,``@00ھ0\4 `@# ` "" $@` `T@   b@w"@H*/+  "bH  0  "  "  * " !` " @ %s: can't open device㿐@K#@  b("b( @ "   @`@)  @   "H@@%s: alloc failed%s: block table corrupt%s: read failure%s: short read㿐 `@    !@`  @ D ? c' / - + ,`2 @      @@ @`a@@?@2 @a aa @` @Ȳ@  ? Ċ`Ī@` Ē`IJ@` @ dvma_mapin㿘? #@(1? @@#1?dvma_mapout㿘 #@(1 @. 1㿘@ " ْ㿘 @  promprom0㿘  ` @ "H `  "  ` ""J  *@J` )*@Can't open device `%s' 㿘@   ` @ "H `  €b  $€b 2$   " @!X0   $   $`$` 㿘# bH`   ``*  `bH   '@`2`0`,6 * '@ 㿘  2& `& $& (   €5 " '@ 㿘 "H  @@ 0(@  㿘  @ $ ? `$ *㿐 "H/  0T@㿘  㿘 "H`t€Invalid controller number prom_iopen: "%s" error=%d 㿘) " ?N  @  "bPbP$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $`  @ `+  " * @F $`0 "$`4 " @$` @ 2" &  %"   @  㿘# b  @ 4 "$b  & 4$b prom_mapin: length=%dprom_mapin: invalid maptype %d㿘  *`@   "H@ Ę    L         "`@{` `  @   8 <?*  Ș آ&@  `   Ȱ@㿘?( ,1 \&"H H L` T ` X P d l$ p  t @  .@ ДЖ ? * `:```?  `Ԕ "`"     А?"  㿘 b'H'L'P'T 'X "b@0H @  exit㿘 !@ ( 㿘!  !X'L'P'T'X$"@L"*㿘 'H'L'P'T'X @ H㿘  @8N@`N@`%` N@`|`  `*` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @L N@ @C N@ @: N@ 0 x  @, N@ % w ls4l404x444444444444444d44444444444@444444440123456789abcdef㿈  @ @,@"  ?L?|/-\㿘  ؀`  "  a8J@ #" @ @   @ *0   @ *`( `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" bootxx /P/`/p////(4444444H44\4   4444#4p,4\74=4F4M4 pV 4 c4m4t4 |4 4H44 4(4@4 4H @ <   @@<>A&f>/<><>../../instbinH!a<&%<&%< h@ 8a<'V<'V< hA0a<) <) < hBc !<*Q<*Q< h6@>B!<,<,< h6A0N!<-L<-L< h6B:aa<2<2< hR-3!<4s<4s< h6Py!<6<6< !6Q/!<8ـ<8ـ< !6R,a<:i<:i< !` ,a<1-<1-< !aOa<<< !bR)@!<Ĵ<Ĵ< !6`:9!<'<'< !6a:0+!<р<р< !6bPB@a< < < !p Ga< < < !qw4a<沀<沀< !rK"!<v<v< !6pq!<z9<z9< !6q<!< < < !6r<:!<9<9< !yˀ:!<<< !y%!<e<e< !yS7!< /< /< !y֏u!Xa<,<,<+ ?!<.}<.}<+*;fa<0G<0G<+ C!<2<2<+* a<4s<4s<+ b!<6=<6=<+*R^a<8ـ<8ـ<+ 6I!<9<9<+*unKa<<<+ `c!<bZ<bZ<+* a<Ĵ<Ĵ<+ !!<w<w<+*Ca<X;<X;<+ f!< < <+*a< X< X<+ ,;!<N<N<+*a<v<v<+ m!<z9<z9<+*ja<C<C<+ v4!<W<W<+* ͠xya<p<p<+ M !<9<9<+* +a<8<8<+ }A!<e<e<,* a< /< /<+ !<"<"<,* mZa<$[܀<$[܀<+ mqS!<&%<&%<,* 7qa<(<(<+ 2b!<*Q<*Q<,*a<,<,<+ A|!<.}<.}<,*ܢa<0G<0G<.} ;7!<2b<2b<.}*HRa<3%<3%<.} 鮣!<6=<6=<.}*ua<8C<8C<.} )@!<9<9<.}* -a<1-<1-<.}  Uj!<bZ<bZ<.}*na<,<,<.} Lj!<<<.}*>Ca<'<'<.} e|u!<р<р<.}*ta< !< !<.} Op!< < <.}*a< < <.} 1!<沀<沀<.}*a<v<v<.} "!<<<.}*&bfa<f<f<.} >t!<<<.}*ӕa<t<t<.} ( !<<<.}*:la<e<e<.} Ժ;!<(<(<.}*w-a< U< U<.} ͞R!<"<"<.}* a<#F<#F<.} {!<% <% <.}*la<&6<&6<.}  X!<(<(<.}*Za<)'<)'<.} Ky!<,<,<.}*Ka<-D<-D<1xˀ ݧH!<!<><><4s*>Ta<p<p<4s ?C!<9<9<4s*?9_a<<<64̮&!<e<e<6{l\a<<<6]!< U< U<6{MSa<"<"<6 #!<$[܀<$[܀<6{OKa<% <% <6ɭ!<'V<'V<6{Ca<) <) <60 O!<*Q<*Q<7n{ya<,<,<6S3-!<-D<-D<7n{Q)Zoa /tmp/fstab munge_fstab < /tmp/fstab fi mount_fs "-o async" mount | while read line; do set -- $line if [ "$3" = "/" -a "$5" = "nfs" ]; then echo "You appear to be running diskless." echo -n "Are the install sets on one of your currently mounted filesystems? [n] " getresp n case $resp in y*|Y*) get_localdir ;; esac fi done echo '\nPlease enter the initial password that the root account will have.' _oifs=$IFS IFS= resp= while [ -z "$resp" ]; do echo -n "Password (will not echo): " stty -echo getresp -n stty echo echo _password=$resp echo -n "Password (again): " stty -echo getresp -n stty echo echo if [ "${_password}" != "${resp}" ]; then echo "Passwords do not match, try again." resp= fi done IFS=$_oifs md_questions install_sets $THESETS # Copy in configuration information and make devices in target root. cfgfiles="fstab hostname.* hosts myname mygate resolv.conf kbdtype" echo if [ -f /etc/dhclient.conf ]; then echo -n "Saving dhclient configuration..." cat /etc/dhclient.conf >> /mnt/etc/dhclient.conf echo "lookup file bind" > /mnt/etc/resolv.conf.tail cp /var/db/dhclient.leases /mnt/var/db/. # Don't install mygate for dhcp installations. # Note that mygate should not be the first or last file # in cfgfiles or this won't work. cfgfiles=`echo $cfgfiles | sed -e 's/ mygate / /'` echo "done." fi cd /tmp echo -n "Copying... " for file in $cfgfiles; do if [ -f $file ]; then echo -n "$file " cp $file /mnt/etc/$file rm -f $file fi done echo "...done." remount_fs _encr=`/mnt/usr/bin/encrypt -b 7 "${_password}"` echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2> /dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd dd if=/mnt/dev/urandom of=/mnt/var/db/host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 /mnt/var/db/host.random >/dev/null 2>&1 # Perform final steps common to both an install and an upgrade. finish_up  . .. bin dev etc mntmnt2lsbinl tmp usr varinstbin install.subinstallupgradeR bsdX.profileMNhY install.mdhZbootB0#!/bin/sh # $OpenBSD: upgrade.sh,v 1.31 2002/04/13 21:03:31 deraadt Exp $ # $NetBSD: upgrade.sh,v 1.2.4.5 1996/08/27 18:15:08 gwr Exp $ # # Copyright (c) 1997-2002 Todd Miller, Theo de Raadt, Ken Westerback # All rights reserved. # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. # install.sub needs to know the MODE MODE=upgrade # include common subroutines and initialization code . install.sub # Remove 'etc' set from THESETS. It should be installed # manually, after the upgrade. Note that etc should not # be the first or last set in THESETS, or this won't # work! THESETS=`echo $THESETS | sed -e 's/ etc / /'` # XXX Work around vnode aliasing bug (thanks for the tip, Chris...) ls -l /dev > /dev/null 2>&1 while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done # Assume partition 'a' of $ROOTDISK is for the root filesystem. Confirm # this with the user. Check and mount the root filesystem. resp= while [ "X${resp}" = "X" ]; do echo -n "Root filesystem? [${ROOTDISK}a] " getresp "${ROOTDISK}a" _root_filesystem=/dev/`basename $resp` if [ ! -b ${_root_filesystem} ]; then echo "Sorry, ${_root_filesystem} is not a block device." resp= fi done echo -n "Checking root filesystem (fsck -fp ${_root_filesystem}) ... " if fsck -fp ${_root_filesystem} > /dev/null 2>&1; then echo "OK." else echo "FAILED.\nYou must fsck ${_root_filesystem} manually." exit 1 fi echo -n "Mounting root filesystem ... " if mount -o ro ${_root_filesystem} /mnt; then echo "Done." else echo "ERROR: can't mount root filesystem!" exit 1 fi # fstab and hosts are required for upgrade for _file in fstab hosts; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /etc/${_file}!" exit 1 fi cp /mnt/etc/$_file /tmp/$_file done # Start up the network in same/similar configuration as the installed system # uses. cat << __EOT The upgrade program would now like to enable the network. It will use the configuration already stored on the root filesystem. This is required if you wish to use the network installation capabilities of this program. __EOT echo -n "Enable network? [y] " getresp y case $resp in y*|Y*) if ! enable_network; then echo "ERROR: can't enable network!" exit 1 fi cat << __EOT You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. __EOT echo -n "Escape to shell? [n] " getresp n case $resp in y*|Y*) echo "Type 'exit' to return to upgrade." sh ;; esac ;; esac echo "The fstab is configured as follows:\n" cat /tmp/fstab cat << __EOT You may wish to edit the fstab. For example, you may need to resolve dependencies in the order which the filesystems are mounted. NOTE: 1) this fstab is used only during the upgrade. It will not be copied into the root filesystem. 2) all non-ffs filesystems, and filesystems with the 'noauto' option, will be ignored during the upgrade. __EOT echo -n "Edit the fstab with ${EDITOR}? [n] " getresp n case $resp in y*|Y*) ${EDITOR} /tmp/fstab ;; esac echo # Create a fstab containing only ffs filesystems w/o 'noauto'. munge_fstab < /tmp/fstab if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit 1 fi # Check filesystems. echo "Checking non-root filesystems..." if ! check_fs $_root_filesystem; then # Prevent check_fs() invocation in cleanup_on_exit from fsck'ing. # Remember /etc/fstab is a link, /tmp/fstab.shadow is the file! rm /tmp/fstab.shadow fi echo "...Done." if [ ! -f /etc/fstab ]; then exit 2 else # Mount filesystems. mount_fs fi # If Xfree86 v3 directories that would prevent upgrading to XFree86 v4 # are found, move them and replace them with links that the upgrade # can replace with new values. ( if [ -d /mnt/usr/X11R6/lib/X11 ]; then cd /mnt/usr/X11R6/lib/X11 for xf3dir in twm xkb xsm xinit rstart; do if [ -e $xf3dir -a ! -L $xf3dir ]; then mkdir -p XF3 mv $xf3dir XF3/. ln -s XF3/$xf3dir $xf3dir fi done fi ) echo -n "Are the upgrade sets on one of your normally mounted (local) filesystems? [y] " getresp y case $resp in y*|Y*) get_localdir /mnt ;; esac # Install sets. install_sets $THESETS # Copy in configuration information and make devices in target root. ( if [ -f /mnt/etc/sendmail.cf -a ! -f /mnt/etc/mail/sendmail.cf ]; then echo "Moving /etc/sendmail.cf -> /etc/mail/sendmail.cf" [ -d /mnt/etc/mail ] || mkdir /mnt/etc/mail mv /mnt/etc/sendmail.cf /mnt/etc/mail/sendmail.cf ed - /mnt/etc/rc << __EOT 1,$s/etc\/sendmail.cf/etc\/mail\/sendmail.cf/g w q __EOT fi ) # Perform final steps common to both an install and an upgrade. finish_up    b  @D, @' $⠜+#@  /P@Z / "%< %< @<@`@4`Ƃd??/usr/libexec/ld.soNo ld.so Failure reading ld.so Bad magic: ld.so Cannot map ld.so crt0: update /usr/libexec/ld.so ld.so failed h! Р"$   Ŗ ?$   `""ܒ      ؐ        ?@ ?# @! ?a ?@ ?# @ `     | ??"  #\@ #`?# @!  3 @@! -? ?c@  ̀@ ! @ ̀@? ?c@ ! @   @! @     #d#h  Ŕ  ( ? $ ( !    ?#\#`ؔ@ ?# @!   a ?@  ?#  ?FB?? ?# ! 2 ?1@! ,? ?c@  ̀@2 ?@ ̐ ? ?c@ ! @" @! @2 #?:  ?# !  ?/ @! )? ?c@  ̀@ ? @ ̐ ? ?c@ ! @   @! @   #d#h   Ř u ?  ( o  l 䀣 !  #\܆    #d#h`#`  R ?2   ( L  I  bP< $ $ $ $  ` ?2 @  !1 `  ?2   h %  "  ""`@z"܁㿘"ܒ€ 㿘"܀``@?㿘"ܒ€ 㿘"ܒ ?Service unavailable㿐"܀     ?1 !P  @Z*`:` J " %s: %s not compiled in instbin㿘@a@ J 2@@H@@gG /  @P @`"@ 2      a@)!@"㿘 ?@?`ÔUsage: %s ..., where is one of: %s㿘  c @!P`@ `@) + @3@  O4@#X@@c``@ @ޒ#X@1Ӑ hostnamedmesgexprmvsleep-shshkshsedmkdirmtshutdownstringsrmtipgetoptmount_mfsnewfsinitsortfsckfsck_ffschrootchflagschownchgrpchmodgzcatgunzipgzipcutcpedhaltrebootffsmount_ffsdhclientftprouteinstallbootslattachmknodrshumountbasenamefgrepegrepgrepnfsmount_nfsmorelessresettsetsumcksumsysctllsifconfigcatpingcpiotarpaxdisklabellnsttyvibuildsyncmountnetstatdfcd9660mount_cd9660dd㿘@!05/5$/7/5@/5l@@/5/5/5/5 /6@@/6skipseekofobsifibsfilescountconvcbsbsout of memoryunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %useek offsets cannot be larger than %qd㿈 "c"` x"  # $b%C+) 5 7 / - 3 @ $@.Ր @} = 2,b @.̐  L bb0@.Ð  ' @)蔒 h @.  "`P@.  €$h  $h`@"@ $hh` @ @xΐ h` `@. "` `@.| `p!4 !"@!   !4$h%`p `@.` "` # `@.W  x%`p#  `x` % a@.F  ? @  2` $ 8 `  @`   `$   aP @.?㿘@@㿘@"c"㿘@"b㿘@ "c8?"c8㿘@R"b㿘 h`@"c 㿘 h`@"` 㿘@:㿘@: 7 Fp77 Gp7 Hp777x7h Cp7X Dp7P Ep7H7@78707(unblockucasesyncswabosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combination㿈 ,'D) % !' # 1D@w˒#'8  @ @-< h`"`c@-3 ` `"h& lD ߐD㿘@@%s%s: illegal numeric value%s: %s㿐@ ?2"`@v 2J"`@, `k`m`b". `w . . . 8 'J`x 4``*2 @2"! @9 "@, "`@, 㿐 @Gm    "`@v 2K"`@,  k m b .J w(J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& 2 @" 'J`x 4#`%`*2  @ @"! @ɷ "@,> "`@,9 㿘 l c  "@  x  *xc``$   $ @   $`$` 㿘"?`$)#  #     ##" "  #@&"@ ##?"`"`%# x "@ #@ '`@8 l    +@ `  0 +@`    #`*`#` " "`?"` l   @." * x` " "` %` #  #`? "`  #` ? %"` x`` ` $` $`@> ` `## @ " 㿘#` %!@ x` "@ "@&A `l `` `   ! "@.9" x" "㿘 l+c  ??  @? ?,@ c@ <c x   @?*" ?   " " " @%@$$ $*@` $@  @ " % c   c@%ʒ"@ c  $ %s: short input record㿘c  2  @t"pc  %   c ? *c "?c x$  `@%``@$`$`x `"* "㿘@ @9a@,# a@, @#Lc8? 3R@Vb??&b@@+א stdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffer㿘#    $  $ @ $  `@t @R"`   `@*  x   @ $ $ ')`h# "& @v! $  h" & @j! $ `$ x` x` @s’`x@ h @2`` @)Ӑ? $`H@s $x! "@*"@)@  $`"@)@ $x`X@s xx`$"`$ ` " @  $@ h@& h   h   @ݔ     @  h"@L`!&b Hhl *  +@ ( 5h"hl *  +@ ( $h Hh  *  +  h"h  *  +  h l`@  @,` h `@s  <     a@,     @"5 ?   "`  & 㿘 )c x#@/1#8#@`  h -` @+` @+`  @"  h$ 6. h$2   @r  @rڐ@K  h      @!ܔ @h @rƐh``$` #@@  $`%#@  h $ #@@  $ %#@ $  $  $ ` %`h` `@w&`$`@@ `"`` %``@w`` p@€$`x㿘`p x@Z!4@  ܀@ h ! x` x@  " @+V  x@+Q  x`"` x `@ %s: end of device%s: short write on character device%s: short write on tape device㿘 x  x`` x35/+-  ?#  x`   2 `` "@r0` x` "$` @'@!' c@ @'ܐ "` @q c@  > B; Ǥ@2   #  x  " &   #    x@""@  x  & %u+%u records in %u+%u records out %u odd length swab %s blockblocks%u truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) Ȑ@ c`c`" '"@ 'Вb@ ?R*"@ "X*`" *  *  ' B?8 ?8`   d #\@@D @*'@ $ "Ѐ "" @ d-`@*%% #@ (" "" @В d-`@*o%%`@`!#@|##\@#Rb` B d8-` ª`@;`@*N%%@*P 㿘! g"$"㿘a@( %sskip reached end of input㿘c 2   @     @ߖ ?CAa@p  9 +-@  "  &!D?D? Rb ?"b@&  hd @pa a@p` 㿐 x      @鸔      @ ?vt a@p=   $  '7a@) c a@p,    X $ T`x `x@v  4A6  a@p   7 'a@)”? a@p  D 4`x, $ (`x`x @S    a@o  D 4`x $ `x0  D4`x $`x㿘@`VVVVVVVVVVVxVp Vhupdateunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaegjo:Rcd9660%s: Filesystem not supported by kernel%s on %s @ '+) '%/5 0* `@€    "@ @w@耢??㰓* & @ @h@?` '' ' '''@%L  "`-b@%6 c @o @& WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW|WWWWWWWWWWusage: mount_cd9660 [-egjR] [-o options] special node 㿘aX@v!@&k ,-o %s: option not supported㿘@א  @n 1' n L  o  @r = 2*`"@ 2   @2    &*@&a@$  @Dᰠ 2L@$Đ㿘@9hiklnPt:only one -t option may be specified.-i is incompatible with -Pretrieving information on mounted file systems%s%s is not a local file system%s mounted as a %s file system0@5%!';/-S+ )+9 $&* @@€ $ $ А $̐ $ $Ȑ '` %Đ "`H c@$, @b@J@Z#?Ґ?#̑*@` & ` @nN@@2@Q  2@c`@m  !@ Y@@ `R' @@  @@ @@m#=`< @ @2 @@@@ 2-`%a@)@ !`  @@@m`@z D 2 ac@@mD` @@m#`@  @`  @& 4?a` $  @ǔ0@`@% \t\\\\\\\\\\\\\\\\\\\\\\\\0\@\\L\\\\h\\\\\\㿐@  @6  @ֽ ` T@! 㿘S H  ``?  #@    2`@ empty type list㿘 N  n`@#  N  o "` "  %S  @ʨ , ` @"*  $H @lҒ $@ , `$@  @ʑ , 2*@, $@㿘 `S H`  Ā` @ ., ' D @"!s  Ā`@%T! T@ a!!S&P' S. X SS`B# h SSpB x SSB  SSB B 8 0B %5.0f%cBKMGTPE %5.1f%c㿐??S BS@Jx#0  #J  #@Jk 0#J  #@Jc 㿐 ' S B B? ' B?  D?%-*.*s %*u %8u %8d %5.0f%% %7u %7u %5.0f%% %s 㿐  @J#!(    " F ` !0@6 @L@'  @D@' ` @ @8@& @0@'` @ @$@!  @@'~ @IҖ!@' S`B'S`D?@  @I `̀ (  !P`"@ ' SญB'`S`BS B?@  @I @I!h!p@I T Size%-*.*s %s Used Avail CapacityFilesystem1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted on 㿐 Ȁ` @$|' @@IJ Ѐ`  P$'@$g'@X `@@I0 ̀`"@I( @I% ` !1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s x Ѐ`!$!Ц"@$!@@H`n T ` ``" 2'@  ?S' ȉ ‰ F?@#`"` @6 `@@%` ` `@@&S` ` @6 `@@ #\`@ݒ@&?#\`  @  @А@` #` @Ȓ@&*`#`#l#d#h@Hxa!a㿘@ @j@#?@^ @  @  ?  df: %qd: %s 㿘 @*@B "!`  @k@}  usage: %s [-hiklnP] [-t type] [file | file_system ...] 㿘P <a@b!@!W ffs㿘   F\!T@"&;?4&0&(& 8@%̘ d &<(#  ; @<  @X d$"@&@%z,?&Ȑ&& ;&$ "T@ Z@ ZDb@ɿ  lfs㿘#` d `!b@"&E?  d& &   "@ 2 &    $"@ 2 & T @%1" @$ d& $ 8 &  " : && (& d@% $&& &$ߐ #HT@? Z@; ZDcP@c  ext2fs㿘- $$  ;`8#S@H?`L (&B?`$*&`4 * &@$.`(``` $@$%4 ?@$`@$Ȑ$& ` &`"@ &&`& &&$  T@ Z@ݔ ZD`@  㿘@Do$OpenBSD: if.c,v 1.29 2002/02/16 21:27:50 millert Exp $ifnet: symbol not defined %-7.7s %-5.5s %-11.11s %-17.17s NameMtuNetworkAddress%10.10s %10.10sIbytesObytes%8.8s %5.5s %8.8s %5.5s %5.5sIpktsIerrsOpktsOerrsColls %sTimeDrop%-7.7s %-5ld %-11.11s none%-15.15s %-17.17s %-*.*s %25s %-17.17s %25s %-*.*s %xHipx:%-8s%-17s atlk:%-12s%-12s ns:%-8s (%d)%x%c%10lu %10lu%8lu %5lu %8lu %5lu %5lu %4dX`@Fa"0Y "@0SX@Fe  NXbА"ؖ@FI"b@   "c@F=#c08@#H@F.cPc  #X@F$c` `8  #X@Fch a``?"