD0 @ 0 KdA0S DKPD1 R n!00 Bn"00v0K00KP0 cX 0QD0 @ 0 K@0S DKPY0 R n!00QL _Bn!00HD000K,HPXlpx0 ?G? >Nk"00Bl2h"cX Q 0@ 0 KD0  DKP0S 4k"00@ > >'k"00A1!cX Qi0@ 0 KD0  DKP0S k"00@ >L >k"00`AD1@!cX QB0@ 0 KD0  DKPw0S j"00p@ ~> z>j"00c0 0cX 0QD0 @ @00K0@0S DK|PLj"00Hj"00DD00 KL\`dh@Dlt|0 G?$P80< cX 0QD0 @ DO0 K`0S DKBP0 R j!00  >wj!0000K000 0cX qQ00KD0 @  O 0@K DKPWj!00p-`P@0!@`Pp -P@E:::LCLM/\p, J\!h1S   00 \ 8AS, 0110 p0 00 A10 46@ d,0 "&`'@0@p 00 `P@0,!O3\ \0 L03  1S@Rp@- b@0`P \02l`1^1b\@0pRp@- b@0`P \02loQ^Qb\@0pQP:  -P@Lh \ p`T<  0 p`@A 0-L LP@᧦\4 00A 0-H LP@᧦0S0h᫦p0 -LP@,M⌥0KQ0 @ ,@ WSO@S`8 RPRI*R4%0 0 0 s 8 0b038 b&x@(8!8HT*@@*TI2@0@bP8@8#8XU*P@*U@2 ȀP@PJD 8#8XU*P@*U@2P0x1 xB 02 #4xB 024=> 0&@-O@d4xB 02d @-M0Ѝ@4=> 0e 46 -L MQ@0K00#  0 0T0P00S00#0 -LM K K!oP -LM K K!cP -L 0KM#K% -@@L0MP0  0 L0  00S00 K( K=P(8b00o -LM`Rp @t%  P`F @pT`P0AS Q)0 0  00    p-LM @0`SPR0 S    0100p 0S Q0 S  0S0 .R@- P@0@ .\Q00Q0S@@ 0S0 .R𠁢Q00á? P0" 8" @" H" P" X" `" h" p" x" " " " " plhd`\XTPLHD@<8 (Px @ 0- LM@P K0  0:p0G*Q@-@Q*\?\ [\#\ q 30  00S+.10#0 \00S#10#0 \00S.20#0 \00S  \  0LS00S qX2  00S \\ 00@M \ J% % % % % % % H% X% h% % x% % % % % % % % % % % % % % % % % % % % % x& \00n  0000D0\  S00000\00a \00b \00t \00v \00f \00r  R   ?\*\ #\[\ 0 \ #3 00000 00@\00M0 0qL00  0 0S-00 ^0\0?0@0\00s  p-LM@QP`0 f0p0  Q -LMP4 Q @pB8 | Pz*QP*Q?Q [Q#Q p10  00S+'10#0 Q00S#10#0 Q00S'20#0 Q00S : Q  0AS00Sp1  00S( \Q PQ T:`4P00 V Q 0K0  jQ@80c@ T4:@D`0K0  j` VPE  k @` -@TL P`p T0g0 0l 0 e@DT * -ML M<$08,0  ,PP^ ~P@cBnK`F`F sP 0#S   P< P  P33p 0PP( BNK@D @D [44S ?R0Sp  iPP  E44S ?R0SpO/2 ,0S ,nBnK`F`F B`rP 0#S \ 7L 28 -P  $PP' BNK@D @D 44S ?R0Sp  PP  44S ?R0Sp BNK@D@D +N< PP +A0S  PP0SU|H0S  B0S  <0Sp 60ST 0P@008  @@@D\`d\DT,؆x -40L R4P P00@D 0-LP$P P$@ P00D 0-LPP P$@ P00D -LtM@0SK 0ĂP H K 0S x0L: S< ^O00^0qP0@ -LM@0S00@ -h0L,M80 \0 00 T0@4 , (0 $@ S S00 8K 0  pR `P0@-@P  0S ^ 0S^0 @0S SS00@00P0* -QLM@,0 pR nP4 i 000 h 0p` V Vᘦ%j:$,0P  0\0 p` V000S00 YB080 4 0\08 0\0I` Vp Vᘦ%.:"0\0p` V?`Wpᘦ%$ 4,0P 0\04 0\0Y4; @,0PP`@,0PP`]0 0* --L]M qPM?KC/`KK \1 4Q 0Q  =K0K0Ǡ0S cK|1 1  x tp@ 1P|P 0S L  |1S00\ 00ՠ0|1 B!y* -4LMQ<@ 8#8Q8:0Q 4 %*0 0K Ġ̌.Č#̌ ! Q*v* -LMP -LMt"  2 ,  " !H `W]0P2 8~PP 0SJ?P OP 0S \ $481!`)!w[0`X0 `R0ᕯKS/K ڜ1S9 @T  0(KQ QMK0SMKP"3@(K0SS SQ  . .OK @D. P-?(K R!  0S .?(K R2S "RK KZT0 4*  MK0iPMKⅽ P+ 1MK{ PZ. b Z0S Z  L* 41`ZLD @. hZ0#S Z  R@\K 0@, "|@@"2@@[P 0S"2Pt):(P|xd -L,Mp`@ KD0K< 8 @ 4 0 , ( $ %PDP@  0`4PP @TDؼDԼX -LMp@P `p08K8 (P , 4` p7K0 8K (0S (H -MLM Z,   4 `a V $ 0P@Q rX1X1 - y$Pp' B^KPEPE0$!W<@a~`[~V INK@D@DP 4: S  R 0 >0 ,0S ,Pt $R 0R\ 4 L  8`o(P -LMh@pP` 04K4 $@ ( 0P `3K, 4pK $0S $墢d -LEM@pKK, 4! 嗾K081 HP@  #R 00T-* R+ R) R' r0 0  R r0 0  R0 Qh#0000ӑ000\*0 S S S0\*0 S S 3000 \ *0 S S\*0 S S  \* 0 S S S R r0 0  R> \*00 S S SP\P 0S ``)Pz0+Sd -S D 4zP0+S0 -S HPPUb ?? UP[|,0 S t,0S @S 'P K?Kv*`0S @S K?Kh*0SP @S  4.P`8~ 81S  K?KP* 4t8 0SP @S 8~ 81S  K?K8* 4\8 t -LM8KKPp <, PP `P@ ,0 S ,hP/K%>KH D LB @B KH L @B 0S J"00J@8ŽJ@V:`P@ 8 `<0$=.`800馎a0AS,~ P~ P~ P~ P~ P~ <~ P~ P~ P~ P~ P~ P~ P~ H~ P~ P~ P~ P~ P~ P ߞCp+WP -W=WD =W @ D 0X0C S񟗕0 p p $ < T p 4 < IPI@ Y 0 Y  X V:H 8 ₡ H UP@Q 808  c 0`@C<0 `@D 0Q0+W00=W SD  V:H080⃡ H0 .P@* 8 0 l8 `@C<X@0 y`@ V:H 8 ₡ H P@ 808  c 0`@C< 0]`8/XD=WQD =W VD :H080⃡ H0 P@ 8 0 l8 `@C<0 6`@Q V:H 8 qH ΍P@ 808  c0`@C<@0X `0S ,S 008Q8钀:I8tI0'@-gQ@ =Q +Q -Q \ XQ0R0- 0+oQ uQ\00@ ! 0 00 0 +^00 -^00 =^000 0@-P 0+S -SXS S5 0+S -SXS @ 0-S" +S XS00 T-00@P^+00P\ X00P0  @0  @0!* --LM p-P0LM@`P8 4T  Tn g됫H2 - 0p@L` GPP0S @TP<@ -L 0Sp 0-0@SPL(( 00 00 0-0PS@L傌PP~ PP0P -LM0`Sp (KgPP (QC 0#S@ S> 0 S RA(  #P0e(0 (xP@} ( (0PP,P@ P0 S S0 S S P0P0,K ),0S ?R0Sp0PB U 0@S  R00 RZ@ T 0S 000 ! BX @ܰP@ PP 000  bG0@NG0@00㚋P0P 0Vp0p -L>0Sp\*;* -LM,4C8̓ <.K #h, ?KKK@D3 0# p @ pQ BnK`F `F nʞ<1$K R@ 0@S 0fS5 B^KPEPEbS  @T0S(0 S (ގapW0 Ƞ0S PᆉU ꁉ*P, !x t@ -Tp`LP6_P@ 0S 0S0S >p -p`LFPP ᇩP @P P 0S0S p 0-@P@0LS00v$ 0000ᥬ\p -LM(@0S0 00\p -LM0St (K Q@`Tg ( 0 S RL0L(  S *(0#` @Rq LPU`@50S0T`ÅậPP `0 S S0 S S ᫭P@00TP@ 0U ` 0S  R00 R@@TP U 0S |00x0V:\~PP 00PP@Ņ,,׫P\`dt@-Mp` @0\@X\x\@ Q $Qq0 0  R#0C'  Q .Q0V42:ЍQ q00  00S 0gC R17 1RTq00 D R q0 0   Ra0LA0L** -PLM`p C000@,K0K 0 , ( @@p0 WV0000嵇PP0  0 @@p  TۇC0@ՇC0@* 0-! L0TT!P@CT @@ T 0C0 0 -LMp`P@匀T U=0S0d0 @ȥX00U@ <:((wt"qvC -LM@(c[@T0 @\ -LM, ,D0 ` v00  R-V`<  +V< `YY0V Y0V <Q +. 0@K  0O@K 0 K@@K V0KP@@K <00 KSP T@0PiPepv$B 00Q0`Fv  00Q[ v 00Q7 FW F` VM\< R& 40S 8@T80 W V00S NB"00`D@ 1B"@$$pSƏ4X004 X 80W8@<0W V00S pD@ 0B"@$$pƏ4 X000Q \,0 J00 K\0XSxS`I   B00! RA R0000000000000000Z]* Z* ?0-1pQ LR@` 0S 7P @@ Z0@< 0n000S@,,0) ?0-1pQ LR@` 0S P @@ Z0@< 0 000S@@@D) 0-LM 0xr.0l@hPTX0 RP 0 PP@ 0xXT| p-LM@hP`\ 0 @4Tp`0@ Rx 0-@LP 00,@r.0  0hxXT -rSLM"0@P` :rAp 0P gA0pbA p-LM@hP`PM \0 @4FTp`0@ Rmx 0-@LP 00/,@r.0 ) 0hxXT -rSLM"0@P` :Ap 0P A0p A p-LM\@0PSP`PP ᒨ@0PPPpPPp| 0-LP(P0@P @0x p-LMDP0@S8`p_$0P@@@˄| -@LMhx -LTMF\` \ , d h g l 2%0S U@T %0S :Sd P0@T @T@KC\d QR dPPCDCPP XK 㫫X0S p00R0Sd@\T00Q00S ` PT0PS l  R T@0,S SS S UP0T0 UP004D,0 S 0,yUT@PPh@T P@K0h LK@Ph Uh  LpLP Lyh00fs`V tCDK0\HK P@KLK @PULD0LP 0H3LK2 P@K@P` P: h0S@- ԃh@ )R 'P  T 5P@ 00CS0 0Ӥ0 P p 0+S:P P P 㻤P TKB\ d0@RSA00崪h !P㢤P \QP!00 DQ0SG d0S7 ,0d LKP@K@PPP LrLiP0T@KPT BB{BPP d@T XK⃪X 0SpR`@@K` `0H0 eP|)]"**$* -LMğ !  \ ,    !4@R@ `h4@K K 0  K K,K  K K K K KV0 \0 x X0 T0 P0 H0 D0 @0 <0 80 40 00 L 0 0 |0 t0 p0 l0 h0 d0 `0 \  !@0pCⅠK  =cPP.0[  R) R' T*00K[p20  00S  Q"0000ӑ0K[ Q"0000ӑ0K[00m>L0@X XKK, PGK _K [K WK SK OK KK GK CK ?V0S 4x!)?l0S3 0CS/,>u@41 ,0S 4,m KOp>0S  u WK@P7KXKL00L0 60[S0X K60K#:=00HEp`= 0(  R 2 00( -L0Mp0P 0 `@ LKL@KD00D0 Q Q =00 0 S 8 , dQtt,t,t,: Sb0 d Sc0 ] Sp0?0 0r0-00w0-00!=@SL CS-0> X! r0-0 0w0-0R00 &R-0! !r0-0 0w0-0R0 R-0 00 0 R 0Rt0T0x00 R 0Rs0S0x00 S ! Ss0S0x0 Sd0 Sl0  S-0 Ss0d *K**%*o* *R0S 0S0S0  R00* -MLM00  0`5`~@t -L M0`S$ p  :S0 $0 0pS PK%t:l:\:P@ (K ڢ(0S p00R0S :P@  â(0S p00R  R W1 $ 0 0 :|:l:d Q T1 R 0S0<00  00  0 R 0 R0 0 0S 0k:g:P@  =(0S p00R0SP XP:P@  &(0S p00R0SP$| -4L  0PP 9`Ŷ@T T 0T,S 0S 7P rr  0PU  0PP  0PPP\ p-LMP0 S0 `@0 P P0Sr0X S0L@0Sp00wr tr qr -L MpȀ@0`SP(@ &\0  &P 10$ KvP(KygP  (,D0  $9r|d`L@-0S@ @ 0 0 0  -LM`Q ^( @`p$ 4 0ҲPB ( K10"P; (P6V00T00S(0V0T00SW P P0 $&@6$ 02P $ 03q$Kd` --LM -L@`p-`0 XXP׹T  8S8 $0  ƹk됫H2t --L 0-<0@ PL,,孹T R 0hꐫH2 0-0L@P 0SP0 CR 0P0 00R P5- 0 0 -PL4MPL p` 0 S@P X 0 S @P L0@K៶P\!H0KQ, < 8 4 0 p4@HP D `` @0)Sn6 0  ./ }+0U# >E0CS <0pCaH0S  j H N a 0H0 L0U 0R*0 0\){} 0-@PL0\*ql0  0!0S T000@CT00^00S 0 u -LP0SPp:qP`\&*0^S00p\*0]S -S \0* ]R S*-R P0]S-Rx \*0]S :0SS 0 0@SJ0  t0`2  00SH@TZ 0S?W"  0SJ 0 @@000l 0\0Z 0  00 0 B 0SP  h hb  P  000  00 -00-0 -  Pz00 -00-0 -  h00 ]00]0 ] h ߮P & P0S1*8  ҮP+ 8000 -@PP050#-SL [S0 :Sa =S1  pR*0-S `WW  0 00 \  X\*0]S -P0`0 `0S0%*00-S]S P*0S*0=S .0]S00$P*0S0"*00-S]S 'P *0S*0:S 0]SP*0S05l:o h -LM @$Ap\ *P q00  R@ `ePi P0S PP PP  000   PP0S (0PS  -LM@=>0 00  0- LR@%*0S*0[S 0 0.Q00PQ*0S*0.S [00]S00Q R* -PL@  R)* P*0PS 0]Sp`ePV , _P0 R 0Spx0   0 R PX 00p , 00  RP   p-LM0K KP` 0 ]0@K0K KhP`p -0L `@8pP Put00  00S P h ]0S04  4  p-LM0K KP` 0 ^00K K]0 @0K K$P`p -LMP`@p0SGT1 T00W0 W00SiPPPPP$PPPPPP`x` f 00   f  f5"  A,  i f0   f  f"  A    @`pG f 0  f  @D @D`q0 S  -LM P p0 0@W` 1R Vg@0S P0 g0S 0S @`P  R Ϡ>1*!">00c # Ϡ j @ gP@ 0^?>1  ^0g0@gP@ 0@0gp@-0`@  ^R *0 00  n^ :0E\  00C 0p -L M, p0 0 S@"* 00T0R00S P*`P0 00 R0#S P: P @ T:`@ T*,,0p-0 R*0 R:@-0@P*0  \: -LM@`p值0 00R0fPU@  P g i鄹 0S  Pig(g- 00/>\ 0S0\ 0@- 00>Q\@ 0R0\00 -0LS8p`0S PU`P 40PU040@0 S @TP -`RL@PpR 0!(000 p-LM0@S`P 0\ 0  !p/ p-LM`\P p@  A 0S0 0H0SHP Z  e! B 0A0S 1>3 01 0-0@SLP0 \f0S @ 00h 0-0P0@L Hf0S 0 0 00 0- LR@00>#R0 (R" R @0Q@PR@P0eP< @Q >3SAQ 00@0QLR RRL>31>#R R "RR R(00(000S0 0>3S S S\(00(0 P L -LM 0R  @T p0R000PP P<PheeeeeeE -LuMp0 (, 1 8eP`` 3ePPR 0@x1 0$P}K@{K 0 oK. ́ ȑ q wuK $P? 1 peP@ oK 0 ,0S ,jj0 D10See H0 @1e 0(p  -LbM⸠0JK(0 嫃p @)@KpZ_K` P TjKjK11 P 0S(0 S ( j -$0L!00  -LMpd*t;*8*P5*2*/*3,*)* P-L h/00 -PL`0\p \=|# 0 0  R3 @ ph P1@rT%0\ \|h3  00SWpG3 /\00\0S@.\ \|3  00S0 0/\@- \ V t0j T ڊ>j1!W pG T (00 0S @S@S@@@0j!T@QQ10  00S V؁P@ h P1@0\ \|1  00S\ Tڹ`\!\1g0XSxSQQNq$10  0D0SE W0P 0\6 \4|00  0D0S+ |  0 0  R \ 00ӑ@ ឲdP`a\ h000X0 WpGk 0002XpGHP\(< -LM0  ; -L M@ 0@+R*Z* -QLM  0K  0  3 0-LP@|p Pp U T 0\ pP UO ( -L>==========>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>P 0SL0 SxP\0R` XRP 0SXX$1H@0K/BA@K TP@`  l@D@KTE c @ K0M0L0 L  eeL 4[#[[#Ġ"!D ȠȞL,Ƞ.$H0@ K@ < 8@ +4K0K 0DPTXVUUU -LM, ZpP U`@1, 4$PT` U@J0VZ @P U0 0P U -p-LM`P@>KC/JK X1 0Q ,Q _?K A xA ZD0 bKd1 t DQ ! 0S +cp?\{*߿* -LM@`p(]PP: 0@0@@@@@@@@@0$` $0 P oP@0 hP' 03`P,YZ#| WP ` 03$0  < P$00$0e]]]  `ٲ0S $ )@TD0 003$  3S03Y`` 0SV,0`@,@ ,@ B00|;0 0 -LM( Dp$ ` / PP P Pቲ@ (@00 00 0S p-LMP`P 3@S0S0@ ]3S]P(P#\$0 #10#0V@@T\0p\0`P`{$0`\ -@LT` $0* 0QP3 Q# R 0PU@G \3S3 3S S  $00 S/0/R@0( D  P 3S 03$0` P3ա 03šv0 #0$0@eP$0 :.$0Pm\3s7 0$ @Q$0@ 0 S003BP $0 :P3 $0p 3P 4 0@/@$0 @2 u0\  @@_Q $@ 0 0R 3 P0 3L00 P  *PP$0   30P0K0 8P3 03 PU 0  PU:$000# 0B8S 3S  $0H P3ԡ 03ġ0 #0 } R-#L 0 0 :Q0-Q@@TLP`=p@$0 3C T TP+ U$0P:$03PS0 /R $0@  h ·Pp OP6K00 -L,M , 4 `PV , R0H0  $ 0S0H0 L ? ,0H S@@PRP < <0@0 4 $$00 S/RA  0T0 /00TT 4P #0 ph0 D 8 Z NPP $0 0.S  P@y Qc*D #  00S$0H:<0S HQ 0 03#40000Q08 8@ @0@ 8@ H R L0S P P $0 0D00$0D00 H Rں#0B8RSH00CH0 0( 0 DTZ0{ $40$0:$0?00puP  W $0 P T 0phpTP{Z0S 4 03$0:$0aP 0S[ 040. ScU P0SA$0 0YXT0AT T 0@0S ,YQ4 3S#$0 Y 0SY00 0 ,0S4 # P 4 #$0:$040 0`0' 40VP @   4 <3@ 0300 <0 @400420#4 0 BH  L ,0S V4 #400} -LpM$0@0PK@P0J c:P10: S S 0  S00D00.S, 040  3S,0Q  3S000P0 E0S D040. S00`|Pp` p L 0 0pkP w00 -0LRP@` V P  0 @T` 0@T000(00~YPpPppLY -LM$0HPPp`YP@ 0 $ 0I00D @0(`¾0 -PLM@ @YT 0-00L@ :0S00?0 00Y0&YPP 0S PX R D0P00c00 R3 SD0Q00c000S0 3S 0-@PPL0!0UP1S -LpM$`@P R KPp 0 0R, 0R p00V@@.yp  ޴PP -L4Mp, &$W, Q< , R0, & BX 0BX0 嗃#(R@40 T P?4 P0`Y 00  Y 0AQ0 X`P&TP @0P UR PUJ P"0Y<0 00  Y 0L\0 `g@g' 0L\0 Y 00  Y 0L\0 P@g< ' 0L\0 < RV 0 b0hP,0P㗃#40 Y0`; 0@P0 4@d0fgP!P Y0` 0L\0 ^ Tჿ4 , d/|  0  0L\0  0@P0 ʿ,0T`P0 0V*@T%Pg PY 00  Y 0AQ0 @' 0AQ0 P`0V: 0Y<0 00 0 0  0 P Y0 0L\0 0' 0L\0 ' 0AQ0 4 4P4 P4 40P01@80  8P@ Ph PZ 800cD0 @ 8PP? P10@4 ` aH 84 HPa P4 P4 k4H H 4P4 PH4 40H P D D0P0 PD D0P0 P   P P  `0VL *@T%Pg PY 00  Y 0AQ0 @' 0AQ0 L`0V: -LLM` d d@` @d@ h0 \`K$ h0 PpW:` <Q U@ * 0dR @T`05<5:T 0 00` 0 0Pp$0(0,0 0LPP d0S`@H0SW 0 P0P00 d\ Q D0^ "0D0^`H0S0 t `0L R0Sf R0S]  0_P@ E U 0 CPU 0; HP@ d\ 0hc/0cOdP^*hP@pD0^ 0  d0^p@P:PP{UyUTPP\oU 0U`@L  0%0D UPc`H0S[OUMU`@0\ PPᙪp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  ᓵP   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0| -LM0Q, `Q0 AϠ lp 0 4 00XP40`l ^0p U40 @  U V  Vs T e42W  U' u "0 0Q_U  V v 00QF_VD  U u!0 0Q%_U# A?G0CS >2,0X  R 00  @P4  0  @0W  V v 00Q_V pp0  @@DTʎ0 00\@\ d0Wpp~ 0w0r ,@pn 0g -LM, 0 0Q0 `Q0AϠ l040 0PX`lp U@  U V  Vr T d02W  U' uŸ 00Q_U  V v!0 0QE_VC  U u 00Q$_U" A?G0CS4 ><,00  X^4 00  @P40  @E0W  V v 0 0Q_V pp0  @(@DTʏ0 00\@\ d0Wpp 0x0s ,@po 0hG-Q0`A $ P !>3Sy < S7 S S S Q@3"Zp0   S S0ZS S S0>#0S S S S "S>0!># R0p !>3 S >3 !>3 S&S S\0X0>0400 S2 aB0L~ -LTMd h h@d @h@ l0 ``K$ l0 PpW:d <Q U@ * 0dR @Td05<5:T d @@Pp'PP$ 0 0( 0 0, 00 000  4  0SPP h0Sd@H0SX 0 +P0P00 h\ Q D0^ "0D0^dH0S0 y d0L R0Sk R0S`  0fP@ E U 0 FPU 0> NP@ h\ 0lc/0cOhP^*lP@pD0^ 0  h0^p@P:PP$OOOTPPYO$O ^Od@L  0'0DNOP^dH0SV}O{O$yOd@0\ PPŤp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P'` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  `P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0| -LMp, 00 Q,(P4 0 8 0 Y0000AϠ0 P0P 4a < 0Y04 `5<0P 0 V<0 @  V X  X T sp2Z  V' v\ 00Q_V  X x$"0 0QT_XR  V v 00Q3_V1 A?J0CS$0, Y00R0S0 80 40 80P1P<  0P00 P P0Z  X x 0 0Q_X 긠00 P@DTP0y 00\@\ d0Zo 0h0c ,@_ 0X -LMp, 00 Q4(P4 0 8 0 Y00 000AϠ PP< 0`Y V @  V X  X T 00 P@DTP82Z  V' v$"0 0Q_V  X x 00QU_XS  V v!0 0Q4_V2 A?J0CS$  0<S 4< P ,Y 0 80 40 80PDP< 00 P8P0Z  X x 00Q_X |0wX0X `0Z@n0h0c,@`0YG-QM@p(,P >3 S C S> #S S S P@Ѝ3"Y0   S S0 YS S S0>#00 000S S S +S "S 0>00 1>3 S 0   0S0 `>3 S >3` >3 S 0&S Sy`0\00 >00`0 S00h0S0`@Cca@-M ^@ P`pX\ Ѝ(@ \@Ѝ@@Ѝ@eE1D* -<5L|MHK0 @K0PuAe/@ L L R *0S0L  L 0|S :S 00$@$@@L KPڄL坜PX00 LP`: @PX0L0P K@X0pP0<T K(@(0T0X K@00X0\ K@,0\0@L K40PL d K@p00, d0h K@80yp408 h0l K@<0op6[>lp K@4gp7[0Pt K@4_p7[04x K@4Wp7[0| K@4Op|00 K@P0Gp00 K@T0?p0: K@07p0,K: 0 0K 4K\TLPX -Lp= P@ dDP`$ d0:SS ^S \S $ @^ 0:SS00f^@A`4EP`VEPfd(EP `d P00:P\00BS1P0C@ 0 0/S7SB0@@2S?긥ĥ̥ԥܥĥ̥ԥܥ00:00 0 0 00T 00S:S00ov -Lp= P@/ dHDPP! 0d:SS 0`e\d@ 0:SS00e\@APDPPU]DDPd P  0-LP# P 0R @ 00B SaBQABW0B\70BS>. 0 XRxR @@00 :S0-LP 0:S0@0嬖@0- 0 Sn@S,p -LM K"応vtO*$* -LM0`=S`pPL,KᮩP@; U@ P:0P00@S=S 0S=Sg! P,@CP 0 ,0RA 0=S 0S0 0=S=000P0 @0S 0S` `00cC QCP@ 0 0S ,0 @0@, 0n` p-L@`M@PKAP 0! 0S0 pn 0-L M@ɘH0P (0 $ 00K K(0@  0  ,P 啥P 0R P* BL*A`G*#D*@-@0S  S 0Sd@(/*()*Q0 c 0c$h*$%* -LM< 08 rSwS@T 00  B, ,0SZ 4K⮝PTpPH P < 0rS <0Z@4冼,0@, P,00,  4H@00@T 0m@T< 0rS 0d4P 80M4T0@4PT 4G0E,B,Bdp -LM☀@`T 0S `@TT $pK pPp0S V0000uBu$d -0-LMP0 S@   R1 00 cQ  R!,0 嗶 0S }G0n -0-LMP0 S@   R1 00 cQ  R! b 0S HG0 -0-LMP0 S@   R1 00 cQ  R! 0S G0 -0L n -BMLMh#0P,0 0L4  0S 00,3 ,0S ,F/PL$H$ K堧2P@@00 cBK J JH MK@DPpP 0Sr`0CK0A S A P2D4 H2@ K0C0C0  A  ᦵD00C=S񟗗 |||||||||l||||||  ||||||||||||||||||||||||||||||||||||||||  0 S  1S!00 c0V pMC0L4 dSPnL$R 060S3/qn@-@^  0 S SS00N0 --L ="  0-LM@P0S 0鼕0S 0S  \ 0 @@P -LM@`P峓P pWMW0S `U @YT :0S e@000@0PTP:@T TW@PP   0Z -PLUp`@: PP@ U:` `       --L p-LM@P\0X T`(T < j!000 ? phꐫH2tP 0000ӑ  p-LM(0`S/    P00 00 @T_Q <0@T_ p R 00c@_ 0(pP@ u0 0 -L * -2MLM#0@,0 q0/S  P BKAA ˔+ p Y W3*WY 0P/S00@83 ,0S $,D/ 弑P<P"P@aTnK`F`F ؤ0Z0pd  哨 0 S/R  Rm/0 0 x2(K RW\᭑P LᨑP@ Y 0C/0h@+l!PBKAA߽P@L<: S< S0< ?nK`F`F!PP|1@(K /R@ Y!Z 0 S/R 0 S*>K0C0C/  +. Pp* +8p?00^ 0@C/]0@h>00SZ I, D\+>00S8 B>K0C0C+< !4} -PLM Q    0@+ @C5>PAp .0@0K+P@ `00  I @ K4P@  Q00RPPU<0S :   `>Pn 0g`0p00 .000PP_ KPZ/000S| _PUl 0.S`   ⪣KP Z 000S0 S0 @c0Q00TQ8  >0P a 0 0@b 0 :@ Q /00b  00b0 hQ00 0rQ =XC ="00 0S 040. S0SZ 00PP 0 S/00a0 a = {0 0;0 H=P   ( p-LMP `V p 0@ Hd=b=`c -LtM㥙p@  K+P`0: S ޶20 0 ㇱp <PP ;#;S + <Pp  P`  =ᴶ ᰶ p-LM@<^<*pUP@P7 P N0 S S0 S S TP`@ 0 SP P`+U`T 0S  R00 RPPU@ T 0S PX000 R X0W@4TP@ P^P $0W`4(x\ -L(Mp젟0 S( PPP 0@`8PK P@'P00 -H 0P<00Š 0 00 RZ -p3L4M @R P,< 4$ <, !4 $,̃.4 8  40Q 4PC7?#/r`Ÿd 08P 1 D` &vH `0# 0DP8XR0zH/HPj $"@ 0,004 @ @@ 8A0 Q̑,0 0 < @A< 0,< < `1020@<#&l/4 L  @ r bP P@0!1 @0f 0 vT0 H ƠT 2 ?  j ̜0  zL X >XΞ    t@@0p!lL0\S@0 !$ 0^A( @@@D@@@G-@M`@<T8 40 ğ0,`0#0c0, `0cC 7?04 #/(00 ( ~- 0 ~ " #~5 ~ !~7   ~9 / 00, ,: "#:0:"&!*  1 !00H,x P `@p` Ph%%),%\P0!ē @ 1 )Wh _)| 0* 0 ` 0+p0 `08000 @`@1p0lPz0p[0ˌ0 00400@Ѝ@@N@n@>@@@ -LM`0(K\p@P.  ϐ($ 8 ( #"., K00K, `0@,<4 Ġ̌(<"4!Č <.̌ (0 $ 娐t  -LM0`$S@ 3 R (PK0000e@SP0m _Rl zP `P;@ ZP@P5@9P-P.@0zS `S;0C ZS@S50C9S-S.0C0p 0@SX, K00KUPP2,pŸ * =? 0 7?0  ?0 4 [,  9?0 &?  3?0 ? 000  6?0 #? ?00P 0zS `S;0C ZS@S50C9S-S.0C0 Rp 0zS `S;0C ZS@S50C9S-S.0C0 Rq0S  0P0S 0 e0#R0L@0SP0SH@ |~@a 01S   @-!P.*@0 S0ԧ S ԧ RQ 00C210P*0SԧQ <0 C120P *0 S ԧ R 030P: p-@L$MaP2 ` 0( LX%X@ phH -LMp0@P 0 0`K 08#HT UPUP#08  0 S  .,P -BMLMr0D`K@P ,0 02S0$S aS@ t,0 S d,.@0$S H KR K0Y@~ P TKB~AK`Z0(H K:K4H  K@TK 0i TN:B]KAKx1 (PE(I(K @PE6I @T@ @?T@BKCK!"41"",!1AK1@TPZ$ @20@0  @*K0 }TK O~ rK @TK  T:k`d |HH(0@-"Q*|@P0#!0\ "0'*0#" \ ! *0##? 0 \0:00000E-0``&&&C&̠O 1t@X 00#0P 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 0$0#0 0#P%%%C%̠O 1@x 0(0#0 0#`&&&C&̠O 1@x 0,0#0 0#P%%%C%̠O 1@x 000#0 0#`&&&C&̠O 1@x 040#0 0#P%%%C%̠O 1@x 080#0 0#`&&&C&̠O 1@x 0<0#0 0#P%%%C%̠O 1t@ ̐0@@0#D 00#P%`&P`E-D0``&&&C&̠O 1t@X 0@0#0P 0#P%%%C%̠O 1@x 0<0#0 0#`&&&C&̠O 1@x 080#0 0#P%%%C%̠O 1@x 040#0 0#`&&&C&̠O 1@x 000#0 0#P%%%C%̠O 1@x 0,0#0 0#`&&&C&̠O 1@x 0(0#0 0#P%%%C%̠O 1@x 0$0#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1t@ ̐0@0# 00#P%`&P` ϋH0@-@P!0\#0 0(S"Ƞ0 -L0M($@KP"h0dp 0 8#x "W 0@2K,0 00 p,K0K  H,0 0("x00W0p@d  608 0#H,0T108#xW -L M((KⴠPp@"hh   0 8# "Y 02K00 40  z000# 00 s40 0#0K4 K40 00 0("04 Y @  X000# 00 Q40 0#0K4 K40 08 4#H00T108#Y p-LMH`P*$H ph? (-"xPUL`@: 08#XU@: (-"xPUL`@: 08#XU@: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 a,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 d,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`5*0K0 0#0P0 8 Ƞ<̌ Č40 ,K ,0 0 ,00 ,@[0P[p##Ġ"" #8"(W0@ P`: -`CL0V Mp@CPC,K0K6,K0K08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0Q`FVPE@D08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0QR-D?0 \ !Zh  -LM@t@ğ0 8`, My gP 00 0S$S 00R5:0PK c 0y *y K y  y 'D\@ @'(`@ ?0(LX\ @c@@ '<@<@ (H<@ [H@ @D@ - K(DH [P@ @L@ . K8DP [X@ \/ KX [@@30K`0T@ 0 KP@ L40K, 1K2PK 84K ,0(S(h ,'  0-PL@U !", 1#80!"$ 11PX 0h0 -LDM@@ hK⼇ p0(h0 0'00 * 霠 d0  (  ly 0)pgz p`00* 00H '臠\  )  $0( jX 0 0'00 * 霠 T0  (  x 0)pgz pP00* 00จ '臠LP  )  0( jH0 0'00p * 霠 D0  (  Lx 0)pgz p@`00*00)COH臠 0'<00) 00 ( j8  '  ܗ0* 霠 40 0(00w )pgz p0  *  0'臠,00)00pd  j0*00(00LP 靠 0)00*00(w< p{ p 0'0 0)00hh0(0 0'00টT  j0*00(00༖X 靠 0)00*00vD p{ p 0'0 0)00th0(0 0'00T\ j0*00(000H  靠 0)00*00 vp{ p 0'0 0)00셟4h0(0 0'00ȥ`  j0*00(00कT 靠 0)00*00uH p{ p 0'0 0)00\h0(0 0' 00< j0*0#00 < i 0)0#00ud pz p 0' 0#00Xh0( 0#00 ꤠ0*0#00औ4  i 0)0#00thpz p 0' 0#00dh0( 0#00H ꤠ0*0#00,\  i 0)0#00 tPpz p 0' 0#00샟D h0( 0#00̣` ꤠ0*0#00ଓ i 0)0# 00spz p 0' 0#00t h0( 0#00T ꤠh0  (  0 0 i *s pg{ p00)00舠T0  '  ̢0 ꥠ( ଒\ i 00* 00r pg{ p  )  l 舠d 'H0 ꥠH00( 00$ i   *  r pg{ pP ) 0舠400' 00༡ ꥠX0  (   i <* tq 0pg{ p`00)00P 舠D  '  (  0ꥠ    xjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆm*#j*g* -LM0p@ LP 00 00B S0`Ba0B\W`BA0B0S7`B R Q\S P Q';;;; <;;;; < < <;0U0P:0`d00c0CV0`ąrppp0d0C0pp -LM 0@Q`pPT*.X0 R0""00 0PT:400 30 SP:00d  -LM0@S 0000 -WMLM0@P=KC/NK, h5 @A (K  2@2  0IZSlAT_T_AT_T_T_T_T_T_ABT_BBT_HD\D\D\D\D\D\D\D\D\DT_T_T_T_T_T_T_T_T_T_DYT_YT_T_T_T_,TT_T_(K *Y 00I SP100PC0 I R$Y 0U@@22R SK).K?K .  00A SPڅ 10 A0 R0PC$^ 2S12 2P  0U@@" B\ R \ 2PB K).K?K 202 P100PC0 I R$YR   } 2S"12 2`202 VgTB   00\0S㬀K& Q; ':Q <#r`>(K VR  "202 @"PaUU&0 "2 0RPEK2 " pUʄ6( "2 0R2 " p>(K R ?K 0C0 20Q2  pʀTp PfUUhE00@ "2 0RPEK2 " pSU0 "2 0R2 " p@ʬ" n` "2 0R2 " p\ʬ" "2PcUUş00 "2 0RPEK2 " p=U! "2 0R2 " +ʰ2"R2 S0K 2 K7P P ?KP 喫02 0@,0 S ,8!KP PK KPKeYU K/ PQ3@ "2 0R2 " p>ʘ"2R @ "2 0R2 " p$ʜ2PCUoU C00@ "2 0RPEK2 " pU0 "2 0PPK BKPKKP{K"Rڜ2RS20 "2 0R2 " p>ʘ2P`UU6A00@ "2 0RPEK2 " p!U0 "2 0R2 " pʬ2 p1 0 2Q02  KhP0KcPK )AKZP"K20 "2 0R2 " p!ʴ0 0 20Q2  p K 0C0K@ "2 0K*PKK#PKH  X  0@ "2 0R2 " pL@" "2 0R2 " p9ʘ2PcUU1ڔ@00@ "2 0RPEK2 " pU0 "2 0R2 " p 20 2"0Q_KPKPK \AKPKKP~K2Sgڤ1. (K K0 "2 0R2 " pN Kz/O P 20C0 2"00CQ2  p ʆ?K0 "2 R0 KzPBK2PCUUڤB00@ "2 0RPEK2 " p U0 "2 0R2 " TPK $CKKPK00 " 2R0K8PK3PK C P`UU'C00@ "2 0RPEK2 " pU0 "2 0R2 " pkڠKPKdPK lDKPKTQ K00$0(0K0 "2 0R2 " ?KPK'PK % >&B`Ph( K0h`C1!`P0h" 00S00 0hV0 ~p0h0 %o`PV P00 U- >(K Pu`  2"S 12 2`0" 2 ~ 2S12 2  Po " l2 "  2S 12 2 Po  W"@ 2S 1 2 2Po"  2S 1 2 2P2S"12 2 2Po02 )   2"S 12 2`0" 2  >(K   2S12 2`  " 2" "  2S 12 2  P` "@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 202 P`    2S"12 2`202   2"S 12 2`0" 2  2S12 2  P` " 2 "  2S 12 2  P` "@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 2P`02 X  " "  2S 12 2`  000S" "  "" "  2S 12 2  P`"@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 202 P` 2SK 12 2`  "  >(K t@ GYgYT@y 2S"1 -K2 2202 -K$P K/ 뤃P- >(K ` -K"Px2KL -K<KK 2 GYgY|\ggYEeeY"fY \  ``y?