`!` * %!`@ ` `% @F ؀ H4@$ !|/W`$@* 䀦` @aT` *,@`,@,!h`|h l p t x ` WR`8 Ĕ" \#p@EH``!#@E##@Ex@@E ` " ``*"*` €!#@E##@EVp@X``  @   @  ! @Ev#@X `` @   @   #@Eaa "Ԁ #! @Ec $@W c@EO#4  p`? ?  '`` $`$`,` ,` @X`` @ Z  @ U ! @E##@Y`` @ D  @ ?  #@Ea  #%@E , @X .``  @   @ ؒcЖ @D p? `* * @' `* `* `* @U@[ِ@Dɐ#! @ZC!  @^@D!  @^ 4?`# `*` '7 @)@[@D ! @Y`0@D# ```` 2 ` `! #@㗐@@DEp  @ `@Dv 8 @ @ @ 8L@ "8 ?  @ @ `  .@DZ? " ?!` `?`$``@ !`* %!`@ ?p@ | H@D3 h Xlpt@D)x WR@D" x`8 @D x!`` ?"`!`* %!`@ ``)w|8w|8|8|8{P|8|8|8|8|8|8|8|8|8{|8{|8|8|8|8zx%s%s: %s: unknown interface %7.7s in %8.8s %6.6s out %5.5s %5.5s in %5.5s%5.5s out %5.5s %5.5s %5.5s %7.7s in %8.8s %6.6s out %5.5stotal %5.5s in %5.5s%5.5s out %5.5s %5.5s%10.10s %8.8s %10.10s %5.5sbytespacketserrscollsdrops %10.10s %8.8s %10.10s %5.5s %8.8s %5.5s %8.8s %5.5s %5.5s%10lu %8.8s %10lu %5.5s %5d %10lu %8.8s %10lu %5.5s %8lu %5lu %8lu %5lu %5lu㾨'D@C     a| ?'"H )4'  7"5-1 +' @ݒ  "p@ؖa|`"`0@΅ "`0਀@ $ @CL ؀ 2 P <a|!@釒bx@| @ D"c@@  ☒@C   8b @C  8 @C "H$ *` *  *  *  :  @   @B   8c   @B  8 b@Bݒ H@:a`&`&`&`&`&` &`$&`(&`,`0@*&`a``?"`a` * %a`@b @  chH @B  8#pxc  @B 8 b@BH$ *` *  *  *  :  !@  ch @B  8#pxc  @Bu 8 b@Bma``?"`a` * %a`@ @sa` `$ $ $ $ $ $ $$ ($ ,rbH@o" @BT ؀ ` @.h@ |`В" ` @B2#@  8`Xh`" l`" p`# t`$#@ x`(@B  8 `,@B" h&`|&`l&`p&`&` t&`$x&`(&`,  $ `  $ `  $ `  $ `   $ `$ $@$ $`( ( $ ( ,`,$@$ ,`0@  bH$ *` *  *  *  :  ,@    " # @A˜  8 ` "  "  #  $$#@  ((@A  8  ,,@A" a``?#`  $ $ $ $  $ $ $ $ $$  ($$ ,$($,a` * %a` @$ @a`c`'@ D @G I  $OpenBSD: inet.c,v 1.58 2002/02/19 21:11:23 miod Exp $TIME_WAITFIN_WAIT_2LAST_ACKCLOSINGFIN_WAIT_1CLOSE_WAITESTABLISHEDSYN_RCVDSYN_SENTLISTENCLOSED㿘@V 㿘@O tcp??? Active Internet connections (including servers)%-*.*s %-5.5s %-6.6s %-6.6s %-18.18s %-18.18s %s PCBProtoRecv-QSend-QLocal AddressForeign Address(state)%-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s %*p 6%-5.5s %6ld %6ld %d %sp'L  "@a`?@@Ӕ ""`'9"7"5"L 3 a`!3`!a  0@JL'䀢  8`@@ <p@@!#@%"@@!a`"@@!Вa`` ?"`a`* $a`@ "l`""8#\"b@"""#`Pa" #d#h  "(@@^0 ""bh"8b@"#\"(0@@PP l  <@@F ` @@@`! @"b@R"`t`L@@-`a 6$@*  4@*  0@  4 @  !p d* 2` S""@@: a`:aL@"@?Ȓa`` ?"`a`* $a`@  @?  @,"@?!%s: %u packet%s sent %u data packet%s (%qd byte%s) %u data packet%s (%qd byte%s) retransmitted %qd fast retransmitted packet%s %u ack-only packet%s (%u delayed) %u URG only packet%s %u window probe packet%s %u window update packet%s %u control packet%s %u packet%s hardware-checksummed %u packet%s received %u ack%s (for %qd byte%s) %u duplicate ack%s %u ack%s for unsent data %u packet%s (%qu byte%s) received in-sequence %u completely duplicate packet%s (%qd byte%s) %u old duplicate packet%s %u packet%s with some dup. data (%qd byte%s duped) %u out-of-order packet%s (%qd byte%s) %u packet%s (%qd byte%s) of data after window %u window probe%s %u packet%s received after close %u discarded for bad checksum%s %u discarded for bad header offset field%s %u discarded because packet too short %u discarded for missing IPsec protection %u connection request%s %u connection accept%s %u connection%s established (including accepts) %u connection%s closed (including %u drop%s) %u embryonic connection%s dropped %u segment%s updated rtt (of %u attempt%s) %u retransmit timeout%s %u connection%s dropped by rexmit timeout %u persist timeout%s %u keepalive timeout%s %u keepalive probe%s sent %u connection%s dropped by keepalive %u correct ACK header prediction%s %u correct data packet header prediction%s %u PCB cache miss%s %u SYN packet%s received with same src/dst address/port h h#@>>"@>H!0`!#!`  !#"@>X@>)  @!#!`4!#"@>B@>>@>    $@!#!`4(!#"@>% @>!$@=(, (!` 0(%#@>  @=۔0  耢 !#!`4 8!##8@=@=Œ8`!#!`4 4!##`@=@=4`!#!`4  max ip packet size %lu tunneling packet%s that can't find gif %lu datagram%s with bad address in header %lu input datagram%s checksum-processed by hardware %lu output datagram%s checksum-processed by hardware  x@8J |#"@88x !*!`4 |!* 8@8V@8'| !*!` !* X@8E@8*!`4* x@8  *!`4* @7 *!`4* @7 *!`4* @7 Ȁ*!`4*!@7Ւ Ѐ*!`*!0@7Ȓ  !*!`4 !*!X@7@7 !*!`4 !*!x@7Ր@7؀ !*!`4 !*!@7Đ@7 !*!`4 !*!@7@7 !*!`4 !*!@7@7s !*!`4 !*"@7@7b !*!`4 !*"8@7@7Q !*!`4 !*"h@7o@7@ !*!`4 !*"@7^@7/ !*!`4 !*"@7M@7 !*!`4 !*"@7<@7 Ԁ !*!`4 !*"@7+@6 !*!`4 !*#@7@6̀ !*!`4 !*#P@7 @6ڒ !*!`4 !*#@6@6ɒ !*!`4 !*#@6@6Ā !*!` !*#@6֐@6܀*!`*#@6  !+!`4 !+ @6@6䀦 !+!`4 !+ H@6@6x耦 !+!`4 !+ x@6@6g쀦 !+!`4 !+ @6@6V !+!`  @6u@6Faddress mask replyaddress mask requestinformation request replyinformation requesttime stamp replytime stampparameter problemtime exceededrouter solicitationrouter advertisementecho#7#6routing redirectsource quenchdestination unreachable#2#1echo reply %lu call%s to icmp_error %lu error%s not generated 'cuz old message was icmp Output packet histogram: %s: %lu %lu message%s with bad code fields %lu message%s < minimum length %lu bad checksum%s %lu message%s with bad length Input packet histogram: %lu message response%s generated ( @5!l#"@5 !-!`4 !-"p@5@5| !-!` S!-"@5@5kS!x P)-'-  (  `"@5Z"Ȣ @5U? 8 2!-!`4 @1!1!`4 !1"@1-@0!1!`4 !1"8@1@0!1!`4 !1"h@1 @0ܒ!1!`4 !1"@0@0˒!1!`4 !1"@0@0!1!`4 !1#@0ؐ@0Ā!1!`4 !1#H@0ǐ@0Ѐ!1!`4 !1#@0@0耤!1!`4 !1#@0@0v!1!` !1#@0@0e܀ !` %2@0 @0Q䀒 !` %20@0n @0> %u packet%s were dropped because of no interface/bridge information %u packet%s dropped for other reasons %u input ethernet-in-IP packet%s %u output ethernet-in-IP packet%s h @0 0#"@0Ȁ!1!`4 !1!@0!@/̀!1!`4 !1"@0@/Ѐ!3!`4 !3!0@/@/ВԀ!1!`4 !1!@/@/؀!3!`4 !3!x@/ݐ@/܀!3!`4 !3!@/̐@/!3!` !3!@/@/쀒 !` %2@/ @/x !` %20@/ @/e %u input ESP packet%s %u output ESP packet%s %u packet%s with bad encryption received %u packet%s with bad payload size or padding received @ P@/B X#"@/0̀!4!`4 !4 @/N@/Ѐ!4!`4 !4 @/=@/!1!`4 !1!P@/,@.!1!`4 !1!@/@.쀤!1!`4 !1!@/ @.ے!1!`4 !1!@.@.ʒ!1!`4 !1"@.@.!4!`4 !4 @.א@.Ā!1!`4 !1"8@.Ɛ@.!1!`4 !1"h@.@.!1!`4 !1"@.@.u!1!`4 !1"@.@.dȀ!1!`4 !1#@.@.S!4!`4 !4!@.q@.BԀ!1!`4 !1#@.`@.1耤!1!`4 !1#@.O@. !1!` !1#@.>@.܀ !` %2@.+ @-䀒 !` %20@. @- %u total input packet%s %u total output packet%s %u packet%s with possibly spoofed local addresses %u protocol family mismatches %u attempts to use tunnel with unspecified endpoint(s) h @- 0#"@-Ȁ!5!`4 !5"@-Ő@-̀!5!`4 !5"@-@-Ѐ!1!`4 !1!@-@-t耤!1!`4 !1!@-@-c쀤!5!`4 !5"@-@-RԀ!1!` !1"@-p@-A܀ !` %2@-] @--䀒 2!` %20@-I @-!5!`4 !5#@-7@-􀤠!5!` # @-'@, %u input IPCOMP packet%s %u output IPCOMP packet%s %u packet%s that failed (de)compression processing P  @, H#"@,Β̀!6!`4 !6"H@,@,Ѐ!6!`4 !6"h@,ې@,!1!`4 !1!P@,ʐ@,!1!`4 !1!@,@,쀤!1!`4 !1!@,@,y!1!`4 !1!@,@,h!1!`4 !1"@,@,WĀ!1!`4 !1"h@,u@,F!1!`4 !1"@,d@,5Ȁ!1!`4 !1"@,S@,$Ԁ!1!`4 !1#@,B@,耤!1!`4 !1#@,1@,!6!` !6"@, @+܀ !` %2@,  @+ݔ䀒 !` %20@+ @+ʔ#255#254#253#252#251#250#249#248#247#246#245#244#243#242#241#240#239#238#237#236#235#234#233#232#231#230#229#228#227#226#225#224#223#222#221#220#219#218#217#216#215#214#213#212#211#210#209#208#207#206#205#204#203#202#201#200#199#198#197#196#195#194#193#192#191#189#188#187#186#185#184#183#182#181#180#179#178#177#176#175#174#173#172#171#170#169#168#167#166#165#164#163#162#161#160#159#158#157#156#155#154#153#152#151#150#149#148#147#146#145#144#143#142#141#140#139#138#137#136#135#134#133#132#131#130#129#128#127#126#125#124#123#122#121#120#119#118#117#116#115#114#113#112#111#110#109#108#107#106#105#104PIM#102#101#100#99#98Ethernet#96#95#94#93#92#91#80OSPF#88#87#86#85#84#83#82#81ISOIP#79#78#77#76#75#74#73#72#71#70#69#68#67#66#65#64#63#62#61destination optionno next headerICMP6#57#56#55#54#53#52AHESP#49#48#47#46#45fragmentrouting#42IP6#40#39#38#37#36#35#34#33#32#31#30TP#28#27#26#25#24#23IDP#21#20#19#18UDP#16#15#14#13#12#11#10#9#8#7TCP#5IP#3IGMPICMPhop by hop%s: %llu total packet%s received %llu with size smaller than minimum %llu with data size < data length %llu with bad options %llu with incorrect version number %llu fragment%s received %llu fragment%s dropped (dup or out of space) %llu fragment%s dropped after timeout %llu fragment%s that exceeded limit %llu packet%s reassembled ok %llu packet%s for this host %llu packet%s forwarded %llu packet%s not forwardable %llu redirect%s sent %llu packet%s sent from this host %llu packet%s sent with fabricated ip header %llu output packet%s dropped due to no bufs, etc. %llu output packet%s discarded due to no route %llu output datagram%s fragmented %llu fragment%s created %llu datagram%s that can't be fragmented %llu packet%s that violated scope rules %llu multicast packet%s which we don't join Input packet histogram: %s: %llu #%d: %llu Mbuf statistics: %llu one mbuf%s two or more mbuf: %s = %llu %llu one ext mbuf%s %llu two or more ext mbuf%s %llu packet%s whose headers are not continuous %llu tunneling packet%s that can't find gif %llu packet%s discarded due to too many headers %llu failure%s of source address selection source addresses on an outgoing I/F %llu node-local%s %llu link-local%s %llu site-local%s %llu global%s %llu addresses scope=%x source addresses on a non-outgoing I/F source addresses of same scope source addresses of a different scope deprecated source addresses %llu forward cache hit %llu forward cache miss  &x@(,9#(@(|x x!` x%90@(# @'@!` 9#P @' @!` 9#x @'Ӕ @!` 9# @'Ô @!` 9# @'  2!` %9@'ϐ @' 2!` %:@' @' 2!` %:0@' @'w 2!` %:X@' @'c䀒 2!` %:@' @'Ò 2!` %:@'k @'; 2!` %:@'W @'' 2!` %:@'C @'Ā 2!` %:@'/ @&Ԁ 2!` %:@' @& 2!` %:@@' @&ה܀ 2!` %:p@& @&Ô 2!` %:@&ߐ @&쀒 2!` %:@&ː @& 2!` %:@& @& 2!`  %:(@& @&s $ 2 !` ( %:X@& @&_(, (!` 0(%:@&{ @&K0  8hhh4 ;:9:0@@":@&4b S,!  @K 2 @&b"@&`װ :@&"40 0!`  0%:@&, @%  9:+: @h@%#( h@㒐@%c@  8< 28!` @8%:P@% @%ʔ@D 2@!` H@%:h@% @%HL 2H!` PH%:@%Ґ @%PT 2P!` XP%:@% @%X\ 2X!` `X%:@% @%z`d 2`!`  `%;(@% @%f  + ;;9; @ j;@%U`X "#` V-?P`t a 4M@%c ;@%2 B|  a 9 @%P@;@% /`(  a % @%<@;@%  `p܀  a  @%(@@$`  @$    + ;;9;7;@ @@ i;@$ېa "# U->O a 4L@$ ;@$ A  a 8 @$@;@$ .(  a $ @$@@$`p\ a 4@$ @$   @$x   ' ;;9;7;3;@ @@ h;@$aa0 "#  T,=N t  4K@$o ;@$> @|   7 @$\@@$,`. (  4%@$I @$  p܀    @$6@@$  @#`   ' ;;9;7;3;+; @ g;@#aX "" S+<M  4J@# @#Ő`@   7 @#@@# .(  4%@#А @#p\    @#@@#`  @#`   ' ;;9;7;3;-;+; @ g@#ma "" S+<Mt   I @#{@@#K @|  48@#i @#9.(   $ @#V@@#&`p܀  4@#C @#  @# ` 쀒@!` ;! @" @!`;! @" Warning: socket(AF_INET6)ip6 on %s: Warning: ioctl(SIOCGIFSTAT_IN6) %llu total input datagram%s %llu datagram%s with invalid header received %llu datagram%s exceeded MTU received %llu datagram%s with no route received %llu datagram%s with invalid dst received %llu truncated datagram%s received %llu datagram%s with unknown proto received %llu input datagram%s discarded %llu datagram%s delivered to an upper layer protocol %llu datagram%s forwarded to this interface %llu datagram%s sent from an upper layer protocol %llu total discarded output datagram%s %llu output datagram%s failed on fragment %llu output datagram%s succeeded on fragment %llu incoming datagram%s fragmented %llu datagram%s reassembled %llu datagram%s failed on reassembling %llu multicast datagram%s received %llu multicast datagram%s sent x  @6 @@w"0@@@!"0HaS@K @@d"0쀒 !` %@@! @!͔ 2!` %@@! @! 2!` %@(@!Ր @! 2!` %@P@! @! 2!` %@@! @!} 2!` %@@! @!i 2!`  %@@! @!U $ 2 !` ( %A@!q @!A(, 2(!` 0(%A0@!] @!-04 20!` 80%Ah@!I @!8< 28!` @8%A@!5 @!@D 2@!` H@%A@!! @ HL 2H!` PH%:@!  @ ݔPT 2P!` XP%A@  @ ɔX\ 2X!` `X%A0@  @ `d 2`!` h`%A`@ ѐ @ hl 2h!` ph%A@  @ pt 2p!` xp%A@  @ yx| 2x!` x%A@  @ e 2!` %A@  @ Q@1node information replynode information requestrouter renumberingredirectneighbor advertisementneighbor solicitationrouter advertisementrouter solicitationmulticast listener donemulticast listener reportmulticast listener queryecho replyecho#103#97#89#60#59#58#51#50#44#43#41#29#22#17#6parameter problemtime exceedpacket too bigunreach#0 %llu call%s to icmp6_error %llu error%s not generated because old message was icmp6 or so %llu error%s not generated because of rate limitation Output packet histogram: %llu message%s with bad code fields %llu message%s < minimum length %llu bad checksum%s %llu message%s with bad length Histogram of error messages to be generated: %llu no route %llu administratively prohibited %llu beyond scope %llu address unreachable %llu port unreachable %llu packet too big %llu time exceed transit %llu time exceed reassembly %llu erroneous header field %llu unrecognized next header %llu unrecognized option %llu redirect %llu unknown %llu message response%s generated %llu message%s with too many ND options %llu message%s with bad ND options %llu bad neighbor solicitation message%s %llu bad neighbor advertisement message%s %llu bad router solicitation message%s %llu bad router advertisement message%s %llu bad redirect message%s %llu path MTU change%s h ?#@9#(@` !`4?!C"@ @?#  2!` ?!C#@ @t?# 2!` T!C#H@ @]T?#aȐ ?cx@?"@#?"#?#b@?"@"?""?#b@?"@"?""?#c P@?"@"Ȑ?""ܐИ?#bؘؒ@?"@"Ԓ?""А?#b̒@?"@"  PX`hp"3C#: @ ",@c ,@bؤ ?# 2!` ?!C#@ @ϔ?#$ 2 !` ? !C#@ @?#,( 2(!` ?(!C#@ѐ @?#40 20!` T0!D @ @T!Ȱ  +:': @@ ",@xb ,@qؤ` D@i 0?c  H  !` ? D ` @S ?#`P  !` ? @D x @= ?#`X   !` ? D  @' ?#```  !` ? @D  @ ?#?# `h  !` ? @D ؒ @ ?#?# `p  !` ? @D  @ݔ ?#?# `x  !` ? @D! @Ô ?#?" `  !` ? @D!0 @ ?#?" `  !` ? @D!P @ ?#?" `  !` ? @D!p @u ?#?" `  !` ? @D! @[ ?#?" `  !` ? @D! @A ?#?" `  !` ? @D!В @' ?#<8 28!` ?8!D!@@ @?#?#  `@  !`? @!D"@" @?#?" `  !`? @!D"8@ @Ԕ?#?"ܐ `  !`? @!D"`@ @?#?"ؐ `  !`? @!D"@Ȑ @?#?"Ԑ `  !#!/bin/sh # $OpenBSD: install.sh,v 1.95 2002/04/12 03:24:02 millert Exp $ # $NetBSD: install.sh,v 1.5.2.8 1996/08/27 18:15:05 gwr Exp $ # # Copyright (c) 1997-2002 Todd Miller, Theo de Raadt, Ken Westerback # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Todd Miller and # Theo de Raadt # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. # A list of devices holding filesystems and the associated mount points # is kept in the file named FILESYSTEMS. FILESYSTEMS=/tmp/filesystems # The Fully Qualified Domain Name FQDN= # install.sub needs to know the MODE MODE=install # include common subroutines and initialization code . install.sub if [ ! -f /etc/fstab ]; then # Install the shadowed disktab file; lets us write to it for temporary # purposes without mounting the miniroot read-write. if [ -f /etc/disktab.shadow ]; then cp /etc/disktab.shadow /tmp/disktab.shadow fi while : ; do if [ "X${ROOTDISK}" = "X" ]; then while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done DISK=$ROOTDISK else DISK= while [ "X${DISK}" = "X" ]; do getanotherdisk done if [ "${DISK}" = "done" ]; then break fi fi # Deal with disklabels, including editing the root disklabel # and labeling additional disks. This is machine-dependent since # some platforms may not be able to provide this functionality. md_prep_disklabel ${DISK} # Assume partition 'a' of $ROOTDISK is for the root filesystem. # Loop and get the rest. # XXX ASSUMES THAT THE USER DOESN'T PROVIDE BOGUS INPUT. cat << __EOT You will now have the opportunity to enter filesystem information for ${DISK}. You will be prompted for the mount point (full path, including the prepending '/' character) for each BSD partition on ${DISK}. Enter "none" to skip a partition or "done" when you are finished. __EOT if [ "${DISK}" = "${ROOTDISK}" ]; then cat << __EOT The following partitions will be used for the root filesystem and swap: ${ROOTDISK}a / ${ROOTDISK}b swap __EOT echo "${ROOTDISK}a /" > ${FILESYSTEMS} fi # XXX - allow the user to name mount points on disks other than ROOTDISK # also allow a way to enter non-BSD partitions (but don't newfs!) # Get the list of BSD partitions and store sizes _npartitions=0 for _p in `disklabel ${DISK} 2>&1 | grep '^ *[a-p]:.*BSD' | sed 's/^ *\([a-p]\): *\([0-9][0-9]*\) .*/\1\2/'`; do _pp=`firstchar ${_p}` if [ "${DISK}" = "${ROOTDISK}" -a "$_pp" = "a" ]; then continue fi _ps=`echo ${_p} | sed 's/^.//'` _partitions[${_npartitions}]=${_pp} _psizes[${_npartitions}]=${_ps} # If the user assigned a mount point, use it. if [ -f /tmp/fstab.${DISK} ]; then _mount_points[${_npartitions}]=`sed -n "s:^/dev/$DISK$_pp[ ]*\([^ ]*\).*:\1:p" < /tmp/fstab.${DISK}` fi _npartitions=$(( ${_npartitions} + 1 )) done # Now prompt the user for the mount points. Loop until "done" echo _i=0 resp=X while [ $_npartitions -gt 0 -a X${resp} != X"done" ]; do _pp=${_partitions[${_i}]} _ps=$(( ${_psizes[${_i}]} / 2 )) _mp=${_mount_points[${_i}]} # Get the mount point from the user while : ; do echo -n "Mount point for ${DISK}${_pp} (size=${_ps}k) [$_mp, RET, none, or done]? " getresp "$_mp" case $resp in /*) _mount_points[${_i}]=$resp break ;; done|"")break ;; none) _mount_points[${_i}]= break ;; *) echo "mount point must be an absolute path!" break ;; esac done _i=$(( ${_i} + 1 )) if [ $_i -ge $_npartitions ]; then _i=0 fi done # Now write it out, sorted by mount point for _mp in `bsort ${_mount_points[*]}`; do _i=0 while [ $_i -lt $_npartitions ] ; do if [ $_mp = "${_mount_points[${_i}]}" ]; then echo "${DISK}${_partitions[${_i}]} ${_mount_points[${_i}]}" >> ${FILESYSTEMS} _mount_points[${_i}]= break fi _i=$(( ${_i} + 1 )) done done rm -f /tmp/fstab.${DISK} done cat << __EOT You have configured the following devices and mount points: $(<${FILESYSTEMS}) ============================================================ The next step will overwrite any existing data on: __EOT ( echo -n " " while read _device_name _junk; do echo -n "${_device_name} " done echo ) < ${FILESYSTEMS} echo -n "\nAre you really sure that you're ready to proceed? [n] " getresp n case $resp in y*|Y*) ;; *) echo "ok, try again later..." exit ;; esac # Loop though the file, place filesystems on each device. echo "Creating filesystems..." ( while read _device_name _junk; do newfs -q /dev/r${_device_name} done ) < ${FILESYSTEMS} else # Get the root device ROOTDISK=`df /mnt | sed -e '/^\//!d' -e 's (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxhpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx@HPX`hpx`? @!D"@ @z?#?"А `  !`? @!D"@ @\?#?"̐ `  !`? @!D# @n @>?#?" `  !`  @!D#@@Q @!icmp6 on %s: Warning: ioctl(SIOCGIFSTAT_ICMP6) %llu total input message%s %llu total input error message%s %llu input destination unreachable error%s %llu input administratively prohibited error%s %llu input time exceeded error%s %llu input parameter problem error%s %llu input packet too big error%s %llu input echo request%s %llu input echo reply%s %llu input router solicitation%s %llu input router advertisement%s %llu input neighbor solicitation%s %llu input neighbor advertisement%s %llu input redirect%s %llu input MLD query%s %llu input MLD report%s %llu input MLD done%s %llu total output message%s %llu total output error message%s %llu output destination unreachable error%s %llu output administratively prohibited error%s %llu output time exceeded error%s %llu output parameter problem error%s %llu output packet too big error%s %llu output echo request%s %llu output echo reply%s %llu output router solicitation%s %llu output router advertisement%s %llu output neighbor solicitation%s %llu output neighbor advertisement%s %llu output redirect%s %llu output MLD query%s %llu output MLD report%s %llu output MLD done%s x  @ @@I"0@H@!0HaT@ H@6!0쀒 !` %H@ϐ @ 2!` %H@ @ 2!` %H(@ @w 2!` %HX@ @c 2!` %H@ @O 2!` %H@k @; 2!`  %H@W @' $ 2 !` ( %H@C @(, 2(!` 0(%H(@/ @04 20!` 80%HH@ @8< 28!` @8%Hp@ @ה@D 2@!` H@%H@ @ÔHL 2H!` PH%H@ߐ @PT 2P!` XP%H@ː @X\ 2X!` `X%I@ @`d 2`!` h`%I @ @shl 2h!` ph%I@@ @_pt 2p!` xp%IX@{ @Kx| 2x!` x%Ix@g @7 2!` %I@S @# 2!` %I@? @ 2!` %I@+ @ 2!` %I0@ @ 2!` %IX@ @Ӕ 2!` %I@ @ 2!` %I@ې @ 2!` %I@ǐ @Ā 2!` %I@ @̀ 2!` %I@ @oԀ 2!` %I8@ @[܀ 2!` %I`@w @G䀒 2!` %I@c @3쀒 2!` %I@O @ 2!` %I@; @ @ %llu message%s received %llu message%s received with too few bytes %llu message%s received with bad checksum %llu message%s received with bad version %llu register%s received %llu bad register%s received %llu register%s sent ` @̔ 89#(@ !` %L@֐ @̀ 2!` %L(@ @Ԁ 2!` %LX@ @~܀ 2!` %L@ @j䀒 2!` %L@ @V쀒 2!` %L@r @B !` %L@_ @/%.*s.tcp6tcpudp6udp%.8s*%d %-*.*sH"l`   a`  @i@1:!M@b@*!M@Z!p@ @א"@``Max@  MMa@ M@fM`.`M!aaM!@ɐblMa@•2bl   !`  @ܐ@אM!@ ?pUaȀ %@ > "aȦ# @l\! 2 , @p . @R`@, @ %         @i  "@K . c @` ",@ `  `   ` `!Ma!" @H!2"     ?  ???  ?//''''' /'/ !#\ؐؔ! @k M#7!" @!" $OpenBSD: ipx.c,v 1.10 2002/02/16 21:27:50 millert Exp $dropresponduseroutputinputspx??? Active Internetwork Packet Exchange connections (including servers)%-*.*s %-5.5s %-6.6s %-6.6s %-*.*s %-*.*s %s PCBProtoRecv-QSend-QLocal AddressForeign Address(state)%-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s %*p %-5.5s %6ld %6ld %-22.22s %-22.22s %d %sX 'HNbP@Ґ`?@ N #`'ܨ 7N5N!`     ܲ  `@  0H@z hU!!`D'N@b"``N@\"!`` ?"`!`* $!`@c "l`N"NNbNN#\#h#t"b#`#d#l#p#x  @2%aNNN "bN#\@$%al N 0cP@ ` LN tH@#X@N@ p@?N@cH ` SN@# !`*`LN@#!`` ?"`!`* $!`@c ܀@  #ܬ@ \ @QN@֐"X%s: %ld %s%s%s -- %s connection dropped due to no new sockets x terminated due to our end dying dropped due to inability to connect incompleted due to mismatched id's dropped due to mismatched id'spacket dropped out of sequence duplicating the highest packet refused as exceeding allocation initiated accepted established droppedembryonic connection closed (includes drops) where we tried to get rtttime we got rttdelayed ack sent dropped in rxmt timeoutretransmit timeoutpersist timeoutkeepalive timeoutkeepalive probe dropped in keepalivetotal packetdata packetdata byte retransmittedack-only packetwindow probe sent with URG onlywindow update-only packetcontrol (SYN|FIN|RST) packetrequest to send a non-existant packet received received in sequencebyte received with ccksum errs received with bad offset received too shortduplicate-only packetduplicate-only byte with some duplicate datadup. byte in part-dup. packetout-of-order packetout-of-order byte with data after window rcvd after window rcvd after 'close'rcvd window probe packetrcvd duplicate ackrcvd ack for unsent datarcvd ack packet acked by rcvd acksrcvd window update packet  @o O"@]W* !O#O"آb@OO#@Kc W4 !O#O"آb@mOO#(@9c W* !O#O"آb@[OO#P@'c W, !O#O"آb@IOO#P@c W. !O#O"آb@7OO#x@c W0 !O#O"آb@%OO#@c W2 !O#O"آc@OO#@ߚc W8 !O#O"آc@OO#@͚c W6 !O#O"آc@PO @c < !O#O"آb@ݐPO 0@c @ !O#O"آb@ːPO @@c D !O#O"آb@PO P@c H !O#O"آb@PO `@sc L !O#P"آ`p@PO `@ac P !O#O"آb@PO @Oc T !O#O"آc@qPO @=c X !O#P"آ`@_PO @+c \ !O#P"آ`@MPO @c ` !O#O"آb@;PO @c d !O#P"آa@)PO!0@c h !O#P"آa8@PO!0@c l !O#P"آaH@PO!0@њc p !O#P"آa`@PO @c t !O#O"آb@PO!p@c x !O#P"آa@ϐPO @c | !O#P"آa@PO @c  !O#P"آa@PO @wc  !O#P"آa@PO!@ec  !O#P"آa@PO!@Sc  !O#P"آa@uPO @Ac  !O#P"آa@cPO @/c  !O#O"آc@QPO!@c  !O#P"آb@?PO @ c  !O#P"آb @-PO @c  !O#P"آb@@PO"H@c  !O#P"آa@ PO"h@՚c  !O#O"آc@PO"x@Úc  !O#P"آb@PO"x@c  !O#O"آc@ӐPO"@c  !O#O"آc@PO"@c  !O#O"آc@PO"@{c  !O#P"آb@PO"h@ic  !O#P"آc@PO"h@Wc Ā !O#O"آc@yPO# @Ec Ȁ !O#P"آc@@gPO#P@3c ̀ !O#P"آch@UPO"h@!c Ѐ !O#P"آc@CPO"h@c Ԁ !O#O"آc@1PO#@c ؀ !O#P"آb@PO#@c ܀ !O#O"آc@ PO#@ٚc  !O#P"آc@PO!0@ǚc 䀦 !O#Q"آ`@PO!0@c 耦 !O#Q"آ`@אQO (@c 쀦 !O#Q"آ`@@ŐPO!0@c  !O#P"آb@QO P@c  !O#Q"آ`h@PO!0@mc  %ld %s%s%s smaller than a header smaller than advertised with bad checksumsh 8@[ ,O"@IԀ !U#O xc@kU@9 Ѐ !U#O xc@[U@) ̀ !U#O xc@KU@ 㿘Ua*`  *` *` *` *` *`  *`  *`  *`  *`  *` @#>*`$OpenBSD: iso.c,v 1.9 2002/02/16 21:27:50 millert Exp $%s: %d esh sent, %d esh received %d ish sent, %d ish received %d rd sent, %d rd received %d pdus not sent due to insufficient memory %d pdus received with bad checksum %d pdus received with bad version number %d pdus received with bad type field %d short pdus received 㿀 -@   (U@ "xU@ "U@ "U@ "U@ ~"U@ z#U@ v#8U@ r#hU@ n#%s: %d total packets sent %d total fragments sent %d total packets received %d with fixed part of header too small %d with header length not reasonable %d incorrect checksum%s %d with unreasonable address lengths %d with forgotten segmentation information %d with an incorrect protocol identifier %d with an incorrect version %d dropped because the ttl has expired %d clnp cache misses %d clnp congestion experience bits set %d clnp congestion experience bits received 㾀 D@ ! ? V@ Ր pV@ ѐ V@ ͐ V@ ɐ V@ Ő!!V!(@ @ V@ !HV@ !pV@ !V@ !V@ !4V@ " 8V@ "8V<@ "h%s: %u incomplete header%s %u bad data length field%s %u bad checksum%s 㿀 "@   !V#@ @ s!V#@ @ j!V#@ @ a%s control block: symbol not in namelist tpprev %p next %p isop_prev %p isop_next %p??? 耦 WW @ <0G`@q 2 H@S0=W @ +06@ 4 0!"@攔 "@&'"@  `ߔ ` @ @^ `` ?"``* "`@[ Active ISO net connections (including servers)%-*.*s %-5.5s %-6.6s %-6.6s %-*.*s %-*.*s %s PCBProtoRecv-QSend-QLocal AddressForeign Address(state)%-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s %*p %-5.5s %6ld %6ld () *.* xU"`N!W@ "Xa W@ "x``?"`` * "`@[2 "l`WWWW WWWW#\#h#p#t#x""Țb#`#d#l@ l $bWWWWWWW#\#bȔЖؘ"@ Zb$b"l  !  Wc8@ L   tWW L#@@ D`؀` a  Wa@DXW@ 6#``"` lW@ +#h`!`l#(@嘔 #( #(@ * #(@֒ ` `΀  W`@XW@ #`0"` W@ #h0! ` @@o  @  @@   @@ undefined tpcb state: %p %d %-12.12s㿈 @ *`@⤐ h@ *` ^W -X+)'X`N  @ ʔ! `@ h!`2    8 6 5 `@   `  @4 "@     `*`X@ "@ `` ?"``* "`@Z  * @*%8lx tpip㾰` @ pa  H@' "l`"Y p@ N``tW`L#@Y@ E`x!W NHL8TP not configured 㿘 Y@ ,!@0 U@ ("x!#!@ 0@u %*sReceiving: %*s%ld variable parameter%s ignored %*s%ld invalid parameter code%s %*s%ld invalid parameter value%s %*s%ld invalid dutype%s %*s%ld negotiation failure%s %*s%ld invalid destination reference%s %*s%ld invalid suffix parameter%s %*s%ld invalid length %*s%ld invalid checksum%s %*s%ld DT%s out of order %*s%ld DT%s not in window %*s%ld duplicate DT%s %*s%ld XPD%s not in window %*s%ld XPD%s w/o credit to stash %*s%ld time%s local credit reneged %*s%ld concatenated TPDU%s %*sSending: %*s%ld XPD mark%s discarded %*sXPD stopped data flow %ld time%s %*s%ld time%s foreign window closed %*sMiscellaneous: %*s%ld small mbuf%s %*s%ld cluster%s %*s%ld source quench %*s%ld dec bit%s %*sM:L ( M mbuf chains of length L) %*s%ld: over 16 %*s%ld: %d %ld: %d %*s%ld EOT rcvd %*s%ld EOT sent %*s%ld EOT indication%s %*sConnections: %*s%ld connection%s used extended format %*s%ld connection%s allowed transport expedited data %*s%ld connection%s turned off checksumming %*s%ld connection%s dropped due to retrans limit %*s%ld tp 4 connection%s %*s%ld tp 0 connection%s LOCAL, PDN LOCAL,~PDN~LOCAL,~PDN~LOCAL, PDN %*sRound trip times, listed in ticks: %*s%11.11s %12.12s | %12.12s | %s CategorySmoothed avgDeviationDeviation/Avg %*s%11.11s: %-11d | %-11d | %-11d | %-11d %*sTpdus RECVD [%ld valid, %3.6f %% of total (%ld); %ld dropped] %*sDT %6ld AK %6ld DR %4ld CR %4ld %*sXPD %6ld XAK %6ld DC %4ld CC %4ld ER %4ld %*sTpdus SENT [%ld total, %ld dropped] %*sRetransmissions: %*sCR %6ld CC %6ld DR %6ld %*sDT %6ld (%5.2f%%) %*sXPD %6ld (%5.2f%%) %*sE Timers: [%6ld ticks] %*s%6ld timer%s set %6ld timer%s expired %6ld timer%s cancelled %*sC Timers: [%6ld ticks] %*s%6ld inactive timer%s cancelled %*sPathological debugging activity: %*s%6ld CC%s sent to zero dref %*s%6ld random DT%s dropped %*s%6ld illegally large XPD TPDU%s %*s%6ld faked reneging of cdt %*sACK reasons: %*s%6ld not acked immediately %*s%6ld strategy==each %*s%6ld strategy==fullwindow %*s%6ld duplicate DT %*s%6ld EOTSDU %*s%6ld reordered DT %*s%6ld user rcvd %*s%6ld fcc reqd B㿀%'Y`Ya@@!Y!@Ð@`!Y!@@ݐ` !Y"@@ѐ`!Y"@@@Ő`!Y"`@@`!Y"@@`$!Y"@{@` Ybؖ@`!Y"@h@`H!Y#@\@`L!Y#0@P@v`X!Y#P@D@j`P!Y#h@8@^`T!Y#@,@R``!Y#@ @Fa!Y#@@:Yc@4`D!Z @@(`@!Z (@@`\!Z P@@Z`x@ a !Z @ؐ@a$!Z @̐@aZ`@a!Z @@ߐZ`@ِZa(a@Ҕa( %Z/Z, @, @ , #`#\`0@a  $, al`aZaH@atZa`@ap!Z@|!x@Za@`,!Z@j!@`0!Z@^!@`4!Z@R"@w`!Z@F"H@ka|!Z@:"@_ax!Z@."@SZc@MZcpZ##\#`ZZZc(#Pc`@=Uaa"  ` a#d#\#`@+ `dZ`h# ``a' U"B[cl'􀢠"U"Bą"?  `<#`#d#\@`#[```Ħa`̢`#\#`@`![` 8`Ȗ`#\`#`#d@ܐ`l[`8`x@Ԑ````#\#`@ɐ````#\`#`#d@[`@`t[`|``x#\@`[` `' UB[cl' "U"Bą"?  @#\`[`a`a' UbB[cl'􀢠"UBą"?  @\#\`Ԣ`a[a@S`@#'[`@8`@+[`ܔ#h`ؚ#``#\#d@;`[a@4`@a`@1[`@!`#h`#``#\#d@`)[@@[aȖ@ a"@ڐ@a-[@ϐ@a8@Đ@a[b`@[b@ݐa[b@֐a[b@ϐa[bؖ@Ȑa[b@a[c@a[c(@a[c@@[aĐcX@{}[]<>㿘 _@J   2    2   "   W`  @7X 2   "   _ ` @ @&   _ `   @ @ @``?"``` * "`@S %s㿘@ $ @ U"  .@*`  :  ** *@ *@_( "@ *@*$OpenBSD: main.c,v 1.30 2002/02/16 21:27:50 millert Exp $_ipcompstat_mclpool_mbpool_mif6table_mf6ctable_mrt6stat_ip6_mrtproto_pim6stat_ipsec6stat_ipsecstat_icmp6stat_ip6stat_etheripstat_ddpcb_ddpstat_ipipstat_espstat_ahstat_ipx_errstat_spx_istat_ipxstat_ipxcbtable_viftable_mfchash_mfchashtbl_mrtstat_ip_mrtproto_igmpstat_file_nfile_cltpstat_cltb_rt_tables_nimp_esis_stat_tp_stat_tp_refinfo_tp_inpcb_clnp_stat_ns_errstat_spp_istat_idpstat_nspcb_unixsw_rtstat_icmpstat_imp_softc_ifnet_udpstat_udbtable_tcpstat_tcbtable_ipstat_mbstatipcompetheripipencapespahigmpicmpipudptcppim6icmp6ip6spxipxns_errsppidpesisclnpcltptpddpAabdf:gI:ilM:mN:np:qrstuvw:inetinet6localunixnsisoencapatalk%s: %s: unknown address family %s: %s: unknown or uninstrumented protocol %s: kvm_open: %s %s: %s: no namelist %s: no namelist %s: no stats routine 㷘@'D   ""h# ' ;975-1` 8c* @€ "bl " "b@  "8`b@ ` $hb@ ` $hb@ {`b@| u`b@v ` z$hb@m( ` q$hb@d0 ` h$hb@[8 ` _$hb@R@ P V$h <`b!@dcH@Y   I"aHb $C"| @$ <"c:b 6"4b 1'b@@Eb   P <`b!@9ch@. "ad '!h "xa "a &  $h  &`@X5b %l$@wD@"耢?C?* @@c\ @ `" @@X %l@Z $`@  ``   @@@@!  @  "P <`!c@ϖ@Đ @@@@ `U@    2  P <`!c@0 <`!@c@ڜ `  "x@"l@ڒ d     * @*`  0` @/#@| @a @  "al P@n bx  !`@S t0@!@_  H 4!`h  !X@{!L"h  UH@s<0  !|!L!d@!p"h  U`<@iT@( h  % @&` @Z 0!8  @ 2     @@&h V@&Uh   hVa@  2 h   hVH@~  2 h   hV"x@n  2 h   hVb@^  2 h   2hU"@:`h   Vc@B  2 @٣ d<Tt ,D\h㿘!` U * b* `@  * b* `@    "h` %s: %s 㿘!  @GP  <# a!c@ڠ"H@4?s c_0es c_0㿘Vc( c(@      2 㿘  @%B@@%( 0 @ϐ   2@%> 2`@%+ usage: %s [-Aan] [-f address_family] [-M core] [-N system] %s [-gimnrs] [-f address_family] [-M core] [-N system] %s [-n] [-I interface] [-M core] [-N system] [-w wait] %s [-M core] [-N system] [-p protocol] 㿘#P!!`<d`@`<d`H@`<d`@`<d@`@ $OpenBSD: mbuf.c,v 1.12 2002/02/23 01:12:54 art Exp $socket optionssocket names and addressesfragment reassembly queue headerspacket headersancillary dataoob datadata%s: unexpected change to mbstat; check source %s: mbstat: symbol not in namelist %u mbuf%s in use: %u mbuf%s allocated to %s %u mbuf%s allocated to %lu/%lu mapped pages in use %u Kbytes allocated to network (%d%% in use) %lu requests for memory denied %lu requests for memory delayed %lu calls to protocol drain routines 㿘@Vc!  P <d!@b(0  P <d!@ݒbX0!"  c 䀢  a| 䀢 V#L` ` ) @`* ` !d"@S#L` ! bH 1d@*` *& @* h`@8"`` 2@㌐  @ %"H! "H%d,``㌑,`@  H@㌢`@&,` %d $@ 8@ۯ 4@4 4@ۦ@۠"   @ۚ" @,`* * @+ d`#c@ߓ:`  d@ڐ#0 d@֐#Pd @Ґ#x%lu%c㿘  # k2  m21 e@? ip_mrtproto: symbol not in namelist no multicast routing compiled into this system multicast routing protocol %u, unknown mfchashtbl: symbol not in namelist mfchash: symbol not in namelist viftable: symbol not in namelist Virtual Interface Table %s%sVif Thresh Limit Local-Address Remote-Address Pkt_in Pkt_out %3u %3u %5u %-15.15s %-15.15s %6lu %7lu Virtual Interface Table is empty Multicast Forwarding Cache %s%sHash Origin Mcastgroup Traffic In-Vif Out-Vifs/Forw-ttl %3u %-15.15s %-15.15s %7s %3u %u/%u Multicast Forwarding Cache is empty Total no. of entries in cache: %d 㶰 'He@#H0ג$ $``e@#p0e@#0H e@#0e@ڐ#0f@Ԑ 0"@x' ""@ؔ(    ;f9f/f+f)f  #.2  @`@`   @H @ f` @; f  @ $*`2   ְ D2Hf@ H    `R N  .