(K R- >(K {\0l``\`T ` 0`L K #2 S``2 2 KS12 2  @]"*" l\2 0 z Q 2S12 2  2 @ 2 KS P12 2 202   2 KS"P12 2 202 y   2S"12 2 202 c  2S"12 22 /202 N0̿2S 12 2 2  092LS1x2 2  P`" 0" 2 x 2S12 2"0X T "  {P `hV`k`",9D $Y K >(K`2S0 2 KRP 2;&KHPK0S"O 00 -LM⸉p㴐K @4KP  , 0 4pK3pK2pK1pK0pK/pK.pK-pK寀T9K  0Pڸ0@%SP@D @ 0AZSchhchhhhhhLbchcchcccccccccchhhhhhhhhhdxfhxfhhhh`ehhlehhhhhlehhpehhhhhhhhhhe dxfxfxff dhhfhfpe(hLhhThxhpehhpehi 00B S`ԅ100C0 A R$Q 0Z0 W pKK0̠ P0 @ W p ̠pKK*Q 00A Sh00A Sc 00B S`ԅ100C0 A R$Q0Р P0 @ W p РBKK <100C0 A R$Q 2/  0Z 0 W p KKh 9  0Z KK[  0Z KKP 0Z KKE@ 0Z0 W pKK50Z KK,0Z KK#   0Z KK   0Z KK  0Z KK 0Z KK@ 0Z wKK0Z nKK 0Z cKK0Z ZKK hR @y lR t r  0Z BKK 0Z 7KK@ 0Z ,KK  0Z !KK  0Z KK  0Z KKz0Z KKq0Z KKh 0Z KK] QW>P$0Q0Siiiiiiiiii(i(ii(i(iiiiiiii,i,iiPP^ 4 K^ 0K00 p,0 S d,PȀ40 :xĐ H  -LM`PQp0 @ 0 x @|@  b-~px l( -LM @`PfT40 p ETeTpG/  P090 ,K0K0RtgTGTp400  fT@ I P0@ 0 R*00SC 00 0:0 g 00S 0@8 a P0h0b -0`P -LNMp0Q 0 P-0 +0a0ŵ0ť \00 K0 ` l@,/C!bL0 Rn000n^*0^0: 0eR  gfff0 0-L@!0RP0L1 0 000 0P 10 -`Lp@P8#8S"!"81 ("((^ XU 0V1`P` !@ xp -Lp B/ bR@P`0ڃ0Rʙ V0P0 P @@ 0 BPU@UPe 0 BPU98 88S00000P0   0"108#8S2 "$"""!    -LM@;00@ -LMp`PW, `pP 00 R"0 0!@0 < 0@ , R40 @*004 T:aPX8` 4P @9*0h&hV 4@ p(8#8"(2, !#, T x:p0#h 4@ pP %82! 8"(#8P2! T, x:80X:0 @0R<  0>S000CS00 0>S 00, 0, -LMPp&EQ @T` P 0`S @c0`\0p0J@`0 1pq$  -LM0b 0PUp@ڂ Ul R0  R00@ d 040 Q2 :RP 0E0e0Q0: P!0 <01R\3# -L@PP`9 @P``!p0@P `a(8#8"(0b! aL8U0CȠ: T * 8#8 "(L8 T0CȠ:0>S0>pGS p00`@-@0!"** B\0l Cʠ\7SL l0\20 -0pQ`5L@B 0` P0U 5 \ lU2><``6> U ` 6> 2.0 -L MP@4Q6%z00 600 T`,@ ' ,KP0 ,0 `100 ,02 0 000S  @0 W 0C>C5 `0C0 C>@0C!0B@`@0K00 0 @ -L MP$K`@0(Kp{ 0$KP N0bŒ\0 :CVP -L\M8 4 ] 04ޏxCPLP PP T T0  q0 0  RT  T 0-S +ST T 0 S/ 0Sw T0`/RX0 p9R 10W0C10W0`CT@p /RT@ 9RRHp  @EReR@@ 8L04T  T @04  +RT0  -R 00B S4T #0R 10BST0B0 /RT0 9R T@10 0C/RT@ 9RT@!0aPS^@ ` @ W @@ @lH@@ \W  H D IZD0 SD@00 HLNoIVP@ 0 aNWl aD@@0dPU 0 uNPV MU-'"00p0lP dwhupslqto8QT  P0 SrN<0 ||@??ER$ U@ L`@P 0 3NU`ʄ5I1 0 'Na&j0jV0Vἐ5XH 0`l l l0h  ! it , K00K^d @@p T@,`l0L! 0P`PCP`P`^CN@6@lpP`U࠱ࠡ^ࠡ^pn`nPnQpdp @dd@ VdGd Zh h Uh;h Wp5p hdt 0< 0pcP tpM/O P@P).O MP@<p`Pp`zP/O bMp`*3 Z] Z/O pP3.O LMzKOH<p`\p` x0 bM 0 7Ma&jjZ dhhfpdtb<SK(H0 2MP@<PX46S / FP/ 0P - 7P`K5I /0 M 0 L1#:x":S5h2\ R `@t<\ O0p`qX46S X N0ndYl"0y\0zi/ P . LP@F[O0<0S, 4`!6S \ <@T 0 LJ/ P@PH  0 L>x1#::646SX1#::C (< R%X#46Stpt 4P5?55?5???|<AMPe ,  wMP@ ERUlU@ p`@P 0 LLU`ʨ 1 K 0 ?L`K O P`` K@K0 L0 +L.O P@P5 P@P Pg@0QtA 0 @ n@ L0 @AL 0 @qt@  L M}/O KP@[/O KBL  40T0 T 0RT T@ T@ TW T 20R) 10BS0BT PX QP U EW !p₠1W`^W 1p⃠W1Ѓ`PT0 T0 00B STP 0RT 0B Q@L@ T0 0ST S}0T@P T@ q -LM, 0 0 S0 J 1P,  4 p tP8P - ` 8#8!"(!82$8!#80a("(40 (bA(U $Bh0SpG W 0SpG WJ0S , 0,P1`8P 8#8!( 8 H!#80a("(40,(bA(U $Bh 1 pRpG W 0SpG WJ0S ,  -LlM4 \80 p`@W00qdz01#:H":S !. P  002Q0 0000K, K0':ც᪪Zp T K J%00ƂJ0 KZ/ l J. JW/ JP@ ER/ J0 JH P PP QX 0 PP00CP0 X 0j@SP0S@dB C`@ U< U<@ E` ES`@ d0 ` 4 ^ࠃ^4 N4 40P\ PS%Кؚ?aCoc?`(?yPD?X<S񟗹꼪pppȪppppЪܪpppppp pppppppppppp$pppp,8@pHpppPpXp`ppppphp000@ 0S`VLB0S<2  02 P@0/h2p' 2. 2Ύ 000 0 00S 00 6 0hpPPl1 ,0S ,|/Z 0000T1LQ:0@1 14101,1(10p0p0000000Pp2Pt p~lpK? 7kP@`&yV0@  Pqpi@nP T X |tpHT\ tp -"L M>@0> 0T0 ` 0Sk*@T0Z`c Sd2 R  mZ&fQ *6 p,K,(2,  R 2Pj@0T1 *jP,0@ 0, PT1:0S ojP,0 0, P11 0F0 Q 000S P!0S0 0 ?mP  , R0000@ 0f00  :j R,  0#P R,  0#PR 0#P LA0 0 0 ,0 `\ tx0@S P-L @ <0!RF 0q PRQ @`@` 0 R0!0  B8# 010 g!0`BQc R0liiP`VP@@`@PFP\  p-1LM `R@7 0P5 T00Q00SJ` t!* T|P0 RU 0 RUU00S p ]lDePዽ 00PcpX  -H3L M R0 ,3@T$f 3 R :##:S )f @ T[2 T,K2,P UP2 2pi\I \E000C@; *"*2`21 2!-0\"00 ! RSR00Z0S $2 R 00 ck0OP@ 0 ZR Z 10 % f s :#:S `hP PU,P h @$ET P, UU` !@h1ShpWPU,P  h @$ETP,p U0 00 SR0 :JR|0 R0P@  Vf tbptx8Pp p-1LM PR 0 R/0 R *0"*RPb%6 ` V#0 VpK0@ T@t0 p0@5h!Rjpp$܎,ptx -X L0PS HH 00CQ07 00:k00;lP  p-LM`0PS@'00 S0K0 0CR@0l T00\Q00Sp 00kpjP $+ p-PLMpPp`@ 0S0X0T S0 ph?0 0CR0pjjP 4 -pL0@S`.P0 0S0"T 20 0CR@0x T00Q00SLq뜻 00jJjP @+ -LM` Pp\ :36021V 0RP!*PPq Ve0`0@0@0001300p \jPK@\ " @0d!ST 21 @!T 0U '6 p(K0(@ T@0 0@fQ 10 QX@ڤ21 Ln!@X @pn*02&60 ` p`tx -0LMR@0 0 40 p R d:#:SP,K0D,<(< <00f010 pPfP,`,0`V,`  f @$ET @`,` 00PVP" '~f1 S01l7@rfPp,`,0`V,`  vf @$ET `,p 7 F RǟW0 0d aQ0  0 6 Hf01 @0D0 6 R6 RvP 0<& 0Q@0 X600HP0@ 0 8FS46  0 4 0bQ@QcՍP`400a0 5"& ,6 080 D 0 f0S 0#P` `V,`  0#Y`V,`   0#Y V<  0#YZ VD0SK 0SPC 4R4 9 ,0Sd00 AS 0 S0 0 4 P 00< Rh4   < 0#% R5052"0<0 B20 5#0@,0 e1SJ 0J#600S00  0BB#60080Z@l @qe1S 01,  00C 04#@ beP&,` 0;#;S`,` <0S<  R00,` R00,``,` ,`Vm " Ne @$ET80Z,`V^ 0;#;SW<Q <  R00,` R00,``,` ,`B P0 S%*0S P40040  0 S*0SU@  @ 04 Q @ 4 D0P P0  0P00 0 S D0P Q0 P00P0040l4 0<  4 ^ l4  0S@ 0P00Pt  gk  {b  gBPhp\ tT x p-LM0<P0C*"*2pB!0`36h1 Rb \] 0\& t!0d1 R1 0R p R 0S 00K  1@ T@0 0  ;d@01 R @T \g R \ 0S * R 0S  0S: PpgDptx8 -``LMPp !0@ `0`VQ0@JDX a0P00SC/f`VX@E_Z 0-0L R, P0SJ R 0SX@ZP P P000     D 0 PH  C/f0!tt -LM:L@0cP0S @0cP0SPt+atM -PLM\\`p@P0SpC/0p_fPUX`EOZ_0  ddt -L0M0 @00 R/(4 $0<HT`lx0 (0 $ (K, K00KKdp, L0 0KfPd 0 K0 (0 $ (K, K00K&dp ,0S  0 0 0 0 0 0 0 0 0$0 (0 0 0(0 0 0 0 0 0 0 0 0 0 0 00! 0(0 $ 0= (0 $ z 0-LtPM@KT 0K 0 %  @@ep 0 S 00 0@0@ p-0LTMP`XK <@KhK0 0h0 \0XK< Kb"@0 dK`0 \0 d0 dfyT M-L@M@ 0p`HP{ 0 p`d>PPk 0`0`KX0-0S   0G R 4 40  1@ 0 (@\`$@TpPa`8@ X0pX L H T` Pp kFXKEP* <0 0PS` 00E0 @d@ 安 PG 0d KR@@ 0000UX 0 D0D#\ ,0$@(\ 0000~fp M0-LM00 0 PS0`" -LM,ş `,  (q 0  0  5 $0 K0 0 0 8K 匠K┐K80P800X0K00 P  0P   P 00 0 X 0jXP0S0S 3`0K KP L 4 32a/@#b! XgP pj `@,,P} p-L$M00 `P80 40 00 ,0 (0 $0 0 8@K2PP T P@ 0S4p -LpHMP`Dp @p  Px tt -pP@L`r/0W@e T@@)0@"p0V`@ h0 2 `@\0@#$0$ ("("4 400g@Ix t -(!XL"x H` P S hSU H -LcS!!Q#7011A!1 ȠQS0!90KS0A0 !0xp00 cd1(0000 c( +S0! (a c0#7%c!c1c X@0ES08 #HT 0 @00, 0  S0 900T| ?A7c%c!c1cW XEن-r-p-t-x-yv-&z--|- -@pL 0R 0SZ`0 P@0E.>? B7c011N0 d 0!T 0 L0L " -/u|-p-v-x-t-Eنz-r-! !UT00P 0-0PLr/8U4@0, ,UB@0S0x t$thtH -0PL4r/U0`Sp- S  0@W0 0 R@ 0T0\ 0S 0S0S0S LPp 0@W0 0 R@ 0TP 0Px t -AMLM,48 <#h0V,0 4  P`F&B~KpGpG 00PSP@ ZH00$H T00S4P 0S`F00 ,0S $,uu P -AMLM,$p(. , "h  V, 4  P 0 ,0S ,JP`F%BKHH 040PSP=@:H $H( 0"(lP0P`F S$ -LMH L p r/0, TH` 9p 0 1d" L"0 R0t2 0<Sh2 l |2 p2 0^x xD R" P P |x0,X0S @㒟KoK%KAK  0@P񟗢`hLh)TP tQ$ Dȟ 0 Sp" ,0 S XD"0S 0@SD2 xPK00D"?WPOK?K@DH2L42  p70 S TV*00, bZ00`F@T@Q*@$?#<-"-0 0c`0, bP *0S  P*0SPlR Pp4 0 0  RP 00ӑ -RL M00 , *,p `PU 0 S0? 4` PU0S 00X: iPUJ0.S \S@TpPUZPU0S .U 0@- .R .R .^ABa0B" Q00.Q^APBa@BABa0B UT00B SQ 00\S0@B-R T0\S0B ^0*S 0.S S0S !0B]S.R000Q\R R.R0S !0C]S0S0 0   < 00 , 0 ( Ġ P 0000ӑ -OMLM@ 0r/ , kP05 - 0cPUT U U U 0R)l= K AAT !p: To!4oS- I>K0C 0C000S000@S0005\ =000@Q JY/0`00n0`A ` 7P@ h lxPpd  T7P< (K OKAPPI $< @REnK`F`F J4@@ ;P@(K R  )P&+(K0 S S %R0P S S \ \ \00\``V`@,L78 P`e $ (P1+(@K0 S S+Pn/Y 0 SS S S ,S PPP 0bSyS fS P 0bSyS fS|zH (PW$*(PK0 S SQ\k0P S S \ \ \00\@@TY`, 6 6P@`0DS PH` \ V!* \00 \PYP\ V: P P P 0S S S  =(Px((@K0 S SrUUo 0 P S S \ \ PP P 0X r0 0  R  0SMKL LL@K '50  vNN.K B0 B0C P0S  R4EsI4 R2% % P l[IT ,tN 'P&(@K0 S S U UP 1115  \ \ \ \ 0 SSz ;S`w 0 SP 5P ;Q Qq 6  0P NKJ J  GPE %4!@% h1 5P`3  Q;Q Qq00  RP 00  !PE4 l1 00 %h1 % 05l!$05  $  \@hl\@K P00 ώlO`  Q;Q Qq00  RP &Y  ! /P P PP0`30E R@ %5E $0$@ % 5 E  BPx &Pd#(K0 S SLY?P  E " I8`0S= UU`0` HPD SEH`P 0.\@SPpVP *T.@D 5PPV:00gP0:0 000,0 S @,4HPP $ENK@D@D,P.4P ,`4fHP= `p,4`0e SDpPH` \V!* R R00 R0SY P\ V: P P P P 0S S S S000 4ST1o/S0S-&1Sx t$thtL @` ;\d l t ) H      -0LMP0r/L0pSD Y@ S S@0TP S S  %P`3$K P$Q |H1  00P0S0 ^00 0 0 00T R R R @0TP R R R0S %P  %P0:0t %P0; X %P0; < %P01x t ^T`   <4<("4 <1QS0 W 0-L@PP@OT0K 0-LM@ P K 0K  P @@"Jp0 -LMKPA-M `p |20  00S3 0\ Pt A\ |0  0  R#0CU\|0  0 D R |0  0   Ra NA N.\ 0V54:Ѝ\ \| 10  00S 0hC10S 485 5d55^*0S쎑W <4<("4.<0^* R0S8<^P0S R8<4X\x\PP P-L \hB~/00h -LMP@`T,`K,pK 2P 010jP VX`@TX ,K E0V0.T00S` X   -"L$M0Z @ " P0` 00PUoS <0PUoK  0p  0S 0aPo 0  p`P v  0htK0-@_0 0-\ @0S  S0S\ -L M, ,P0 `@ t00  R-T@ +T@VV0Tg V0T ``YqqBBYp XfphX t0 0Q0@Dt0 0Q2 t0 0Q7 DW D@T%^Y \ 00T00S  d "00@\00T00SL, z00S ^,00E 0XSxS@`P p-LM`K$P PP@ 0S 0S @TxU pF00,P 0Pp -LDM@@KD`KH @  0P < 0 8 4 , CP PpL T DPP P0 CPD@0U*0S 0 @T:L 0 0S 1gAL  Pp  DD\p 0pU 0` \`T0 @*0S 0 @T:\ `FV0#0%H0% %:H00\0 S2 S00T0  `T  0T0  \`[? `00p ` T ` M?T0S00pp0pP` p D ?? D `DpT R 0ST0S 0 P 00   X  `62` V`06` V  D `0S0V V p QX DXp > pVp p 0SV X DH@@=0 S S#00T0  T0 S000T TL000pDL0 T R 0S7T0S   X p`6 ` V`6 ` V0S V PX0 0S V X : p-LMP7.@P`0  j>0p -L M, ,P0 `@ t00  R-T0@40  +T4 @VV0TP V0T ``x@d@p$t0 0Q0@Dt0 0Q t0 0Q7 DW D@T\ W00 T00SG' bp"00@40S\00pgS \,00E0XSxS@`P --LM 0 0 -- L 0 -MLM@P, `T< p 4Q& #$0K$K0 S2|4 ,0S t,NX 0H$@W KHH 0($B$4PP4 `W \ Q\ #0S0 0 #dBP PJ `0S ZJZ:00 00J žKIIR PK %R| T @D R@T<@  0P PJ >K 0CPcT RL K0 A ,P@)t W~ { 0  3P`K> @)>K 0C1Kc@@2AlA H D< L @L 6Qa07S K A 0P@N07S  0\KclA18 A 4< 0 < v6mQ T00%Q00S  `@Dvr `W!X< APPD@`PeX } 0 C 0 AP PJ `81 K@@ 0| P PJ ` 1 K@@#@ 4R -LM0@s yP0000 -LtMp0|@ $0 " 0jP`KS  $0S $sAth KPK叀K*) DpPEPP0fp J|( -PLM@R  ?  000 -LM@P 0 0 0P0 -LMI5 -LMp@`P0T@$K P,0 P00g Z@갪 -L\M `\, l Pt 0%S U 000S,0 S ,c@zTa__________________________________________a_____________________a bhl\PPl@ 0h hKlhP\th 0\t0l 0l 0S$@T @dJPϠ0Bl4? 2cc1D1A$4fl,x*8$I@QnmDRL:X`d -LMTp,@KP` 0  W>  0S lQ *0S0 Q*0S0 -aLA@_OReBd @Ap`@@qGTçPDdp@DW00ä?dpG@Q ?T00S L U'@(0 0Qtx0 S0 R -LMP LL1R00 mm@ `  0@T1@0pT mmP ` 0@11 T!@ 0T p`P%P_00 0@T0@Tlpk0@Ps(0SHp0T%P00-L5, -#ML M$0PP,0 ` P 0:S /S .V%P PU  0:S0/S TtW 6(@3(@@ T*BNK@D@D+B% +-+)..%PP EP /p@ #\K(PE PE#8ELP741 0-$0)(0% 2R,p\ \^3^P2P ZZ0Y0 YQ001001 0 e b 0RQ @Xp@X L0 0 QsX Xp@pL0SP7d0T7 @S^ XX 0X0 1QuM@p0Xp@ X ZX 0SX7. X X  Y\ 0S\70X 00CX 1 RXl0 ,0S t, XPU/?$P8P0`(rLt|}0S0 C,S R-S+S0SS0SSP@-@  00L S 100C^00L S^ 0-LMPK@ 0P 02c2c20 :R 0 ;0P 0 2c! 0:S<0 P0 00 0-0P-SL@P +SP  U0 0c00 -LM0@JS: MS 00C S00 0P 0/S00    00  0qP 0.S 0fP 0.S 0 0 00 m E-P@p "22a11\3a11\p0Sl S  W02c2cZ@]E ;RPS J^P WXa  102c2c^S,! 1?0c0AZ1`L ` !Ϡl  B 111F/N!b  !@!A! B 0C`aR0B S B^ W 00T` 010S^ 02c2cS002c2cSQ|*gfff$I -RLDMP\ ` /\0<S \0@0cd0 0S TKP@ IP00 `R <R `@ ~`@a0S,S ;S XKP@s 0V0R00S D ;Q,Qh Qd@Q` 0011P'RL7`c \\%0011P'R\\ds01u.00\'RT0 0f  P'L7R`c\T0X d0c bL7`'0 Td7 PhY 00 0 0 SmM @ \="d Y0@ `2"@<KnP@ 0,SPKeP@ ^d TX0]~h al0 0`p LP7`Tdh 0< KhX0@hP KT0@000@000 L1`"`!!X1X1 !h0 "b"b3h0 0XTڄT0>CX0 &@>`@ 0@>S``@ T00c  L7PTdg\ >0@>S\ @ bd  s$<0\@ R !`0@d T0 Q -@LM$0S hx -@ 0LS0 00Phl- -@LM9h9l 0-L4P@8 P0Sh!P. 1$PP!\ 0m ,TǃPǃLǃ 6!0hP 0:S H HP 0 ,!00hlk-x -@LM9h9l -LM`\p  0P"P7 S@ u RA @0S@AL0 Kp ] P` T70m= 01(0 R0P R0  A- p-0``0^80 ``V0u 8 ^N 0 0R 0 0R80L080 A 0V?HE.²QScQ$Ių| -Lhv -L,M@<Kk0 Q 0 Q  -@p0T`LP40c0h4 -@p0T`LP30c0h3 0R 0R 0R 0R 0R 0c -LtM0 00TK0SPPK?L@K< PhHK Pb@P儀KDK P PY}PTH^DńPڜ4^$ڔ4\  “Ϡ2l1Q`3l1R1R`@4!bH XP/H4^DńPDP$O2d1ap3d1U1UpW 00# 0A0d^ \D H0 0D0 )PH d!PT0;Q@0 v>8# 0ST Ŝ ŏP@@TPZ@ကK?0/0S0 P S@ ňK   P0SÈ0S S UP@P0CS0 @0S0 PʷTKP4\>`0 S; (("(Y 0@S1P1P}R pRJ0 S @TpG4UZ 0`S1PQPJP7  S K`VPE4UZLǕ0 00n0  0STK P` 40R00 ? \0#S gK    P00:TKwPT;0 T0 f QuPLDP0\  “2a1H`3a1R1R@0!^H PPKTK< YP 'lnQ|~-L -LMp@P`\ 0 ~ -MLM 04( S0 0ł>K0C0Cp0 D8 ,(RJ 00S1 P1!88 8( 80QBKL !80Q8(0@ SJBKL@8( 1SA0@(K@1 @( QZ@0S<8 <8.K B8(  0 P1H P'R <(@8 R<( @8XH8( 0>K0C!88!aPǖ\04(D8@X PLLGdUPP P`,8SL'L 0 `bS00 0~L- 0-4PL@4  Z@40l~0 0 L 0 0F@0  R J1u  0Q R@Z- -LM@K$0c -L M@K$0@K 0 `RA 0 `RS  0 `RS AR b-  \ 1<20 0 \ ?\"00 0QS@-@0c  \1<0   \ ?\0 @0 @\ PT0 0 -RLM@8"x8S,0 `0hȠ,Ƞ*H&$!PQ # 3(!( '#P020cY ! C2R `0 !8,0S&hh0` 0 Q 2RhF0P13P1 <2 -(0(   1 P ;;( ;S0 0P0 -LM`PP0@ KpD0 K04 4K00M00Ѝ -LM@Pp`EUW 00-_u@T0-`P\9p T0 R @  S$0 -LM`PpP%J6 K`P`,K0 0K00CM-00!OO$P`0"&pЍ -LM`Pp, H0P`pY ,0 p-LM`P@@@`@p -1LM0S``V$ P@pSS PpR SN $8?S @ U=|:JUT!0000à@T  RP;?$ $  u00Q0SpJe\0 \03  0<$0 00P@ $0P0?45WCpSpp p-LM`P@l@P@` ph -LMPP@`pW P `034 `RE0E0BUPU0H @0`043P 0 00` -LMdß@TXp, 00 ` T W 0^0T3("S*2V ,P0;,P02S|5P3 T T00W00ST00W\ /O0`PP#>`P`P`0O/ <`PP`V%^!000P 0\P2 000 ,P 00 0O/O0`*0`@0@ P` 0``!v00Q0 S  P (1U:  |0#03  ,K0f0K "Y` ^X,P0W T ,P0^,P0T^,P0{0^0TD -RL@M@p $0 0 $ ` `AG P@U0e $ e0(0 21%$ `e( $0 K(K$K$P0 P O4  b p-PL Mp_@@` P0Q S0 U UJA>`o0OoPJ0P` P 0 `p0`S  0 S43"?S04# 0 0 p-;PLMDUEoJP V 0T0U00S pp~UPD 000p5 D" 0a4000V`p -;L,M\< 8 * \PoO 0^8K< K`P80C8 <=PoOoPJ  0P` P`PD @ `Po4KO0^`P,0P`$+`P -;L`p45gSM 3^@$P 0 )V! W2 0 KN0^0 ^0n03  1>0$0 2 A$0 AB B0Q0UzW V2$0 n$Q0 Q03  01$0 0P0S;V V ?"0!P -;LˠP` 45fMà3^@p $0 $U V1$0 N$^0 ^0n03  1>$0 0$0 cAH0Q0\U UP` S:\: 0S00 lp'V U Kn<Q0 Q 03  010$0 1$0 0P0S ";Ϡ\  Ϡ\  y -;@T;LM/UT`ᠯ", (@ 4P 0 H X9 T^(K, KV0X4P 0K4 KM0,4sL'h$H X!1"4 R0#038"8(!,6.(0\ ! 2\ 0C QCR ,p 5U`; i^0U0X00S; -;PD;LM0/EU"4 0P ,@ (0 h Sb ST P ?45(K, K0PU4P0K4 K0P,0454( S b4 ࠑ}~ ,0 4 p?0S`,Ƞ,Ƞ(XB[ 4!Q0#038!8 5"40P 20bP  CR`P`  0P0!02S `FT ^S ;T -;0LMS@ ;0S P  00 45S P{P c45S;0 S-L# ;0S ?S S 00 P *S S 45S 345S;0 S-L# ;0S ?S S0 0000P *S S 45S 45S -!:**@LAB14LM\?@(0R\0l0&03  T`PT P TQx 000T`0R@L0R000 000 l>"0   -p`':@ナ7DL⨊ MXO<0KP  @KX@0H1@0 A@ 0?48@K5 0 ( -LP@K4MH)JJp,jP@ 冪 #T # 3(l0 $(h0.%pH(N.l # R2^P2t 3#S#3t@p#8$0 (, PP@2`3`#\ # 3(t0,( Ƞ##!@ Q020S ! 24`h@^ ! 2ldxY00RKAH D L0 *L`H0DK HKLK0D @T0 0` 0O/ l0T Y 00` 0O` -LP@KlM`K PP<,JXJ@ ,Jᄪ@|40 X%X "| t #[,Hs[2,.\0#03^#38,8 Ƞ&.x 8 "# V2R02 3#h00c bVQ0C2Y0C2S`h0 fh  00|00|0 H0 DK|D 0HKLK>L`dD H0h`Pxt@030# 3# h \|L| h|H ph0l@ 3 #030#0SPLh P DP t ` 0/O PP@Z ` 0O/A?O`PP` -p(  LMP`P' &:::S@ W @0 O00X64460 PP 20460@ -p(  LMP`P3 &:::S@$ ?S@ S@0 O00W VUS S X64460 0460@ -p(  LMP`P3 &:::S@$ ?S@ S @0 O00W VUS S X64460 0460@Q0 0aQ03000100P0R b0@- @P 1<\0 0 ?\4 00-b1R"  @-Sc@#0 401  00S20@-  3#@3@# 0  0bQ@2c0 0@-Pc0 @R#3 e d \@2 n0Q@20p@-X h%X ! $ T#3 Ƞ$ȌH.@!Q2pG-(!X  "(!& ' V#3W#3 Ƞ&Ȍh$a*'x%p,Z@2\P2 3 #P$ PG-ȠM!h,Ƞ !#8() X#3 Ƞ"( X(ȌPA*% ᑌ,Z@#@3H*H F' ᙡ&,QP2 Vp2` P@3@#\#3P, Ƞ%".p RP2 3#^#3@ .,$<0\@2@PTP28 40@0 PЍQPP  :Q00SP  :Q0#02SQP -P`LV@cp0S  SP@D RCA 0\R#R! B -L M@KZPT `0 -L"ɠ2l3c13@"c1MP 1K0  & C -L^M⸠p`OKPC/MK@( h < 8 c&Vat0V$KOK`?cKpG 0@FfKq q A A 1 (0S ( -PLKTP(K@0CP@ 0C4 d B P@o 3( K!$(,"( R`*R^ 2Kp2 0 IF>K0C"P pt0,^0S 0t t h wdh$`0 K@P@ @ $"(0K!48<#8 S*S 0H T H0L P J I@  Lh@hA Hp\ G0p4Slgp PBNK@D@DhL!L1#p@) #pPu0#SEKEKALK 0 LAIP4 \ X T $X4P$0P 2hP22p$RhPV0hz$\lx -LM` @0 0\ `0V -pp`@LTP S P `@T` 0V0000h鯸hz -LM$@0 S h0l -LMPp`P@b ,K0,px!0 #p  P @\T`E,0S ( 0"00,(0 $" "p P@T` (pP0P (0L 0 "(0 ذRt bH -Lh\P0P -L  hBt -LM`TPpP 0 S S 0d t" 0 0 @0$ c"@5pl -LhP0 --LM ? -LM@$  0$0KQ \  0  K 1S01 -@LM ul 0-LBP|@ 0S L| 0SPeT 0S \00LS `000 0 -LDM@ d ,P d'P`} 0Sh 0S0J0@ @@`K VLpP dP00 H XP L T@ fXKP0SV1X. 0P0P0H0STTA 0@81H  FP $P0@ 00r00p0d  N X%4 40  `0X@\ 00r00 00(@, 00r00t pL -LTM` `\ h0 0Qd 0p KLP0|0 pK0 0Rx0  x 00$0L< 4 00h[  % 0-LP@P0  P 0S S-P 0h'0 0-L@PP 0S S 00h0S 0h 0-LM@P0S0P  \0C 0L 0-0 0 0LS@P 00S 0S 0S  0S 0hP000 0 0 0 0 0 0P0 P 0 0 00 0-0LS@P S 00  0S S 000  0 S 000 000 P0-  @ d@-0@SC @<4(<"4!<0  -0S C   <4(<"4!<0   0-LM@0 SKCP0 "<4(<"4!<0  -LM0@SK C < 4  j 0 0 p-LPd p`0@,$,!$#,B V 0? !<4<("4!<0cS @` V @ P,$,< $,4.l$<("4%<A0 V 0? !@<4<("4!< 0cS @` V<4, <$!4 , P 1!0 1!( 0P1D!D, W00  ,0i -L`p@ۤPP  m d P -0LM@ ,0( P00 0-@LPP P \ 031 1! \!00`0@'`0@p@-0P0 @ 0`0  00  00  00 0 0 0 0 00  00  00  00  00  00  00  00  00  #0 0" ! !0"0 # '0$0& % %0&0$ ' +0(0* ) )0*0( + /0,0. - -0.0, / 30002 1 10200 3 70406 5 50604 7 ;080: 9 90:08 ; ?0<0> = =0>0< ? C0@0B A A0B0@ C 1 G0DFEEFDG ` 0V0pG-M0 咀 0P0呀 @P`pL吠叀 @P`p0P0 0 L0 0 0 兀H儀0D僀@@傀P`p0 <偀8 0 @P`pH0$0D @00<8000tw|04vx 0u0 ~}|{@zPy`xp,t( 0 @!P"`#p40$00%,0&0((0'p00 ,04h jl0r s0pon@mPl`kpdq$i hgf) *(0+,-@.P/`0p$0< 10 @2030405080\ \`0be0a`@Xd c_P^`]p[ ZYX9:;@607 8p0T@?0 @0A0B0C0D0^T0 0TD E0FG崌⾉0 0 ZЍ -LM@p4 00 , 08 40L0 Ƞ< S,ȠL 0X0C8#Ƞ3 X0 08\<#X5 0<0e8#h < b X0` 0n0C 00,`0 0X00 00C8#Ƞ BPp@00 0E8X#X4  R 0("X0e8#h 8! 0`0l0C0 , ` 8040 ePp80 4 4P㌠!\/ X0 08#X\< " 0<0e8#h<  `Ie00e0 `0@040\ 00C8#ȠQ00X @ -LMP @p`0B8S`RE 00Q 00lU@PT3 V  0S 0Q S0ò000 B0 00C0C0 0 00T00 UU800C800 R -LMP`  a("H T p 0 ʲ0S T0 fP  `ZQ0 Ppd`P 0 0b8#H Tʲ0S  0- LP@0S 0\P 0Q 0S 0S 0S00 -LM@ PQpl 0 RX 00 P) @Y 00d0 0S 0S 0P  0(1 P$1 0$1  $1 0(! @0 d Ƞ Q`ἠ,kP   04p  0 S  1 0%]0 00 0S0GP 张@`0 0S07P 0S @ -LMP`  Q@ n, $ 0 0S0P  0Pp 0, S 0 B  \0 0  pP!ᚠP Y 0(10S$1 0 ! 0S 0P  0P$1 0$1고 0-LMP @p 1 00 -L M`@ A nQP, p'P"MP 0 P 0, S 0   ]\0 0 e0 0S0|P  0Pp -LMP<0 80K0 Kp `P@Q0, 30 <KRp8#80CY 0@00PP08#X ("X 0 P L 00< 0@00Q<Y0A  P00<S PP< 0P -RL M`Pp 0 @T 0S @RT ͅ0! A0@ &P@ V00 G P V, 0 10 731 B,0  1@01S -L MQ 1pU, 0 1S{@`x 1Uu 0  \0D 0S0SZ 0 0<3Q B K  1F 0 10S% @ ` 0 Y \ಐ\% 0 Q10  @0 @00, S00 0 P 01-0Q0 P0? P 00 `4 P@ ˞PP  ÞP@  1S0C100! Q0PQX 0 AQ=Q10 -LMPpPmP@ R0 X 0W@ P  0孞AT _ 壞0 P @-0@0 @0!00  RCA 0\R! BQ'  0R!>?>>>>>> 2 2 2 2 2 2 2 2Q 0S !0S: 0-LMPK 00%0 @( 0ST 0S @S 0ST 0S [   Zr00 l{10*2 ,p 0-P@TUL P :᳝P@  0Y 0 0 p-LM@ P$K, ,0K $0 (` ` P `p -LM`V (  0SP@ p`@ V`pV@  V 1+#,PP 0p0`S0`` 0 @00, eV`pV@ B<B S=  P UP! 0 0e P0 0p0eS0`e0PVPV: ,PP 0 P0f  000vP P*0P` 0PU:XP 0 0c  0P0 V,` `pV@ ,0S? 0Y 1! P Q00P00S$ Q ,PPkY 0p0eS0`e^%P], P 0 0e 0  y000P E  bP0g0,0 X 0 03 0-0L @R5 P-  0P @0P 0P $00 0 00 QB< S  0  0 0c0 00000Πt p-L M0K K@C 00p!`8PUhC 0 SP P000pkP` 0 0 pd p-LtM@PP`K'P0@: S  Q  SL  p( 40R p; 0p0+ 0 pK -LM, PPpF0S@a@T 0 0S00 p@ 0S 0000 0E#10 0@S000,!0 0 Pp0S P P l{ -L M`CPP쀟0S6p@T 0S @S 0ST  P ` 0So`0 .p@ 0E#1, 0@SP l{ 0-LTPM@KT 0K  0  @@Wpm -LM`@ 0pP`R -LM@{PP/0:0 p-LMP `@0 : 0ph* -LM@pP  0:0q0:0 -LMp` \0 P@ P@ 0-L0MpP0 @0 0SDK@ 0S ,00@@v * t,@ P-L 0 hV 00h*tM p-LM`0p@T 0Pd@00U0  ,PP`@Up0@00pp -dpLMW` P@PUJ0SX@PUZpW`tR @0S R@- Mp-LM0`0 @`Lp Mp-LM0`0 @`9pP@-@p `0S0S=S 0S=S PdP U 0S  0R^ 0S ^0=S P00cC10n -LMK -LM0K *P - LMK0P -LM 0@P@ -LM 0@P@ -QRLtMp` 0@S 0S@b@DT*U00 0P0XR00S @ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -LM@hS -LM@\Pp` h^\QU0SD R 0S=W00  00CS]\]]]](]T]4]<]<]<]<]<]<]<]<]H]T]0 0R00 1 0 0 ;00 0 0 R 0;S< W  4 R 00R 0, q@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R -- L`^M@pTA0TPC/M_K 0 KKM?KPE@`1 4a 0a d0K?aK@D 0KQ |A Q A v1` 0S  刚4+-R0 0c BSR48 R p-@P`x BRpR0 BRRR2** *x*J** -p@L00l8#hP M08#x `0 0c8#h@08#x 0b0C`p`0 -LM@P 0S p7U0R G0`8U#h 0  b Rʂ0 S00@0@@0@Rڰ 0000G000A8  B8 000o" -L4M@ 0< 开@ PD p <0Px D0@ 00  0 ZH P L *P0<S`R0000 l , N@0g\0KH8 K8' 0080 0 c4 CP08#8P0 0ZpPP0n0 a B 00ഀD   000#8ᲀL  L 08# asL0 00`0ᲀPD  0<@ D   000 -LLMT X PpP 0L8#hL \\P ` h [00C8S 0@TL s \d `E0S@@KHKd0@ @ b 00H0 0L c@d@ P P3 0S 0 00S L Pp   00008#h\0 0S\`0S L'\0S 0 00S\  TLPT \ \  hT 000 0a0C0 h 0b0C 0X L0oPX L` X0@QPh  L X` eX 8K TP X0LPP4PT 8pW\ 0 RL0X P X -LM@p0Qs P`0 R=V0e S0 0RS 00P U*V0 00Q *^ 0P@  0Y008 8(40Por P0 00S"P@ 0S 0 00S 0oP  Q p-LM40@SP`$ 000`!H 0 Pp0000000 0 B@ 0p00S40040 -L M`pxQ  0 0C0ppSa <0R@W  P@0Pp  P P>Y 0S00C0pp  ,1R Y 0C\0K 1 00  0 !0  00[\002K)0[* [0 0\ʌ0 0"K+ [,[ \MO0 0@0@0<  JPPBJ@ @00@ -L MPx`p@ `  1R TI 0CP0K100  0!0  00[P0Z" <0W@  P@0PNp  P MO0 0A@0@0< J PpBJ@ 1@00@0Tʀ0 0"K) [*[ Pڸ5P  -LM` 0H20APP p0 101  d 020 0  崜8Q0 00P -L M  !4 0pD $0@SQ!P40 BU00 ,P 18aV U 0, 1 CU@  T pb @ TPU00ZD0 $0@0@@c TD ZF !4 0@  A@ D@ 010CY ?=2!I !U08#X&ʊU0 aP`40@ D0 T0D0Z 1@@ AU@ D 1 8 L001 / Ld@?=2D  $0!E!P@T$ U D0T P U D0TU1@ \0@bT5У 0$10C@/-"@dP`S@+ -0p8#(=1@0@A0C$0^^ 18a!$ BVLP ?