`@ `?`9f/f-f+f)f2!@@fp (o P0@ @Za4@ \8@O! @:#f.2  "@BaȒ*`2  @:a(`'@ ff@*!0"@&@$a""@mrtstat: symbol not in namelist multicast routing: %ld datagram%s with no route for origin %ld upcall%s made to mrouted %ld datagram%s with malformed tunnel options %ld datagram%s with no room for tunnel options %ld datagram%s arrived on wrong interface %ld datagram%s dropped due to upcall Q overflow %ld datagram%s dropped due to upcall socket overflow %ld datagram%s cleaned up by the cache %ld datagram%s dropped selectively by ratelimiter %ld datagram%s dropped - bucket Q overflow %ld datagram%s dropped - larger than bkt size X e@#H0 ``e@u#p0ve@p#0q`g@i!0js 4g@b!!g!@Y!g"@P!g"8v@G!g"hm@>!g"d@5!g"[@,!g#R@#!g#@I@!g#p@@!g#7@!g#.@$OpenBSD: ns.c,v 1.7 2002/02/16 21:27:50 millert Exp $dropresponduseroutputinputspp??? Active NS connections (including servers)%-8.8s PCB%-5.5s %-6.6s %-6.6s %-18.18s %-18.18s %s %-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s ProtoRecv-QSend-QLocal AddressForeign Address(state)%8lx %-5.5s %6ld %6ld %-22.22s %-22.22s %d %s8 Ƹh@ƒb`?! T"D@ T"D@7 ;ha         `r  (` ㈐i hV2~V#%`;!h@M"a`h@G"`` ?"``* $`@Iߐ "l`hhb@/"l h"h#h#x#\ h@hHh#PhcXh@h%"l " h#@  th L@#@C@c@>h@c ` Sh@# `*`Lh@#Ȓ`` ?"``* $`@I D  T @Zh@͐"%s: %ld %s%s%s -- %s connection dropped due to no new sockets x terminated due to our end dying dropped due to inability to connect incompleted due to mismatched id's dropped due to mismatched id'spacket dropped out of sequence duplicating the highest packet refused as exceeding allocation initiated accepted established droppedembryonic connection closed (includes drops) where we tried to get rtttime we got rttdelayed ack sent dropped in rxmt timeoutretransmit timeoutpersist timeoutkeepalive timeoutkeepalive probe dropped in keepalivetotal packetdata packetdata byte retransmittedack-only packetwindow probe sent with URG onlywindow update-only packetcontrol (SYN|FIN|RST) packetrequest to send a non-existant packet received received in sequencebyte received with ccksum errs received with bad offset received too shortduplicate-only packetduplicate-only byte with some duplicate datadup. byte in part-dup. packetout-of-order packetout-of-order byte with data after window rcvd after window rcvd after 'close'rcvd window probe packetrcvd duplicate ackrcvd ack for unsent datarcvd ack packet acked by rcvd acksrcvd window update packet  e i"@SW* !i#i#cuii#(@AcHW4 !i#i#ccii#P@/cHW* !i#i#cQii#x@cHW, !i#i#c?ii#x@ cHW. !i#i#c-ii#@cHW0 !i#i#cii#@cHW2 !i#i#c ii#@՚cHW8 !i#i#cji @ÚcHW6 !i#i#cji 0@cH< !i#i#cӐji X@cH@ !i#i#cji h@cHD !i#i#cji x@{cHH !i#i#cji @icHL !i#j#`ji @WcHP !i#i#cyji @EcHT !i#i#cgji @3cHX !i#j#`Uji @!cH\ !i#j#aCji!@cH` !i#i#c1ji! @cHd !i#j#a@ji!X@cHh !i#j#a` ji!X@ٚcHl !i#j#apji!X@ǚcHp !i#j#aji!@cHt !i#i#cאji!@cHx !i#j#aŐji!@cH| !i#j#aji!@cH !i#j#aji!@mcH !i#j#aji!@[cH !i#j#a}ji!@IcH !i#j#akji!@7cH !i#j#bYji!@%cH !i#i#cGji"@cH !i#j#b(5ji!@cH !i#j#bH#ji!@cH !i#j#bhji"p@ݚcH !i#j#aji"@˚cH !i#i#cji"@cH !i#j#bېji"@cH !i#i#cɐji"@cH !i#i#cji"@cH !i#i#cji#@qcH !i#j#cji"@_cH !i#j#c0ji"@McHĀ !i#i#coji#H@;cHȀ !i#j#ch]ji#x@)cH̀ !i#j#cKji"@cHЀ !i#j#c9ji"@cHԀ !i#i#c'ji#@cH؀ !i#j#bji#@cH܀ !i#i#cji#@ϚcH !i#k#`ji!X@cH䀦 !i#k#`(ߐji!X@cH耦 !i#k#`@͐ki P@cH쀦 !i#k#`hji!X@cH !i#j#bki x@ucH !i#k#`ji!X@ccH %d %s%s%s smaller than a header smaller than advertised with bad checksums㿀 8Q i"@?耦 !o#i cao@/ 䀦 !o#i cQo@  !o#i cAo@  too large to be forwarded forwarded too many times while gatewayed Refused due to lack of space at DestinationPacket at SocketNo ListenerBad Checksum at DestinationUnspecified ErrorNS error statistics: call to ns_errorerror ignored due to insufficient addressingerror request in response to error packetserror packet received incomplete received of unknown typeOutput Error Histogram: Input Error Histogram: 㾰   o@" !o#o bo@t" !o#o co@d# !o#o c8o@T#Hp !o#o chvo@D#xl !o#o chfo@4# Ъ)o,` ",`@&# ,``@+`,`  %o,`@ ",`@Ц ,``@`,`in transitat destinationUnknown XNS error code 0%ox V*` * c ` 2``p"p"p(@\   !o @ǘ㿘W`2`  2` 2` 2` 2`  @C2` $OpenBSD: route.c,v 1.45 2002/02/16 21:27:50 millert Exp $Routing tables rt_tables: symbol not in namelist Netmasks: p@#bl   W t` @y  p@{#08`Đ   !'p%W .  &w t "hbl " "h 2 @\@G  2 @1 $p@0@@4  ֑. InternetInternet6XNSIPXISOX.25EncapAppleTalk %s: Protocol Family %d: 㿘?`q"T*` €q! q!0q!@q!Hq !Pq !Xq!`q!h `q@!x0q!@                     %-*.*s Address%-*.*s %-*.*s %-6.6s %6.6s %6.6s %6.6s %s DestinationGatewayFlagsRefsUseMtuInterface㿀"l`qq"ȖВ @ q  ""@`  "   "@`q "q  #"@`     "@`q qqqqqq#c (0#8c@#\#`#d#h#l#p@f%-*s %-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)㿐"l`rq @> r rrrqr#\ ``@/ 㿘!#` 4 #`.%-16p (root node)%s => 㿘%#H T `Kbl r!@ bl 8r `!r!r!@ ,HW p`!  @bl H@NH   @\ ,``?"`` * "`@@l H  H0  HW p`r@!@$H`` mask (%d)%6.6s %16p : %16p %d refs, mk = %16p {(%d),%s ->㿘!HT!H  r@#xW  @?``_%0! !r @r#@k`%? )r!c!8-r+r j  @ݐU!8 8 r#В@K   @̖?`` }?"```* $`@?ِ } `@-c؀`͒``?"`` * $`@? route-sysctl-estimateout of space sysctl of routing tablex   ?''''   @E s@mv!@@ @ǻܢ 2s@!@6   @. 6s@m^!@( @ @  %-6.6s 㿘 L% `" $ 2    @; $  @5  L ?  M@ P  @(  s @b``?"`` * "`@?3 defaultlink#%d%s%x: %02x%02x%s  x?`t#*` €  `@@X`s# ? ?  ? ? & 2`@7` @@Ȑ@y|    2  t @ m  " `  t @ _`+t)t?$@`? : `@H@iD@K ? z $r @q: 2*:)+t)t?$@]`    2?$@L (   2 ߐ?t 0@0"@`r @0q"Ȗ@ hHHH4HHHHHHHHH4HTHHHHDдpWR ,Ѐ`  ,R@"` `*`R@ *@q %6d %8ld %6ld %6s - %.16s%s => expire %10lu%c recvpipe %10ld%c sendpipe %10ld%c ssthresh %10lu%c rtt %10ld%c rttvar %10ld%c 㽐 @֔  (   @͒  2 @\0 " @̾  (  @̵     4"@`  "  0   "@`"    ~  4slb 8u t@ h T`u@ x Puu @` P   L a``?"`` a`* $a`@=m  @!! `ɔ  @$!u ` u t @ a``?"`a` * $a`@=C !``+u P \   L `  L d  L#\@턐 Pu h   L l@  L p  L#\@o%u.%u.%u.%u㿐W`x 'D"`x"@D&! 2 ,b@l̒ . @\,b"@` D @A  @l . b@xr ", #a@E , D! 22v#\p2 `!@!!%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d㿐"@`   `@  2`" @@ !"@ #c@ES , 6` `!v 6 #@d!*# `!6 v ȗ6   !6 6 v#\ؗ6  `#@J!#!6 6 v#\#`6  `#@;!#illegal prefixlen invalid%s/%dp`    ' `' '  ' ''' E @C`@ + 3` "$  "  `` " `"  "   ` 2 `  ` ``2+ + `@ Ĕ  ` `䀢  `耢  `쀢 `1s&#v!@cX"@`2 !#\ؔ! @r vp@!1 vx@!㿐  !!#\!! @T t ,!rtstat: symbol not in namelist routing: %u bad routing redirect%s %u dynamically created route%s %u new gateway%s due to redirects %u destination%s found unreachable %u use%s of a wildcard route 㿀 w@뽐"(03Ȕ w@뷐"H!w"Xݐ@뮐!w"xԐ@륐!w"ː@뜐!w"@듐!w"빐@늒*.%xH*.*any*%02x%02x%02x%02x%02x%02xH.%xH%xH.%s%sp 7  7 7 * 7777&7+  2#+` 2 2,2  #bx 2@А@T 1!x"@ƒ 21W"W @  Wx,   |@  2  x, 1%'#x# b x#d    #\#`  `@Lbؗ,`01% #x   K 0 *  2x@@{ ",Ȱ"`HȒ 2@p@0H.㿈 7777 7 7 77`x"@x  " %02x:%02x:%02x:%02x:%02x:%02xp ? / / // 7  / / / / / / // ///#/  W W #bx 2@ @!x"@ 2G"W @9  Wx"  @/  2 `x ! `*  `: L`#@L`+ +`#\#`Ox#d; ;`@Ғ  !x@#0@ɒ 1*#01"xH#0 2@@>㿈 7 Y7 77  Y// 7 7 7 7 //Xx"@wɔ  " %-18s %-5u %-18s %-5u %-5u %-42s %-5u %-42s %-5u %-5u %s/%-u/require/acquire/use/dontacq/permit/deny//in /out / 㼰 @g 0 @b 0 0h@] 0ʀ  !y"ڒ@鴐!y"ܐ@ʀ 2@jx@@( X@@$   /Y/y/X/x@/ ` @*!y"(@酐@@ @@ /y/x/Y/X@  @!y"8Ȑ@ij ilp А #\  @!y@T"P:y@P"X9`%*`z"0 €y@D"`y@?"py@:"y@5"y@0" y@+"y@&"`  y` * *y@"02 `` ` y yy@"0@"Ё,Th@ J(8f4 a* J TP_CONFIRMING(0x8)TP_LISTENING(0x7)TP_REFWAIT(0x6)TP_CLOSING(0x5)TP_OPEN(0x4)TP_AKWAIT(0x3)TP_CRSENT(0x2)TP_CLOSED(0x1)ST_ERROR(0x0)T_ACPT_req(0x18)T_NETRESET(0x17)T_DETACH(0x16)T_USR_Xrcvd(0x15)T_USR_rcvd(0x14)T_XPD_req(0x13)T_DATA_req(0x12)T_LISTEN_req(0x11)T_DISC_req(0x10)T_CONN_req(0xf)XAK_TPDU(0xe)XPD_TPDU(0xd)DT_TPDU(0xc)AK_TPDU(0xb)CC_TPDU(0xa)DC_TPDU(0x9)DR_TPDU(0x8)CR_TPDU(0x7)ER_TPDU(0x6)TM_data_retrans(0x5)TM_reference(0x4)TM_notused(0x3)TM_sendack(0x2)TM_retrans(0x1)TM_inact(0x0)$OpenBSD: unix.c,v 1.8 2002/02/16 21:27:50 millert Exp $Out of memory (file table).  `!H  @t| `  `{@!H00 *`" *   "`d$"h h hT h ( h`   h` h (@Lh 8* seqpacketrdmrawdgramstream#0Active UNIX domain sockets %-*.*s %-6.6s %-6.6s %-6.6s %*.*s %*.*s %*.*s %*.*s Addr AddressTypeRecv-QSend-QInodeConnRefsNextref%*p %-6.6s %6ld %6ld %*p %*p %*p %*p %.*s( 粔 8 h `  稔! 2  'W< '{@獐"{ {{{!{ (08#@#\{{{{#h#t###"Ȗ#c#`#d#l#p#x#|#@k $H"l`@P "@2"l`@P| @&a`` ?"`a`* $a`@4 %s: %ld packet%s with short headers %ld packet%s with long headers %ld packet%s with no checksum %ld packet%s were too short %ld packet%s with bad checksum %ld packet%s with not enough data %ld packet%s forwarded %ld packet%s rcvd for unreachable dest %ld packet%s dropped due to no socket space p  $ ~!@䬒Ѐ !~!`4 !~!ʐ@䛒Ԁ !~!`4 !~"乐@䊒؀ !~!`4 !~"0䨐@y !~!`4 !~"P䗐@h܀ !~!`4 !~"p䆐@W䀦 !~!`4 !~"u@F耦 !~!`4 !~"d@5쀦 !~!`4 !~"S@$ !~!` #C@mroute6pr: symbol not in namelist no IPv6 multicast routing compiled into this system IPv6 multicast routing protocol %u, unknown mf6ctable: symbol not in namelist miftable: symbol not in namelist IPv6 Multicast Interface Table Mif Rate PhyIF Pkts-In Pkts-Out %2u %4d %5sreg0 %9qu %9qu IPv6 Multicast Interface Table is empty IPv6 Multicast Forwarding Cache %-*.*s %-*.*s %sOriginGroup Packets Waits In-Mif Out-Mifs %-*.*s %9qu %3d --- %3d %u IPv6 Multicast Routing Table is empty  @l!0G#?blt ``g@_"0:@Z"805`@S"h0.@M"0(?@h ? "@ Jbx  b/-%  '; ؀`. @(⸪ .  2`@" `#0@Ē# @ ( (  @  *`2  ? Ҡ ``@#8$  *``?cpc`#  `73@#hc`#@    'c  '@   c`#@    c  @  #\@#` c`#@    'c  '@   @└c`@    c  @  o@y`# @s   3x    @cc8?#@@Z#?@V ?c   3. 2 2 *  ,@  @D` *`2  @ @; 2M `$>*``@- (@*` ?h$@mrt6_stats: symbol not in namelist multicast forwarding: %10qu multicast forwarding cache lookup%s %10qu multicast forwarding cache miss%s %10qu upcall%s to mrouted %10qu upcall queue overflow%s %10qu upcall%s dropped due to full socket buffer %10qu cache cleanup%s %10qu datagram%s with no route for origin %10qu datagram%s arrived with bad tunneling %10qu datagram%s could not be tunneled %10qu datagram%s arrived on wrong interface %10qu datagram%s selectively dropped %10qu datagram%s dropped due to queue overflow %10qu datagram%s dropped for being too large ( ኔ ``g@u"0@p"80`@i!0s h@b!!ሠ!ؖ@X!ሠ"@N!t"8@D!j"X@:!`"x@0!V"@&!L"Ȗ@!B"@!8#(@!.#X@!$#@!#@!#@㿘@unionsoftdepsynchronousroot file systemread-onlywith quotasnosuidnoexecnodevnoaccesstimenoatimelocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasynchronousffsAadfo:rwt:uvonly one -t option may be specified.rorwrqnoautogetmntinfounknown special file or file system %s.can't find fstab entry for %s.%s: unknown special file or file system.%s has unknown file system type.:@nfs/var/run/mountd.pidr%dsignal mountd㿀@x #ظ   75 # %W/ +2'쀢 8-* @@€ (  %&x"bJ@ @u , c@Ԑ @(b b@  %` ?@@c?ː?c * & ^@   0,06.`? @k  @k  @k( @   @ 0 @Ր     @q#\ 2 @}k 0@  @`8@N  @ D "@ǐ!@ސ, @@t@@^@ '@`H@G @}^ T 2& @`p@= ) T@}Q@  @}7@ @`@+  @j  @j   @j( " @`@    #\ 2`@@;耢  @@Ŧ 2`@#\ @@ `&@R !`@9 !@{  @ ?  b a @ @|@G00 0000000000000000000000000000000 00 0 00000000 00 0 (,㿘N@ n N` o `@aw # n J` o  `@7/ "   @7( 2 `?  @|c( 2J@@/usr/sbin/sbinrealpath %s/statfs %s%s on %s type %.*s: %s already mountedforceupdatemount_%sexec: mount_%s %s fork%s/mount_%sexec %s for %sno mount helper program found for %swaitpid%s: %sX@ `    O@   @`@`(@i[ \@( %@= Ӣ@k˔ Z @kÔ   !`` @`Xn@  @Q`h@J`@@B`px$@^'h $'@[ * $  '* $  x* '$ @ݺ   6 #,  @ݯ` , @ݨ n @?  W0-@t @^ #;9 5$`@@"`@Z  2 "` @M@ @b@) @? +   >   0"  !@惠!@[  !`` @l  0@ 0@n %s on %s type %.*s%s%s (, %sunknown flag%s %#xs, ctime=%sv3v2udptcpsofthardintrnoconn%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadmfs%s%s=%lu %ssizeadosfs%s%s=%u, %s=%uuidgid%s%s=0%omaskmsdosshortlongnowin95gemcd9660norripgensextatt) h  T !@@ǘ D >a` *   W!Xa` @ܳ W"0` D#3"0 `-+)@`  2 Xa`!h@ܖ ,@`  뀌@`!p!`!h@!  @v`   4'Ԓ@H!@h/`@g !X!!`!h "!!@L   @ !X!`!h@8  !X!`!h !!@$   `!X!`!h @  " !X!`!h @  @" !X!`!h @  `!X!`!h @ߔ`  `!!`!h @ɔ`  $`!!`!h @۳`  (`!!`!h @۝`  , `!!`!h @ۈ`  0 `!!`!h @s`  4`!!`!h @^`  8(!!`!h @I(b8@f} @ꊒ̦"@!`!h!!x@'"P@(bX@f\ 7`  ! l  p `"`!`!h  lp p@"x`  t̀"!`!h @b@f! {`  ! l  p `"`!`!h  lp p@ǘ"x`  t" x"!`!h @ڲ x !X!`!h @ڡ x !X!`!h @ڐ x !X!`!h @ x K!X!`!h @n=@eb 7! l !X!`!h @T l !X!`!h @C l !X!`!h @2؀" @)㿐@5  @6  @eQ  @eJ T `@! 㿘W",  aP`?  # @g    2aP@ empty type list㿘 N  nb@   N  o   "aP "!P %W  @Y6 , ` @*  $, @` $@ , `$@  @Y , 2*@, $@%s,%s㿘 L@ @@ @[  @5 @ `@\F`@l-o㿐@'!%  -, &@Xے =  ,  .&` @d  ,  `H, &&  @( 2N&@usage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special node[-adfruvw] [-t ffs | external_type][-dfruvw] special | node㿘a@p!a@a!@V ufs%s: fstab uses outdated type 'ufs' -- fix please%s: fstab type %s != disklabel type %s㿘 @d `  @5^`耢 2( @P "" @d   @d b 2 c@d 2 @̐"  "H@Ŗ  ,-o %s: option not supported㿘@[q  @P 1' n L  o  @X  = 2*`"@1 2   @2    &*@&cP@@  @vޒH 2L@^㿘@㿘@p @[㿘@㿘  ?R$   @ 4  H @ 0? @   @2    @"`  @?`  "  smcuprmcup㿘 ` $`"4$0T!܀ )3! `$!a@@!! @ 0 3! $!a@,!! @֒ @a`@a`' !  @’ !@ϼ @ِ!`  @" "`@ 㿘 `$@|J! "&"X K"""X 2 ! n  !!,""X    !"X$"&@ "X!&@ 㿘$ ` @ 1 !̀ " !! *` * 8`0 @ 0@ 0 " !! *` * 8`  ` @X  㿘@`8`?耠"?P"@耠"?P" H@ "@㿘% /@ & `?R@耢?R4@耢@H ? @X ??  @͢ @L@O?8`?㿘 ` $`w! @Ւ !!`l#D @ @ƒ ! ``?"``` * "`@&` !@Ϋ 0F!!`   ?`&  @ !`* $!`@&F< !`   ?`&  @ !`* $!`@&/< !``?"``!` * $!`@& @!`0@ 㿘`@Ē 8`? ` $ ` `"  *`?"" Error: move: l(%u) c(%u) o(%u)㿘 H@@?   H@  㿘  $a ``@­ @`8`?xterm]0;%s㿘  \ $!  a@c  !`&!!@@ !`0 !` &!!@ @!` `   $&@$ !"@4   @~N! @K !bT  @~DP  `?R@`耢?R#D `@ @'``@)5   @ !@~"  @ !`" ! ?$$! `@) `@f    @Ā    "   $a" %susage: ex [-eFRrSsv] [-c command] [-t tag] [-w size] [file ...] usage: vi [-eFlRrSv] [-c command] [-t tag] [-w size] [file ...] 㿘!`@@{HTERMunknown]0;%s㿐@m a  "a@U@@_! @x$!Ф@ 2@!@@@W $`\$``@@   @p "@b $`D$`Ha`$`8$`<   @ɐ@֒ @N @@2@؀  `? @ !@@ @a @O@U@(㿘@) / 2  @?( 2&@W &/dev/ttytcgetattr㿘 @)!䰒 2$`$@@A $`$@ "hT!"&! $hT!" @!?"@0# @ݔ ?@!?@@c @א @h@ѐ%s: No terminal database found %s: %s: unknown terminal type 㿐 @,"?  0!`@z@ !`8@z@  В  $ ᤄ   $!@"! В  $ ᤄ  $!"!signal-reset㿘`4 $ 3 &aԔ@T! 2&a &aԔ @I! 2a &a @=! 2a &a!̔4@1  ", @ ' А @$  @  @  4 @  P@X  㿈'''@s㿘 $ !@k  !@g  !@c !̐ @_ 㿘3579;!#%')aдT!a(x bhPl a  ax⨨"&(&(X&(\&(`&(d&(l&(p&(t&(x&(|&(&(&(&(&(&(&(&(&(&(h&(%s:%s 㿘!`H@y’`@y b!@H P@y@ 㿀  $! @ !`@ $! X&` U&`$   N&`! I&` >$! @䀢 <   @  2&` @Z#'#@<* "@*`@*`'0!@$`"h*` € &`&` &` &` &`@  B$B<BH@Ainput`$!" @ߐ 2'    ??p?x?' 'pp 'p  @M ? `0 `0, @ Ȁ 2(T`  ̐ '''''''Ԅ '''' @{ T  @{!\T @  ?pp??x?'p p3@ d"`2`*@ `.  #@ 42d  @M ?$ p@l @L] Ű 06 @J2d!  1$! ! .'  "`  @ `   ?` "' !*'$! `  @zȁlines=%lucolumns=%lupР?''''$@@!'@ 2 $@o@'@u @ 㿘 (T   $@j 2e (T ?$(T`$`2[ ``2V $  ?&$$  &$ ! H  4 @  @ȋ  4  H@ @ @  耤)@ 2. a $a$`"' a"# " " " "  *` 8* ? @l @r   @]  a ? $a 㿘 $!  # @ 2 ! ""2!@ 2 ! "" @ 2   @yÔ!! $!016|Vi's standard input and output must be a terminalTERMLINESCOLUMNS%s%s: unknown terminal typetcgetattrtcsetattr㿘  $a a\"@Q   @   >@ 2 #耊 " ## * * `8@!!P@BX @t @8" "  * * `8@` @a @%!` !X * * `8@@Q a`! $"@ `"  h@5 e p@- ]  @aP @X2 @` j@ !@ v@%p @#  @$  $aܒ @   @a\ @ + a"$a\"$a\a$"aha\$$a\ah  $ah,a~,aw,au,av,a{,az@ 2 a\ @xԒ   @Ւ  @ 0 㿘! $ @# !`  @   @ǘ?D  @ @  @@x&!܁ cupsmsormsoelcuu1㿘  $! K!0"Nap@Y!ax@T!a@O!a@J!a@E!!` ! 2! `@ $!! "! @$!! $!8!!$!@!$!D!$!H!a!! %!$$!L!($!P!,$!T$!X$!