=2!E.!h}` -LAMp0P 0 LANK0AnK @D `FS@D `F) \0 0 AK A0A $4 0s1 xP R  0 pS $ 4(0t++ -L MⰀ0ሐ` 0cV8#Ƞ, F0@p P0 100 0c8#Ƞ 0 &밀,000 0Pc PEP00@ -LM1@QPap o0 Rp8! ,5P8q8唏pR0-P@ 0bR03 B0 -Lᴃ%s: %s not compiled in instbinUsage: %s ..., where is one of: mount_cd9660dfmountmount_ext2fssyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigrtsolping6kbdlessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfsckmknodwicontrolreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shmvexprdmesghostnameXp~t~  |~8@@~X~~~Љ #@@~cbsconvfilesibsifobsofskipno value specified for %sunknown operand %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationscbs cannot be zerobuffer sizes cannot be zeroseek offsets cannot be larger than %qdconv option disabled%s: illegal numeric valuefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%s: end of device%s: short write on character device%s: short write on tape device%u+%u records in %u+%u records out blockblocks%u odd length swab %s %u truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryskip reached end of input x,08DLPX`huserquotagroupquotarwautoaccesstimeatimedevexecsuidrdonlyupdateegjo:Rcd9660%s: Filesystem not supported by kernelrealpath %s%s on %susage: mount_cd9660 [-egjR] [-o options] special node %s: illegal value '%s'needsdoes not need-o %s: option %s a value-o %s: option not supportedhiklnPt:retrieving information on mounted file systems%s mounted as a %s file system%s is not a local file system-i is incompatible with -Ponly one -t option may be specified.empty type list %7s%-*.*s %*u %9u %9d %5.0f%% %7u %7u %5.0f%% 1K-blocks%-*.*s %s Used Avail CapacityFilesystem Mounted on iused ifree %%iused Size%-*.*s %s Used Avail Capacity1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s df: %qd: %s usage: %s [-hiklnP] [-t type] [[file | file_system] ...] ffsext2fskerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdepasynchronousasyncexported to the worldAadfo:rwt:uvforcerqnoauto/var/run/mountd.pidsignal mountdgetmntinfo:@nfsunknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./usr/sbinexec: mount_%smountfsstatfs %s%s/mount_%sexec %s for %sno mount helper program found for %sforkalready mounted%s on %s type %.*s: %s %s on %s type %.*s (%sunknown flag%s %#xv2v3udptcpsoftintrnoconn%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregminacregmax, %s=%dacdirminacdirmaxprmounthardmfs%s%s=%lu %sadosfs%s%s=%u, %s=%u%s%s=0%omsdosshortnowin95gemdirexecnorripgensextattprocfslinuxversion %d, ctime=%s%s,%s-o[-Aadfruvw] [-t ffs | external_type][-dfruvw] special | nodeusage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special nodeufs%s: fstab type %s != disklabel type %s%s: fstab uses outdated type 'ufs' -- fix please x,08DLPX`hmount table fullspecified device does not match mounted device%s on %s: %sfilesystem not supported by kernelusage: mount_ext2fs [-o options] special node $FreeBSD: src/sbin/newfs_msdos/newfs_msdos.c,v 1.9 1999/08/28 00:13:52 peter Exp $%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) %s: can't read sector %u%s: can't write sector %uNO NAMEFAT%uBSD 4.4%u clusters too few clusters for FAT%u, need %uwarning: sectors/FAT limits file system to %u clusterstoo few reserved sectorsno room for backup sectorbackup sector would overwrite info sectorno room for info sector/boot/%s%s: inappropriate file type or format160180320360720120014402880%s: bad FAT typevolume ID%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorswarning: %s is not a character devicebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: FAT type limits file system to %u sectors/dev/%s is mounted on %s%s: unknown standard format%s: can't figure out partition info%s: partition is unavailablegetdiskinfo%s: unknown disk typeioctl (GDINFO)%s: can't read disk label; disk type must be specifiedbps=%u spc=%u res=%u nft=%u mid=%#x spt=%u hds=%u hid=%u bspf=%u rdcl=%u infs=%#x bkbs= bsec=%u spf=%u sec=%u rde=%u%s: no default %s%s: illegal %s%s: bad %s"*+,./:;<=>?[\]|usage: newfs_msdos [ -options ] special [disktype] where the options are: -N don't create file system: just print out parameters -B get bootstrap from file -F FAT type (12, 16, or 32) -I volume ID -L volume label -O OEM string -S bytes/sector -a sectors/FAT -b block size -c sectors/cluster -e root directory entries -f standard format -h drive heads -i file system info sector -k backup boot sector -m media descriptor -n number of FATs -o hidden sectors -r reserved sectors -s file system size (sectors) -u sectors/track М؜ lD     G(0:048<@HPX`hp x #3#3233#@ȟ@LO@П@؟ $,4<DLT\ d l@t@|Ġ̠Ԡܠ  $,4@LT\dlt|ȡ@С@ܡ@@    $,4<DL@T@\dl t C$|CC$CĢ̢Ԣܢ  $,4@<@DLT\dldiscarddsuspeofeol2lnextminquitreprintstartstatusstopsuspflushrprntoption requires a numeric argument -- %smaximum option value is %d -- %sundefoption requires an argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:ispeed=%d:ospeed=%d %s=%x:%lxoflagospeedlflagiflagispeedcflagcbreakcolscolumnscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttyillegal option -- -%s%d %d TIOCSETDTIOCSTARTTIOCSTOPcs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeottablet disc; ispeed %d baud; ospeed %d baud;lflags-extprociflagsoflagscflags%-8scchars%s = %s; %d rows; %d columns;speed %d baud;#%d disc; slip disc; ppp disc; strip disc; -aefgaef:gTIOCGETDTIOCSWINSZtcsetattrgfmt1illegal option -- %sTIOCGWINSZnot a terminalusage: %s [-a|-e|-g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.13 2005/12/02 20:36:56 cloder Exp $Ffhnslinkit%s/%susage: %s [-fhns] sourcefile [targetfile] %s [-fs] sourcefile ... [targetdir] @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.97 2005/11/13 20:27:10 deraadt Exp $p,0Ծ4<@DHLH\{sƑOJNqեvuNuޕڵs!0 '+5/&f%kt9<^|⫓Z2}@mrXN㣈Odv2/fP@WmUvhQ*; k~}xrBT?"R=PYvh{]25xp꺂] ot+iֹecolaZ.^Ҽu[(821 5nx'G b ;WΕͫ۝<ᔑ&b競ЫVjaVk܇v \btKHwgl;] = 늾dX`J g x9y׷^mIzUyϖu i Xb1 ~صh:#(_pm%"" JY'-%kl j7^#Ai$;3lhPJO+Z8#z,G4_6xA%Q3 "5-<Ӓ,U绶ɜ[[N*i%0nzcA1:X._-^]_|2cD[y@bA!d@ui@^ lS&]j4p a LFsCW$l)LyaRw :xw6͝frz'3'eF8̏y4t?W F<<4 [._Gv"nc@ZпYiD0kDN ԠԀMH>[U/f& -`+n"Wᆱ ¼JL PB]b{{n5vF Dcrtj^5̟n8:+xhТ1mUY= &u 6naomo$AG̋ž6M{vav%lz.d0K8oab Gh@=S x(A$qt8,27~UZf&+CC_6WE!QPt!V'>G9 (Bc Ni՝ X S, f{Bb9  F4:B7p f#+P~e8+R,֍"8 I8̓(^!DsІ4tO !LF [6R0&[(+"$Di|p)B,O?orzoC;%%&xT cB5|̹;g H:{;z>yv-^rGT3&;]F))x]Pah5A%h$Y{żՋu(_;A~ahɴ؊ √駸i8K#B6rQ(:D $y^ m 4S#VRׂ2MSM65$˰8_ƴ N]~`gkBW$V$#h=kQLj٩ \Ȉzrdfv) 'b~|L0CRhs"k[РQ0IWk!ނ6&7\ S&D 8z42vyq\&!(3'R@ 6"qJ8)МG 6}+ demːy6k!K/h)elɉ >Usbq]`xpu젃K.csf +}u )R."p4#w("F R>P veyĻޚWej\}WACIK Ee@if1k@"8p@BL/-sl!oHo&ՁD(~#!|`O39 JȂz(BB+Q;si_4o$ X)+L`@Z8F~|uS@IwHWN*'…+ix%^Zu0"bh;K[Nۑ/*^]$a$)! bVc)cC_[@Dwf=um[p-n(ڭMKe,>V-SJidO˴|3j hg0ǘ(DPS`M-58cʢ7RcwMod Q1Z\{+zP-4}%,^/YȌ6Wi#FT0$"Pj5;LtMpeϙΜ-o6G:ꄱs~hs5SDmęH*ѭ%h_ ^VA]{ac47(ń+-9%E)m"ğO-n%IKFPQy ^}e۾*Eag69!W}̑6:ήIQ#A0|nN%M`U}Fﱞ*54=/DS- %%8 qMu8E)H$ہ9|T3'֍cvWcPuAn'#B lݴc]X9Hq~9:/L_[̻ڋ?֊m̻IR1+ vJ׭*g)riMĞ vlVMْ=Xe @\c|5f/hp EP8N,w>!ˁF;_k¼f}w>0}&"ı6LLȷr'aiMaw {LA-Րz"$55_cSOq8L9YtӸŵ=siLR*UNNNj&+SKQJ[ D1$Rs.^%5XC\j;{{6V9 ` H(JSy+nXݮT4]({g⢊#o95ۙPD:NΘϴt&l: ;S w &DPrS~Z ơEF7/Y=;>rq eQ-n &\v{]\Ro5r -XRr[h)T?tLA rST6 !v 5rrC՚&W'{il"ȅ-i߈(gD РjHO(6HFocHj^ZI9 $9ɊLG- _@6X)ҝ"c{PxmH?:Cevص9/' P|R|ԮJ)35GM!;3<Ħc7qBMC QەE~W'=ɹVqO"ky(}"2H/xT Tdȹ};T! b%:/بYlpuWtߙf3yz-=1ns8RL $s0o:ُz`-Ope_Ln|ʡkJګ8= :9Sp|J J3 `c֝W0rK1kS;kqA=EI4ݤI~}{]|}7AS=O|:VJc'O&4|3KqnK]}^Gw gf!諹 gO82zҊD 3x( ŧQhxC yB۠78*gٙwP2j}Yݱ1"O2|#6:IePʛB8YVZ6=v&NeD[Xs'Wn$N⮘>\y JЙ^&nK|9Y~)]`@y/5 = MeuL7ͭ<Ұ">4SG[^ψ:Ps{~ j&GAN 9-m/X}H&xE I͍3$=F֥,@RedvVe Sar۫o_:gscwרL.q7uXYh3'bi u6pKֲ ]BuJM_a@!4]ꡔZxmOwū!#Ed%ܖ"fp 48 W:/puijMP$$<]c Ќ >v׬Il)i=Rw,L"IR i-z]ZH^G7jՆM/Ei7ۑJϿH!tɽjɿv=%F`G)w\D3^4q{rI#M@pq0 4m6"6=BeiG8tZh@LgckLEޙ]J(\c.rEmZw9|/vyJc_4w-n,mv3VU猡 K=VkDp!ē=|"1ul\|QQ&HlgY$əM#7'_Ja\Cya??䏾< PbadosudfunknownSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedswapVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDFBEf:NRWb:cdenp:rs:tvwbckmgioctl DIOCWLABELunknown disk type: %sDANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.writelseekwriting label to block %lld (0x%qx) ioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -r" to install initial label%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)no disklabel found. scanning.no disk labeldisk label corruptedfound at 0x%lxreading label from block %lld, offset %lld ioctl DIOCGPDINFOioctl DIOCGDINFOioctl DIOCRLDINFOBootstrap doesn't leave room for disk label\ :Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%u:%srm#%hu:%sil#%hu:d%d#%up%c#%u:o%c#%u:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:%sts#%u:%shs#%u:%scs#%hu:%ssk#%hu:%.*s| %c: %12.*f%c %12.*f%c %7.7s%7d%19.19s# %s# Cyl %5u-%6u %5u %5u %4hu %5u %5u %4.4s %c: %13u %13u device: %s # %s: type: %s type: %d disk: %.*s label: %.*s bytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total bytes: %.*f%c free bytes: %.*f%c rpm: %hu %hu partitions: offset# %13.13s %13.13s fstype [fsize bsize cpg] interleave: %hu trackskew: %hu cylinderskew: %hu headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %d free sectors: %u total sectors: %u badsect ecc removable # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) re-edit the label? [y]: editNo changes.-cEDITOR/usr/bin/vifailed to start editor/bin/sh # line %d: syntax errorIDEline %d: warning, unknown disk type: %sremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: warning, unknown filesystem type: %sline %d: too few fieldsline %d: bad partition offset: %sgetasciilabelline %d: bad partition size: %sline %d: unknown field: %sline %d: bad # of partitionssector size %dtracks/cylinder %dwarning, unused partition %c: size %d offset %dpartition %c: block size < fragment sizepartition %c: partition extends past end of unitpartition %c: offset past end of unitwarning, partition %c: size 0, but offset %dwarning, number of partitions (%d) > MAXPARTITIONS (%d)warning, super block size %% sector-size != 0super block size %dwarning, boot block size %% sector-size != 0boot block size %dwarning, revolutions/minute %dcylinders/unit %dsectors/track %dcmplabel usage: disklabel [-c | -d | -r | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d | -r] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d | -r] [-nv] disk (edit) disklabel -E [-c | -d | -r] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nrv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) disklabel -B [-nv]%s disk [disktype] (boot) disklabel -Bw [-nv]%s disk disktype [packid] (write) disklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)You need to specify a type for this disk.No 'c' partition found, adding one that spans the disk. Initial label editor (enter '?' for help at any prompt) unable to get default partition tablePAGER/usr/bin/lessgunzip -qc|%sunable to execute %sEnteringExiting%s expert mode This option is not valid when run without the -f flag. Write the modified label to disk?Write new label?unable to write labelNo label changes.In no change mode, not writing label.Recalculated free space.cannot open %sFilenameName of the file to save label into.Nothing to undo!Last change undone.Unknown option: %c ('?' for help) can't run when there is partition overlap.Partition must be between 'a' and '%c' (excluding 'c'). editor_add Please re-enter an offset and size for partition %c. Partition '%c' exists. Delete it first. The letter of the new partition, a - p.partitionPartition '%c' already exists. Partition must be between 'a' and '%c'. No space left, you need to shrink a partition Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to nameThe letter of the partition to name, a - p.Command aborted Please re-enter an offset and sizeWarning, need %u sectors but there are only %u free. Setting size to %u. partition to modifyThe letter of the partition to modify, a - p.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. The letter of the partition to delete, a - p, or '*'.partition to deletePartition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk partition to change sizeThe letter of the partition to change size, a - p.%s: [%s] %s: [%u] Rounding to nearest cylinder: %u getuinthas_overlap Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE)."%s" is not a valid disk type. Valid types are: "%s"label name15 char string that describes this label, usually the disk name.The Numer of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.Not enough free space to shrink by %u sectors (only %u sectors left) The rotational speed of the disk in revolutions per minute.The physical sector interleave, set when formatting. Almost always 1.edit_parmsYou may want to increase the size of the 'c' partition.failed to sort partition tablesdrzFLOPPYxdhdCCDVNDsvndPossible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'g' command is used select which disk geometry to use, the disk, BIOS, or user geometry. It takes as an optional argument ``d'', ``b'', or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'x' command exits the label editor without saving any changes to the on-disk label. Available commands: ? [cmnd] - this message or command specific help. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. D - set label to default. d [part] - delete partition. e - edit drive parameters. g [b|d|u] - use [b]ios, [d]isk or [u]ser geometry. M - show entire OpenBSD man page for disklabel. m [part] - modify existing partition. n [part] - set the mount point for a partition. p [unit] - print label. q - quit and save changes. r - recalculate free space. s [path] - save label to file. u - undo last change. w - write label to disk. X - toggle expert mode. x - exit without saving changes. z - zero out partition table.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). '%' for percent of total disk size, '&' for percent of free space. Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help.The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. mpsave%s%c %s %s rw 1 %d Starting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors Size of fs block fragments. Usually 2048 or 512.Zero fragment size implies zero block sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. Error: block size must be at least as big as page size (%d). cpgNumber of filesystem cylinders per group. Usually 16 or 8.FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' noneWhere to mount this filesystem (ie: / /var /usr)Mount points must start with '/' Can't stat deviceBIOS geometry not defined. You must enter either 'd', 'b', or 'u'. Note: user geometry is the same as disk geometry. Enter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.[d]isk, [b]ios, or [u]ser geometry$OpenBSD: ar_io.c,v 1.37 2005/08/04 10:02:44 mpf Exp $$OpenBSD: ar_subs.c,v 1.29 2006/01/25 17:42:08 markus Exp $$OpenBSD: buf_subs.c,v 1.21 2005/11/09 19:59:06 otto Exp $$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $$OpenBSD: cpio.c,v 1.17 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: file_subs.c,v 1.30 2005/11/09 19:59:06 otto Exp $$OpenBSD: ftree.c,v 1.26 2005/04/21 21:47:18 beck Exp $$OpenBSD: gen_subs.c,v 1.18 2005/04/28 06:58:07 otto Exp $$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $$OpenBSD: options.c,v 1.63 2005/06/02 19:11:06 jaredy Exp $$OpenBSD: pat_rep.c,v 1.30 2005/08/05 08:30:10 djm Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.28 2005/08/04 10:02:44 mpf Exp $$OpenBSD: sel_subs.c,v 1.18 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: tables.c,v 1.23 2005/04/21 21:47:18 beck Exp $$OpenBSD: tar.c,v 1.40 2005/12/17 19:47:02 otto Exp $$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $Cannot write an archive on top of a directory %sFailed stat on %sFailed chdir to %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %s%s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. done. %s: Waiting for tape drive close to complete...ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specEnd of archive volume %d reachedFailed read on archive volume %dWARNING: partial archive write. Archive IS FLAWEDWARNING: partial archive write. Archive MAY BE FLAWEDFailed write to archive volume: %dUnable to append, trailer re-write failed. Quitting.Write failed, archive is write protected.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Cannot allow updates to an archive with flaws.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to seek archive backwardsReverse position on previous volume.Unable to obtain current archive byte offsetUnable to backspace tape %d blocks.Tape drive unable to backspace requested amountget_physUnable to backspace tape over %d pad blocksUnable to backspace over tape filemark.Unable to locate tape filemark.Cannot determine archive tape blocksize.Unable to backspace over last tape block.ar_next ATTENTION! %s archive volume change required. %s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot open %s, try again Cannot save archive name.Quitting %s! %s ready for archive tape volume: %d Load the NEXT TAPE on the tape driveReady for archive volume: %d Unable to restore signal maskUnable to set signal maskcould not pipecould not forkcould not exec-dcCan't fchdir to starting directoryCannot chdir to %sextractUnable to open %s to readCannot mix current archive format %s with %sappend%s: Reading archive to position at the end...directory name is too long %scopyDestination is not a directory %sDestination pathname too long %sCannot access destination directory %sArchive I/O error. Trying to recover.Archive I/O error, cannot continuePremature end of file on archive readInvalid header, starting valid header search.Unable to append, archive header flawCannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximium is: %dWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleUnable to rewrite archive trailer, cannot append.Cannot append to an archive that may have flaws.Archive read error limit (%d) reachedUnable to append when there are archive read errors.File changed size during read %sFile %s was modified during copy to archiveRead fault on %sActual crc does not match expected crc %sUnable to obtain block size for file %sFile %s changed size during copy to %sFile %s was modified during copy to %sFailed stat of %sFailed write during copy of %s to %sUser specified archive volume byte limit reached.Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache tableTRAILER!!!cpio_endwrCpio file name in header is corruptedCpio file name length %d is out of rangeCpio link name is corruptCpio link name read errorCpio link name length is invalid: %qu070707File is too large for cpio format %sCpio header field is too small to store file %scpio_wrUnable to write cpio link name for %sUnable to write cpio header for %s070701070702File is too large for sv4cpio format %sSv4cpio header field is too small for file %svcpio_wrCould not write sv4cpio link name for %sCould not write sv4cpio header for %sFile is too large for bcpio format %sbcpio_wrBcpio header field is too small for file %sCould not write bcpio link name for %sCould not write bcpio header for %sUnable to create %sUnable to close file descriptor on %sA hard link to the directory %s is not allowedUnable to link to %s from %sUnable to copy %s, file would overwrite itselfCould not link to %s from %sUnable to remove %sUnable to link file %s to itselfCould not create: %snode_creatCould not access %s (stat)cannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not unlink %sUnable to remove directory %sAccess/modification time set failed on: %sUnable to obtain file stats %sUnable to set file uid/gid of %sCould not set permissions on %sFailed write to file %sOut of memoryFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Failed seek on file %sFile changed size %sset_crcFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:Can't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sIgnoring too-long pathname: %sIgnoring unterminated pathname at EOFls_list%b %e %H:%M%b %e %Y%s%2u %-*.