<$!0$!4!0 @xI   @H  㿘 $@# 㿘@ߐ " @ "  @y & @(  @y 㿘! "!@&!! "!@&!! "!@|&!! "!@u&!! @n&!%lup` @ (@@8 SSSSSShS`SXSHS@S8S(S SSSRRRRRRRRRRRRxRpR`RXRPR@R8R0R(R RRRQQQQQQQQcursor upkkcuu1cursor rightlkcuf1delete to end of screendGkedscroll upkripage upkpppage downknpcursor lefthkcub1delete lineddkdl1insert at cursorikich1go to sol^khomego to eol$kllscroll downkinddelete to eolDkelcursor downjkcud1delete characterxkdch1insert lineOkil1S`T(SHRxT R`QTQQTQlakahaja㿈 `%  @ "@@@#\#`#d@M 2  #`0)Z   @k " ! !Ԣ`@ 2``"@\@Y`#\#`#d@ 2_  #`"B   -@9 4"3@YF0 ". @-@*#\#`#d @@@#\#`#d@    !D " $     @=  2 $ 㿘!D`  `$ @@c 2 `$ 㿘$    " @ kf%d233|This terminal has no %s keyfunction key %dH#c@# @@ @  " @ ` ` !@8  #@#ِ@ @ ?8 ?@ #d#\#`@G㿘 ` $`>` `" (T0,`I"0' (T`"(T$  &$  @0`?0   "  0 " ```   stderr%s046|messages not turned on: %s045|messages not turned off: %s8@s    <@w 7 @O 6a؀ .(Ѐ     &a؀@ֵ` 6 ?c @֦ 6  @A  TERMlinestigetnum: linescolstigetnum: colsLINESCOLUMNS㿐  '`h @?  `1 ` 2q'0oi" " " "  *` * 8 0YW!` " !X!X *` * 8@ ܀0G@؀0C`( @#0 ! `@P#8 6 @@Ӓ `` @@#P 6 X@Ò  " `" P@#h  @(Ԕ @~#p  @(˔ 2&2& 㿘!``? "`` *:  !` * #!`@ 㿘  `C  @  2 @ @#\ ` `  "  H*@ `#\ ` ` H*@  ` !@ $ `      2   @" @ 1 !$  @w  2,  @   $ $  a@ $ !@"` "a@ !@$  @B $ ,  "  , @8>  ?@ ^`@/ @"  ?@ I  ?@ >`@ @  @~ ,   "! #\ `2  1 H `e 1 !@  `  }  z  2s  m  @ΐ , $  㿘 !@) ?π` "*` € 2* 3* 4* 5* 6 * 7 * 8* 9* 2  `"  "` "@@ @b4b@bLbXbdbpb|bb㿐 @x 2(  @F    "" @@&  & &  2 ' "'     ' 㿘!@  "@F `"  "` "@@p!@ 2 !,!,@0㿘 @uܒ <  @  & @( &  @ה   `@B  @& 㿘@& "`@&"@@ 2㿘  @@002|Line length overflow㿈/ @  ' @x^  d d@& d  (T`Đ  @u=   (T`@? ' @y 2      @w쀢 2  쀢@`? k @'' @x _ d d@& d  (T`  @t   (T`@? '@ @wt쀢 2s    `T! ' @7耢 !x t@+x "Q &ttx'T!&T@``@@x * < @ 2Q` @w1쀢 20    T!"x ' @耢 ޤ` t@x " &ttx'T!&T`@ `" `@`# @@xm" נ ՠ 6 @vߘ 2ް    !T!"x ' @耢  t@x " &ttx'T!&T@I @v쀢 2 쀢 [?@W"  @<       T!"x/''   "TtTx >&T  t@Ex "k &ttx'T! &T@4耢  `@" "@ @@wƔ 20 @ '' @v # d d@C& d  (T`  @s   (T`@? '     ` `thT >"hT@script 170|Interrupted㿘`@a "lܰ  `x   `"  "` "@@ @l 2T ! $$?#a *  p+$d @i 2 @&@" $d@ @2d`L@Δ d $d@< a<`"a4a4`*` * 8@2 @ b ` @ b  8bؑ*` * `Tb؀ T "T :@\8 2Y `(T`  @rĖ   `(T` a@;@;͐ @M`x` 2` $$$`$ $@ "`T 2% `(T`  @r  2T`(T` T "T @aT 2&dV & !#&*<=>@~080|Unknown command name1bca1082|%s: command not available in ex mode083|Count may not be zero084|%s: bad line specification085|Internal syntax table error (%s: %s)lr086|Usage: %s088|Flag offset to before line 1089|Flag offset past end-of-file090|@ with range running when the file/screen changed091|Global/v command running when the file/screen changed092|Ex command failed: pending commands discarded093|Ex command failed: mapped keys discardedx  |` "`` %`%`@ @vb L  ѐ & P`*@$`` @   %` ``* $` $``   3@Y`Q`@$`@z 2 T` $` `` $`$`` &:`J   %` `$`  2`  :` ?  $```$`J`:"``  "`?  $`` $`J  2``J 2|` `@ ?$`$`y$`"`` J`?$`  $`J "` "``   $ `("`@ !  3 |` " /'L``   *`J` *$` @    쀢 2`` u ` J`?$`  $`J "` "`:"`` ] `J`|X` V@E"!`   ``?$`$$`` `#\ @ ` "` ``$``$`  `2``2 Lp * : I  x* €c! 'JL   'JL L l p + - ^ ##``"@! $`0!Ę!!`$!$`!$`!$`$$`($`,$`4$`8$`0a$` `H+   ,@  T$` L k s0> <``?`p$`$`@$` ?L  L c" g" r"#`?`" $$`($@$X$`$$$`$$`$`$$`,$`0$`4$`8$`($`  b*  ,@ Ɛ`` "@$ `$` ` ! #H H !Ӏ"#X "#P#P *` * 8`2  @_ ` 0 `0L < `02&` L >! `+ `: `J@2```$``$`J"``" @ 2S`` #耢@  "@$`@2`%`(`*@#H$` ``(``@$`$@2 ` $`` L`$`d P$`h` $`" """ *` * 8`2` ` " ``@`| b$`4`|@*@$`$  ` $"` $` >$``` !  @  $`@h@@v8``"``J !2 ``|!$`4`|$`$``  5` J`$`` $`J "` "```" ``J +2``$`$`:``@ J 0  'S ` 0 'R @n   `` ` $`$`J    "`,`` $``$`ʨ `$`֮"@x@P@0X` ` 5`J\ `` J  $`$` J`%`  $`  ,`` $``$` @Ȁ@:' 5``?`$`$```  J   '쀢~!2}`` #@쀢 "t`J "p```$``g$`J 2`b`@ ]5`  J`$`` $`J "` "``#\  `*:  |2`#$$`($X$`$$$`$$$`,$$`0$`4$`8$`(($` `%$``$` `J \2 ```$`$``J@ "`` $``$`2`` `J@ @ Y```@ J 04  'S ` 0* 'R &@l " `  `J ` '쀢`|2%, 2 ` %` `$` ` ` $`$`쀤 |2, 2``  $``? $`,`` $``$` ```$ "`$`` $` $` $`   L \",` `c`` 050 `` "  "`l~@$`` $`@qے耢 2`耢 2 L`$`d $` L$`d Pd$`h$```p$`d_$`h] 0( & @ $`$``  $`l@q`l 2```   `l  `$`$`d$`d`$`p $`6$`h "*`d2 20` ` $``$` L 2$`d @q耢 2`耢 2  L`$`l $`$`d L$`d$`l P$`h $`p `h$``$`l$`p 2` ` @,  $`` L`$`d#4   L#, *` * 8 #,$`l P$`h$`p@qG耢 2\`耢`" `  L@(` `l 8$`l` $`\ L`- !2``""`J@ !2`|`!$`$`4`| "`` J`$`` $`J "` "``  ϑ* : Fݘ #\* €` ?#`J ^"`\ l +"`\ - #"`٤" `\դ p"`|Ϥ $`\?$`\`| b$`4`|`(" %`(`|$4`|`(d 4`|`(@ %`(`` $``$`` "`J ."`| = + -" `| ^" `|   @`| ( L 32`| 4`|`` $``$`y`J + - ^ #2 `@@ 1 2h`#\  ` 2_``|?`,`Q$`$`T4`|` c\ ` L +2H*:  + -2A`J - +`| 2``| 4`|`@ 2G䀢 L 0*``"@ " $`$`L a `l`p$`d$`h ?$`l$`X`|  4`|`@ ـ @a u쀢 ܀ `@oȐ $`T ` #В@ ``?@ Q ``'``?``@ J 0  'S ` 0 'R @jY  `  ?`$`$` ,  2 ,`` $` $``` $``$`$ @  2`` "` ` J`$`` $`J "` "`` "` `'``6!``@J"`",   'S `"`, 'R @i 2,`  ?`$`$` ,,`` $``$`$ @  2U`]```@ KL NQ?'L o`$ "J`` 2>` E``` b ` *` *  !X@+ :`@i@w L  ` `? $`" ``J  $` ` 2 ` @b8 " ```  @@w ``` ( 2@$`l```2`d$ 2` @2`d` ֔ @n 2`d`| ʐ@n耢 2`$`l`d`` $ 2` @2 $`  @np $ `@B@=<``  21``l L   '`# " & L& P@ P``d L   `  " & L& P@p P``$`$`@ L  P''`* $` '@vO 2\`$ "  , & ,  $@2`@n` @" `   "`$ "`T 2`@2|` @2`|€ ` *@$`` `€ 2T (T`2T  @iw  2$ (T`" $T " `$$&$ " @xA  "&$`\""$ L @ٔP8   @ `@ @m 2 LƔx L`\ & L$ G  C L ?`|`:! @4`|`@@<`|! @4`|`|"@ $@ ! "!! *` * 8`2`  ` @2   L''@/ 8`@J?`"`!` ?   'S `"`` 'R *:`@g 2 `` $`*` $```"$` @$``@$```$`$`$"Ȥ   |`# `P`#8*` € 2@ 2 @ؤ @uϒ @@e@`2 `P pn$"@2y'|Ȑ@u ``@v `  @Ֆ ` @ϔ ` 2@`` "<`! `J` @$` 0  'S ` 0 'R @g\  ``` $` $` |2 `` 8 $```? $`` |@" @uR @v@jC  P@uF  '%$*@&$tP hy<y<yXyXyXyXyXyXyXy<yXy<yXyXyXy<yXy<yXyXyXyXyXyXyXyXyXyXyXyXyXxT094|The second address is smaller than the first㿈&`  &``` @ ?* : `2r!`*` €`@2    @k`l ǖ `l` `@ `?&`d&``&`&`&`p&`h`@2հ    "!``` " L  " L`" `l` &`d P&`` &`h`p&`d&`h L &`l P&``&`p`J`;2``` "`d  `" `l `@& L`h& L`p& P` `?&`9&`@ޘ 2  쀢 - \`` "   ` ` &`d&`h&`` &`l&`p &```l&`d`p&`h&`l&`p ` 2O``@2M ;`` "2 L   02"&`l.`` L&`d P&``'&`h  @ .   @  (   @ ! !   @  `p&`d&`h L &`l P&``&`p`` 2 `d`l @s  & ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, $0123456789'\/?.+-^095|No mark name supplied096|\ not followed by / or ?097|Reference to a line number less than 0㿈'&`* &`  2``J@:A"0     @t '` @ ?ܑ* : `8!ܓ*` € &`@&`&@ju 2 `` ? &` &`` @ @? z'&&``""@&`&` &``  &`H@r _'`J @q "`T'` &`j&`` K  / ?" `h@rԒ  ` ?&`&`K `/2;:#;#| L@& P&`` ` p!p#\ m  ``" " &`&`&` )&` & P& L 2&@i "  "`&`  `c\  ` ++` ?&`&`` Ơ `J "` 2```?&`  &`J` "`` "``  `  c\ `2 *:  + - ^2 2 ` & L& P&` &`` \`J "` 2```?&`  &`J` "`` "`` i\`  ` 2 *:  + - ^2Y \ `2`  `2 `+2? ``?`&`&`J@ - ^ ``?&`&` ` @2  ` " $   ` $ :  { `$``" " &`|&`  "    @q ^ 8   S @& X@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@㿘$*@ &$|@2 ``@n @`i$` 2g `P "A@`<`<  @@ $`@"` @$`<"@@`<2 2,`H `P `D`@h- " `D@hW L " L+   & L@r`H@`"``"``@"@@g|`L   @$``L$` & L$`D`$  `P $ &$ 㿘 `|`"1`| P ` < <@@`& @"`@& <"@-  <@2@@' H`"  "` "@@`|2 P`|"  098|The %s command is unknown㿐    (T!" x ' @ 1(  t t@ x %$ t t x'(T!$(T,@@_ ᠐@q   ` `t@hT >"hT@Ő㿘@$    @%@ 㿘@J?`!  @   !А@`?㿘c cLJ@4 2  @k   2 099|Address value overflow100|Address value underflow101|Illegal address combination102|Illegal address: only %lu lines in the file103|Illegal address: the file is empty104|The %s command doesn't permit an address of 0㿐"      @oÔ 0:,)  ` @@Q 0('" . €0@f P@o 0@o 0 @)@@o 105|No abbreviations to display106|Abbreviations must end with a "word" character107|Abbreviations may not contain tabs or spaces108|Abbreviations may not mix word/non-word characters, except at the end㿈`x  "`t0 @ 2q  @o7 j @@` ?\@ ` 2 @`_R@@ "@  Bx  @ `#\  ` _2    ` _   @ `  #\#d@N#` 2  hT  "hT@nΒ  109|"%s" is not an abbreviation㿘 `t(T @@`@͖ "  @@o  㿘@ 㿘@ 㿘@  273|Entering ex input mode.㿐    `  @P` 0`d & L`22``d `d`l   2Ѱ Ɩ  2ɰ ` C`%    2? 2$ $@&   .2  ?@dU  }`  ?  @dF n` ǖ 2&`&`$@u``&蠟€  `  @O 0o$!2  ``&$!@) @sa@)!@)@)Đ`|!! "!! *` * 8`2!< "!<!< "!4!4 *` * 8`2@  @  ?''@Iߔ  @```@c̒  `@@2`` & L@d   & L 111|No more files to edit㿘`x `(   2`K `!"`|`x 2`( @@  @R}@}y a@[  r `x Jd@2d`$ " d@  @`$d* $d$`(`x @`%   $`$  @m.I `t `"$@ $ `  $`$$`(@R d $d `(@R d@  2`|!  $ @S_    "d`( $`(d ($d㿐 @ 3 @9 `t@R  `|2 @S2  @7 @ 0 @"`("`$  "$@ $$$ 112|No previous files to edit㿘`(`$@2 `@l 5 !"`|@1@ ' @o" a@Zٔ   `(@RZ  `|!  $@RԔ   `( d($d$`(113|No previous files to rewind㿘 $ 2 `|@lH !  a@Z  2  $& (@R" " `|!  $@R 2 $ &$ 114|No file list to display %s%s%s[]㿘 $ @l 0Q   H)'-@ (  8@ ?@   @'#  (" ( @' ( #Ȁ #Д؀ #ؒ @'` hT   @^  2  (T`  @'j# 㿘` `x @^   @k `2`t@D@7 &  @ `"$@@& $`@`  $㿘  @Y$ $ &`t $&`x 㿘 @N $ *  @V $ *` * $ * "` $  $ $&`t $&`xx    (T!" x'' @o" "e '쀢!  t x@c" "Y $ t t x''(T!$(T#\#`#d'@ʚ    ` `thT >"hT@u /  @ @  J@  J@ "` "`@ y   ` `thT >"hT@G  echo x  ` (T!" x'' @" "̰ '쀢!  t x@" 2$ t  t x''(T!$(T  *@  *`  *` *` + '#\#`#d@5 2  3@y  R  4@y  K cp " chch`* * `8@N    #\ ` J?  ? # N@19  0  %N   \@ `2 ? @1"  ?   ?'N * .@@]  @` `` `thT >"hT@a 㿘z "xN N " ""j )`N  0  'S ` 0 'R  @[     ؤ@$*@ " @ ))`" @L@ "` @   'S `"` @ 'R  *:`@[c 2 @` @,`ܠ ,$ $$&`t$&`x 115|No previous command to replace "!"116|No filename to substitute for %%117|No filename to substitute for #㿐\`@d'@+N #"`  % ! '`@ \'`"`  @Ш'@    "(T t(T x >@  '(T t x@E " ' t(T ta x' '(T@ @3 ӠN  @'@    "(T t,@@'@    "(T t(T x >@  '(T t x@ " ' t t x'(T! '(T@ @ @`@@&`(`N % # !2`'`    "(T t(T x >@  '(T t x@ "^ ' t t x'(T! '(T@ @ B, "'`   `"hT`thT`x >@  &hT`t`x@ * &`t`t`x'hT!&hT@@n  x@h+   ,'@%` "㿘 ` `$@&"`` @X,  @,  $` @h `2` @e? * @U P$` `,   @Zڐ ` "@ @g ``!`  #$  $ @  @Z $ @gǔ   $ , $  @g   , `,@   @Z ` "@ @g ``, "`㿘   "& $  @ ,``"  ` " @@ @@ `@& @ & $& &  ./%s304|Shell expansion failed㿘@3 / "X  "` ,@ @@5Y 2M$h@h _ 2  L  .? @ݐ@ؐ@ 4@b -@ `$`*` @ `M / /, `@$ *` " $`$$' t$' x@6ِ @6b$@  .` "@7H  p@f  㿘@@@9289|Shell expansions not supported when the secure edit option is setpiperfdopenvfork-c118|Error: execl: %s119|I/O error: %sx'D#X'H'L 'P#P *` * 8`  DDcP D/  cd  Dc\`* * `8@'#\'@S / '' 'H?@'L'@''@  D @fc @THa  'D(@fV @3 D0@fE 쀢 "@K?"@~? @~ @ @~@~@~ 8@ Dܖ@@gc @ @~wC쀢`9D     t@L(T >&(TL x*`  x t@.D "Z & t t'L x"(T!&(T@*  D@L "E 'L@"@'. ?'`? "`@N@  "@䀦( .N?  2.?.P"@H"` @@K  DX@f   D @*q 2 N  N " "" ``Dp@e} `@ 㿘`|  @`Q ` @ *2 . $ @2  9 . #\ $ ` &$ ` H+ @  `  !@     2  +  * !X@ @Vm @G  0^@X 4`<$`<$`@ @X  ,``d " `P"   `P`l " ,`P`<"`@"$`@"`$`<    `   @?.` $` @d " $`L$`H*   @  @ .@ ` `| $@`|"  "`|  |$` !!%s 303|File modified since last write.! 㿀`t@` 2  `  @F 0  @@.@ $  @d  `@$@2```@a@ ``@a@ @ \`` L  > X ";$!$ "!! *` * 8` $T  @Sd  "#$m $T "$L$L *` * 8`2$$ "$$@2 $a@i^ $ @`?@(b:$ 2 ``  @F 09 `d @`&``l 2@@[i쀢 (  2@&`l&`d @`d`l#\@ $ & L& P@a P$& P$ @2 @a8 120|File modified since last complete write; write or use ! to overrideHOME121|Unable to find home directory location%s/%s122|New current directory: %s%s㷘  `X "`x`|!2`x  J@/h@c  `x  "#`t0$@t L @P@V   "J  @c k @@@M 2`x_ V`t `/"P  `.H `.2 !H  .2 !H  /; :!H " !@!@ * * `8@ ')`N@ @ :2`(.@@a@.@@ 2N@@n(  @dt   N@ ږ`@dh  V<xX( VlXHxhPHB &@1,BxHxhP`1H0 ixp"h@( M`B`XP8BX( ##h`&P( i$/Ph`X@81 AtBJTphV @NBJTpFxH@KX8(Vl`XS8VTP4TP4p8(T_qxpPH`X8( aD1Ux8iXP@Pkphh` TxhH@0H(M`B`Dʜ`80< T4@xXH 8 I/xp8pH@!8@#`X$P( $Pt$Pph$H@8`0X replace previous RE with previous replacement string,[line [,line]] ~ [cgr] [count] [#lp]~display different screens of the file[line] z [-|.|+|^|=] [count] [flags]3c01zcopy lines to a cut buffer[line [,line]] ya[nk] [buffer] [count]bcayankexit[line [,line]] x[it][!] [file]xitwrite the file and exit[line [,line]] wq[!] [>>] [file]wqwrite the file and switch to the next file[line [,line]] wn[!] [>>] [file]wnwrite the file[line [,line]] w[rite][!] [ !cmd | [>>] [file]]writedisplay vi key usage statement[viu]sage [key]viusageedit another file (from vi mode only)[Vv]i[sual][!] [+cmd] [file]enter visual (vi) mode from ex mode[line] vi[sual] [-|.|+|^] [window_size] [flags]2c11visualdisplay the program version informationversionexecute a global command on lines NOT matching an RE[line [,line]] v [;/]RE[;/] [commands]vdelete an input or command mapunm[ap][!] word!w1runmapdelete an abbreviationuna[bbrev] wordunabbreviateundo the most recent changeu[ndo]undorun the tcl interpreter with the commandtc[l] cmdtcldiscard all tagstagt[op][!]tagtopmove to the previous tagtagpr[ev][!]tagprevreturn to the previous group of tagstagp[op][!] [number | file]tagpopmove to the next tagtagn[ext][!]tagnextedit the file containing the tag[Tt]a[g][!] [string]!w1otag[line [,line]] t line [flags]tsu[spend][!]suspendsuspend the edit sessionst[op][!]stopread a file of ex commandsso[urce] filef1rsourcesuspend editing and run a shellsh[ell]shellset options (use ":set all" to see all options)se[t] [option[=[value]]...] [nooption ...] [option? ...] [all]wNsetrun a shell in a screensc[ript][!] [file]scriptsubstitute on lines matching an RE[line [,line]] s [[/;]RE[/;]repl[/;] [cgr] [count] [#lp]]re-edit all the files in the file argument listrew[ind][!]rewindgrow or shrink the current screenresize [+-]rowsc+resizerecover a saved filerecover[!] filerecoverappend input from a command or file to the line[line] r[ead] [!cmd | [file]]readexit ex/viq[uit][!]quitappend a cut buffer to the line[line] pu[t] [buffer]putedit the previous file in the file argument list[Pp]rev[ious][!]previouspreserve an edit session for recoverypre[serve]preserverun the perl interpreter with the command, on each lineperld[o] cmdperldorun the perl interpreter with the commandpe[rl] cmdperldisplay lines[line [,line]] p[rint] [count] [#l]printenter "open" mode (not implemented)[line] o[pen] [/RE/] [flags]openchange display to number lines[line [,line]] nu[mber] [count] [l]numberedit (and optionally specify) the next file[Nn][ext][!] [+cmd] [file ...]!fNnextwrite a .exrc filemkexrc[!] file!f1rmkexrcmap input or commands to one or more keysmap[!] [keys replace]!Wmap[line] ma[rk] keymarkmove lines elsewhere in the file[line [,line]] m[ove] linelmovedisplay lines in an unambiguous form[line [,line]] l[ist] [count] [#]listmark a line position[line] k keykjoin lines into a single line[line [,line]] j[oin][!] [count] [flags]!ca1joininsert input before a line[line] i[nsert][!]insertdisplay help statementhe[lp]helpexecute a global command on lines matching an RE[line [,line]] g[lobal][!] [;/]RE[;/] [commands]globalbring a backgrounded screen into the foreground[Ff]g [file]fgdisplay (and optionally set) file namef[ile] [name]filedisplay ex command usage statement[exu]sage [command]w1oexusage[Ee]x[!] [+cmd] [file]exbegin editing another file[Ee][dit][!] [+cmd] [file]f1oeditdisplay buffers, connections, screens or tagsdisplay b[uffers] | c[onnections] | s[creens] | t[ags]w1rdisplaydelete lines from the file[line [,line]] d[elete][flags] [buffer] [count] [flags]bca1deletecreate a set of tags using a cscope commandcs[cope] command [args]!scscopecopy lines elsewhere in the file[line [,line]] co[py] line [flags]l1copychd[ir][!] [directory]chdirchange the current directorycd[!] [directory]!f1ocdchange lines to input[line [,line]] c[hange][!] [count]!cachangeput a foreground screen into the backgroundbgdisplay file argument listar[gs]argsspecify an input abbreviationab[brev] [word replace]Wabbreviateappend input to a line[line] a[ppend][!]append@ [buffer]@shift lines right[line [,line]] >[>...] [count] [flags]>display line number[line] = [flags]1=shift lines left[line [,line]] <[<...] [count] [flags]<execute a buffer* [buffer]b*repeat the last subsitution[line [,line]] & [cgr] [count] [#lp]s&display numbered lines[line [,line]] # [count] [l]ca1#filter lines through commands or run commands[line [,line]] ! commandS!scroll lines^DX8  $xpP@88Discard all current cscope connectionsresetkill numberKill a cscope connectionkillhelp [command]Show help for cscope commandshelpfind c|d|e|f|g|i|s|t buffer|pattern c: find callers of name d: find all function calls made from name e: find pattern f: find files with name as substring g: find definition of name i: find files #including name s: find all uses of name t: find assignments to nameQuery the databases for a patternfindadd file | directoryAdd a new cscope databaseadd309|Use "cscope help" for help㿘 $8   @l " $8_  ,$8`t@ #\ @ `      `2"7#\ @ ` 2 L   `"L , L  #\@ `   L  @ `2 @ 2  `@Zƒ  CSCOPE_DIRS :㿐@|!8 "T @}U     (T!" x`' @~Ζ @  t x@~– 2$ t-  t x'(T!