*s %-*.*s %4lu,%4lu == => %9qu %s%s %s ls_tty%s: unknown option %c %s: %c argument missing bcpiosv4cpiosv4crcustarab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0Write limit is not a %d byte multipleInvalid write limit %sError count value must be positiveInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Destination directory was not suppliedb:cef:hmopqruts:vwxzBC:HI:LOPXZ014578/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8Unable to allocate space for option listTAPEProblem with file '%s'Unable to open file '%s' for read-C-Iwrite_opt=nodirabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-0cdOnvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [pattern ...] pax -r [-0cDdikOnuvzYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T [from_date][,to_date]] [-U user] [pattern ...] pax -w [-0adHiLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [-x format] [file ...] pax -r -w [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [file ...] directory usage: tar {crtux}[014578befHhLmOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhLmOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list Empty replacement stringrep_addInvalid replacement string %sInvalid replacement string option %s%s while compiling regular expression %sUnable to allocate memory for replacement stringEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern list inconsistentPattern select out of memoryRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Processing continues, name changed to: %s tty_renameProcessing continues, name unchanged. Skipping file. File name %s/%s, too longrep_name%s >> %s >> %s Replacement name too long %s >> %sReplacement name error %sTMPDIR/tmp/Cannot allocate memory for temp file name.Can't open current working directory.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerUser selection table out of memoryUnable to find uid for user: %sUnable to allocate memory for user selection tableGroup selection table out of memoryCannot determine gid for group name: %sUnable to allocate memory fo group selection tableEmpty time range stringUpper %s and lower %s time overlapIllegal upper time range %sTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Illegal lower time range %sBad option %c with time range %sUnable to allocate memory for time rangeImproperly specified time range: %sCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %schk_ftimeFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryFailed ftime table readFailed ftime table seekCannot allocate memory for interactive rename tableNo interactive rename table, links may failInteractive rename table out of memoryCannot update rename tableCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to allocate memory for directory timesUnable to store mode and times for created directory: %swrite_optnodir%s=%s is only supported when writing.Unknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format optiontar_wrFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for ustar %sUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sustar_wrnobodyFile is too long for ustar %sLink name too long for ustar %sUstar cannot archive a socket %s/dev/ttyFatal error, cannot open %s%s: @(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.73 2006/01/09 22:42:35 deraadt Exp $DI:LRS:c:dfi:jl:np:qrs:T:t:vw:number of packets to transmit is %s: %sbad interface address: %stos value is %s: %s%s: only root may use interval < 1sbad timing interval: %spreload value is %s: %spacket size is %s: %sttl value is %s: %smaxwait value is %s: %s-f and -i options are incompatiblebind-R option and -D or -T, or -t to unicast destinations are incompatiblesetsockopt IP_MULTICAST_IFgetsockoptCannot set the receive buffer sizePING %s: %d data bytes ping: recvfromPING %s (%s): %d data bytes Could only allocate a receive buffer of %i bytes (default %i)setsockoptsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_LOOPping: record routerecord route not valid to multicast destinationsunknown host: %sping: wrote %s %d chars, ret=%d pingerping: sendtopacket too short (%d bytes) from %s unknown option %x LSRR: 0.0.0.0 (truncated route) %s RR: (same route) NOP%d bytes from %s: icmp_seq=%u ttl=%d wrong data byte #%d should be 0x%x but was 0x%x%x (DUP!) time=%d.%03d ms%d bytes from %s: %ld packets transmitted, %ld packets received, %.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms -- somebody's duplicating packets!%ld duplicates, --- %s ping statistics --- Echo ReplyDestination Net UnreachableDest Unreachable, Unknown Code: %d Destination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF setfrag needed and DF set (MTU %d) Source Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDesination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffSource QuenchRedirect Network(New addr: %s) Redirect, Unknown Code: %dRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostUnknown ICMP type: %d Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime exceeded, Unknown Code: %d Frag reassembly time exceededTime to live exceededParameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xpatterns must be specified as hex digitsusage: ping [-DdfjLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host $OpenBSD: fsutil.c,v 1.13 2003/09/25 04:15:29 deraadt Exp $lost+foundwrong type to dirscan %d DIRECTORY CORRUPTEDNAME=%s fileerror%s=%s DIRLINK COUNT %s COUNT %d SHOULD BE %d (ADJUSTED)ADJUSTLINK COUNT INCREASINGUNREFmkentryUNREF %s RECONNECTSORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATElinkupSORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY DIR I=%u CONNECTED. PARENT WAS I=%u SORRY. NO SPACE IN lost+found DIRECTORYNO lost+found DIRECTORYCREATE (CREATED) (RECONNECTED)makeentryNO SPACE LEFT IN %s (EXPANDED)EXPANDLARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE ckinodeDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSiblockPARTIALLY TRUNCATED INODE I=%ublk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot increase directory list cannot find inode %d CLEAR (CLEARED) I=%u OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s %d %s I=%uBAD STATE %d TO BLKERR b:dfm:npyAlternate super block location: %d ** lost+found creation mode %o bad mode to -m: %o -%c flag requires a %s checkfilesysCAN'T CHECK FILE SYSTEM.** Phase 1 - Check Blocks and Sizes** Phase 1b - Rescan For More DUPS%d files, %d used, %d free ***** REBOOT NOW ***** ***** PLEASE RERUN FSCK ***** ***** FILE SYSTEM WAS MODIFIED *****The following zero link count inodes remain: %u,The following duplicate blocks remain: %d,%d blocks missing %d files missing ** Phase 5 - Check Cyl groups** Phase 4 - Check Reference Counts** Phase 3 - Check Connectivity** Phase 2 - Check PathnamesINTERNAL ERROR: dups with -p** Root file system** Last Mounted on %s starting usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... UNKNOWN FILE TYPE I=%ubad size %llu:INCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED)LINK COUNT TABLE OVERFLOWCONTINUEbad indirect addr: %d bad direct addr: %d bad size %llu ndb %d:HOLD BAD BLOCKINODE I=%u HAS DTIME=%12.12s %4.4sPARTIALLY ALLOCATED INODE I=%uDUP TABLE OVERFLOW.EXCESSIVE DUP BLKS I=%u (SKIPPING)EXCESSIVE BAD BLKS I=%uBAD STATE %d FOR ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYCANNOT ALLOCATE ROOT INODE ROOT INODE UNALLOCATEDALLOCATEpass2MISSING '..'FIXBAD INODE NUMBER FOR '..'DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '.'I OUT OF RANGEREMOVEpass2checkUNALLOCATEDBAD TYPE VALUEIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)DUP/BADZERO LENGTH DIRECTORYEXTRA '.' ENTRYEXTRA '..' ENTRYCANNOT FIX, INSUFFICIENT SPACE TO ADD '..' CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'BAD STATE %d FOR INODE I=%d ZERO LENGTHBAD/DUPsummary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dBLK(S) MISSING IN BIT MAPS #%dINODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADpass5ino_bitmap:ibmap:blk_bitmap:bbmap:BAD STATE %d FOR INODE I=%ld %u: %2x %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /r%s is not a character device Can't stat %s Can't stat rootmalloc failedrealloc failedstrdup failed%s is not a character device (NO WRITE)cannot allocate space for superblock setupLOOK FOR ALTERNATE SUPERBLOCKSLOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THE%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d WRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead cannot alloc %u bytes for typemap IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULT** File system is already clean %sile system is clean; not checking ** Fstate = %d NO WRITE ACCESS** %sCan't open %s: %s Can't stat %s: %s MAGIC NUMBER WRONGBAD LOG_BSIZEINCOMPATIBLE FEATURE BITS IN SUPER BLOCKcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %ld, original %ld, alternate %ld BAD SUPER BLOCK: %s %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ioctl (GCINFO): %s %s: can't read disk label PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK bad file type 0%o %s? yes %s? [yn] %s? no INTERNAL ERROR: GOT TO reply()cannot allocate buffer pool deadlocked buffer pool CANNOT %s: BLK %dProgram terminated MARKING FILE SYSTEM CLEAN cache missed %ld of %ld (%d%%) MARK FILE SYSTEM CLEANUPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:returning to single-user after filesystem checkSALVAGE (SALVAGED)UNKNOWN INODESC FIX MODE %d benstuvusage: %s [-benstuv] [-] [file ...] %6d $a\'\^D\^D\^\^\^\^\p[^[^[^da^xb^LZ^_^`^ %d:powersave on (%dms sleep) (auto) %ddBm %sieee80211_statusSIOCG80211ALLNODES nonerestoreieee80211_listnodeslladdr %s %udB powersave %uMESSIBSSPOLLABLEPOLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SHORT_SLOTTIME RSNDSSSOFDMCACHEBSSAUTHASSOCCOLLECTSGIOCGIFMEDIA%s: no link type?init_current_mediaSIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandsonly one `mode' command may be issuedinvalid media mode: %sonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sEthernetetherTokenRingtokenFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA1DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbackloopEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituunknown %s media subtype: %sunknown %s media mode: %sunknown %s media option: %smedia mode %smediaopt instance %d physical address inet%s %s --> %s phys_statusno carrieractiveno ringinsertedno networkbackupUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %lu mtu %lu lladdr %s description: %s %s: no media types?SIOCGIFMEDIA media: status: supported media: inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime in6_alias%s: bad valueprefix %s: %s%s=%o%s=%xusage: ifconfig [interface] [address_family] [address [dest_address]] [[-]alias] [[-]arp] [broadcast addr] [[-]debug] [delete] [up] [down] [ipdst addr] [tunnel src_address dest_address] [deletetunnel] [description value] [-description] [[-]group group-name] [[-]link0] [[-]link1] [[-]link2] [lladdr etheraddr] [media type] [[-]mediaopt opts] [mode mode] [instance minst] [mtu value] [metric nhops] [netmask mask] [prefixlen n] [nwid id] [nwkey key] [nwkey persist[:key]] [-nwkey] [bssid bssid] [-bssid] [chan n] [-chan] [txpower dBm] [-txpower] [[-]powersave] [powersavesleep duration] [[-]anycast] [eui64] [pltime n] [vltime n] [[-]tentative] [vlan vlan_tag vlandev parent_iface] [-vlandev] [vhid n] [trunkproto proto] [[-]trunkport child-iface] [advbase n] [advskew n] [maxupd n] [pass passphrase] [state init | backup | master] [syncdev iface] [-syncdev] [syncpeer peer_address] [-syncpeer] [phase n] [range netrange] [timeslot timeslot_range] [802.2] [802.2tr] [802.3] [snap] [EtherII] [pppoeac access-concentrator] [-pppoeac] [pppoesvc service] [-pppoesvc] ifconfig [-AaCMm] [interface] [address_family] ifconfig interface create ifconfig interface destroy getifgroupsSIOCGIFGROUP groups: malformed link-level addressSIOCSIFLLADDR1ACFLRSTacdfghiklmnopqrstuxCOLUMNS%s: %s: %s: directory causes a cyclefts_readdisplay%qu%*s%*qd printlong%3d, %3d %-*s %*qd %*u total %lu %s %*u %-*s %-*s -> printlink ls: %s: %s %*s usage: %s [-1AaCcdFfghikLlmnopqRrSsTtuWx] [file ...] mainifconfigmake_packetrtsol_check_timerrtsol_timer_updatesockopensendpacketrtsol_inputinterface_upinterface_statuslladdropt_fill)get_llflagprobe_initdefrouter_probesendprobeadDFfailed to open a socketfailed to initialize interfacesselect: %sfailed to setup for probing routersfailed to initialize %skernel is configured as a router, not a hostkernel is configured not to accept RAsadDfFm1memory allocation failedinterface %s was already configuredfailed to get link layer information for %slink-layer address option has null length on %s. Treat as not included.memory allocation failed for %sNew timer is %ld:%08ldthere is no timer%s status is changed from %d to %dNo answer after sending %d RSstimer expiration on %s, state = %dset timer for %s to %d:%dstop timer for %sillegal interface state(%d) on %susage: rtsol [-DdF] interface ... usage: rtsol [-DdF] -a usage: rtsold [-1DdFfm] interface ... usage: rtsold [-1DdFfm] -a <%s> %swarnmsgprobing %sreallocmultiple interfaces foundff02::2inet_pton failed for %ssetsockopt(ICMP6_FILTER): %sIPV6_HOPLIMIT: %sIPV6_PKTINFO: %ssocket: %smalloc for send msghdr failedmalloc for receive msghdr failedsend RS on %s, whose state is %dsendmsg on %s: %ssendpacketfailed to get receiving interfacertsol_inputinvalid icmp type(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on %s, state is %dreceived RA from %s on an unexpeced IF(%s)invalid icmp code(%d) from %s on %spacket size(%d) is too shortfailed to get receiving hop limitrecvmsg: %schecking if %s is ready...interface_up%s is duplicated%s is tentative%s is readyget_llflag() failed, anyway I'll tryioctl(SIOCSIFFLAGS): %sioctl(SIOCGIFFLAGS): %sinterface_statusioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS) on %s: %sunsupported link type(%d)get_llflagioctl(SIOCGIFAFLAG_IN6): %sgetifaddrs: %ssocket(SOCK_DGRAM): %sshutdown: %slo0defrouter_probedefault router list contains a non-link-local address(%s)ioctl(SIOCGDRLST_IN6): %sprobe a router %s on %ssendprobeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftinvalid namelen:%d/%luno nameunknown qtyperefused???unknown, type 0x%xrefused, type 0x%x%d bytes from %s, icmp_seq=%u hlim=%d(DUP!) time=%g ms dst=%sfailed to get receiving packet informationa:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwW-R is not supported in this configurationinvalid source address: %sinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit -- %sillegal hoplimit %stoo small interval, raised to 0.01illegal timing interval %sillegal preload value -- %sMust be superuser to preloaddatalen value too large, maximum is %dillegal datalen value -- %sgetaddrinfo failedsetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_HOPOPTS)setsockopt(IPV6_DSTOPTS)-f and -i incompatible optionsUnable to allocate packetsetsockopt(IPV6_USE_MIN_MTU)setsockopt(ICMP6_FILTER)%s: invalid interface namesetsockopt(SO_SNDBUF)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified recvmsgpollsetsockopt(IPV6_HOPLIMIT)setsockopt(IPV6_PKTINFO)setsockopt(SO_RCVBUF)you need -b to increase socket buffer sizeUDP socketUDP setsockopt(IPV6_PKTOPTIONS)UDP connectgetsocknamecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodecan't set the last flagcan't allocate enough memorysetsockopt(IPV6_RTHDR)IPV6_MULTICAST_HOPSgateway resolves to multiple addressestoo many intermediate hopsgetaddrinfo for the gateway %s: %sping6: wrote %s %d chars, ret=%d sendmsg\%03odnsdecodeinvalid peernamepr_packunknown code 0x%x, type 0x%xNodeInfo NOOP HbH Options: Routing: Dst Options: -%uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap %s(TTL=%u)pr_nodeaddr(TTL=infty) no address truncated --- %s ping6 statistics --- round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms %.1lf%% packet loss+%ld duplicates, IPv6 addressDNS labelIPv4 addressSuccessRefusedNo Route to Destinationpr_icmphDestination Unreachable, Bad Code: %d Destination Administratively UnreachableDestination Unreachable Beyond ScopePacket too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Bad code(%d) pointer = 0x%02x Erroneous Header Unrecognized Option Unknown Nextheader Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sBad ICMP type: %dNode Information QueryNOOP, invalid, oldfqdn, subject=%s(%s), no subject, subject=%s(invalid)Supported qtypesDNS namenodeaddrIPv4 nodeaddrNode Information Reply, %sVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphHBH RTHDR FRAG ESPICMP6: type = %d, code = %d Unknown Header(%d) DSTOPT IP6ff02::2:0000:0000nigroupusage: ping6 [-dfHmnNqtvwW] [-a [aAclsg]] [-b sockbufsiz] [-c count] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-h hoplimit] [-g gateway] [hops...] host usage: %s -l or %s [-q] name lqpc-xt/pc-atusbadblk201sunsun5hilgscdkfrukjpsvnohuberuuasgsflabrplsicfnodeaddeclklk401swapctrlcapsdvorakmetaesciopenermachdepappletables available for %s keyboard: encoding /dev/wskbd%dWSKBDIO_GTYPEUnknown encoding or variant. kbd(8) needs to be rebuilt.kbd_listunknown encoding %sunknown variant %s%s: unsupported encoding %s on %s WSKBDIO_SETENCODING: %skbd: keyboard mapping set to %s kbd_set?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSSECURELESS-E-G-L-mMOREWARNING: terminal is not fully functionalCannot allocate memoryticdcmsomdmbvbbc|^srget_termraw_modeLESS_TERMCAP_ltget_envLINESlicokrklkukdkPkNkh@7kDTERMhcxndadbpcNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorch_ungetchar overrunseek error to 0ESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off (P)+ [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found help(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Command not availableBrackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%sHOMEbin_file%s %s %sLESSOPENLESSCLOSE...