$(T`@|s'# @!@>aH 2J   ` `thT >"hT@yА %s/%scscope.out8 @|`x 2 `x@ @gcXy @@< q `t,  @X  @Z* a <  2"$@X@W @Z E @ݒ / .@`@| @L`8  4 @Y /  $ @{$ $ @. @  $" $$ @ @>   @y; cscope.tpath%s:8`˜!(@W@W Q@x` &`, @Y \  @Wd `,@r @Zڒ  G @qC @q`, *@ `,:2`J` 2`J@  @@Ld  #&`(`, a(@?X "! &!(@?Q   @#` &`, @LG  &`(`,  "@`,  @x&`,pipevforkcd '%s' && exec cscope -dl -f %s/bin/shsh-cexecl: %swr㷈?''''D'H'L@= @8耢 D@Y @DH?"`  0DD@Y ?"@q`?"@qZ耢?"@qT쀢?@ @qN@x @u @r @qD@qBH L(@Vݐ–cHP @d#@D”X@Z @y @q& @q$Hch"$@F HH"` ’cp @F"H"`310|No cscope connections running%d%s 278|No matches for query㿐 ` 2 @Ðh@X     @Kx $$  @Kp , % % 2$ " $$@ ~   L  P` !`?` '+ a@F+ @p @?  @w@1>` 2  2  Ð@X6 R $ ``|! a @.M <   @. 3@2 $$`2@$`" $@@$ $`2@$`" $@@` "  "` L"  P"`" "` "  @w[  @wV sgdct efi311|%s: unknown search type: use one of %s㿘`SN@N@ "` "`N@ FN`  A&J    &L`"LN@@2L 2N`@Ė `  * *  !X@*`:`@HԐ`@W n `L  "  " L  "@cY ) L  % L  "#\  `  H*@  `  !@ `     2  @y @J2`#  @W= @.&& & *`& @y@ *` . cscope: %d lines%1[ ]%s: "%s" x@ '*@` @W`@( Ēc@  ??'`@(  @֐ '``? "`@?``@  "@ 2`*@' #"   "   @y\@  @ucЪ 値  Z耢 U`"T@yC@m܀ 2  Đ@)C؀   .@`@`@In  ; ( $ @xj / *@  ' @x]`@$  $  $ $  @xN$  $$ &"@&  &??_'@  @V?  ` `   "b` @Wx @  8`( ""'%$@T@S 2 &@x'`   '@ 2'㿘@"%s doesn't match any cscope command Command: %s (%s) Usage: %s cscope commands: %*s: %s 㿘`N@ `@ 2 Ɛ`@@\#  `h@U Ɛ@P` `@K` `3 `@?   2 㿘@@  312|%d: no such cscope session㿐 `` ``@ 2@`2 `Ɣ@U{ * ` "` @:` "`@:`@ @`"``"``@"@`, "`(@t`( @t@tÐ 1㿘   " #Ɛb "    No cscope connections. %2d %s (process %lu) 㿘   Ɛ@cP0  %  @h ` 㿈 2$@L# 2` ' #\ '' @s ` @.6 0  "& & L & P@yB P 㿘@w ` @*    2 㿘``? "`@=``@  "@>2`2` % `? "`@=` >` @`">``? "`@=` ` @`" 2` 㿐  2 `|`  @6[ 0&  `Q`d`l  2 ̖  2 `d& L@K " L  8& L buffersconnectionsscreenstags㿘`t `c" `s`b"  >`  `t", 8` 4ǐ @Ob耢 2/` @@0 'ǐ @Ob 2"` # ǐ @Oےc 2` @ ǐ @OΒc 2` @+w`  @5ؔ 123|No cut buffers to displaydefault buffer㿘 a@ 2  a 2 ȐX@Sْ 0\!@ "( # c\ 2  @@]  (T`D  @F~  2 (T`8 2  !@ "' # c\   @@4  (T`  @FU  2 (T` 2  ! Ȑ@x ********** %s%s (line mode) (character mode) 㿘Ȁ"@``*` *  !X@@D` "X"h@ܐ``3% & ` *` *  !X@@Dq@ hT   @E   (T` ޴@͒2 㿘`x  "`t0       @8 7  @@8 . `t @B%`@s`!@`|@A a 2 `|!,@9;  $ ($$ 㿐 @o = @ `|2 @9 @ @pp 0# "` ""`   `2 L"`L P"P֒ "`("`$$ &$&  %ld 㿐  2 ``  @4Q 0@ @I   `d'@ b8 㿘  2 `x`  @4/ 00 ) %`t@ @v 2`!  `@Ao@q``?#? @`6`&`   h @r L@T  piperfdopenvfork-cexecl: %sfilterforkwparent-writerp'L'T'`'D'P'X"'ܐ "D 3@` ? ''''\  '@ D@耢 D @?cȀ  'D@QĒ @(?D@Q ?"@j ?@j`@7  쀢?"@i쀢?: @i؀?"@ @ @ ?"@i?@i@i@iD d` D\ * * `8@Dc\@; / D d  D\ * * `8@Dc\D d  D\ * * `8@Dc\ X@՘ D d` DD\ * * `8@c\Dɖ@Ru @r @i@i\`'@i|cDL@͚   'D\`\D "\L TT" "D  `X @*`X? 0$Dʒ @P @iE'@iCkD@i?@>Œ` 2 @q #`DcL#\P@5D @q@i)\ @kD  'cDP@o   'D\ "\D @~   '܀`T\TD L P   L PD  'T` D@GD DT@?"@D `X *`X\  Dd @ DX@= 2 ܀2 filter read㿐   @ s 2` @0 2`  (T`  @C  2`, (T`"`,` @ː@P- @5 㿘`|2@ 㿘@ 124|The %s command can't be used as part of a global or v commandppp  2 $`  @1ܔ 0I@ ` Ȑ@O > `x "` `t@ "  "  #\ ` 2 ` \|   `  @1 02   \ 2 *  *   ꀢ \ " * @   2$ @1~  @2 L Đ #\   @ؚ " Lٰ #\"   @̚ 2ϰ  &  L P '' '@NƔ 2  @B\ `<$`<$`@`t@$ " '̒  '@n*  $` @OP  ؒ  $`H@q;$`L `P$`D  ,`P `| $@`|"  "`|  |$` `l`d@z d( (T`2@  @A   (T`@`"``"``@"@@n|`@nzU@pl  d @DX؀  ؘ    ??ܐ @h    0 "/` `@"*``@@!`@ @ $  @A   @Nɔ " $ $ $`@$ `<@2`@$`<"$`@`@(@p  㿘``@oC2  [  @N U  |"Q P G<<B  : @ `2`? $ -$ $<2 ?@%$ @ $@$` @"@@mݐ@AW  $` `$` $ $@$`2" $@$2 $D2 P 㿘 @A5$< 2&`$$ $  $ $    "@w $  @N+   @&+   㿘 2$$ @@ @9@ w 2  , " @mw  @mq@' 2 @mj& 㿘`= @'M/etc/vi.exrcNEXINITEXINITHOME%s/%s.nexrc.exrcΠ   @~  2  @Ɛ 2   |`"$Γ$&2 ΢ @o " @pU @ H  @oq " @pD @ 7 @oa "5 L 0΢8 Θ $@K @,  "    Δ $@Kp @  2  @` 2[   |`"$-$&2O ! "!! *` * 8`? ;΢ 8 @ "%   8 ΢  @՘ 2 8@<@ @ "    |`"$$&  X#\   5  @-w@o@-@㿘 `| ` @?В 2`| @Lڔ 3  $`|" `|$`|$ ` $ $ `2 $ @q_ $  `$ $ @o\@qO $    $ $  125|%s/%s: not sourced: not owned by you or root126|%s/%s: not sourced: not owned by you127|%s/%s: not sourced: writeable by a user other than the owner128|%s: not sourced: not owned by you or root129|%s: not sourced: not owned by you130|%s: not sourced: writeable by a user other than the owner㻐@J*  @` "` `" ``  `?`   w @Q@ / ?`@W$ 7@Q`  ` ϔА @L ϔ @K -   ` `thT >"hT@kZ`  ` Hx @K֖ ϔ @KΖ    ` `thT >"hT@k+ 131|No following lines to join.?!㿈 2 `d`  @- 05@B  АP@K )   "'(T!"  x' @o! `|   t x@o! "  & t t x'(T!&(T`| "`d`l &`l`d`l@2`d`&`l`d `l   쀢`   "(T t(T x >  &(T t x@oq "а & t t x'(T! &(T @o_ L `|!I쀥  쀢 ?J 쀢 9'`0'J "쀢 "(J`)#А!p@ ",@,`` ,@` ` J'` 'J "쀢 "쀢 @lȐ@ @J?@  $@?"$P " ?"$P  @@쀢 ]&`l`d$L`d`l @@x ?$@@Au  ` `thT >"hT@i  ` `thT >"hT@i`d h`l`" @$h132|No input map entries133|No command map entries134|The %s character may not be remapped㿈`|!  `x  "`t0@m  2 `""@J1  @ @j #:#\ @ ` 2    `2 '`  ` #\ #d#`@ku " Z ( `t KI `27`t  23`t ` 'S 'R  @;  "  " `t2`t р` "*` *  !X@@:@I   ` #\#`#d@k 135|"%s" isn't currently mapped㿘`t ``|!@ @k 2`t  @@J̒  136|Mark names must be a single character㿘  2 `t`  @+L 0 `   @H`d(@IX  .exrc137|%s exists, not written; use ! to override%swabbreviate map map! 138|New exrc file: %s8`x  "`t0  "ؐ@@8]`|@i`|! @F Ґ] &@FҔ! RҒc@6 ! "@aaE @lQ 9! ` @6"Ҕ0@lD  2,! ` @2(! Ҕ8@l7  2! ` @2! @Z@ 2! ` @2! @.5  "Ґ@@J   "@.%""Ґ @I X    `  @* 0?`d `h ?`l'`p'''??''' ؐ ?G Ƞ `T /'' @^<   & P"  & Lť139|Destination line is inside move rangex 2 `d`  @*1 0`h'`l'`p'`T@ '쀢@ Ӑ@H=    8`T   '"  8    . @@ 2   "'(T!"  x' @lB! Р耢   t x@l6! "ư & t t x'(T!&(T耦@"@G` &@ @=B܀ 䀢   @l䀢 ܠ@iȐܐ @= ` 8 `  '" "&  2 @= wŐG A @<܀ d䀢   @kʔ䀢 Xܠ@iܔ @= K`` 8 "   '" "&  2  @=? 1Đ ` `thT >"hT@fɐ$L`$P 8 "l  '"   @@ 2 l $l140|The open command requires that the open option be set141|The open command is not yet implemented㿘" " "" *` * 8` 2ԐH@G  306|Vi was not loaded with a Perl interpreter㿘Ր @F  142|Preservation of this file not possible143|File preserved㿐  2 X`  @( 0$ @ Րp@Fɒ  @^ݐ 2 @> 2 @_.  2 Ր@F  㿘`t@5ސ`|@5Q a 2 @, "  2`|a  $ @,  $ ($$㿘`|$`d@8`l  `l $ L`p$ P㿘`|"`d@%`l  `l $ L`p$ P㿘`|`d@`l  `l $ L`p$ P%6ld TOOBIG x  2 `  @( 0VU Pզ"?c#!Հ"'䀦 c@D%''  @ 24  @;i܀ ܀  $@#  @ 2  (T`  @8  2 (T`2 " $㿘 'PP$@ 28  (T`  @8  $ (T`2' $ ֒`P @ "   (T`2   @8k   (T`2 Ր@Pc  [ynq]㿈" '" *` * 8`@" ֐!Ȓ'  @Q 2J @ @:Ƙ쀢 2A  ` @= 26 `  '&  @+ ^ 2$  (T`2   @8   (T`2 ֐!ؒ'  @  2 @ %c㿘", ""$"$ *` * 8`2$#Ā "#ĸ$#Ā " ## * * `8@@ 4`$2 @jd 8 }%@??y֢#` @x hT p  @7  2 8 (T`2e& 8:\??‧`V  , *  !X@@5 ,  * a] @@5`2 ? 8@@Y-??"*)# 8 @I#c @ hT   @7H  2? (T`2 &??ݤ2v@& 㿘$'L'P'T'Xd4`4$ @@Ld4$  #" @$d4J`3 @)㿘N@    4$4$(@@@$4* , :`$$4 ` N@  `@㿘 $4 4 h $$4 㿐  2  L`  @% 0  P'`|`'`Q `d @YĚ    $ L$ P㿘`| !@2 2 @$ `  $$"&$ !!%s ! r%s145|Only regular files and named pipes may be read146|%s: read lock was unavailable `x   "`t0'( @ @ !`#X`   #P 8*` * `2 `  #P " `  @%o 05 @d"   @)i  @) 2!   `x  2 `x2  `  @%> 0?` "`t@b`t, @ @ $` Ȕ $ `@`t`@$`@ `t`0ؒ`ܐ$`2$@&$$ (€  `  @$ 0$ &$`t  @#\`d 2 ` @&`$ & L& P@gQ P  J  2 `x 7  "`t2`t@ct!   ` ! @gk "  @b8` "  ?#? @2   ` 3   蜟@ ؐ@1 `t@ @$ 0Nؒ`@ T @eQ  ؐ@Cے ; < @  @" T @'ؐ @B 0'T   @1Ș  ؔ  @Bo`d@! $ `d & L``d & L 147|Reading...148|%s: %lu lines, %lu characters㿐 "   0@g d 2, (T`,  @4  ` (T` `2 ,   hh , @8< >@" ͐ @1@'l ,؀ 2'`/ @G^ِ @A    ` `thT >"hT@aK  ؐ@C @'8 `hh  㿘@=㿐``x` !`t@  @Į    $ &$&  㿘`|     "  ` "  `  @#o 0`X@149|No background screens to display 㿘     ڐ@Am 0I     @d ` 8@ ?@ ڢ b8    ڒb@   T   @4  2  (T`єT   @3   (T`ڐؒb8 150|The script command is only available in vi mode㿘$  ڐ@A   `x    @@ tcgetattrptyforkTERMemacsTERMCAPemacs:EMACSt-iexecl: %s㿘 3@O 2 @` ? @@Δ  $ & $  \$ $  @c?2 `ېH T d ? $ `$ d`h @c?ې H  @ ?ېX@@  @||?$ 0bې`@@  ?" @X ?b @Xxې h`p@r̔ ?ې x`@rÔ ? ې `@r ?@aR ~@|R  @cA`a@X  @  @  @ @X #d`" #\#\ * * `8@@ / 2 ۖ @ΐې@A| @a @  2  $@ @&$T  "TselectError: timed outError: shell: EOFshellh    ????'' Й2+ @  * "@      @   $@? $f$@$"  @Xe?  @۔@?ג 0dPؤ)  'S 'R  @1   2 @7̀ C̐ @5Ԙ$ ;  * $@@Y@a"''    @E " ?0 0۔@? 0@6ʒ̀  $@̐ @5 @ @-151|No command to execute x@6 2   @4쀢 2ܰ  @* 7耢 5      (T!  ' @ca䀢  x   t@cT x " $ t t x'(T!$(T@Yh @4=܀ ܀ {  @ܐ   ܔ@> f "@  ''  @Wo@ ` ܒb@We   `  "bؐ@>̒ D A   `"hT`t@hT >&hT`x  `t@b`x "; &`t`t`x'hT!&hT  @bД䀢 % @@X@5g 2    ` `t@hT >"hT@]p Ш  ????'' @ $"  2`* `(  "  ` 4 2$   @? "'  ې@>4  '@$" `2* @ :@ `"@  2 2$ `@5[̀ 2̰     "'(T!"  x'Ȑ @b0$  #  t x@b$$ " $ t t x'(T!$(T  `@Vc$?  @ ۔ؐ@=ђ } (  'S 'R  @/   2 ̦$ '̖ @3ј V  * C$@Ā Ā %a  ????''`Й2+ @  * "@ `   @/ @W̔@2 +  '̐ @3  ̀& L& P& P@U    ` `thT >"hT@\㿘  @\@\ $  @=0   @W $ *@ @I   5 1 . K2!K )? K"? "" J@K `J@2" KJ@ `?Ԕ  2" script-shell㿘` 2d  @*@$d@ ?" @U) ?"@U#ߔ @  @\* @\($`   "(T@䠀 "(T 2(T߁"(Tttypqrs0123456789abcdef㿘@Q! ? J!`T!Y"+ aMa F-Y"  p,,  @:9   t "`/:?@,@[V!@@ @: ?&&@@@,C   `g@_& @TL 2  M 2   "b?㿘`x 2` @Ke   `t @H2 " %s -i㻘 3@K$ 1  #dߚ#`  #\ * * `8@#\  @:$ h  $3    @  h $@$$ vfork-cexecl: %s㿘'D  3D'L@Jߔ D d  (€  D`  @ 0u(\  D$`"$ D``D[DW`zD@` DO D@; L D cd " c\c\`* * `8@@U / D cd  Dc\`* * `8@#\D cd " c\c\`* * `8@ L@ D #d` D#\ * * `8@c\D@< @\6 L@ waitpid%.*s%s: received signal: %s%s ...; core dumped%.*s%s: exited with status %d㿈# b $b@Y ?  N L  I`N #N " "@@g@]@_ `c ` `#@#H #\#P#H#` @:ߘ \   ` `thT >N"hT@Z<M `2J :` E2D N #N " "@@@]Vc` `#@#H : #\@:    ` `thT > "hT@Y  @:    p`P@    hP @0 hP8Filesize limit exceededCputime limit exceededWindow size changesVirtual timer expiredUser defined signal 2User defined signal 1Urgent I/O conditionStopped (tty output)Stopped (tty input)SuspendedTrace/BPT trapTerminatedBad system callSuspended (signal)Segmentation faultQuitProfiling timer expiredBroken pipeKilledIOT trapI/O possibleInterruptInformation requestIllegal instructionHangupFloating point exceptionEMT trapContinuedChild exitedBus errorAlarm clockAbort trapUnknown signal: %d㿘"8 @  ``1 !@7 (㿘@ 㿘@  152|shiftwidth option set to 0㿈`    @E 0k c| " ctct`*` * 8` H@9N V  dlŘ  N t @'J " ctct`*` * 8 `'J` >" c| <" c|` ` "'(T!"  x' @]I! d   t x@]=!  $ t t x'(T!$(Tdl  @.O쀢 `쀢 = @. M  # &  cĀ  c`* * `8@ c  *`  8*  @^0&`@*M   $ ``L"  ` ` "(T t(T >$(T x   t@\ɔ x " $ t t x'(T! $(T@\ ~ c, cĀ`  c`* * `8@& c& cĀ  *`@ *` 8    , ?@@ZB"" "@/" ` `` `thT >3"hT@W; `L2  `P$ `P%@@ "@$`P %` `$`L$`P@\r`P` `` `thT >"hT  @Wqd `pl`" @$`p%s8`t  @5 F@Z AȀ    @  2"b@W`  @7ϔ `@P*2 ,@@PG@P  ș>`̀@ ȕ>`̀  "b@WP@8    걚 㿐`|!2  @&  2  h€    2  @\  㿈`x `t`@L@ `L@ " "2L@@hdc\  ``\2.  P . 2 @L` \`2 @,`  @,` L@  @ꀢ \"`,L $ 2$ @ % @  Đ #\   @W 2    #\  @H  #\ ؘ @< Ȁ 2  & L@` @@`%@"` "& @VM& & L``@2@``Ϣ*`:   :  ~` L@ 2*`   ` hT!"`x' @Zٔ  `t@Z͔`x " $`t`t`x'hT!$hTL ' ~L` \?` ~,` 827 @"D `"< *` * 8`2) @ "< 2# @ 2 @"D ""<"< *` * 8`2  @ " @  @X>`   @,` L@  @ \"`'&  @U@Uv &  @6%   ` `thT >"hT@U @X   ` `thT >"hT@Uo@㿐 ؀2$ @͔ !  @  ܐ #\   @' "`x `x  `t@@b 㿐 2$ @ ! @  Đ #\   @ "`x `x  `t@@6 153|Count overflow155|Regular expression specified; r flag meaningless156|The #, l and p flags may not be combined with the c flag in vi mode169|Confirm change? [n]157|No match found㾈 'L  'P`  @A 0<! L ' P '!| *` * 8`!| L. . L ''`'J@ y @?* : `i}#*` €`\ b&`\`\?^&`\m5 LL&@t  "&LJ 'L "2`l֔ @5   &`l&`d@, 0L@,B`l *LѰ  $' $`?`.   ?'' `?.  '  ' $@  'PL 'LJ 2 @LJ`2 ` 2 $ " $`  @ 0$ "`d `  "`di`d `l'' '''' L@) C  C    T!"x/''   "TtT >&Tx t@Xx "= &ttx'T! &T@X ZL@V<'L ' '   L   ? ?(P@ @MM  Ӓ `'8` $@24 (,@2/     !*!@' @SW  @S ' @4  " 'L? *@  ' $',@''̀'''$ 4 ' 'Ԑ& P& L@̒  bP@8 @K ؐ @& o ")  (k @(^f иȐd 2[  2T  @( I  @/䀢 q"E  y"H(   B    &L@ $@  2!a ! ' @R  @R ' @3X  )L@,@UB,@T' 'hT !"hT& L  @ B  $ & P2)@ & @ B 4  2! !   ' @Rg  @R ' @3   L@$@T$ L'@ @֚ 2 ',` $ú  ` * @  !*!@' @R#  @Ra ' @2Δ  "'L@T@@'  ! @  / "  @)2 b   \`  & \ $@ " '&  @)r I L@' A   "TtT >&Tx t@Vx "R &ttx'T! &T@V oL@TQ 'L' "!@' @Q  @QӐ ' @2@  "J'L@T*@' `   L `  )  !*!@' @QZ  @Q ' @2  "'L@S@@'   @  / "  @(j    \`  & \ & " ' @(   X `& X & `` 2' "!'''̀`'ԐЖk$Жb" ЖY쀢`8  (T`  @$M   (T`  L@ 2& P P & P@Uϔ P  `    ` @&`P@  $@ h@1L   !   ``thT >"hT@15   @   9'@P @P<<<<<<<<<<<<<<<<<<<<<<<<`<<<<<<<d<t<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<l<<<<<<<<<<<Н㿐\'H'L T ! "!! *` * 8`2 ! "! ! "!! *` * 8`2`!䀢 "!`!䀊 "!! *` * 8`L  LH#\ @ `    `""`  $@ @\ $*@&$  $ @ @\ $ *@&$S  HL@y 2e ` HL@ L@^ 2T   @O& L'L@Oa  & @0  H@QLL*@    ` H`thT >"hT@Od `" 'HH@P  2 @ `$ &$ $ &$ [[:<:]][[:>:]]㿐 @` L ["l"D \ *f ."e"Dv ~"H"Dp`(m L < [ *' ."&"D_"""D ~ >"  V""DR O " "<"< *` * 8` 2A ' "D " "<"< *` * 8` 2/ +  ""<"< *` * 8`2   "   "D " "<"< *` * 8` 2   2~L  &&    T!"x' @S\   t@SQx 2&tȰ tx'T!&T`@ ` ~ \L [  \ * .""D. ~"q"D.`(. L < [ *F ."E"DZ."A"D ~ >Q."#"DM. . . . . . .  . . . . . . .` ""<"< *` * 8`2R.6 "3 K."D ""<"< *` * 8`2. " . 3. /. ""<"< *` * 8`2  . ". @Pe   "D " "<"< *` * 8` 2 . .Q &&@& ^.[]$*㿐 &   , T!"x ' @Rk  @ t@R`x 2&tY tx'T!&T@  J? / ? ?  J?`$ ?   N / ? ^ ?N ^,@ `?  ' \N \2 NN  / ?2N  ?@ؐ耢 ".?.   $.&&@& ([ ]|/\*([^*]|\*/)*\*/)*\^.[]$*+?()|{}㿐  @L@ "?` &* @* $@   *     ` hT!"`x ' @Qʔ @ `t@Q`x 2$`t9 `t`x'hT!$hT@ ^. `@Oj  ) \L@` @O]   @Y! " @.  @. ?`@OJ   $. &&@& RE error: %s㿘@5 @L  @-6 0 @5 @-+@L㿘'P 'L'TP'H N L & \ ” `"D ""<"< *` * 8`/   )*  `L?ڀ`O ! *` €"D  "< *` * 8`"<   *: ?Ц* @ ?@ @  {@ `?2`` ?t `` H"@3 @ `   'R  @ ' "    c\0  c\0c\ ` `  H c\ ` ` "*@  `@M!*! @K@K  @,l M-`      ` 'S 'R  @#   &   @2  ` & @Kx*` @K*` &  @,#  耢 2 & Z  * "  +& ) "    0  0#\ ` `   H #\ ` `  "*@  `@L!*! @K+@Kh  @+Ք -2LL "P"T"̝X#\   9  @ @N @ @   > $158|No previous tag entered㿘`x . 6` "`t@J`t@~@ $` @+2  #Ѐ " ## * * `8@ "`@M`(``*` 2 `@+  @K`@ " @   @ j$$  @ , b% % 2$ " $$   L  P`  a2`| `|a !@ >  @Ð 5@2 $$`2@$`" $@@$$`2@$`" $@ $@g "  "` L"  P"`" "` "   @J @I@ 282|Already at the last tag of this group㿘 2  @ &  @ 2 `|@*c   @V "   $ B `$ @ `  255|Already at the first tag of this group㿘 2  @x &   @ 2 `|@*%   @ "   $  `$ @`  㿘` `@ &`` @ @T   ` @Y   $ >($$ 㿐` `@  &` @G G @,    @ @G09` @@$ @* @G~ 0( "` "`"`   `2``  "`("`$䠐 >" "$@ $$$ 159|Less than %s entries on the tags stack; use :display t[ags]160|No file %s on the tags stack to return to; use :display t[ags]㿐 @@2`x @ b   "`t0ST  @jJ@ $L @4;@)0 9 @KӐ@@ /   @~'  @K 22 @X@*N  2`|  @I`|@ 㿘 @  ``|@  @,  㿘@   @  & L & P@1  2)    "   #`  `3 @,  "$ (&$@@  2@@@2 @ 292|Display too small.%2d ... %*.*s %*.*s*%s%.*s 㿘 2 8 @Ɣ 0 "@(w 0xd @] ;9753/@a`!` 2 `@J   ޖ  Д ֖ 2ϒa@"` 8?• @J֐  8݀ 8 @!!! 㬐㩒@@2 (T`  @̖   (T`2 㿈 @G`@ e``(@ 2[ `"``" "`@2 ""@"` ݐ" "@2 $"@$ @@ "@"쀢 " "` "$     @ $  @'  㿘@Fѐ  2` @'  `$ ` @$` $ $ @$  $ &  㿘`  ` !@F  @'Z  @II $ $ $ `  $ & 㿘`  ,` -` ``$ @F  @'2  @I!`` ($ ` "&`   $ & 㿘@` `"``" `@"@@F}`@F{ 㿘`` @&` "`@&`"@@Fb `2@` @`$ "``@@"@@FO 164|%s: the tag's line number is past the end of the file165|The tags stack is empty166|%s: search pattern not found㿘`  ` 0 @& 0@' 0@G=㿘  N@ @  /`&@`()@@EҐ   @& $ @EȐ` $  @&w   @E @Ha *@, $ $  "@$ @``ʲ` 㿘 Q@ 6 `  @E 㿈#\@ `@&'@N 1#  ' '#\@E @{ (  " #\ @E "   Q 0 2 & & L & P@J[ P 162|%s: tag not found%s㿘@H @ג`! K & &   & `& @GВ ` @J  `   ,`@` 2)& H@'   `' ! `  2 @` ` `$@&  ` ,`@`2 `@E   163|%s: corrupted tag in %smunmapclose  'P@#G  " ' @H/  #\    @G֘  " @=' 0P@ @P@( 'M  `'J` @"J@  *@ '%`"`'@GՐ``@Ƞ ``2P P@G 2>PP@*y' @*t! @%     t@T >"T@Db    ` `thT >"hT@DM@ <@P.@`@`@  , ( $ @F / *@  ' @F   $ $ $ @F$ $ $ &"@G& @G  @$ @< @$  %s/%s8'N /"@"U `@zF / ,@`$@"l@"A  /`@G&' /,@㿘&2  : @L  @3 2&2  : @L  㿘@@ "@? @0@@N@ `뀦@ J(88   ?J` @ : JJ@  @ *J  @  J@` ` 2?302|Vi was not loaded with a Tcl interpreter㿘x@#ڒ  8@  8$   і "m @$ $`2@&`" &@ L $  T    Q* !`* L#!`  L  @s| 2C @e ؐ @K 3?`  #0*` €C @&?      @G " $ ?`"*` €0&@쀊 䀎   ` @J?`\‎   @ @J?`.@ &`"` @"@ذ  5 Ѐ  $` @r 2 @B   @r  @ז$`$ @@2`&@"i&`  @2   @~2| {䀎+  @ J@  J "` "`@  $  !`*  *`?`" @ܐ e) `"&"  *" 01 @''  @Fϔ "G '  @D  '' @ |€ $ $  @@ 2( |@C| €@B䀎@ #\ `  Ґ  * `$  X|T8D@@@@@%c%6lu %.*s㿘@i#`" """ *` * 8`  `@i#h"`#p@i`@:!`㿘#Ā " ## * * `8@#| " #t#t * * `8@` ` @ `L 2`@GC$@ *L@G9$@  @G3$@G-$$@  `@E` 2&` &` &` ``* `&`    `?`* `&` 㿐`L`P'' '@ ٖ  , ` X 2 4  . X& 4 4   @ 2   & 4@    & 4@A $`L$`PTo see the list of vi commands, enter ":viusage" To see the list of ex commands, enter ":exusage" For an ex command usage statement enter ":exusage [cmd]" For a vi key usage statement enter ":viusage [key]" To exit, enter ":q!" 㿘Òbܿcܻc@cܷܳc The %.*s command is unknown Command: %s Usage: %s ^D%*s: %s 㿀`x S `t@c\  ` `H*  + #@`" @@@` 2`@  "``!2`  @ b*  *@`9`80g!`3 X"@ @[@ 2 ```# X0Q#6@2`( x!$ [/@ @ ]*  /@` //@ ``*  / * +`  @`` @  (T`  @  c (T`c0@@ The %s key has no current meaning Key:%s%s Usage: %s %s 㿘`x e `t `" `  @ 0 `~4,`[`]`~ #`~B$ "## *` * 8`|B |"PB#x.`@` `` #0*` *  !X@@fQ ` J cX #p#xT? B#x #| !.`$ "## *` * 8` bP.` bP.`` /#``~4  (T`  @T  Հ`~ (T`Ѐ`~ @@ 㿘\  @Aې.`@*`# @& & `& d& l& h`& p |!6 |& t & x$ x t( "`"@ x t(" x"@㿘  `,"" `0  `,@Cy`0 "2 $`,`,`? &`@V@  &@`  ⨀ 2  $6` ` 2 ,2&2&   Ť167|%d more files to edit㿘`2$  0 , @"  ("  " & 0 `@ 2` ("@ :@  㿘 (€  "(\$   "`" " "  * * `8@!`  & 4!X * * `8@!X$& 8 ? &$ 168|Buffer %s is empty144|%s: expanded into too many file names283|The %s command requires the ex terminal interface272|That form of %s requires the ex terminal interface274|Command failed, no file read in yet.173|The %s command requires that a file have already been read in171|No previous buffer to execute172|No previous regular expression230|This screen may not be suspended290|The %s command is not supported when the secure edit option is set284|That form of %s is not supported when the secure edit option is set174|Usage: %s㿘 C ē. €0`x@U 02%!`2H @ 0P@ 0@ے @P`xVersion 1.79 (10/23/96) The CSRG, University of California, Berkeley.㿘@  175|The visual command requires that the open option be set%luz%c%lu%luz%c 㾐" " "" *` * 8` 2 `dX@   " & L`| (b  - @  ^  ( +  . L P#  "`@A L ` 72``|   L`X@Y!  L@Q! 8  @6 `|" @d"4$b2$ !  @+ $   @+ $`2$@&$$@  `& "@{' 2 2 2  ؾa  &$ 㿘@j 2  @ Ғ 2 g&`x㿘@U  2 @  2 `| aӒ `  $$"&$ 㿘@4 㿘  2 X`   0! @   2 @  2 `| a `  $$"&$ ! 㿈  2 `|`  l 0!  `x `t@L  "  " ^2]`dL !2Y`d#X "#P#P *` * 8`2`      `  5 0L  "  " L `  " 0@>  2 $ &$`t `d#\`l% 2 $ @2 ̒a `d `l@)` "``x L >L  > L`L  "  " L `l`dP @> 2I `x 8  4@   &`d&`l 20 @?`&`d&`l@ ' @?&`l&`d` @|쀢 2 `l쀢 8&`l̐  2& L /tmp㿘`,`0`0'   $`4$  @ "@  @9k@9i $`0@쩒 52  @ ג   @ `# c@쏐 `0@  & @9? @ʔ  `0&`4& `02`4$`0"$`4%s/vi.XXXXXX237|Unable to create temporary file238|Warning: %s is not a regular file%s239|%s already locked, session is read-only` `   ?#ߐ @6`@5  `6` @ p \ 2 `X @z  ? $`T,`X$`H$`$`x@t  `t f` 2M` @(f 2F`!xx!@`  !p * * `8@!p  @C$@;?@\C!? P@0 ?" `@10"@1``` 6`@d  &` ` 2` @[ &`` "@8~ @  @?`` $` 6`@R`D-  @ cB + gB + 3`   8 " < `X x|  ,`X$`<$`@$`D, x @  ??  ?/''T2   '`@0P `L'@ $`L @ ` `X' ,`X  ! @؀  $`᠐@ڒ  @i 2}`@g 2w` "     "@  ``6` @ @ X``?# @6` ` @`H@ "   0 `! 6`ᨨ @  $@`  `@    )  @& @ )  @& @&  $@@& $ @&$2 "` @7{&`` " `X@>@7r` &` `X @"`L@>`L`L "`@7e$`L`  @@7[`P %s/%s㻘`2Lf& / .L / . L / @`?P&@ 2"Ȑ H&   " * * `8@" - !  L : 2 ?:L,$@#8#,@d 2L ` @6ɐ  @x   @9g@6`&`& -c option㿈  & L& P $   `2 $@ L q L 2 & L& P #bx@9 [  \I$ $ @ L Q L 1 ; ` `& L`&$& P!l "!d!d *` * 8`  & L  @ & L  L  @ `쀢  & L& P P쀢@8  L& P@;O P P L ''& T '@9240|%s: remove241|%s: close242|%s: remove243|%s: remove㿘`" @? &@ 0"0  L $  P`$ `/4  ",`@=  @ @6   $  0@ "4"`  0@"@  @6@6& ` `"@  @ƒ @  C&@@t@R`X` 2`H`L " `P@=W `Lฐ@ `P " `H@=I `P@ `H?"`T@.`T?"`L@.`L "`P@5`P @5@5 244|Read-only file, not written; use ! to override245|Read-only file, not written246|%s exists, not written; use ! to override247|%s exists, not written248|Partial file, not written; use ! to override249|Partial file, not written250|%s: file modified more recently than this copy; use ! to override251|%s: file modified more recently than this copy252|%s: write lock was unavailableaw254|%s: WARNING: FILE TRUNCATED256|%s: new file: %lu lines, %lu characters315|%s: appended: %lu lines, %lu characters257|%s: %lu lines, %lu characters   @M     ` "쀊 """ *` * 8`    D#PA# B$ " $$ *` * 8` 3`  @.   ##ؐk  `@  # 0@/ 2 @ $ `   X  <@ @@ D@  P -   &"  @$   !0 !( * * `8@@! " @!  `᠒ @! 0  @   А @ !@  `@ @- @ ''@  2 '@#\#`D`@n " X@D  ,X$<$@$D  2 @ {  ?  5  X ,X `@㿐 5 @Ŕ<0a(!X!@h HD@$@@G?8$? 8@4 8 !%@6ې@@ OH /@  N@ /2` 8?:`@  ..@.@.@@ <    ` `t@hT >"hT@3o 258|%s expanded into too many file names.%d259|%s: not a regular file260|%s: not owned by you261|%s: accessible by a user other than the owner?b'H! $" @ ?   " :H` 8#\    * N N  @6G͔ 2B   @@ג @+5      (T!?# '`*  2#  @7 @ x*  2 (  t t@7 x ހ$ t t? x# '(Ta$(T @L*`: `% `/L  %" *"  *L    % d,@,`,`@: p ,@4 /,2 @$@9#`@I 4@ ?@p?  `"@@ x @@̐ "*<  @|@  6  @ Q$`@! @UВ! @@+@9: @+? 1 ?#@@+) 4"H@* H@* `݀   ` `t@hT >"hT@1+ @*ې`@9d@*Ԑ`᠐@ `   ` `t@hT >"hT@1ʐ 㿐  @  "  yJ@#$! &$ <J`#2j& L  @ 0^ ,/*J` *&$!&$ ( J@ *J` /`?' '  @\ 032& L/J@ /+J` /'$!&$'' ( J@ /J` /`?' '  @) 262|File modified since last complete write; write or use ! to override263|File modified since last complete write; write or use :edit! to override㿘 2 X7 1!$ "!! *` * 8``  `@   `  ! !P@k  @B264|File modified since last complete write; write or use ! to override㿘  X   ` @=  @265|File is a temporary; exit will discard modifications㿘 "   `@"  4  `2  P@  266|File readonly, modifications not auto-written㿘  `X !$ " !! *` * 8` 2"  """ *` * 8`    @Ӓ    / 㿘 `@03` & @ &  @ 㿘"8 " "0"0 *` * 8`   @  ?2 1 @ے 1 &"@Մ  " #@? ` 177|Empty file㿐@`` @     @m  ` ` @i`  &`&``&`` .` 㿐`` ``"*` 056`2@ &@ @`  @?&`$&@` `&`@i "` &`&`&`&` @.``?@`  &``&` .`@0 㿘` 2 ` 2  ` "  㿘 "`  " " 2  ` "  㿘``; !*` €@' &@ `@(`  @ '&@` ` @i`  &`&`` &``  ?@    &` &`?`&` .`@0< 1L01L01㿘 "`  " " 2  ` "  079|No non-printable character found㿘  b0@W= @ @N  @J  @F  @B #Z!Z!b @߰,RbS R@:  ,R ` *  c\J`    ,p  c\ @J`2 ,p p   8@  㿐 h " Z!Ԙ` !  2" 2   Zb!ԗ*` * `# #b㿘  ] *` , !X@   - ,@`  㿘@ 㿐bԀ /b`. (8b``@" b"'/``@b" bxbx`. (8` 1@ `@#\H#\/`_ #\   2b ^/`@ ?/`I b"bb`(( 8! \Z6  \/`/`   8 8  (@6`?'` \ xZ/`/`  @0@ /@@`/'`)㿐Z"Z/aԘ @͖   㿘 a (aaa a`2 a 8 aa ("&$aa@ @ `@* @@ "aQ a .a*"@ "a* + " #H*` @(-* $aaa*`" a* @0$a `"$ @$`$ `$ ` $ `$ `$ ``$ ,  'S   'R  $  $ , ՠ  㿘`  ` !  `@!!! "@@ `@ @@!!*`" !* $!*"@ `*` # -` $ @, ` 'S   'R  :$  $ ,  0@# `$ `$ ` $ `$ `$ `$  h`   @2p `A6T "xη 2b x1 2Y `?`! *` €  @RF   hT "hTg 28 A25 * "@*` ` ` &@`&``&`` &` `&``&``&`? $$ $\ ` Yc\"W ` L`  ` 2H @ : I  #\ @. Ԁ 5 $ "$$ *` * 8`2`| y ` 2!! "!! "!! * @*`8 * *  _* *` *  Y* &c\ `  `2@* a@&@`&``&`` &` `&``&``&`? $$ $"  "\  2  a .` &`.`&`} * "@*`  @0Y `? "@`$$  $  # "## *` * 8` J F  @ xؔ  2     (T `"(T3&`     " ݘ  2&    Ԙ   * "@*`a    Ř  "       O ;<<(<(;;<(<㿘   "  @$&   @$276|Unexpected character event277|Unexpected end-of-file event279|Unexpected interrupt event280|Unexpected quit event281|Unexpected repaint event285|Unexpected string event286|Unexpected timeout event316|Unexpected resize event287|Unexpected write event㿘`?` .*`# €! @ ` @ # ` @+ @*CCCC(C8CHCCCXChCxC   """  ( (  㿐 !@*`.`" "**   '!@/ 2$! @/M $!   ` 㿐 '@ ` @ 2 `  @W  ' 㿈`K'H ` } H 2H$@"#` x |`      @`2@ `'? ;`H@" "@'H`H 2&` *&` H ?`  ? 2H H@ 2'2&  &`&` &`' `& 003|unable to delete line %lu㿐  'H   @ @ ђ  29 Ho  22 H@ H ''    HH@@    @($   ?$  X " X@"  X`, XH @ 004|unable to append to line %lu㿈  'L 붔 J L ?''   ? LL@  4  @*$    $  X " X@!ǐ X`, XL @`L@ N L@   2 L@B   005|unable to insert at line %lu㿈  'H X F H ??   ? HH@ a 1  @:$    $  X " X@!j X`, XH@ H@ H@   2 H @    006|unable to store line %lu㿈  'H  3 @ H ''?   ? HHp@    @"$  X " X@! X`, XH@] H @ 㿘  `   2  $@  x |`"   `?   `?007|unable to get last line㿀 `2` ꐔ G  &@$@"?  x |`" 6 ''`  ?   0@ &@ &@ / ,  ,  , $`$`$` $`$  | @  &@ 008|Error: unable to retrieve line %lu㿘@S 㿘$ 2&  @   "  2  @ 2    @009|Log file㿘 &`$&`,&`(&`&` &`0 "! @d &`  @  `X  .`X㿘` "` @&`` " @'f&` &`$&` &`,&`0&`( 㿘 X  , L",P "0 ",P @"0/usr/src/usr.bin/vi/build/../common/log.c㿈     @+ "& $   ,*  @"   ( ''  ''   ? (  $ $$ (`@̔ Ű 㿀 'H X " ,b ` , X  2X $ ,H Ԙ H`E !' '  29    (   @+ ", $  H*  @!   @! ( ''  ''   ? (  $ $$ (`@`! 㿈  X " ,; V  23 $ ,    @+E  "' $   *@  @![  ( ''  ''   ? (  $ $$ (`@!Y 010|Logging not being performed, undo not possible011|No changes to undo`  `X`  `( `Ȓ @ 0`@!z ,`X`( '' `(`$`(   ?`[#8*` €"`( @   `X `P,`X @ ޔ U B  d & dĒ @ Д  Ė 1  \ & \Ē @   Ė?    XĀ "`( `& X & `  @ ؐ''@  `(@& `X  ,`XUUpUV0UUpVtV012|Logging not being performed, undo not possible`  `X`X@ ~ `(  `x `@C!q ,`X`( ''`(`$`(   ?`S!*` € @ C  L@2 `X`( 2`( `XB  @ 3  L@"`(`( `X` ,`X3$`( @ "  L@2  X   X "  `& X & `  @ ؐ''@ 2 `X`(@&= `X  ,`XXdXX X X X XYL013|Logging not being performed, roll-forward not possible014|No changes to re-do`  `X  `(`$@ @i 0`@"K} ,`X`( '' `(`$`(   ?`^ *` €"`(`(`$`( @  `X `P,`XĒ @  Ė ?  \ & \ @u  1  d & dĒ @g  Ė    XĀ "`( `& X & `  @Pؐ''@D  `(@% `X  ,`XZ[[X[[X[Z\0015|%s/%d: log put error267|Log restarted㿘! @)_ @Ę   @ @ exnexnviewviewc:eFlRrSst:vw:only one -c command may be specified.only one of -r and -t may be specified.only one tag file may be specified.-s option is only applicable to ex.window=%s0(h # &(h(  #&(& &  & &   | & |& &  . p 0& 4& 0!,&!0&!,&!@&!D @ a` @ah  @ap @ax    @ "(T   @&(T     7%`80#D*` €!  "(&! %`(T ?!&(T  t r  rt "  t  ` "( 0@p?ƒ?c*  `  @   (T 2  @! `"  "@"` 2 & "`|& d "d ""` 2 & "`5&  f    6 ?Ȁ` )"@` 2"@`?"@@  L `!0@@&#''''''@    @/  (  @)  C  @#  G  @  "  "   * * `8@"4 ` " XX* * `8@"8   rZ  d& r  2 `@  ~ ` X* @*`8  2 "!   ` ?"d "d׌   ( "@% @"7   & " @ ` @'" $" (rd "d " 6$`2 @ 諒  褐 |$@   2  n  | `{d&  @ k ] [ $`!@~ @ ؟@ E B  2(d耢  2(d ?" `  "`") $`Ȑ @`ؐ  2$   @   @E`P`P`P`P`P`P`P_`P`P`P`P`P`P`P`P`P`P`P_``P`P`P`P`P`P`P`P`P`P`P`P`P`P`P_`P_`P`P`P`P`P`P_`P`P`P`P`P_```P`8`D%s%.*sex/vi: 㿘     @   @  @  @ @  @(T !@朗`( l !`0%#  8`@  @` "` " l 2 ---c$-s㿘)'!hpN+L +$L  @   '&@ !h `* `* `*8*@$5@ ֐  &@ - c**@˒ )` -2&`L   c@    &@ " @*   p * ** T t w2`J` "``@ " @ a` 2@ %s: %s 㿘!b@c@` ! b@#@@c"`8 㿘 `8`""`"@@  `82 017|Mark %s: not set018|Mark %s: the line was deleted019|Mark %s: cursor position no longer exists㿘``" '@   `#耢`*`#  `  ` "  2 ``  (*` *  !X@@  & &㿘``" '@C  %@    @ / 2 `8 "`8"  "`8  8 " "" $"  2     $ , $  , ,   8  *2㿐`  ` 0<@   8 "6  * ? `. &  2 ! F  2  q      8 "     &  2  020|Error: %s, %d: : %s%.*s㿐'P'T  'X` C `"@ ?  `7!,*` €$ / $$  8$*` * `$   T $T$$  8$*` * ` 0$  $@ a@ P aȪ   "a$   ` `t@hT >"hT@ , '    (T!' @# "%a x  t x@# "%a$ t t x'(T!$(T` c@ @!R @ ``@ <; 7L $   ` "* *  !X@*`:`t@5 ' L  "@@# 'n@0 "@@P^' X`2  b!$@@ @' D   ?  . 蔒 !`@쩖   ` `t@hT >"hT@3%aȁpqPq,qPp㿐! 0 "@$"    ` `thT >"hT@vhvXvHv8v(vv299|yanked298|shifted297|moved296|joined295|deleted294|changed293|addedvv301|lines300|line%lu 㿐$@#  & X# * * `8@# \  ,    t   ,"@0    "'(T!"  x' @"V" y"  t x@"J" m$ t t x'(T!$(T"ta     9 3" ; , , ` "@` ` @ ' @ @@А ,@ @ @Ð`@  $Ȧ , `h    ` `thT >"hT@317|%d files to edit021|new file022|name changed023|modified024|unmodified025|UNLOCKED026|readonly028|empty file027|line %lu of %lu [%ld%%]029|line %lu㿈  @ ` '  * (Ta  ' @! z   x  t@! x m$ t t x'(T!$(T  L@ , @  * @ *`!] '*:`e' @ ` *`* *  !X@:`\@`L@` @ :, ,$@' $ #@  `@   a@ @r@ :, ,$*@&$ `  ?# @2"a`a@@   ,, ,  X`aa@є@   a  ,, ,a@@  "쀊 " "" *` * 8`0  ,, ,b@@d   :, ,,쀢 |쀢 b@q@C" @eb .`@*`@*`@ @0 b@@Q@@Ԑ ,$'* 8@&M /   L /2 $@8  .$? ,?,?,?,$'Ӑ h    ` `thT >"hT@SLC_MESSAGESLANG%s%sVI_MESSAGE_CATALOG030|The file %s is not a message catalog㻀@Q / "#L  2 @  K   @~ K   @$   @  [`L 2*"`L*   ?'`  2` 2 ` `@@  " `@[`L  "`L   0 [ h "`L @  " h㿘 h  @268|confirm? [ynq]269|Press any key to continue: 270|Press any key to continue [: to enter more ex commands]: 161|Press Enter to continue: 275| cont?271|Press any key to continue [q to quit]: 㿘`"! |.` € c c   c@  c c c@@ 0@P㿀#\@ `9` `3` `-N` |) ?@'䀦    "` h   2`  ?& *? `@H&㿐&L  #\@ J` " L L  @ J `2 L  2@ ` `thT >"hT@ڐ  @ + .&  (T!" x!' @ 1!  t x@v  1!$ t t x'(T!$(T1!7! &L `(?& `*` * !X@*:`VJ@ `.J@ * @ L  * .0p`XH@80(|xtph|`XH@0(0 |Äph `P@@0 @|@  Ř <  xp\`XH8(writeanywrapscanwrapmarginwraplenwindownamewindowwarnw9600w300w1200verbosettywerasetimeouttildeoptersetermtagstaglengthtabstopsourceanyslowopensidescrollshowmodeshowmatchshiftwidthshellmetashellsecuresectionssearchincrscrollrulerreportremapredrawrecdirreadonlypromptprintpathparagraphsoptimizeopenoctalnumbernoprintmsgcatmodelinemesgmatchtimemagiclocklistlisplinesleftrightkeytimeignorecaseiclowerhardtabsflashfilecextendedexrcerrorbellsescapetimeedcompatibledirectorycommentcolumnsceditcdpathbeautifybackupautowriteautoprintautoindentaltwerase   !$x%p+h)`/X1P3H9@68705(= <A;>>HMHJKLwswmwlwiwawttytypettytstotltagswsmdsmslowshsectscrroreparaoptnumodelinesliichtexedebdircobfawapaicdpath=%sCDPATH:directory=%sTMPDIR/tmpescapetime=1keytime=6matchtime=7msgcat=%s/usr/share/vi/catalog/report=5paragraphs=IPLPPPQPP LIpplpipbppath=%srecdir=%s/var/tmp/vi.recoversections=NHSHH HUnhshshell=%sSHELL/bin/shshellmeta=~{[*?$`'"\shiftwidth=8sidescroll=16tabstop=8tags=%sscroll=%ldwindow=%lu031|Unable to set default %s optionhР?'''' >  @  e#`.#   @  Z""`."   @v N"!``.!` 2  @j  2B"#X$#`$.#X@h# $#$@@4' @ $" # $@M#0 $#8$@x@'@~ $ #@ #@ ?/'@'@i $ #P #P7?@'@V $ #` #`'?@ސ'@C $ͮ $p〒$@+@̐'@1 $ # # /?@'@ $ -#  #????@'@ $ %$ȖВ$@@'@ $ &$ؖ$@ݐ@~'@ %m *     ? ?'7@g'@̔ %V 1 %@ ( % 0$@@M'@ %< 3 8   8  ? ?'/@6'@ %% 4 P  P ?/'@!'@ % 5 `  ` ?7'@ '@q % 8 p  p7?@'@^ % ;#В$@F@'@L ""֮ = "  * @*`8 ?2 '̀ ̐ '%$@"@Ð'@( "  /h`€̀ 2 ̀"X$  " " " "  *` * 8?'%$@@'@ " H 8 8`_  !     O  "" 0G   @  @ >  " @? * * `8@ @x ,  "@?*`  * 8`    "  * * `8@ @T + @!  ` @?" 8@* @@@'@} 2 @`@?*   " 8- %Y  all032|Usage: %s291|set: the %s option may not be turned off313|set: the %s option may never be turned on034|set: [no]%s option doesn't take a value035|set: %s option isn't a boolean036|set: %s option: %s037|set: %s option: %s: value overflow038|set: %s option: %s is an illegal number314|set: the %s option may never be set to 0039|set: %s option isn't a boolean㿀  `  '@ƙbЀ 2 $   L ' = ?2  =`ؖÒ   L ꀢ =`'-@`@( "L n L o  '@ "@kR `8% :`,*  `2 ` 2  @ `?2    "  0-   '耋   ''H` 2  ,*  a "   *` * 8`   *  a "    *` * 8` 2     @    @ܘ     2²   2  @&7 2  ( 2  2    @   @  ' x` c\ @ `_@v `N"䀤` ` ` ' ' @6    ` `thT >"hT@䀢 뀦   ` `thT >"hT@+ J A ? "> ͐Ȑ' Y耢    ` `thT >"hT@䀢    ` `thT >"hT@  @   (X  ,*  a    *` * 8 @À   @ʖ 2     2  2 @%# 2  ( 2  2   (@  ` 2 "   s- 2. ,*  a "  *`  * 8`   *  a "    * * `8@@G "F   @J 29     2. ~ 2& @$ 2  h 2  2  @ " @ `2` @|㿘.