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSplinenum~ Calculating line numbers (press RETURN)Invalid mark letterMark not setMark not in current fileLine number is required after -lless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThere is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeSearch includes displayed screenSearch skips displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by clearing each lineRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesAllow help commandDon't allow help commandCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: Position target at screen line %dDon't display a status columnDisplay a status columnDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: Horizontal shift %d positionsUse keypad modeDon't use keypad modeBe less helpful in promptsBe helpful in promptspostoalinenumtoainttoaiprint_intiprint_linenumap_posap_linenumap_intNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned off x,08DLPX`Іh  @$xt 0@8 bgdumbtimernfsv3rdirplusmntudpresvportnfsv2ac23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -I value -- %sillegal -R value -- %sillegal -a value -- %sconflicting version optionsillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %sNFS Portmapcan't access %s: %sbad MNT RPCCannot MNT PRCcan't resolve address for host %sno : or @ spechostname too longusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node unused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB HPFS/QNX/AUXAIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech Thinkpad Rec Willowsoft $NEC DOS 8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootBSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT Z[s8~eWjbO6p;x7NĞݳ5!8H.Aq~&9ڗU"@ї|u}}>*}{{%nuFr7U2~o|>]x7;?[yȋb/֞~ıyE(2RqZTy =8n>{~wIvJy|zXx{^x‹^𢅧^ ߓo&nkCkv-icU檃+  8w@4h$rD3RpGl۷=+.eXBioio^0#ڦGFxee)TBFF7$ ĪȶqKa+)(* =,'l1q*G-nng0XG⻬JwX;[?: TZAkI.F[8-Q~+9= 1x V1#W^_SFN닠8,:XUĊ)+\ӵ kupNG<XNZiU 76^z$VY_||{!Uv&t.∾\&#;~4= cɇ`c߀~R0iu:2, '3< !q0u9~;W-rt9Rԉe9pti2B&lRX cp4&㛷G0q.s-ܭ9simU& CPz(W-J\J*}n~j'ٴWϴfo.,_= , /&c e,{S&7hU`F,'IQ3sL*NLܠv]ׂD[? Sa \(:ғ¦HC(SN% v6~!مRtQZE t}࿷6OזLNe_N&(œErxK #d[2;7;paɆCx[z'k;%q dLO »[xٙ: X"DoLP3lͿ@릗nţL*XS$"U0pd-Q/-xSV a7ì(ybV=3P,"KiTP;*I,%״Q%wlV@URsQ,ik%%vzh}\*JC)YaKq1KXs]?N4tp 2l]LW8:-B[hxw{umoD ջp}wqzq`xl2tTHЧH }ke!C29.Z sQ7ih^Sog>-9ﮩd/%σzNչQ(M+qXd&6UJ w0;L$KI{Mx^j󱀒a]fmOyցJxl2ja%!'C2Js0h8ǒ ?$klbxCN=\~,=Й^h0Ce-$h`}Yu$hEg)g]މ@uYSVi0yp8Mټo6?BZ"zgiPXΆ(1<} A/^--ae877!V^c١ה_0PKt&Doyz tpǖMfÙ?$c :ڞZ>La`6-2$>jXi(@!_sἁ!ũ@d@g2R9`ȭ8P3;zfxBᾩ8-.|iʆ_|[7ߨoL|0FEgf+q Ӫnv5,o+g2/?lZwi[dʲ ;THo>+ 8`Ume (oqr)ee'.X>iʊ57?Զ& l)v/tP$`$ijؙ KV~JRkiU$NUrl ~ZiK]n3 lf4 "sUlRSS+ydž IA%C[Bx,Ȣ~!Rl,| ADf\]3-&N36[[;&$+qJ F0 .#[>-[nA(U*Xo".͞jwxOܥJݾL] ikOH:&Ȅº{⊞ۍ:褻u3`[ڱY*L6P42N{?jK,‚=(mz#^k (աש6j\ coU+Gt!b챀wNxڨ)7goloߑ\8AD{"=d~Bj6 Ѵ`W`ZU %"ua9b\ v bDwNB- jq :꒵1vOw.ÐWFִu\z7 ~. +9n`Y$MCK2 頝ZTd&f5$πHݚ4!Y*C:R*ݴO̖sog]oL[9bsj:uRqu HڅV}Tn aUP 5 ]t uVaVUI{64֜ABT|WE&͔ $a KjXF0kGFZ&3 qvS٬֧Xёب$g}Lb oV߰*͔sLgmz',#G%;sϩy쩒Zgtk#MjFGPA;%hk$~ţ,FwMōc ^ͫJm@;R %ՋnmcfB3.KPN/w'Q%{݁ +9-~{6c5o\C#V }J>&$Zo1.e|:x^pzړ5ĂTA(ZnԒ$Ȩ{ﯽG!Mm[zs#{UJdy8927O6PMa3ļTww _ZRBh;9Fp@3m4ٝnNG+wl6`]{H8— `WՕ`~0䮙YɼH0j3'q!}L$sL $ ⇟ً,usage: %s [-ieu] [-c cylinders -h heads -s sectors] [-f mbrfile] device -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry `disk' may be of the forms: sd0 or /dev/rsd0c. /usr/mdec/mbrieuf:c:h:s:Cylinder argument out of range [1..262144].Head argument out of range [1..256].Sector argument out of range [1..63].using builtin MBRCan't get disk geometry, please use [-chs] to specify.Please specify a full geometry with [-chs].Command help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statsEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tableWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes ----------------------------------------------------- ------ ATTENTION - UPDATING MASTER BOOT RECORD ------ ----------------------------------------------------- Do you wish to write new MBR? Do you wish to write new MBR and partition table?USER_initMBR is unchangedEnter 'help' for informationfdisk:%c%d> Aborting changes to current MBR.USER_modifyWriting current MBR to disk.Invalid command '%s'. Try 'help'. Offset: %d USER_print_diskBytesSectorsKilobytesMegabytesGigabytesask_cmd%s [%X - %X]: [%X] %s [%d - %d]: [%d] (? for help) ask_num'%d' is out of range. '%s' is not a valid number. %s [n] %s is not a character device or a regular fileDIOCGDINFODISK_getlabelmetricsBIOS fixup botch (secs (%d) > size (%d))Disk: %s geometry: %d/%d/%d [%.0f %s] geometry: Signature: 0x%X MBR_pcopyChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s Warning CHS values out of bounds only saving LBA values Starting Ending LBA Info:%c%1d: %.2X %4u %3u %2u - %4u %3u %2u [%12u:%12.0f%s] %s #: id C H S - C H S [ start: size ]------------------------------------------------------------------------Start of partition #%d after end!In memory copy is initialized to:Use 'write' to update disk.XreinitChange disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsInvalid argument: %s Invalid partition number %d. Swap with what paritition?%d same partition as %d, doing nothing. Invalid argument: %s Invalid partition number.Partition id ('0' to disable) Partition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorLoop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Partition %d is not an extended partition. Writing MBR at offset %d. Xwrite %s %s Machine code updated.Partition %d flag value set to 0x%x. Partition %d marked active. Invalid argument: %s [value] (standard input)(fd %d)invalid file type^\((%s[[:<:]]%s%.*s%s[[:>:]]%susage: %s [-abcEFGHhIiLlnoPqRSsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxybinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpbinaryversionbyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetscontext out of rangegrep version %u.%u without-matchUnknown binary-files optionBinary file %s matches [[:<:]][[:>:]]%lldaFfh:t:v%s: not a directory or special deviceumountfsBad MNT RPC%s: unmount from %s %s: not currently mountedusage: %s %s umount [-fv] [-t fstypelist] special | nodeumount -a[fv] [-h host] [-t fstypelist] x,08DLPX`hGsl9xu:g:m:o:not an MSDOS filesystemstat %sunknown group id: %sunknown user id: %sinvalid file mode: %susage: mount_msdos [-o options] [-u user] [-g group] [-m mask] bdev dir $OpenBSD: fsck.c,v 1.23 2005/11/21 14:27:55 millert Exp $$OpenBSD: fsutil.c,v 1.13 2003/09/25 04:15:29 deraadt Exp $$OpenBSD: preen.c,v 1.16 2005/10/28 07:30:35 otto Exp $start %s %swait %scheckfs%s/fsck_%sexec %sCan't get resource limit for data sizeCan't get resource limit to max data sizedvpfnyb:l:T:t:-b %s%s: unknown special file or file system.fsck_%sInvalid option stringusage: %s [-dfnpvy] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sCan't open checklist file: %s/etc/fstabBAD DISK NAME %s pass %d, name %s Unknown pid %ld%s: %s (%s): EXITED WITH SIGNAL %d done %s: %s (%s) = %x disk %s: %s in fstab more than once!mkfifom:invalid file mode.non-numeric major number.non-numeric minor number.major or minor number too largenode must be type 'b' or 'c'.usage: %s [-m mode] fifoname ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p @(#) Copyright (c) 1997, 1998, 1999 Bill Paul. All rights reserved.@(#) $OpenBSD: wicontrol.c,v 1.58 2005/05/25 07:40:49 reyk Exp $ 8P` |     !("(#($(%@&@'@%d station%s: %02x:%02x:%02x:%02x:%02x:%02x asid=%04x, flagsAUTHASSOCPERM, caps, rates1M2M5.5M11M, sig=%d/%dwi_dumpstationsSIOCHOSTAP_GETALLLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB)SIOCGWAVELAN (0x%x)wi_getvalwi_setvalSIOCSWAVELAN[ %s ]must specify stringstring too longmust specify addressbadly formatted addressno WEP option available on this cardencryption key must be no more than 13 characters longonly 4 encryption keys availableencryption key must be no more than 26 hex digits long[ 0xUnknown Lucent chipUnknown PRISM chip[ %s, Firmware %d.%02d variant %d ][ %s, Firmware %d.%d.%d ][ On ][ Off ][ Firmware WEP ][ Software WEP ][ Unknown ]AP Informationap[%d]: netname (SSID): [ %s ] BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Beacon Interval: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] DataRate [Mbps]: [ %2.1f ] AvailableRates [Mbps]: [ %d.%d Capinfo: [ PRIV IBSS ESS [dBm]: [ %d / %d / %d ] NIC serial number: Station name: SSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Process 802.11b Frame: Port type (1=BSS, 3=ad-hoc, 6=Host AP): MAC address: TX rate (selection): TX rate (actual speed): Maximum data length: RTS/CTS handshake threshold: Create IBSS: Antenna diversity (0=auto,1=pri,2=aux): Microwave oven robustness: Roaming mode(1=firm,3=disable): Access point density: Power Management: Max sleep time: Enhanced Security mode: Intersil Prism2-based card: Card info: Encryption: Encryption algorithm: Authentication type (1=OpenSys, 2=Shared Key): TX encryption key: Encryption keys: Transmitted unicast frames: %u Transmitted multicast frames: %u Transmitted fragments: %u Transmitted unicast octets: %u Transmitted multicast octets: %u Single transmit retries: %u Multiple transmit retries: %u Transmit retry limit exceeded: %u Transmit discards: %u Transmit discards due to wrong SA: %u Received unicast frames: %u Received multicast frames: %u Received fragments: %u Received unicast octets: %u Received multicast octets: %u Receive FCS errors: %u Receive discards due to no buffer: %u Can't decrypt WEP frame: %u Received message fragments: %u Received message bad fragments: %u usage: %s [interface] [-olL] [-t tx rate] [-n network name] [-s station name] [-e 0|1] [-k key [-v 1|2|3|4]] [-T 1|2|3|4] [-x 0|1] [-F 0|1] [-c 0|1] [-q SSID] [-p port type] [-a access point density] [-m MAC address] [-d max data length] [-r RTS threshold] [-f frequency] [-M 0|1] [-P 0|1] [-S max sleep duration] [-A 1|2|3] [-D 0|1|2] [-R 1|3] [-E 0|1|2|3] wi0a:c:d:e:f:hi:k:lm:n:op:q:r:s:t:v:x:A:D:E:F:LM:S:P:R:T:get_if_flagsset_if_flagsbssad-hocunknown port type %sUGHRBD M@dmCXLS1@2 3cJ0123456789abcdefold usage of trailing 0assuming route to if entry in usenot in tablerouting table overflow: gateway %s (%s)netmask missingold usage of trailing digit, assuming route via gatewayblackholechangecloningdstexpiregatewaygenmaskhopcountifaifpipxjumbolinkllinfolockrestmpathnojumbonostaticproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticxresolvebotched keyword: %susage: %s [-dnqtv] command [[modifiers] args] commands: add, change, delete, flush, get, monitor, show dnqtv/dev/nullroute-sysctl-estimate%-20.20s donewrite to routing socketgot only %d for rlen Examining routing table from sysctl(address family %s) actual retrieval of routing tablemust be root to alter routing tableking bula sez: set_metric with invalid keyinet6_makenetandmask128%s: resolved to multiple values%s: bad address%s: not a network%d: bad address familyinternal errorprefixlen is not supported with af %dactual retrieval of interface tablegot message of size %d on %sread from routing socketwriting to routing socketso_labelso_ifaso_ifpso_genmaskso_maskso_gateso_dstRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departurerouting message version %d not understoodprint_rtmsg%s: len %d, if# %d, link: %s, flags:name: %s, pid: %ld, seq %d, errno %d, flags:metric %d, flags:if# %d, name %s, what: departurearrival route to: %s destination: %s mask: %s interface: %.*s if address: %s flags: label: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8lu%c %8ld%c sockaddrs: gateway: %s RTM_GET: %s (errno %d)message length mismatch, in packet %d, returned %d locks: inits: sockaddrs: %s: link %s; sodump%s: inet %s; %s: ipx %s; %s: inet6 %s; label too longRouting tablessysctl of routing tableGatewayFlagsRefsUseMtuInterface%-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %s PortProtoSA(Address/Proto/Type/Direction)Source%-18s %-5s %-18s %-5s %-5s %-22s %-*.*s Address%-6.6s %6d %8ld %6ld %6s %.16sp_rtentryInternet Protocol Family %d: AppleTalkIPXInternet6Encapp_flagsroutename(%d) %s%u.%u.%u/%d%u.%u.%u.%u/%d%u.%u/%d%u/%d%s/%dnetname6illegal prefixlenaf %d: %s*.**.0x%XHany%XH.%s%s.%XH%02X%02X%02X%02X%02X%02XHlink#%d KMGTPasciiimageebcdictenexusage: %s [ | Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.We only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] APPESTORSTOUlocal-filesusage: %s local-files Continue withmput%s: not foundr+wusage: %s remote-file [ local-file ] local: %sRETRgetitremote-filesusage: %s remote-files can't get cwdSkipping non-relative filename `%s' mgetand logged inConnected %sto %s. Not connected. Connected for proxy commands to %s. No proxy connection. (none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. (disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Macros: usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] %s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory Local directory now %s getcwd: %slcdDELE %susage: %s remote-file mdeletefrom-nameto-nameRNFR %susage: %s from-name to-name RNTO %susage: %s remote-directory local-file nlistLISTNLSToutput to local-file:usage: %s remote-files local-file Try again latershellusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. PWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameMKD %susage: %s directory-name MKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1SITE CHMOD %s %susage: %s mode file-name SITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:usage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. usage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". |%sCan't allocate memory for $PAGERaccountbellbyecasecdupclosedisconnectepsv4formgateglobhashidlemacdefmdirmlsmodtimemsendnewernmapntranspassivepreserveprogresspromptpwdquoterecvregetresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquetraceumaskverbose'%s' macro not found. domacroRetrieving %s/%s auto_fetchExtra `@' characters in usernames and passwords should be encoded as %%40Can't allocate memory to parse URLhttp://ftp://url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sReading from filehost %s, port %s, path %s, save as %s. (unknown)Trying %s... r+Requesting %s (via %s) GET %s HTTP/1.0 %s User-Agent: OpenBSD ftpGET /%s HTTP/1.0 Host: Can't allocate memory.[%s]:%s %s Writing HTTP requestreceived '%s' 301302Too many redirections requested200Error retrieving file: %sContent-Length: Location: Redirected to %s Can't open %sCan't allocate memory for transfer bufferReading from socketRead short file. Successfully retrieved file. Auto-login using ftp URLs isn't supported when using $ftp_proxyReceiving HTTP replyWriting %sImproper response from %surl_get http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'*?[]{}Can't allocate memory for URL decoding:/ftpgatehttp%s: bad port number `%s'connect to address %ssetsockopt TOS (ignored)fdopen failed.Connected to %s. hookup---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. %c%c%c421 Service not available, remote server has closed connection. getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s %s: not a plain file. REST %lldnetoutsendrequest receive aborted waiting for remote to finish abort. receivednetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. wrong server: return code must be 227 %u,%u,%u,%u,%u,%uwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode AF mismatch. Shouldn't happen! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s runique: can't find unique file name. Lost control connection for abort.%cABOR abort_remoteNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssu-r requires numeric argument46AadEegimno:pP:r:tvVRetrying... FTPSERVERPORTFTPMODEunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERftp> sorry, input line too long. Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46AadEegimnptVv] [-P port] [-r seconds] [host [port]] %s [-o output] ftp://[user:password@]host[:port]/file[/] %s [-o output] http://host[:port]/file %s [-o output] host:[/path/]file[/] anonymous4K macro buffer exceeded. Unknown .netrc keyword %sError: .netrc file is readable by others.Remove account or make file unreadable by others.Missing macdef name argument. Macro definition missing null line terminator. Remove password or make file unreadable by others.ruserpasspasswordpasswdmachine%s/.netrc: %s%s/.netrcstringlist|%.*s%*s| %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterAlready connected to %s, use close first. usage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. %s@Name (%s): Name (%s:%s): Password:Login failed.$initftp_loginsorry, arguments too long. (%s) unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %scan't find list of remote files, oops.can't find list of remote files, oops. remglob%s %s? n, y, p, a, are the only acceptable commands! Interactive mode: off. Prompting off for duration of %s. confirmSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. Unable to determine real path of `%s'fileindir %3d%% *************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d ptransfer/etc/rcWARNING: some process(es) wouldn't die(can't restart init): SIGTERM processes/dev/consolesetsidrevokeSIGTSTP inithalted (with powerdown) by %shalted by %srebooted by %sdlnpq~usage: %s [-dn%sq]  x,08DLPX`@8|hxІreloadfilesystem must be mounted read-only; you may need to run fsckusage: mount_ffs [-o options] special node F88\x88888 98 98,98<98H98X98t9H99H9H99H9H999: :$:4: L:d:h:x::::::::; ; 4;L;\; t;;H;8;8;i;8;8; <H<8,<8@<X< h<<<<<<H<< = =H4=iL=iX=id=Ht=8=H=H=8=8=8=8=8=8>8 >8 >8H>HT>i`>il>ix>i>i>i>i>8>i>i>i>i>i>i?i ?i?i$?i0?iclient callocifi->client->config callocInterface name too long%s.%s/var/db/dhclient.leasesasprintf%s: no link ... giving up got link cannot open %s: %m_dhcpno such user: _dhcp, falling back to "nobody"no such user: nobodycan't open and lock %s: %mPREINITAF_ROUTE/var/empty/chrootchdir("/")can't drop privileges: %musage: %s [-dqu] [-c conffile] [-l leasefile] interface ARPCHECKcheck_DHCPACK from %spacket_to_lease failed.BOUNDRENEWREBINDREBOOTold_new_bound to %s -- renewal in %d seconds.BOOTREPLY from %s rejected.DHCPOFFERDHCPNACKDHCPACK%s from %s rejected.BOOTREPLY%s from %s%s isn't satisfactory.%s already seen.ARPSENDdhcpoffer: no memory to record lease.dhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.dhcpoffer: no memory for option %dInvalid lease option - ignoring offerDHCPNAK from %sDHCPNAK with no active lease. Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %dNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping. EXPIREDHCPREQUEST on %s to %s port %dsend_requestDHCPDECLINE on %s to %s port %doptions do not fit in DHCPDISCOVER packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDECLINE packet.can't create %s: %mlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } script_init: no memory for environmentPATH=/usr/bin:/usr/sbin:/bin:/sbinip_addressnetwork_numberbroadcast_addressserver_nameprepend optionappend optionno space to %s %sexpirypriv_script_write_paramsunexpected msg type %ureceived corrupted messagefork: %mwait: %mexecve (%s, ...): %mscript_set_env: no memory for variablescript_set_env: no memory for variable assignmentillegal character (%c) in value '%s'%s%s=%sdaemonInvalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xwarning: hostname %s contains an underscore which violates RFC 952option_as_string: bad code %ddhcp option too largecannot fork%s [priv]poll errorCorrupt lease file - possible data loss!expecting a statement.semicolon expected.expecting string or hexadecimal datastring constant too long.expecting hexadecimal constant.hexadecimal constant too long.expected option name.expecting semicolon.%s: unexpected option name.%s: too many options.expecting interface name (in quotes).expecting left brace.unterminated interface declaration.no memory for lease.unterminated lease declaration.wrong interface name. Expecting '%s'.expecting lease declaration.expecting identifier after option keyword.no option named %sexpecting number.expecting identifier.truefalseexpecting boolean.Bad format %c in parse_option_param.expecting string.option data buffer %soption data buffer overflowout of memory allocating option data.parse_option_declExpecting media options.no memory for string list entry.no memory for reject list!parse_reject_statementexpecting IP address.getifaddrs failedno space to remember ifpCan't allocate poll structures.No live interfaces to poll on - exiting.poll: %mreceive_packet failed on %s: %sInterface %s no longer appears valid.got_oneioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %mCan't allocate timeout structure!can't allocate protocol struct for %sCan't create socketinterface_link_status/dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %mif_register_bpfCan't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't set filter-drop mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mCan't install write filter program: %mCannot lock bpfsend_packet: %msend_packetcSclarger than bufferoption %s (%d) %s.Many bogus options seen in offers. Taking this offer in spite of bogus options - hope for the best!rejecting bogus offer.Can't allocate storage for option %s.Can't expand storage for option %s.pretty_print_option: bad code %d%s: Excess information in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of arrayUnexpected format code %cpretty_print_optionDiscarding packet with invalid hlen.do_packeteof in string constantstring constant larger than internal buffernumeric token larger than internal bufferlways-reply-rfc1048llowbandoneduthoritativeackoff-cutoffootingoot-unknown-clientslassiaddrlient-identifierlient-hostnameomainenyefaultynamic-bootp-lease-cutoff-lease-lengththernetxpireixed-addressddiet-lease-hostnamesardwarenitial-intervalnterfaceax-lease-timeediameserveretmaskext-serverne-lease-per-clientrependequestequireetryenewebindeboottartsubnethared-networkerver-nameerver-identifierelect-timeoutcriptupersedeimestampoken-ring-host-decl-names-lease-addr-for-default-routenknown-clientsendor-classexiting. %s line %d: %s%s^subnet_numberbroadcast_addraddr_eqpiaddr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packetssubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81option-82option-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143option-144option-145option-146option-147option-148option-149option-150option-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251option-252option-253option-254option-endpadvalue %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dfilename must be a stringno memory for string %s.expecting a network hardware typeExpecting numeric lease timeno space for numeric aggregatenumeric aggregate too short.Bogus number: %s: digit %d not in base %dBogus number: %s.numeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.buf_open: %mbuf_add: %mbuf_close (connection closed)buf_close (short write): %mbuf_close: %mbuf_read (connection closed)buf_read (short read): %mbuf_read: %mcorrupted message receivedreceived unknown message, code %ddispatch_imsgcannot read temp filecannot seek temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keywordbad hex digit in keybad binary digit in keydes_setkeydes_ciphercbc_decodedecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiter& no previous commandunexpected end-of-filecannot close input filecannot open input file%lu newline inserted newline appended cannot read input filecannot close output filecannot open output filecannot write filecannot read stdin \abfnrtv\\ warning: file modifiedinvalid filename@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? script, line %d: %s number out of rangeinvalid redirectioninvalid destinationno previous substitutiondestination expectedcannot nest global commandsno current filenameunexpected command suffixinvalid command suffixunexpected addressno matchfilename too longshell access restrictedinvalid mark charactered.hup/ed.hupno previous patterntrailing backslash (\)unbalanced brackets ([])infinite substitution loopnothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: name too long (not copied)cannot overwrite directory %s with non-directory %s%s is a directory (not copied).%s and %s are identical (not copied).overwrite %s? readlink: %sunlink: %scopy_linksymlink: %smkfifo: %smknod: %schown: %schflags: %sutimes: %slchown: %susage: %s [-fip] [-R [-H | -L | -P]] source_file target_file %s [-fip] [-R [-H | -L | -P]] source_file ... target_directory ] ]]Tmtuo `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@aa``````%s not a regular file%s%s already has %s suffix -- unchanged/dev/stdout%s: unknown suffix: ignored%s%s: name too long%s: input: %soutput: %sdeflate.gzzcatzipunknown program nameGZIPGZIP is too longoption -a is ignored on this systemillegal bit count -- %s-o argument is too long123456789ab:cdfghlLnNOo:qrS:tvV/dev/stdin-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchangedcompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errordodecompressfchown: %sfchmod: %sfchflags: %sfutimes: %sZgzztgztaz.-_method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out usage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] [file ...] 1.2.3put_headerfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionneed dictionarystream end@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.22 2006/01/25 06:13:27 tedu Exp $HLPRXfghorstuwxinvalid flags: %sinvalid flag: %sthe -R and -h options may not be specified together.user is %s: %sgroup is %s: %susage: %s [-R [-H | -L | -P]] %s file ... [owner][:group]usage: %s [-fh] [-R [-H | -L | -P]] %s file ... $OpenBSD: dir.c,v 1.17 2004/07/05 02:31:54 pvalchev Exp $$OpenBSD: inode.c,v 1.26 2003/10/11 01:43:45 tedu Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.26 2005/02/03 05:03:50 jaredy Exp $$OpenBSD: pass1.c,v 1.18 2005/12/19 15:18:01 pedro Exp $$OpenBSD: pass1b.c,v 1.11 2005/04/16 18:15:41 millert Exp $$OpenBSD: pass2.c,v 1.23 2006/01/25 06:25:46 tedu Exp $$OpenBSD: pass3.c,v 1.10 2005/04/16 18:15:41 millert Exp $$OpenBSD: pass4.c,v 1.13 2006/01/25 06:25:46 tedu Exp $$OpenBSD: pass5.c,v 1.21 2006/01/25 06:25:46 tedu Exp $$OpenBSD: fsutil.c,v 1.13 2003/09/25 04:15:29 deraadt Exp $$OpenBSD: setup.c,v 1.22 2005/12/19 15:18:01 pedro Exp $$OpenBSD: utilities.c,v 1.21 2006/01/25 06:25:46 tedu Exp $?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@dirscanexpanddir blk + cnt %d > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listCG %d: BAD MAGIC NUMBER dfpnNyYb:c:l:m:conversion levelusage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) phase 1, inode %d/%dcheckinodeconvert symlink %d(%s) of size %llu cannot read symlink phase 1b, inode %d/%dphase 2, directory %d/%dphase 2, parent directory %d/%d%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %d (REMOVED)phase 3, directory %d/%ldphase 4, inode %d/%dphase 5, cg %d/%dCREATCANNOT %s CLUSTER MAPS SUMMARY INFORMATION BADBLK(S) MISSING IN BIT MAPSALLOCATED FRAG %ld MARKED FREE ALLOCATED INODE %ld MARKED FREE FREE BLK COUNT(S) WRONG IN SUPERBLKCREATE CLUSTER MAPS%sING CLUSTER MAPS DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSUNKNOWN ROTATIONAL TABLE FORMAT %d INFORMATION; SEE fsck_ffs(8).IMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKcannot alloc %u bytes for cylinder group summary area cannot alloc %lu bytes for lncntp cannot alloc %lu bytes for inphead CONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATIMPOSSIBLE MINFREE=%d IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKclean = %d CPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEoffset %d, original %ld, alternate %ld NCG OUT OF RANGE%s: NOT LABELED AS A BSD FILE SYSTEM (%s) UPDATE STANDARD SUPERBLOCKreturning to single-user after filesystem check catchquitcatchinfoffs_isblockffs_clrblockffs_setblockffs_isfreeblock   init: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'ignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't open %s: %mcan't get %s for controlling terminal: %m/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated, restartingsingle user shell terminated.single_userautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modesession database close: %ssession database open: %sinsert %d: %sdelete %d: %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %dcan't exec %s for %s %s: %msome processes would not die; ps axl advisedNOS:T:a:b:c:d:e:f:g:h:i:k:l:m:n:o:p:qr:s:t:u:x:z:P:T:a:b:c:d:e:f:i:m:o:s:%s: can't figure out file system partitiondisagrees with disk label%s (%d) %s (%lu) Warning: calculated sectors per cylindermfs:%dNumber of cylinders restricts cylinders per group to %d. Warning: changing optimization to space because minfree is less than %d%% %s: no default sector size%s: no default #sectors/track%s: no default #tracks%s: maximum file system size on the `%c' partition is %d%s: `%c' partition overlaps boot program%s: `%c' partition is unavailable%s: %s: not a character-special device %s: getmntinfo: %s%sr%snewfs_%s%s/newfs_%s%s not found%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad average file size%s: bad average files per dir%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: bad rotational layout count %s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad sectors/track%s: bad spare sectors per cylinder%s: bad total tracksinsane maxpartitions value %d%s: mount: %sabnormal terminationioctl (WDINFO)%s: can't rewrite disk label-N do not create file system, just print out parameters-O create a 4.3BSD format filesystem-P src populate mfs filesystem-S sector size-T disktype-a maximum contiguous blocks-b block size-c cylinders/group-d rotational delay between contiguous blocks-e maximum blocks per file in a cylinder group-f frag size-g average file size-h average files per directory-i number of bytes per inode-k sector 0 skew, per track-l hardware sector interleave-m minimum free space %%-n number of distinguished rotational positions-o optimization preference (`space' or `time')-p spare sectors per track-r revolutions/minute-s file system size (sectors)-t file system type-u sectors/track-x spare sectors per cylinder-z tracks/cylinderusage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: %s: exitedchdircannot stat %s%s: not a dir or a block device-rw-pe/bin/pax%s: mount (update, rdonly)unmount %scopy %s to %s failedrmdir %smount %s %s/mnttmp mountpoint %s busygettmpmnttmp mountpoint %s too longmntXXXXXXXXXXmkdtemp %stmp mount point too long%s: initializing cg %ld/%d siginfopreposterous size %u, max is %upreposterous ntrak %dpreposterous nsect %dillegal expected average file size %dillegal expected number of files per directory %dblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dno block size to support this diskminimum bytes per inode isWith a block size of %d %s %ld With %d sectors per cylinder, minimum cylinders per group is %ld CylinderWarning: cylinder%s groups must have a multiple of %ld cylinders panic (fs_cpg * fs_spc) %% NSPF != 0cylinder groups must have at least %ld cylinders!mapcramped && !inodecrampedBlock size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder (not %d) File system performance may be impaired. and ntrakrotational layout tables with nsect%s %s %d %s %d.%sWarning: insufficient space in super block for Warning: inode blocks/cyl group (%ld) >= data blocks (%ld) in last cylinder group. This implies %ld sector(s) cannot be allocated. mkfsfsinit failedsuper-block backups (for fsck -b #) at:%s: %d sectors in %d %s of %d tracks, %d sectors %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) cg summaryWarning: %d sector(s) in last cylinder unallocated filesystem must have at least %d sectorsinode blocks/cyl group (%ld) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increased%s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment sizeWith %d bytes per inode, Minimum bytes per inode is %ld block size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %dpanic: cylinder group too bigcg 0: bad magic numberinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic number (0x%06x != 0x%06x)fsinit: inode value %d out of rangerdfs: read error on block %dwtfs: write error on block %disblock bad fs_frag %d clrblock bad fs_frag %d setblock bad fs_frag %d dfiPRr%s: is a directoryrm_overwrite%s (inode %u): not overwritten due to multiple links%s: malloccheckoverride %s%s%s/%s for %s? remove %s? "." and ".." may not be removedusage: %s [-dfiPRr] file ... bsfbsrdensityeomfsffsrofflinerewindrewofflretensionweof%s: illegal count%s: unknown commandf:ioctl MTIOCGETWriteProtectMounted76543210%s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) %d: unknown tape drive type usage: %s [-t] device usage: %s [-f device] command [count] Lost connection to remote host.shell/tcp: unknown service/etc/rmtwho are you?invalid user name: %sO%s %d rmtopenC S I%d %d ioctlrmtioctlProtocol to remote tape server botched (code "%s").rmtreplyProtocol to remote tape server botched.(rmtgets got "%s").m:pusage: %s [-p] [-m mode] dirname ... $OpenBSD: compile.c,v 1.21 2005/04/11 07:11:44 deraadt Exp $0123456789/\$invalid command code %cextra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandunexpected }branchempty labelread commandw commandfilename expectedunterminated substitute patternsubstitute pattern can not be delimited by newline or backslashextra text at the end of a transform commandcommand %c expects up to %d address(es), found %dcommand expectedunexpected EOF (pending }'s)\ can not be used as a string delimiternewline can not be used as a string delimitercompile_reRE error: %sunterminated substitute in regular expression123456789\%c not defined in the REunescaped newline inside substitute patternnumber in substitute flags out of rangemore than one number or 'g' in substitute flagsbad flag in substitute command: '%c'compile_flagsno wfile specifiedunterminated transform source stringcompile_trtransform strings are not the same lengthunterminated transform target stringtransform pattern can not be delimited by newline or backslashcompile_textexpected context addressunterminated regular expressionwhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'$OpenBSD: main.c,v 1.9 2003/06/10 22:20:50 deraadt Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %s ..."$OpenBSD: misc.c,v 1.6 2004/07/20 03:50:26 deraadt Exp $sed: %lu: %s: $OpenBSD: process.c,v 1.12 2003/11/07 02:58:23 tedu Exp $\%d not defined in the REflush_appends\ \abfnrtv%03ofirst RE may not be emptyxh1 p` t`)  d) | @@ l9 ; 8  |X d) d) Ȧt7 Ԧ@% ܦH: H: $4B ~H C _  S _ Ĩ S Ш4P ب\ Q C Q T C `W P @J $J ,_ 4C <n DD LU |] -a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$ȉH0t(f8cLd\sllmnp t d | @  x ī ܫ ܟ Р  < p` М (t ^$ 84 H X d@ p | @ X p 8   ̬      $ 4 H P \| lH    ȭ Э, ܭ     $  0 @ LH Thb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /&.&_606162636465666768695U5u4L4l3C3c[O%A"BCD#++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():xIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }D̰@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.1 2005/10/06 06:39:36 otto Exp $ac мeؼiu L\d($ t t  @(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBunable to allocate memoryLPrestricted shell - can't cdOLDPWDdon't know current directoryCDPATH%s: bad directorytoo many argumentsno OLDPWDno home directory (HOME not set)can't get current directory - %sRnprsu,-p: %s-u: %s: %spvVpv is a reserved word special is a%s shell builtin is a function undefined (autoload from %s) tracedn exported%s is *GOK*exported is an %salias for alias %s= is a tracked %salias for not foundL#R#UZ#fi#lprtuxfunction %s %T %s() %T %s: not identifierexportreadonly%s[%d]typeset -U -u -l -Z -R%d -L%d -t -r -x -i only -t, -u and -x options may be used with -funalias-tadprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzjob control not enabled%%%*d %*s %s%*d %*d %sls:bad signal `%s'Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %s: arguments must be jobs or process IDsmissing name argument%s: is not an identifierarguments changed since last callOPTARGc_getopts: no argvmissing options argumentlm+alias+cd+command*=export+fc+getopts+jobs+killlet*=readonly=typeset+unaliaswhence+bg+fg%s%*ldm%ld.%02lds%snothing to shift%s: bad numberc_umask=+-rwxugoXsbad maskaugo%#3.3o ugorwxprsu,%s is read onlytrap -- bad signal %s%s: can only %s %d level(s)%s: cannot %sfv%s%*ld.%02ld%sreal user sys system user real :ptime: -%s requires an argumenttime: -%s unknown optioninvalid file modeusage: mknod [-m mode] name [b | c] major minorusage: mknod [-m mode] name p*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unset-tmissing ]internal error: unknown opunexpected operator/operandmissing closing parenmissing argumentmissing expression operatormissing second argumentexpression expected-atime(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)ulimit: %cunlimited%-20s unlimited bad limit: %sexceeds allowable limitinvalid limit: %sx_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}*&;#|<>"'`beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringauto-insertkill-to-eolkill-regionlist-commandlist-fileprefix-1prefix-2yank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcommentx_search_hist I-search: nothing to yank yank something first%s = '%s' %s: no such functioncannot bind, not a ttyPOSIXparameter null or not setexpand(NULL)%S%s: bad substitutionsubstitute%s: parameter not set%s: cannot open $() input%Rfunny $() command: %s*+?@! coprocess already existsPS4%s: can't find function definition file%s: can't find function definition file - %s%s: function not defined by %sCFUNC %d%s: can't open function definition file %s - %s%s: cannot execute - %s%s: restrictedcommand -p: restrictedbuiltin: %s: not a builtinEXECSHELL%s: %s: %sshcomexec: %scould not finish (dup) redirection %s: %sdupcannot %s %s: %s%s%s herein: yylexerror writing %s: %scan't %s temporary file %s: %shere document missing-rPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)%s: unexpected `%s'end of expression%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )missing :zero divisorhistory functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,-%c%scan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e%.*s ${FCEDIT:-/bin/ed} $_error reading temp file %s - %scannot open temp file %serror writing temporary file - %scannot create temp file %s - %s-16substitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrinkinternal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againillegal file descriptor namefd not open for readingfd not open for writingbad file descriptorno coprocess/tmp%s/shXXXXXXXXstoppedrunning and You have %s%s%s jobs no such jobambiguousargument must be %job or process idwarning: won't have full job controlj_init: tcsetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcgetpgrp() failed: %sj_init: getpgrp() failed: %s[%d]jw:last procchildexchild: execute() returnedexchild: XPIPEI and no last_job - pid %dcannot fork - try againwaitlast: no last jobjw:waitlastwaitlast: not startedjw:waitfor| jw:resumecannot continue job %s: %sfg: 2nd tcsetpgrp(%d, %d) failed: %s1st tcsetpgrp(%d, %d) failed: %s[%d] job not job-controlledjobsnotifyzombiej_async: bad nzombie (%d)j_async: job not startedj_waitj: tcsetpgrp(%d, %d) failed: %scheckjobcheck_job: job started (flags 0x%x) Running (core dumped)%-20s %s%s%sj_print%s%5d %-20s %s%s %s%s%s%s %5d [%d] %c DoneDone (%d)remove_job: job not found (%s)no closing quote here document `%s' unclosed PS1PS2dopprompt\%c%r%l:%M:%S%a %b %d~/%smissing ] MAILyou have mail in $_typesetKSH_VERSION-xPPIDOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccdatemailmakeprviwhoENVSH_VERSION$ /etc/suid_profile/etc/profile$HOME/.profileCannot determine current working directory-c requires an argumentUSERinclude: %dUse `exit' to leave ksh shell: %d%s%s-`%c' requires argument%s%s-%c: unknown option |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEFallexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivemarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallvirawvi-show8vi-tabcompletevi-esccompletextrace%-*s %sCurrent option settings -o %sgetoptionsparse_args: `%c'%s: bad optionA:o;sgmatch'\'%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_reopen: missing read/writeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: bsize %dshf_read: flags %xshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: no fdshf_putchar: flags %xshf_write: nbytes %dshf_write: flags %xshf_snprintf: buf %lx, bsize %dshf_vfprintf0123456789abcdef(null %s)too many <<'s for%s: bad identifier too many redirections %s: invalid function name thenelseeliffiesacwhileuntildo{}[[&&||;;((|&unexpectedunmatchedsyntax error: `%s' %s ?%dsyntax error: unexpected EOF ERRError handlerEXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-args# #no-vars# ( %T) %T| %T%;%T%s %T ]] %Sdo%N%T%;done in %;for %s select %s case %S in%N(%S%c%;%T%N;;%Nesac %s %T%;doif %Telif %Telse%;%T%;fi then%N%T{%;%T%;} %T& function %s %T%s() %Ttime %T%T|& < >| <> <<- << >> <&>&wdscan: unknown char 0x%x (carrying on)j_ttyinit: can't set close-on-exec flag: %sj_ttyinit: dup of tty fd failed: %sNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorOPTINDPOSIXLY_CORRECTHISTSIZEVISUALMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENO%s: subscript %ld out of range0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZsetstr: %s=%s: assigning to self%s: is read only%0*s%.*s%*s%.*sy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-%s: destination pathname too longdo_moverename %s to %scan't remove %scannot resolve %scannot rename a mount point%s: remove%s: set times%s: set flags%s: set mode%s: set owner/group%s: set owner/group; not setting setuid/setgid%s: waitpid/bin/cp%s: terminated with %d (non-zero) status%s: did not terminate normally/bin/rm-rf-PRpusage: %s [-fi] source target %s [-fi] source ... directory |&=<>+-*/%:()syntax erroreval5division by zeronon-numeric argument_msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: %s [-M core] [-N system] sethostnamegethostnameusage: %s [-s] [name-of-host] /var/run/utmplogout%s: not a device nodereadlabelfs%s: bad filesystem type in label%s: couldn't read disklabel%s%s%s%c/etc/fbtab(null)%s: bad entry: %s%o%s: %s: %mlogin_protect/*%s: chown(%s): %m%s: chmod(%s): %m%s: opendir(%s): %m%lld.%1lld%c%lld%c0B/var/log/wtmplogwtmp\\#TERMPATHtgetent.termcap /usr/share/misc/termcap/usr/share/misc/termcapTERMCAPOOPS?Ynacosacosfacos: DOMAIN error asinasinfasin: DOMAIN error atan2atan2fatan2: DOMAIN error hypothypotfcoshcoshfexpfy0y0fy0: DOMAIN error y1y1fy1: DOMAIN error yn: DOMAIN error ynynflgammalgammaflgamma: SING error loglogflog: SING error log: DOMAIN error log10: SING error log10log10flog10: DOMAIN error pow(0,0): DOMAIN error powfpowpow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sinhsinhfsqrtsqrtfsqrt: DOMAIN error fmodfmodffmod: DOMAIN error remainderremainderfremainder: DOMAIN error acoshacoshfacosh: DOMAIN error atanh: DOMAIN error atanhatanhfatanh: SING error scalbscalbfj0j0f: TLOSS error j1j1fjnjnfgammagammafgamma: SING error 0C0longjmp botch. no errorunknown/invalid errorresolved protocol is unknowninvalid value for hintsmemory allocation failureaddress family for name not supportedservice not supported for ai_socktypeai_socktype not supportedai_family not supportedno address associated with namenon-recoverable failure in name resolutiontemporary failure in name resolutionname or service is not knowninvalid value for ai_flagsxxswfstabscanfstab: rcmd: socket: %s rcmd: socket: All ports in use RSH%s: %s rcmd_afconnect to address %s: rcmd: %s: %s socket: protocol failure in circuit setup. rcmd: accept: %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: write (setting up stderr): %s iruserok%s/.rhosts.rhosts lstat failed.rhosts not regular fileiruserok_sa.rhosts fstat failedbad .rhosts owner.rhosts writable by other than owner/etc/hosts.equiv__ivaliduser__ivaliduser_sa__icheckhostrcmd: address %s not listed for host %s__gethostloopgetnameinfoip6_parsenumeric/usr/bin/rshlocalhostrcmdsh: socketpairrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: execvp %s failed: %s -lrcmdshrcmdsh: setuid(%u): %s rcmdsh: fork failedrcmdsh: unknown user: %s ,<XpResolver Error 0 (no error)Unknown hostHost name lookup failureUnknown server errorNo address associated with nameResolver internal errorUnknown resolver errorrresvport_af%u.%u.%u.%u%u.%u.%u.%uinet_ntop4inet_ntop6%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%u4@( $,08@HPX`Signal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2p ,8@LT`p|nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaque ,"*"too small%ld%s-blocks%s: unknown blocksize%s: minimum blocksize is 512maximum blocksize is %dGBLOCKSIZE%02x:%02x:%02x:%02x:%02x:%02x%x:%x:%x:%x:%x:%x/etc/ethers+ ethers.byaddrether_ntohostethers.bynameether_hostton*** unknown regexp error code ***REG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routineregerrorREG_0x%xsecurertsctssoftcarwindow/etc/ttys/var/run/dev.db__ttyname_r_basic/etc/protocolsgetnetanswerIN-ADDR.ARPAgetnetbyaddr0.0.0.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa0.0.%u.%u.in-addr.arpagetnetbyname/etc/networks/etc/groupgrscangroup.bynamegroup.bygidreadpassphraseglob3g_opendirg_lstatg_statmaster.passwd.bynamepasswd.byname__YP!__has_yppwgetpwnamgetpwuidmaster.passwd.byuidpasswd.byuid/etc/spwd.db/etc/pwd.db*netgroup: %m(%s,%s,%s)netgroup.byusernetgroupnetgroup.byhostnetgroup: db getnetgroup: Syntax error `%s'netgroup: Cycle in group `%s' ,/etc/netgroup.dbyp_first: clnt_callalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzblankcntrl digitgraphABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~lowerabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ punct!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ upperABCDEFGHIJKLMNOPQRSTUVWXYZxdigit0123456789ABCDEFabcdefalnumABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789NULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL[:<:]][:>:]]authunix_createauthunix_create: out of memory authunix_create_defaultauth_none.c - Fatal marshalling problemT\hp $<P\hx(<TT\hp $<P\hx(<THangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2option requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %sinet_net_pton_ipv40123456789abcdef0123456789/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 9n >= 0 && n <= 15assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" ipx_addr%d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x,%x,%x%3x%3o%3dsscanfb0b1ncdtscilcshssbpxbxfxoxtxdxsimulatedgetenttc%s.dbcgetnext|:execlexecleexeclpexecvpexecvp: : path too long xdr_array: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathvfscanfgethostby*.getanswer: asked for "%s", got "%s"-_/getanswergethostby*.getanswer: asked for "%s %s %s", got type "%s"gethostbyaddr%x.%x.ip6.arpa/etc/hostshosts.byaddr_yp_gethtbyaddrhosts.byname:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy$1$%s%.*s$md5cryptMD5Pad__sbprintfbug in vfprintf: bad baseInfNaN__find_argumentsexponent?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZ?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/&/etc/resolv.conf;#lookupsearchnameserversortlist_res_initRES_OPTIONSenvLOCALDOMAINndots:insecure1insecure2edns001234567890123456789abcdef0123456789ABCDEFinet_pton6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~txf  48 DL TX x| $,D<DL\|hdpKtxć $!DH"\dde $f<@#X`xINCHAOSHSHESIODANYname serverMDmail destination (deprecated)MFmail forwarder (deprecated)CNAMEcanonical nameSOAstart of authorityMBmailboxMGmail group memberMRmail renameNULLnullWKSwell-known service (deprecated)PTRdomain name pointerHINFOhost informationMINFOmailbox informationMXmail exchangerTXTRPresponsible personAFSDBDCE or AFS serverX25X25 addressISDNISDN addressrouterNSAPnsap addressNSAP_PTRsignaturePXmapping informationGPOSgeographical position (withdrawn)AAAALOClocationNXTnext valid name (unimplemented)EIDendpoint identifier (unimplemented)NIMLOCNIMROD locator (unimplemented)SRVserver selectionATMAATM address (unimplemented)IXFRincremental zone transferAXFRMAILBmailbox-related data (deprecated)MAILAmail agent (deprecated)UINFOuser information (nonstandard)UIDuser ID (nonstandard)GIDgroup ID (nonstandard)NAPTRURN Naming Authority"any"/etc/services,/syslog_r: unknown facility/priority: %xvsyslog_r<%d>Error %d[%ld]%h %e %T syslog: unknown facility/priority: %xconnectlog_r/dev/log (08@HP\dp| JanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturday%H:%M:%S%m/%d/%y%a %b %e %T %YAMPM%a %b %e %H:%M:%S %Z %Y_fmt%Y-%m-%d%H:%M%2d%03d%I:%M:%S %p%e-%b-%Y%04d_conv-0GMTmnabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual page/usr/share/zoneinfotzload/etc/localtimeposixrules,M4.1.0,M10.5.0TZvsnprintfyp_match: clnt_callyp_next: clnt_call/var/run/ypbind.lock_yp_dobindclntudp_createfcntl: F_SETFDYP server for domain %s not responding, still trying clnttcp_create%s/%s.%d/var/yp/bindingp4Pp8|0; errno = %s ; s1 = %u, s2 = %u ; why = (unknown authentication error - %d) ; low version = %u, high version = %u RPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolRPC: (unknown error code)%s: %s - %s Authentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)clnttcp_create: out of memory bindresvport_saxdrrec_create: out of memory perrorlibcUnknown error: Unknown signal: _catopen/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGNLSPATHp!!!!!!! "$"8"L"`"|"""""""##$#8#X#l######## $4$X$t$$$$$% %8%T%l%%%%%&&@&d&&&&&&','@'d'x'''''''($(8(L(`(x((((())0)D)Undefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceT\hp $<P\hx(<Txdr_bytes: out of memory xdr_string: out of memory %$sniglet^&isatty ((((( AAAAAABBBBBB arc4_stirsnprintfHASH: Out of overflow pages. Increase page size %s/_hash.XXXXXXopen_temp |p| |@(|8| @|(L|tT|X|d|h|l|Put||B|hKx|h|$|h&|,|,|!|T2|^|^|^|ć|В|Ԛ|}xPH}} },}t h8}A<}TSD}TSL}TST}8\}8d}8l}\8I x}d } }@ }@ }L X }  } }$ } }` }P {$OpenBSD: args.c,v 1.15 2005/04/08 01:46:45 jsg Exp $$OpenBSD: conv.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $unblock and -DNO_CONV?@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: dd.c,v 1.14 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: misc.c,v 1.14 2005/05/27 04:14:24 millert Exp $$OpenBSD: position.c,v 1.7 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_cd9660.c,v 1.17 2005/04/08 20:09:36 jaredy Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: df.c,v 1.43 2005/02/20 01:34:56 pedro Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount.c,v 1.40 2005/05/26 20:16:21 fgsch Exp $@Ѕ :  (88@@HH P\x@h|8|@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ext2fs.c,v 1.13 2005/04/08 20:09:36 jaredy Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sync.c,v 1.6 2005/02/02 19:23:17 jolan Exp $$@@(@h ,p0p 4p 8` @@ H $1м|^t0 Non-system disk Press any key to reboot NB:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:qr:s:t:u:$OpenBSD: cchar.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: gfmt.c,v 1.6 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: key.c,v 1.12 2003/06/11 23:42:12 deraadt Exp $px@@l`<p<<HĞ̞8О؞<$OpenBSD: modes.c,v 1.9 2004/09/16 09:55:09 deraadt Exp $$OpenBSD: print.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: stty.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $| 08@|HPsX`dȅltą\xpȅ8x/tmp/EdDk.aXXXXXXXXXX0:$OpenBSD: dkcksum.c,v 1.7 2004/09/28 17:57:46 otto Exp $$OpenBSD: editor.c,v 1.101 2005/12/05 21:30:40 miod Exp $| 08@|HPsX`dȅltą\xpȅ8x abcdfiklnoprstuvwxBDEGHLPTUXYZ0$(P>l|L$(P>nL$(P> n(P>h|(zB`{wB wwPz((\w$twwP>8~.? ɚ;> ...@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.14 2005/02/03 05:03:50 jaredy Exp $| 08@|HPsX`dȅltą\xpȅ8x@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cat.c,v 1.17 2005/04/05 01:18:53 jaredy Exp $ i0kkkkk|4$,dH$OpenBSD: cmp.c,v 1.5 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ls.c,v 1.27 2005/11/30 00:57:25 deraadt Exp $P.$OpenBSD: print.c,v 1.24 2005/06/15 17:47:17 millert Exp $$OpenBSD: util.c,v 1.12 2005/03/24 22:53:15 jmc Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. @(#)ping.c 8.1 (Berkeley) 6/5/93.dAćԇ,9ČȌЌԌ;lK، ܌      \  $,4D L@T\d"" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)a b@H@`BXcPԙ dAHde0|fp̚F8,ghPph4ЛHA`$i,@`xj$J!@ԜlH L\ ,mdDTdn"LppHPq(ȝr"0Txs!<ОS!|u"<XVw"tpȟx( XA@yT`xz"Ԡ~!D?#$8.AlXh (press RETURN)... (interrupt to abort)؏(381@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ $OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxU[i] R(PXXXS\U\hL\iY@T4ZP4[t[[[$$<0?@<,<DTAdB>CDtEFGUVabceKfhiLlnqq$r0s<vLwXxdu@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.16 2003/07/29 18:38:36 deraadt Exp $$OpenBSD: mount_msdos.c,v 1.19 2005/04/08 20:09:37 jaredy Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.13 2003/06/02 20:06:15 millert Exp $ AB,@ThC|71D(D\|%-  4CH81d  * kacde fm0n\pq\rs\txA*DECM%P R-S TF71$%HT\^dh(p x L x  l|L`T`؇l^5^ !"#$%&'() *+ ,,-4.L`|8Xx< pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD LABEL(Tf\dl d6\H=\IPTt.H|L4LUT}(GIxL^D3^6D9I.HxPdL0!012/0H\5|@[TB9V7 |;%}B(|;8,Y|@[4<Z|9DlNLLdX@[TT\3h0t1dJ,|AHD0! !'$9U|HCZUp0DE$YL)TtVl.\LGl@p0fSD@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $lx @(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.26 2004/07/09 18:49:57 deraadt Exp $@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.18 2005/04/08 20:09:37 jaredy Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $ /sbin/dhclient-script( 0(EHC P E(  0(EHDHC ;Zx0N$OpenBSD: buf.c,v 1.16 2003/10/18 19:15:43 jmc Exp $PN$OpenBSD: cbc.c,v 1.13 2004/05/08 07:05:19 deraadt Exp $@ $OpenBSD: glbl.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: io.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $`M$OpenBSD: main.c,v 1.28 2003/06/11 23:42:12 deraadt Exp $DMH$OpenBSD: re.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: sub.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: undo.c,v 1.8 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.30 2005/11/09 20:03:29 otto Exp $$OpenBSD: utils.c,v 1.26 2004/12/10 10:23:30 jmc Exp $____ _> ... ...| 08@|HPsX`dȅltą\xpȅ8xf?@[\\]0^<^P_\_h`x{{|}}~(%,%`%&'?| 08@|HPsX`dȅltą\xpȅ8x2  ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz:./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789abcdef 0000000000000000}`4l LKKLKp LKKLKq LKKLKs` l t(@xD  L\t8<DL 440h40<p DUl>'*$NetBSD: ffs.S,v 1.5 2003/04/05 23:08:52 bjh21 Exp $$NetBSD: memcmp.S,v 1.2 2003/04/05 23:08:52 bjh21 Exp $.shstrtab.init.text.fini.rodata.data.eh_frame.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident PP$ttz${گ%\d+5>C J  QZ\k _fq44~ma  ln}of!NI u p + & d _afs*QQafs Daemon/var/empty/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 Server/var/empty/sbin/nologin2_ospfd*UUOSPF Daemon/var/empty/sbin/nologin3U_dhcp*MMDHCP programs/var/empty/sbin/nologin3M_identd*identd/var/empty/sbin/nologin3_ppp*RRPPP utilities/var/empty/sbin/nologin1_ppp_mopd*NNMOP Daemon/var/empty/sbin/nologin1_mopd_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 Server/var/empty/sbin/nologin1popa3dLGhc" ? : X " X _ppp*RRPPP utilities/var/empty/sbin/nologin2_pflogd*JJpflogd privsep/var/empty/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin3V_mopd*NNMOP Daemon/var/empty/sbin/nologin3Nnamed*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam Daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmspfa#A< r m & ! P K  _ntp*SSNTP Daemon/var/empty/sbin/nologin2 _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam Daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2_tftpd*OOTFTP Daemon/var/empty/sbin/nologin3Oproxy*GGProxy Services/nonexistent/sbin/nologin3G_ftp*TTFTP Daemon/var/empty/sbin/nologin1_ftp_ntp*SSNTP Daemon/var/empty/sbin/nologin1_ntp_afs*QQafs Daemon/var/empty/sbin/nologin1_afs_rbootd*PPrbootd Daemon/var/empty/sbin/nologin1_rbootd_tftpd*OOTFTP Daemon/var/empty/sbin/nologin1_tftpd_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X Server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"ID { v   P _ftp*TTFTP Daemon/var/empty/sbin/nologin2!_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/ksh2_rbootd*PPrbootd Daemon/var/empty/sbin/nologin3P_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/ksh3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin1_hostapdproxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd[T vq ~ > 9 j e !  _ospfd*UUOSPF Daemon/var/empty/sbin/nologin2"_dhcp*MMDHCP programs/var/empty/sbin/nologin2www*CCHTTP Server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_afs*QQafs Daemon/var/empty/sbin/nologin3Q_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody_ospfd*UUOSPF Daemon/var/empty/sbin/nologin1_ospfd_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadmin"vm,%KB k f  u p / * Q L   _hostapd*VVHostAP Daemon/var/empty/sbin/nologin2#_mopd*NNMOP Daemon/var/empty/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_ppp*RRPPP utilities/var/empty/sbin/nologin3R_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 Server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam Daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1root\Vpk-( Z U    z + & Q nobody*Unprivileged user/nonexistent/sbin/nologin2$_tftpd*OOTFTP Daemon/var/empty/sbin/nologin2named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_ntp*SSNTP Daemon/var/empty/sbin/nologin3S_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP Server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X Server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP Server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucplg&!72 N I  _rbootd*PPrbootd Daemon/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X Server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_ftp*TTFTP Daemon/var/empty/sbin/nologin3T_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerd . install.md set_term() { local _tables TERM=${TERM:-${MDTERM:-vt220}} ask "Terminal type?" $TERM export TERM=$resp [[ -x /sbin/kbd ]] || return _tables=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "kbd(8) mapping? ('L' for list)" "none" case $resp in [Ll?]) echo "Major tables: $_tables" ;; none) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done } welcome() { local _q cat <<__EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD in a simple and rational way. At any prompt except password prompts you can run a shell command by typing '!foo', or escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C and then RETURN, but quitting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat <<__EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat <<__EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat <<__EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat <<__EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat <<__EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it." } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } get_ifdevs() { ifconfig -a \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_serialdev() { local _d _bd _td [[ -n $MDSERIAL ]] || exit set -- $MDSERIAL _d=$1 _bd=$2 _td=$3 set -- $(scan_dmesg "/^${_d}\([0-9]\) .*/s//\1/p") echo "$_bd$1 $_td$1" } get_drive() { ask_which "$1" "contains the $MODE media" "$2" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } get_partition() { local _drive=$1 _fstypes=$2 _part _fst disklabel $_drive 2>/dev/null \ | grep '^ [a-p]: ' \ | egrep -v "swap|unused" \ | sed -e 's/^ \(.\): *[^ ]* *[^ ]* *\([^ ]*\) .*/\1 \2/' \ >/tmp/parts.$_drive disklabel $_drive 2>/dev/null | grep '^ .:' ask_which "$_drive partition" "has the $MODE sets" \ "$(sed -e 's/^\(.\).*/\1/' /tmp/parts.$_drive)" [[ $resp == done ]] && return 1 _part=$resp _fst=$(sed -ne "/^$_part /s///p" /tmp/parts.$_drive) ask_which "filesystem type" "should be used to mount $_drive$_part" "$_fst $_fstypes ffs" case $resp in done) return 1 ;; $_fst) resp="$_part" ;; *) resp="$_part $resp" ;; esac return 0 } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while :; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _err=$5 set -- $_list if (( $# < 1 )); then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_def:=$1} _list="$*" while :; do ask "Available ${_name}s are: $_list.\nWhich one $_query? (or 'done')" "$_def" isin "$resp" $_list done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file >/tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >>/tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" <<__EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi cd /dev ; sh MAKEDEV $_dev || return 1 ; cd - >/dev/null } addhostent() { local _addr=$1 _name=$2 _delim="." [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].* $_name\$/d" /tmp/hosts >/tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do _action= _next= echo for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "Set name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_ifs() { local _IFDEVS=$IFDEVS _ifs _name _media _hn while :; do ask_which "interface" "do you wish to initialize" "$_IFDEVS" \ "" "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat <<__EOT The media options for $_ifs are currently $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the media options?" case $resp in y) cat <<__EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media || return 1 ;; n) _media= ;; esac fi rm -f $_hn v4_config "$_ifs" "$_media" "$_name" "$_hn" v6_config "$_ifs" "$_media" "$_name" "$_hn" [[ -f $_hn ]] && _IFDEVS=$(rmel "$_ifs" $_IFDEVS) done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } v4_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$3 ifconfig $_ifs inet $_addr delete fi fi [[ -x /sbin/dhclient ]] && _prompt=" or 'dhcp'" _prompt="IPv4 address for $_ifs? (or 'none'$_prompt)" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then addhostent "127.0.0.1" "$_name" echo "dhcp NONE NONE NONE $_media" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp NONE $_media" >$_hn fi ;; esac } v6_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up rtsol -F $_ifs addhostent "::1" "$_name" echo "up\nrtsol $media" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp $media" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _netfile _gw for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} ifconfig $if >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -host `hostname` 127.0.0.1 >/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat <<__EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $_ftp_active -o - -V -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $_ftp_active -o "/mnt/$_f" -V -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) [[ $_f == xserv39.tgz ]] || continue ( cd /mnt/usr/X11R6/lib/modules ; rm -f *.[ao] */*.[ao] ) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" "${_get_server_list:-yes}" _get_server_list=$resp if [[ $_get_server_list == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $_ftp_active -V -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while :; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then case $_ftp_active in -A) resp=no ;; *) resp=yes ;; esac unset _ftp_active ask_yn "Does the server support passive mode ftp?" $resp [[ $resp == n ]] && _ftp_active=-A fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp _passwd=root@`hostname` if [[ $_ftp_server_login != anonymous ]]; then resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -o - -V "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls -l $_dir)" } install_cdrom() { local _drive _part=c _fstype get_drive "CD-ROM" "$CDDEVS" || return _drive=$resp set -- $(disklabel $_drive 2>&1 | grep '^ c: ') case $4 in ISO9660) _fstype=cd9660 ;; UDF) _fstype=udf ;; *) get_partition $_drive "cd9660" || return set -- $resp _part=$1 [[ -n $2 ]] && _fstype=$2 ;; esac mount -t $_fstype -o ro /dev/$_drive$_part /mnt2 || return install_mounted_fs } install_disk() { local _drive _dev _fstype _fsopts ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" "$DKDEVS" || return _drive=$resp get_partition $_drive "$MDFSTYPE" || return set -- $resp _dev=/dev/$_drive$1 [[ -n $2 ]] && _fstype="-t $2" [[ $_fstype == $MDFSTYPE ]] && _fsopts=$MDFSOPTS if [[ -z $(mount | grep "^$_dev") ]]; then mount $_fstype -o ro,$_fsopts $_dev /mnt2 || return fi fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" "$MTDEVS" || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while :; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" case $resp in "") ;; ?) ls -F $_zonepath ;; *) _zonepath=$_zonepath/$resp ;; esac done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue ask_yn "'$_s' was not installed.\nAre you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d=disk _locs="disk ftp http" [[ -n $CDDEVS ]] && { _locs="cd $_locs" ; _d=cd ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" echo "\nLet's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -z $DEFAULTSETS ]] && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin "cd" $_locs && install_cdrom ;; d*|D*) install_disk ;; f*|F*) isin "ftp" $_locs && install_url ftp ;; h*|H*) isin "http" $_locs && install_url http ;; n*|N*) isin "nfs" $_locs && install_nfs ;; t*|T*) isin "tape" $_locs && install_tape ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat <<__EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the $MODE. __EOT exit fi done /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi [[ -n $(ifconfig -a | sed -ne '/[ ]inet .* broadcast /p') ]] && v4_defroute edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { local _bd _td ask_yn "Start sshd(8) by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi ask_yn "Start ntpd(8) by default?" no if [[ $resp == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" yes if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi fi [[ -z $SERIALDEV ]] && return set -- $SERIALDEV _bd=$1 _td=$2 ask_yn "Change the default console to $_bd?" [[ $resp == n ]] && return ask_which "speed" "should $_bd use" "9600 19200 38400 57600 115200" [[ $resp == done ]] && return echo "stty $_bd $resp\nset tty $_bd" >>/mnt/etc/boot.conf sed -e "/^${_td}/s/std.9600/std.${resp}/" \ -e "/^${_td}/s/unknown/vt220 /" \ -e "/${_td}/s/off/on secure/" /mnt/etc/ttys >/tmp/ttys } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi echo -n "Making all device nodes..." cd /mnt/dev sh MAKEDEV all for _dev in $DKDEVS $CDDEVS $MTDEVS; do sh MAKEDEV $_dev done echo "done." cd / md_installboot $ROOTDISK populateusrlocal [ -x /mnt/$MODE.site ] && /mnt/usr/sbin/chroot /mnt /$MODE.site cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT md_congrats } ROOTDISK= ROOTDEV= VERSION=39 VNAME="$(( $VERSION / 10 )).$(( $VERSION % 10 ))" SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" OBSD="OpenBSD/$ARCH $VNAME" SERVERLIST=/tmp/serverlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot DKDEVS=$(scan_dmesg "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") CDDEVS=$(scan_dmesg "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cmsw]t[0-9][0-9]* /s/ .*//p}") IFDEVS=$(get_ifdevs) SERIALDEV=$(get_serialdev) THESETS="bsd bsd.rd bsd.mp $MDSETS" DEFAULTSETS="bsd bsd.rd" for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $0123456789abcdefX_)ptX_ eT X_, c ؁ hy ` X_8#$X_:8#$ԖX(X_<~X_+@|X_,dX_) 8#$` X_ 8#$X_gD8#$X_8#$<40V_X_ @xcc@2X Xd$` Y_$Y_d[_h[_l[_p[_t[_4Y_0Y_[_LY_PY_[_ ʚ;5ym8@ E82(@AAA==(A*X_X_X_X_X_ Y_X_X_X_X_X_Y_Y_X_gQ [_[_  @ 4ATL 4AM 4A4A4A4A4A4AT4A8d4AT4AT!\""4AT4A4AT4A<\(  % 3u Du u <u 8u 2u 0&'u 1&u 0&u     )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u  *|# # hF8F`lkhlO  ȝ$ $,4<DLT\`dhlptx|$0`xd2ddP ++#aa@(([//\))](-{/-|)-}!!c/l-y-soxoco<<>>??  ` ~ ^ "' AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uyL$Boldface.iso1  _wfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xpК_ _  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ް__2 _);_ad___x_______  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~_o>_____  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     l_a?l____&_! _@ \ 44$NetBSD: blockio.S,v 1.4 2001/06/02 11:15:56 bjh21 Exp $.symtab.strtab.shstrtab.text.start.data.sbss.bss.arm.atpcs.identD !_(@.__4__T9_D_9_K_p{  HYa^N__  >"|LO84etlCl ?\@-t p pW8 D Y dpX)0<Ha_R@x\-ecr`_{0tFCdo\pxVL 4HP Dc8 &@b6hAt,XSdf\fw7,_P+<l| H5$8D@XXb,`)U,3hC<G<NLbcDr=y6@ << $`R <XnP(AD"'~3)<;CLt`YIbxFrJ |xJh a a\a pb bb04  H*@30$CHG,>HS|x _4K jp{@T EB @,dD_ p |p0Q;"\0a>iRY8dOv}@a_9$cP`DU( l- `c( ( p7 UD cQ i g `mr U Wc D R a_ 0  8 x9  m0 T,. lac 9 h@ HS \Qxf ap f_ w b  83 $@  , a h h/ h M < D Dja$ @WX1 <  PE p/(S xbk |`z  <{ < dX t Tup K b_0 L: h# h, : p D x9tX  j <y  d  TT H D !P D piaD  ( Г_ ̷ p# x0  $? S \Rg Op ,p\ p @ T H  T-h B4 Ġ P  D 1h b;LxLWH^<o |Lh,88Cp]TD P\ @ $A5dHWRl([,2,cme}  h_]8$\ L4 $b3Tdb l l+078d8E$ bQ9X_ co8 {HN@(XTa4HL|9 h(c@z  *,9+p@UPNdT4\dJr~`GH X(0 ta X@$P6c( htG$\r,, 9̧C0dOWcXWcgsxwPF7 ,=8G \0$0}$2F<@GhCPY 0a  aU DDG0x:TxT{ x$U .l<T G/S 5t[ahXs|P \f_ cX l @41P0Wxac[Ha%8daFRg!Ls`lh DX7xX44QUc(E t.tk$F4]a\iauIaȪa|ta@688 P_|E|+G:H4\c,,x |  R@h3DEh btbPL(b 1[_$`F6FGGVlgaq`} LiH  W p@E,`bX  е<8 -l9dF<8S)c [0 | g4 Dpddahx@8X4 TXO <\\b0a& .14C;Cp|xOWcf<rH@|xqu@ax 844(F\ a_PU %_0;D8PZ hyxihCh[_sx@W V(mD?p5 D&4P/a(?O Q@e|94\  c0<Lm L h8( @tjNDbc^OTk },PpWc X(btd_ka ЉU 8t N0* ,5>[q e0v Є( " 4UQ ph(lL&E!8$24(FL\LZtEkX*0w< Q lWlXS4 <,`.  q( 8 0 p4x> dG  P S^ <o Xz D < hS| , @f Pb l= X a$ h  T ! !tP(!d9!P- J!t`!PmHl!\L!Lb!@!!!a_!v`!j!0`!v!H!Ա"ȕ  "l "܍a-"X_<"J"$`T"dbb"x"XS"&D"@"P"C`" x"8/("[(#Ml#Xd $#|4#D#`4 R#4l#@#T##8<#X#PP#B#H#@ $##,$Wc$)$$T :$LB$̙M$c`$h ,o$4f_y$:$$`$8L$H6$4($T$9$$$% c%TI, %Pc6%Ȓ XB%M%|a%q% ~%Lp%Z% %%%t%8%vl%(% T&p- &4a&,&DY_D&(_&$\h&4 t&X p&  &؛ H& &HP \&&&^p&t&N'Vc '\"'(09'MH'UT'@ a'+n'XC~'t('<L'\S'<'@'̺`'8' _((Ucx(bc$(8 `/(>(Q(c`(,k({(oL(`C(<b(m (0(Wc(@(D)p\c )b)()(0)d<)I)a)!m)p[_{))k),<)X))H_)`8));D); *D*x)* 4*xz;*$R*Z*ad*n,m*9\{* *F**dH**y*+D' +2+ | &+3+Q(M+lYY+2 d+l5{+9p+(+|+<:+ Y_+tG+X+\_+r+0,x\ ,,q!, (,D`C,hR,o`e,,_v,H,8,V\,< ,l,,b,$,x,@,,|Z, --$)-4X5-0) B-T-r-t -!-t-cc-J-B--(-P_-Y`-`c. 8..,-.H<.b_S.Za.|j.St.pW.2. .$_.0.$[3Ai3m s3<tQ<_ Z<4Jhg<<  r<w<_<G<(<Hq<P<B<E<.p<<Ho =x="=Da)=5===pd0J=< [=H/a=pka@n==8S=(@x=E==0C =X=la=6c=P@= >@>Xa#>h(>3>va@>${`Q>\ c>q>a>>`>D>Xmx>4 >c>4*l>t>7>k p>(?(?"?@59? 4Q?<[?Lj?/z?X_ ?pE4?,?L&?<?9$?\\?@??d @0,@D@!@@P01@0G:@ E@<(U@t `@4dn@F@<>L@P @H@d8@X@l@Vc@AhcAhdaAx|AHl%+A`5A07DA4 tVAPiAxwADA\aA/AXy0AaA A4A\`AOA<AL$ B3!BȐ(B .B(6BEBpMBd^BFxnBd7pB.PBQB8 B&,BxSBa_BELBxx8C@<C9C/C:hDxKD$^D.lD<vDD(z`DpDhDd4DdDDDD EGE"ET`2E,c$DEElQEyPhEH9sEe_E: EH!E EEEH\E/X EE$ FHPF|$h!F0F tJFPE`[F=qF*|F(aF EFd3FpF` FTrxFqFTcF\F G,G4!Gx ,Go dK|=PK ]KHtKP(K0K<Ku KdcKr KHKd KppL LGL+Llc4LHe@DLph RLcP^L lLvL<HLG LLLx L<LX8LhxLxT4LXLs Lpax M _MI$ Mz,M/p;MxhEM\{ NM7cM` @lM muMy M*M_M MUMUM VM̪aM8-M\NHlNPz NWc,NP8>N (KN@,[N Y_mNTN0N NKLNbNTBT`d TtX5TFT(]_QTU ZT pT~T$UTT<T To \T8XTTlsXT0T@Ud$UaUT*Uȑ6UEU\0PU` PbUanU<xU`+U UWU{dUVcU4Up xU_U8.8U} UU VuVV| D*Vl 6Vx%<GVcYVpbV(h DjV,x}Vhy V~VVvaV$V_VDVxn lVK dVb WvWb_#W44/W4G6WNEWV_XWlgW qW [_~W2WWWWt!W: W_W%WHW0TtXh Xb"X b5XVcFXhTXН@`XĈ_iX \tX,~DXpJLX$<X\>X[_XlXtX\aXx_X8YaYYha&Y4YyH=Ye_RYI[Y <kY3wY_TY@YtY Y YL|Y1dYVcY Y@YbcZ0W_Sg_r_a_H_ __4p_,__P6$__L_QD `w`<``t |-`4A`wO`\`he`^j`@P`@`a`a`) `dz`^L` x`[` a cXa Lah\&a 4/alT9a Ga8Sa`a\ja-|a|Fa`1a<adA aaa\laXaOaPea\  b1bb,bt@gLJg)Zgo\fg\lgj\"hFj\Zj& (hjUsj|_{j(j\ ljjj dj8jj k@ck -k8%k81yr8y$Iya8Uy7byGqy- yt 4yB yLAyHy \yU(y|2y DyNybcy|a zP Pz@/zdDz|Vz{_zbqzkaz(8z/z zNz zHz) zzU{^{ T#{T:{|_{b(h{ xv{a~{X{{X3{ G({${h6d{c{5h{Q |`!|&|dh3|>||P|p>X|l| y|L|h_|z8|Ph|\|yD|H||>| } }}4$*}(-x8}FM}he}<p}r `y}4G@}(d}a}آ}}Tc}l}i} #`}?p} ~D~8_~al%~plh3~duB~YL~<|U~,l_~_g~Xp~ ~D~T~l~T$~0(@~,,~P~L/~~' 4t,+X6DXR LQ4Wf,ap<z`Qd Al$x$L( P,-   #'0.4$=XGPcHLD<W T^iac rzpt<p0Tǀ̭Ԁc ߀>0FX t x) 4x @hL`5lmQ}  Z(dú- ށ4aعXLclHO  t- =4R$Hdȶ\m$| @g4xǂl΂ق<߂U_+ N.Q>(aE+Q0H`< lx_tcOȾ8H0<̃N- E# 8RTE] 7nxdT<cL3dj L4ƄyքL ݄K$?`@d>!0l 1\? @<<H<Y8Fop{`  x h?Hl4X4ͅ,lޅČ  8 @t|:%H9CTAN Zldn_~4ԹPaȇ$.ņLT҆<*݆@V H L(8!HHT-0 X6HF NtT0D_hv@} <8t&(Ç,b҇P= < |b P @<-F h6X_4B<_M(8\t8}ltTP ʈ-$Ո4E]a@@ax8$, < \JUc `Dt0cи_k LƉ $Ӊ܉تTL( Db$*L,2xr>!`HULg` qa{Da_ X <qLʊDԊM 0G X@e 8 1'l9@cBD5K Utds8}Tu (1ȋjЋ8i0ۋ$P# -pdT"d H07*H;NpXgXu\4Ip4ԊŒVtՌ& tpjWc \G*9cPIbcT\c+rLaehTY p, ύ`aՍ8mLߍG@b  c p@&@,1db=,DQ8 T`6u4.ah4ÎP Ύp ߎ]aaL_dx.9KZ1jTa0sLz @ `LT8Џ K܏( 08lT+ |4ZGX c[|h8>dxa<PS`Xc<+lFDUXKDQy ,_,flTu\TWcDx@̞`(_h8a%E5 $@ FJcX8xeR{1/({@ccƟhݟ`<c edl  ta.TcT;Reab,s|p a_\[ ^HXpѠ$D۠dTPm`4TX_)9l Bx DJ؉ <WZGh`q,` p{8l|D|H|͡@ԡP $|P$ wdE#23 >XhKxLYafP\X#(8pam$u h¢G4Ӣݢ ka@Rld,!hb+/56(D=Jd4[|[_hY_oXd| o`},L0a0p lT b4Ƥ ҤڤT lYX(~,>$FT[$ 8ebnp%$w X`X7 0d 8̥ ܥhP Ԛ 6$K\b#.(6pcE xW`ac_WcnpDw8   Du6æDЦL@ܦ_q_ 4;L< ,=$kaHLYa,rX <3@ §%0̧ $٧(t @ F H)B@W^_f %\pa8\^` 4t$ę̀ۨ|ma,T)ؕ_=d;<Ui\gTq,|U$:04H8tɩөܩHXX FLY `#L$,va48@rHaHL l0tP}4(FLԩLd Īتp,@4p -  , 8.P7 CSR`m_{qd\Y_Ыpbc  L, _hO@"+p*bcA Ma$r44 |8¬hά@ެ} (`$$TL l,(a9xC`Q8E(]LjdPXta|IhPl`H­Wc˭ b٭-? t ( &$DGT$Q8`FDAOa\H"e`qHod 0Е\|Ю\Hݮ,d144̫h*X;C0X`d,k% z ,d~0d(LPǯկ5$ Zdv 0.Dbc8r#|i-PJ@%DH@bW <dLl[~Db@8 [_<Z,ðXʰDDҰ14ݰ<l0b,"4v.b8e|HNa]Vch sd8~H.l@Sx(_o ɱt_ӱ,߱4_ q!>*0/1LFH|X|ftq@ |PX T8YlP@.²0Wղ  dhx@b$+ 86H <TN KXc\c ljtF$}m@< @T- ȳ6ݳaL] |@@GP#lyP1G=,aI[@ hL[(w`f3(p1LǴdCڴ\4ud@(Y_\ ,@p% dG<RT]Pgvdtl2 <^\Lc_X еa$ܵtbHia8<+$#&,iT4,/A4L Z ghu4 }(BVcL,VcŶ>Lֶ߶(`@<<.K8Hc(2$=@ FT\d4u( TTULSǷUطplT \ @l\%42xa>Ph STdho<4~ c@axbT_ɸ0ka<ظ< u0O@` ,"/Hp? @LD ^jsP(L4m,̹0 ݹ4a [ cdDT#@x/;H@U$ a lxx(!,kaa0 @ Ǻ* ԺHODpj8~Le@XbpXR XcʼxaGXC"2\D `ZLP<gtvh P0 0C ͽXcp.(>tDh'20/Z x<K\Q <W_dVw%{X,t4ѾDS 0޾>T |$B @x xD%,MT5OHXPV<&\D-f<Xv l8\ěl ÿ$J Ϳٿ| j$* ,R<MX~D\4<0q\P>(lFh,<,8$ $X'-$;L8F Sk4_ g`v7 XZ`{@ 0P4Ha(g@Vc@q `utQ,$$0/PT=0aEaL\Z pБT) t0ae\0@ Mkd}Kv0^_xpX_H/\=bK(aT:$q DzX` 4\btp: HDsp[T]\1,HTxO]l_cy h< X0}.( H$\ |0!.S(6CKaX<f |H<H0fL\\P1 8.$"<6 .((>8<Sagxe dvb7$p  [@@cpE ̨P sX  '|M4 XcHGOȥa(\2fd{ e_X08q|a\P xHY|L(83CXN [fį (q h/ HO$B\At?t[PRxphWd ~4.$ @5ta8C0SD,[̋giLzEL>sp H\_ |x.  `Y #p0@r$Tl \ <cn8POtb(; H DHva!4 .px =2R'_llv <|xB  7 lxx|aTc 'x -Lb<!hCtcMI YP@b|xw T C l< at Pa`d_4DГTpbH$ x 0V_pB4!>@0<]_;NxTB hht>00`b 'x '$4l=GZ8bp@n|adt cLb m0l0$P\.Dq,X< HC(Z,nT`y P<4G8at44sxhX0tX@*X_;lH`DTP_m)|xX( d@8X(0@H(gX,`X  PE(1;(Hp0RbTo i(~8.x,X<p,=p Da(h@Fd5a:R(E\-\$hGtb? T$a  La hS4h-58BLODg\|<D  p~x8\ ,<|0a\&a4DdE_LhQX4\@oTp _ȕ_d*l$Ta_0 .(_4!h87ȳE$tY03 f&dyt44d  l|-L4< |$7)P FpFSdpZ&HtFb4^c# aP3B0\>D4{l * 5$TB|N$e^k 2uP3ETHEW$`|"ؐ<0HJa_S$Ac(Xq}8_|W@- u8]TȞ M || %pw1y =TD\L? xY\f4{Dj \$%lb_@>0T tR X <%=:̏J$ cX @j_qp@LT XĝX8r,ܙ x, 0Vc XXD5$/t8Dx& R`cY<pn̳u( $,ȝ0>X$a_( Hܻ\-\Xcp+X4p=HtTbZfybHHXWMz TZl<ja_qlX<$ <\ @=L8\]_ DUcL_0.$kl c!\P6_cG4SddXo y$Ld_(SH H$8H tz ,H@HTp$0.EdU@ _Di2x[Xؔ(Hx !va# q*0 b5 + \DBOHb^5$m5U $ Xx4]Tk l 4u,J2?l J_Qf(,Pp@7@~ȦR, TbtlYV\ xTt5-$*(9$:@F|+ PTxbq,P <4VcM86  Hda`Vc,%V400> (HVHqg_tt8P@\7,^_Ta_$0W 'r8?HhNPcZe_jDz,PG k4$H tU \0{<h L$vVc Pc_xc_ X1a?,N,Xa`s @|, bKd6JSR@]}e9|C\$S`<TO Td8HLk DBHe_#?=X@tWBsr }XHL0,lP (4W`$-Xc  _#hac4c:ܺ LF,Ph0\ Un4xa|h  0dw[E|b$l+ L  %\2ܚAP:Wddc_lx a l LYT$UW,Xd~|bc84Hl&-/_6p`A$N$^< PjP~? _c(Uc1`b,bb(8.X@D`X4<i+}cc@8KL$X$ܲ,utbV#D.@D# NaZ,`h06c w<HR\bil@D t,Xdܘ$X> -a`4x0GfOP\ acbl4As [d(; T4 bbpac Pb# <0,H? XcNPb \hsh(x0_\rh4aLP(bX b8'lV:a_AHi N\- S<\LjX ${t)(Hk @a  _cY_08 .(0B4FILWaa( tt$@jab@HF0_Ld_NX3Ti$z T_p)acT9JU V̡Tdy @ _c{4HT\ b_|88j Ll ̇ <b%+6bCh[DXcx%x j@Dv( ~`l @ܮ 0Y`@R|0b$$q V7\rLII `S _,q` y_ <Wx$/8x_T@P`@ lq$(M6DB<L VXZ\ ddLny$yG.4bP@HhGtH8a\`c$x6pE |QP`g5 p$|D^$ \ |e  pV,<40 p hz$Xc%X<,6 BI(XcQdR_ص$h(WnZ8 DL wxuTTPUH.(F bc  T u( D |9  <C ^cT (b k Hq n ,b @ l[_ `  [_ E p5!=0!$a+!x?!@pJ! 4[!`! ]_q!l{!Ї <!(c!X!L!! b!a!CD!T$`"0 "."e_"(,"t*0:"A`F"t 8P"r4^"o"x" `"P" "I "Tc"?X"< "T"#`/#dC8%# P7#XcE#`xV#w|g#\Fz# p#^l# ##.#P;##,K (# #p$b $T"&$Шt6$4E$_ ,P$,:$b$0Ws$4$$$_$0$$|v$ w$D$Tp%T+  %hM%f&%8b<%aE%<U%ccg%XXo%4 %t l%b%(bc%b%@ %h}X%,%[_%Ȓ& c&* '&4&ԸA&^cT&T^&|q&|& &d@&l&&\B,&l&3&& 'x)'x 6'(F'T' a'(IPq'P)h'$'pX'Wt'(a_''p''\'p@'<&X (W(h/(9<((iN(h8Z(Ȕ $h(@v(@t (a(pvL(T% ((d((<=x(,(\)6T)e@)D ()DF;)@T)Թ e)Lw)L)\)h H)) )4L)PX)p)a)" )L)d  * X*)*x5@9*`"G*aLX*Hm*p*Tb *6*bd*؈_* *\*n *4*,*Z *HP +1,+$\'+p.X0+C9+`H+V+ u+1+\+C$+D+d[_++0P+̘D +H+(, , ,D0,v/,!;,_L,lxa,h6Xv,t.,O,,,L6$,y d,a0,l,O,hR,T -H-p'-0-Q@?-H-X_U-(]-,Pf-4-Tm-X-` -$-<b- -(--E.|#.*&./xHR/,[/,.j/\cs/0az/</h /va/bc//(3$/=$/HO/& |/a0a 00 #0TC00X,=0I0\0l0u0  0(S0$$0:<0,c0p80 0Xd0p^ 1x+$11[(1l01<-@1pI1hhY1 >DH+>8|5>`E>CU>4Xci>G|>> >$>h>\c>t>p>Ć T>>`Ad?d?t1'?D<>?tjtI?bT?x`?tXv?Ln\?b?X?@X?AP?|?a?Du?N@`P@</@TF@@8aI@l!LT@F(c@bq@@H~@D@ b@H|@ @ |@ -@=@G@E l@(d A`A`pD*A(.7A HA|$TAtA