`*  !`  @ * *   8@ @i       2&`` "&`@&`&` 2 &@@ "&@@r&@&@ 305|No %s edit option specified㿘.`*  !`    * * `8@ J 2 2  " 8.` +@  %ld%*s  5" 8 8@0 ?  8  ? @'8 'l8  8 %`: `, ``"0`  ,* *  a   @  * * `8@@ *  a "   *` * < ܐl* אg* *  a   @  * * `8@@ *  a "    *` * < *  a "   *` * <`3*  /*  a "    * * `8@*  a "    * * `<@@ǐ }*  !`v* @* @ ! ,!@` `.?S ! " @@ *` * 8` "A@? !p+!`  @ * * `8@@  @͒ @n' ! "@@*`  * 8`   *  a "    * * `8@@I?l/`" `* " l'l 8`=@ @D@& 2`   @,l" 8/+-$ `'Ф , @*`@=@@l +&ߠl @+" 8,``*`@@l@ l+l@,`+%s%sno%s=%ld%s="%s"㿘" 8&@`: `+ `"A+`0q+` *  a,#x   *` * 8` $ ,  `$#,#@ 0M+` *  a,@ #   * * `8@   j03 *  a,@#  *`  * 8` $  ` *  a "    * * `8@$#А7set %s set no%s set %s=%-3ld set 㿘" 8` 8 2 8 %`):  `>,` ,*  a "@ @  *` * 8`- - -a-a@7` ,*  a- !@  * * `8@@   @` *  a "@ @ *`  * 8` `  -a@-  \2`` \?`&``@ \@* &@@6`?`&``@ @* &@@#`L@ Ӏ ` =?`&``@ =@* &@@ *  a "5   * * `8-@  \2`` \?`&``@ \@* &@@`?`&``@ @* &@@Ԓ`L@ Ӏ ` ?`&`@* &@ @` @ 햔    2  㿀$.`#' %@8  1" *  87'"8.#' N@&  0(' @8  JL & 4@" 2 `  " JL & 033|set: no %s option: 'set all' gives all option values㿘. t 㿘@@㿘@@㿘`@ #" 8`  a  ,@2l @ 2h  @  `*`` * 8` 2 @      F " `* * `8@      ( @ "`*` * <`2 @ " @ " `* * `<@ m  졔  `  M`㿘" 8   !  ,@2F @ 2B @ "*`  * 8`  @  @ "  * * `8@@  @ " *` * <`2 @ " @ "  * * `<@@ `  M`㿘  B    040|Screen columns too small, less than %d041|Screen columns too large, greater than %d㿘/`    / ! 042|Screen lines too small, less than %d043|Screen lines too large, greater than %d㿘 !0   0H !ڰ 0   `?$`  & $X * * `8@ $X $`   *@ *` <  $\  *@ *` 8  HS (P  H   a H  [ B $`2 ` & $X * * `8@ $X $`   *@ *` < @ $\@  *@ *` 8 ? ( ? H  !? H   044|The lisp option is not implemented㿘0@  㿘u 048|The paragraph option must be in two character groups㿘@ ͐ 0 H  㿘+$ $$ $($"$ 㿘$@  @L $*@&$$ @@A $ *@&$ 䠐   049|The section option must be in two character groups㿘@ z 1 ʒ  㿘      㿐 (`€   $@8 㿐 (`€   ;P.@  㿐 (`€  "@@   *` ( 8: 0    *` (8?" " 053|The default buffer is empty054|Buffer %s is empty㿈`H ! `2A1+  #\ `  H*@  ` !@`` `  `@`` 2@`21`# *` * !X7 b  '`6 2X  2``   \ '`& \ '' 9 ` $B? `' '   \ '`& \ @'   ' 쀢 2     "(T!   ' @ 耢 U  x    t@  x "߰ $ t t x'(T!$(T쀢 @ @ O@@'@ D 쀢 `?"  ` '` @  P  ' `@@ $ ~  X y  `& X t& `` $'쀦    "(T t@2`(T >'(T` x@(  t t@ / x "h ' t t x'(T! '(T @ 耢 `@`@ Ӑ`@ ̐` ߭$ 2,  X " `& X & `   \ '`& \Ғ    \ & \     ` `t@hT >"hT@%s055|Files with newlines in the name are unrecoverable%s/vi.XXXXXX056|Modifications not recoverable if the session fails8 *y T3" " "" * * `8@@4 " "`3@" 3F 233? +3@9#N` N 3($@.@!?3@@c &`L  @38  `X  @.`X057|Copying file for recovery...058|Preservation failed: %s059|Modifications not recoverable if the session fails㿐  X @, XB  P `0, X @m 14 +4 4(h `  € 4 L 0 hh  4 hh   L@9! X `@, XP砒  060|File backup failed: %s061|Copying file for recovery...㻘 "| X @ v ` €  4 X ,XL跒 c `` X ,X`P@`K  *k 2D " " "" * * `8@3($@J@8!?'4 (haؐ L@  @  @ " @@  hh  ` ` >  2 062|Information on user id %u not found%s/recover.XXXXXX063|Unable to lock recovery file%s%s %s%s %s %s %s%s %s%s %s X-vi-recover-file: X-vi-recover-path: Reply-To: rootFrom: root (Nvi recovery program)To: Subject: Nvi saved the file Precedence: bulk%s%.24s%s%s%s%s%s%s%s%s%s%s%s%s%s%s On , the user was editing a file named on the machine , when it was saved for recovery. You can recover most, if not all, of the changes to this file using the -r option to : -r 064|Recovery file buffer overrun065|Recovery fileX @P@I   5\   *g 2 " " "" * * `8@? 5($@C@1!ؒ   Հ  5@)  2 @h%T %P   L  / @; `!?"@a#@!@N5 #d55?`##`#h#\@55 a#l#p#x555#th`@6@kn5@@55555apᨘ!Кb#`#p#x#\#h#l#t#d5b0#|#5b8##555#0Xa`@ 5@婒 A , <@@ & <N 2& <8N .&@ 25٢ ?@@ @Ӑ 5hl    ?%T @ .recdir: %srecover.r+066|%s: malformed recovery file%.24s: %s vi: no files to recover. 8 *H ""  " "" * * `8@@   66@1"   6` x 96765535/6d-6"@D  ]@cऒ WT  M   @^0I$@ !@#  @ؒ $@} `@   @Œ 2* 0,@! $"@➐  " 2T@ 0 T@k @ѐ@,-@@  `6@,!#@ %s/%s067|%s: malformed recovery file068|No files named %s, readable by you, to recover069|There are older versions of this file for you to recover070|There are other files for you to recover('H *t ""  " "" * * `8@@c H3ƒ ?  ' ''6bА@u  7!$@6 @   t       ''@u0$@ #5`@A  7@ $@ٔ 5`@-   7@ 2 ,7 -!0N,@! $"@Ẓ   '" @ 0;@ 6@ `'*@  㵔 @  ` 㪔 @@@'@@@s Q @  7ؒ ̰ 01 `7y  7Pp Hؖ  @א@Ր@   "`P"`TH!2 `X  @*`X?c @ ? ? @˔ @?@ 43  3o  㿘@?@  "  ;   @w 0 㿘@?.@& 2`?3@ ?@S@ ߐ?/usr/sbin/sendmail071|not sending email: %s%s -t < %s 9 p@೒ 9 0 9@ʒ(@㿘& @լ$ 2& ⶔ    ` $ $ $ $ ,&  x$ |`$ xa$ ` "d@ B$ d "`$` $$, ``@ `$ `@% +$ ``Ā`$ `@  $ ``܀`$ `@ $ ``䀢$ *@ $  _  耢 2` W 0`$ `$ @D1 d$ @$$  @  &@ 㿘 ? & m ""$ ` "` "  @"@$ @(&$@  2 $@2 x $ "  x@n  @h $ x " _- x " @\ "$@V$@" @.  ؀ "$@I$ @" @!  " @< 耢 @6-@2``"`0!"```  "`    `" "` 2`"` "` 㿈 L Ғ 2s   ` `!@ h ` K2N   'N2 ' 2$@ K @D`@ Ě `  #\  2  \2 @J` 2 @` @*`J@ 퀦2` 2'"  Ě `  `2 `2 #\e 2 `@2&  㿀\ | 2ڰ  B @ S 2ʰ @`20/ `  ' ;  $ " $$ *` * 8`  @  `  d  t @  d @   $ `p@Ӓ l`$ " $$ *` * 8`   `Y@ U`;  "7  ? ?    @  "  ` d@0` @ & &@   ?&     (T`    ` (T`{``@ x\   "``@`('䀢 #@ $ " $$ *` * 8` @0  瀧 '`  d  ɸ @M  d`@@ ``4` ʐ@ ƀ $ " $$ *` * 8`   @  䀢 䀢 2   @  '  ܀ ܘ ?    ?   @  b +   X쀢T䀧`/-@ *  ?쀒   @| )  e d@I   쀢 `B ?  쀢䀌 &܀@   ?&&  ?'>` (T`  ٖ  +  (T`& @p 072|File empty; nothing to search073|Reached end-of-file without finding the pattern074|No previous search pattern075|Pattern not found076|Reached top-of-file without finding the pattern077|Search wrapped㿘`!=!.` €==8= p= ==ޫ 0@B(8HXh078|Searching...㿘 =ha㿈`#\\d @Ț 2 ``  @    "$ @$ |$  @T (  _ ` "8 $ @ $  "&$ @ $  "`$ $  @Д $  b @  @@$b  0 $ $ , $ 2 !D`$ !D"` "aD !D $  $"`"$  J@  @ 2H  * @*  㿐#\ @&  @㿘`"  "` "@ @;@9   @3@1 㿘\ 2$  C!D*@ 2< $ 28  @n  @85`*' 2# $ 2  @ 4 `& 8  " `2&@0  $@    `2&@ 㿘!D " @  " @  "@`"  "` "@@!D 2  㿘 !D  @2 $ 2}  -> @` *` *  !X@Vɐ? `@岒 %@$ !>#0$   @` *` *  !X@*? ` ,8 (@} %@ !>#0$  @` *` *  !X@m? `8f2}%s㿘 !D2 $ ?ax@m`G  |     'S ` `? 'R Y 2`` ?`&``@ @* &@@s`?`&``@ @* &@@su2 ` ?`&``@ @* &@@sa "H` `C  |   'S ` `? 'R  2`` ?`&``@ @* &@@s.`?`&``@ @* &@@s2 ` ?`&`@* &@ @s 2@ " `   ?"` 㿘"*! @@C  ۰  &@&& 㿈&Θ쀢 쀠'`?   "  '' J ? ' 'J   B&㿘@1< / 2 㿘@  Z @H. 㿘! @$"&"``"  ?  㿘! @S$"&"  "   #@  @   %lu㿀`0" @` @ * $$ @  8  #\  &$ ` H*@  `  !@` `  `@` ` 2@`2. * * !X@   < ` ` '@ `    ̧ 2&    ̞ 2  2 ``0(`@Ȑ@؟ 8  ̄   㿘 !.` !`A"*` €@- @̒@e@ @?@0@Th|㿘 !.` !`A#h,` €@ @:@@ @z@ "!(<㿘@ "`@ ?`, &`@ @2 `<&`H&`D  "a 㿈`0 ` *!  "a`42쀢 쀢 /6  ( @`8`0@h'` @ 'J @  `," `&`@`@" `<`4 `8@ `<`@&`D&`H 㿘@ 2  `@ `< &`H&`D&`@  "a㿈`0 ` *!  "a`4И쀢 쀢  9  @L0  `8?`0 '` ?@ 'J?@  " `<?`,&`D&`H &`@@ `8?&`8 178|No previous F, f, T or t search㿘BK 179|%s not found㿘 `B #* *  !X@q. vT@"% $ol $$$$m $$Pq$@$(n( $#H##KD ##lD##`##hlDH#X#(lD##l8D""`""*@ ""mx ""p"h"Hil"@"(p"")!!!!'D!!x*@@ !p!X)!P!0fHD !  *,   3t   xgD h PS<D@" H 0& ( P\C( \D@"D@"lDHxHD 8l8DHql@"O@ xX-H8(D (T, (, qP@"pX P8= (ߠD D pP tF 8jEHjE?, ' xhkDEX8k E0v@"@d ^H 'DpF `H0 (F 8 ׈D xD `8 (}D@ zD@ MlD L D@`P@B"XH>` 8 ߼D BX %0 $D x`F H KD ? lDl8DfHD pPP H8v`@" @ _4 a G x`|F Hl פD ,  P@(ZD@"NDD VD@" xh ~ reverse case[count]~ } move forward paragraph[count]} | move to column[count]| { move back paragraph[count]{ z reposition the screen[line]z[window_size][-|.|+|^|] y copy text to motion into a cut buffer[buffer][count]y[count]motion x delete character[buffer][count]x w move to next word[count]w u undo last changeu t before character in line forward search[count]t character s substitute character[buffer][count]s r replace character[count]r character p insert after cursor from buffer[buffer]p o append after line[count]o n repeat last search m set markm[a-z] l move right by columns[count]l k move up by lines[count]k j move down by lines[count]j i insert before cursor[count]i h move left by columns[count]h f character in line forward search[count]f character e move to end of word[count]e d delete to motion[buffer][count]d[count]motion c change to motion[buffer][count]c[count]motion b move back word[count]b a append after cursor[count]a ` move to mark`[`a-z] _ move to first non-blank_ ^ move to first non-blank^]] move forward section]][[ move back section[[ZZ save file and exitZZ Y copy line[buffer][count]Y X delete character before cursor[buffer][count]X W move to next bigword[count]W U Restore the current lineU T before character in line backward search[count]T character S substitute for the line(s)[buffer][count]S R replace characters[count]R Q switch to ex modeQ P insert before cursor from buffer[buffer]P O insert above line[count]O N reverse last searchn M move to screen middleM L move to screen bottom[count]L J join lines[count]J I insert before first nonblank[count]I H move to count lines from screen top[count]H G move to line[count]G F character in line backward search[count]F character E move to end of bigword[count]E D delete to end-of-line[buffer]D C change to end-of-line[buffer][count]C B move back bigword[count]B A append to the line[count]A @ execute buffer@buffer ? search backward?RE[? offset] > shift lines right to motion[count]>[count]motion < shift lines left to motion[count]<[count]motion ; repeat last F, f, T or t search[count]; : ex command:command [| command] ... 0 move to first character0 / search forward/RE[/ offset] . repeat the last command. - move up by lines (to first non-blank)[count]- , reverse last F, f, T or t search[count], + move down by lines (to first non-blank)[count]+ ) move forward sentence[count]) ( move back sentence[count]( ' move to mark (to first non-blank)'['a-z] & repeat substitution& % move to match% $ move to last column [count]$ # number increment/decrement[count]# +|-|# ! filter through command(s) to motion[count]![count]motion command(s) move right by columns[count]' '^^ switch to previous file^^^] tag push cursor word^] ^\ switch to ex mode^\^[ exit input mode, cancel partial commands^[ ^Z suspend editor^Z^Y page up by lines[count]^Y^W move to next screen^W^V input a literal character^V^U half page up (set count)[count]^U^T tag pop^T^R redraw screen^R^P move up by lines[count]^P^N move down by lines[count]^N^M move down by lines (to first non-blank)[count]^M^L redraw screen^L^J move down by lines[count]^J^H move left by characters[count]^H^G file status^G^F scroll down by screens[count]^F^E scroll down by lines[count]^E^D scroll down by half screens (setting count)[count]^D^C interrupt an operation (e.g. read, write, search)^C^B scroll up by screens[count]^B^A search forward for cursor word[count]^A㿐`0 2 " ` `4`<  N* 2I P  2A `Dɷ` 2 24   &`D+&`H`D     ٖ  &`D`0   >`H @ &`0 &`H`0  > @&`0 `4X#\   Ԓ I @207|The Q command requires the ex terminal interface 㿘 (€  I(\   I L#  c@ P "  3 $ $$0  `4`0(`` `4p#\  | @/<`4`<X#\  j JP @>`4`<X#\  R Jk @suspendX#\    69 JR @180|No previous file to edit Jxћ     2 X#\      @- @X#\   9   !0@@p#\ ;   ՚ @!`0@ `,D X@"@b`4p`< #\   J" $ e  2?  $'4@. ! /  x 8  L &`D P$&`H@;~`4p#\`<    "`$  e     $'@$'`   p0p #\ , #\ G  T @j@㿘`  €@   㿐  K f`!T "!L!L *` * 8`   @ 2i       2_ @:$ `` ?"``* "`@g QQP@=Y < #` ,  & ,| `@တ@r : 2-  x 8    @Ő 2  ` $ &$@=* 2 @ 2    @&㿐 L \  $ L $ P P ` $ P L`0&`D P ~` &`0&`H 㿐   @ 2= @ 4 @Q[  ° 0*  "` " ` "  ` 2( L`L  "`L@&  "$@&$&  307|No ex command to execute㿐 L    L   @)K   Lϡ      $  "$$$ 㿐 ` 2 @  2    `2&  Ò 2 & ` Ŕ`&  㿘 L 잔  "   –     X `*X 3@38303(3 %#0*lo0x%0*lx0X%0*lX%+ld%ldabcdefABCDEF181|Cursor not in a number # +. + -( @( 00(   @Ԓ  4:  L 8#\ @ `      `2w&`P@=ؒ J`0+"`( J  X x2#K@#\ @ `   *L#H@:` EJ `XLc M c I K@ 0``#\ @ ` & *:  8! 9Lc . `#K@ + - @ #\L c   L @ c\   LXd  D!L !  c\03"00  ` *:  8 9' @?Ȑ 8&$ c\ @ ` $c\  ` *:`@#H  $@ $` ` (T!  2' 9  x 2   t, x " $ t t x'(T!$(T @@;- 7x|  t - |  `#" b  |`6   " W | '| @ "|@˯ d$ Y @ + xx8  6 @:"/  'xx@ˌ d`c c@Ր@А"@@ɔ""@"@ 4'D @(` `` `thT >"hT@182|Resulting number too large183|Resulting number too small㿘`  `` N0 @N+ 0' 㿘 @!̢  &`$a,$a !H "!|@[ $aD    !D@[!H!H$aH!| " !@蘿 $a|   !,a!$a!$a 㿘 !0 "!D@Q!D "!|@K!| " @E ! @>@<&  㿘`1""`H`%"#L% " ! #D * * `8@ " "" * * `8@@@*Ɛ㿐`4   2    ?& P   *`" *  `č@x @& `4 & L쀢 쀢 2 ' `"  P @& P `0#\( `#`#d @ 㿘& P`4 P "    *`" *  `:@x @G & `4 & LB쀢 쀢 2'  " `0#\( `#`#d @2 㿘@  㿘@ x@   L `&  2\  2 ''D  & PP ` '*`" *  `ʐ2 L L/ 25  L 쀢 2,  L   2!  L & L 쀢 " L ?`0#\쀊( `#`#d @ x`0`4 >`< &`0 쀢  쀢 ܐ @ & `02`&`8! "!! *` * 8`2`4`4 " `4`4`8 2ܰ `4& L`8 & P  *`" *  ``5`2*`0`4`<@%`0" ``<`4F 2  "`0h#\ `#`#d@4 " ``4`<  Fg 2 `= `8 9`4 5 2~     `8(T! ' 耢 > x  t x "\ $ t t x'(T!$(T@`8H  2G ``4`8 2= `4& L`8'& P`4쀢 쀢 2'* `8 :`0#\( `#`#d @    ` `thT >"hT@͐x@  & `4쀢  쀢 2'!   " H `4 &`<?`0&`@(`<#\ `#`#d@c x@K  & `4H쀢 쀢 , ' " `4`0&`"7  ] )"  < ( &   { [ ޔ } ؔ" )  (" ]  [ "  }  {" >  <`4' 'c 2   `2`    `Tƻ m `4&`< &`@2`<`8 :`<`, " `< @"`<`8&`D&`H`@&`D&`H`, "M  @"H `4`<@`<@`4  'Ѐ 24  Ѐ :`4- `4`<@`4Ȕ    ܐ @' ؐ"  ?J@    ؒ`?'܀ '`0  &`0㿈`, "`4 @"`4`8 "`0`4&`@&`<ꖔ`@ 2 `8`@@8`4`0 &`0`4  ~ 2`4`0( ``, @e "?  ` a h@0``"?@H ?> J  .?"6`,ۨ2٨ (ը !|J` H*:  2J` 2H "?H@2?J  `"@  2?2 `, "&`D @ &`<&`@&`@`4S`8&`D&`H&`<P&`@@7`4@@2!`,Ř쀢 쀢 = :&`8 `8?@ `,`2`,@> ) @ D!`0 > @&`0&`<` `,  &`@ @"`<`4`8`<`@&`D&`H 㿐`, `4 @"`4`8 ?`2`0@e`4  &`4&`0&`8`4 |   2s `0( ``, @i "`8 ?  ` c S@0K`"?@J ?C J  .?";&`Dݢ2ۢ (ע !|J` H*:  2J` 2H "?H@2?J  `"@ 2? @N &`D&`H&`<&`@ 㿘` @M @G`@"! @  2  Đ  !| `@`@ؔ`@Ҕ&!| 㿘`0@@p`0(* (``0" ` `4`D% 2 `D`H&`4&`8 (T`2       (T`  ؠ? 㿘`0@@5`0(* (``0" ` `4`D  2 `D`H&`4&`8 (T`2   ֖    (T`  ؠ?  `πX( 2  3  4  5 6 7 8 9*`(`L`T`\`d`l`t`|`㿘 h€ 186|No characters to replaceh``4 Ѐ 2: Ѐ2 `0Xõ /  ``8`4? &`<&`@@`4 F  $`@2 2 ؐ R 2 ?` +Y"*` € 耢    .!<&!@d $$d @  @2A Πڰ  հ ` ` (T!" x '̐ z̀ Ԁ  to x " $ t t x'(T!$(TԐ@݃Ѐ'!@ "`4!@ 2`8`4&`@Ԑ`&`<`8 2~ `8ԐД"@'Ԁ`(' a "aa`*` * 8`Ѐ Ѐ  JԒ'Ԁ` 'J Ѐ А? 6Ѐ "$&`@ a "aa`*` * 8`2`4&`@ "&`@`4  @ '    ?&`@   ?&`@`4     ?  !<@`4x` `` `thT >"hT@`<`@&`D&`Hb bdbdbLbbbbbbbx㿐`4   !G  `0(`8`@`&`@`8?@2`@`, " @2`@@1 & 􀢀 ?`,`&`@`@"`<`4`8`, "`< @`4&`@`8&`D&`H`<`@&`D&`H 㿐`0("(`<` #`4&`@t`@ 2N `, "` @" ``8`@@8``0 &`0`&`@+ 24 `< &  "( ' 2`,`,@D!@  ?` &`@`@"`<`4`8`<`@&`D&`H 308|Enter to execute a command, :q to exit187|No other screen to switch to㿘$@@Z  @" #  2 # Z H     "$ @ #$㿐`0(` `   2  " @1`4     " &`<@; 㿘`0(`<`? @Av   @' 㿘`< @Ah   @ 㿘`0(`<`? @AT  @  < @" D ,"" H 0 4@@ " 02 4 8:  4D @  8" D" H 8" D" H㿘`0( ``4@ "@ `@&`H&`D&`< @`4 㿘$@"0 @2`4@0w㿘`0(`4`@` 2`,@`4   &`< @"`<`4`8`<`@&`D&`H 㿘`0(`&  `<@;ޖ   `< `@&`D&`H㿘`0(`&  `<@;Ȗ   `< `@&`D&`H㿘`0( ` @   ""$`$` @  $X8*` *  0 $X @~  *` * 8   8$X* * @j  $X@e  ?`<@;w   `< `@&`D&`H㿘`0( ` @   ""$`$` @  $X8*` *  0 $X @-  *` * 8   8$X* * @  $X@  ?`<@;&  `< `@&`D&`H㿘`0`<( `@;   `< `@&`D&`H㿘`0`<( `@:   `< `@&`D&`H㿘@" 㿘@ search+%lu188|Characters after search string, line offset and/or z commandx`0@   @ p` / ?#@ "#8#8 *` * 8`"" ""  @x 2߰  x`8 ـ 2` L&`< P`,  &`@ @T `< `@&`D&`H $ `$!$  !`2 L@$! L  PJv܀ 2 $ ܀ 2&`H`  "l `<d&`<h&`<p&`@`<1 2`,`<\ `   O8 &`H " @  @Ks`[ @L zc\#\ @ `    `2 Ӑ *`:  + ^  ;\   \   25   2, `<\@ 8   2  aȐ!2a`<`@&`D&`H`0 > @&`0   &`H&`D 㿘 ``"     @t 㿘   @j %s%s%s[[:<:]][[:>:]]㿐 !4 `   (T!" x' —  (  t tt x 2$ t1  t x'(T!$(T ]!0]]␔b@. : @@    ` `t@hT >"hT@~189|No previous search pattern㿐`,   @2  !`"!`" #\ `#\`4`<ݼ  `4`<Ϛ " `, ^Ԓ  @j "`< @ @  0`<`@&`D&`H 190|Search wrapped to original position㿈`4`<@`8`@@ ^@ M "`4`0 &`0`4`< 8 `82`4`8`@@( `4&`4`@&`<&`8&`@''`4`8&`D.&`H`< (`@ &?&`<  ˘ 2 쀢  ?`4&`@'쀢  `8쀢@  `0 &`0?&`@ 㿐#L " #D#D * * `8@ " `, "`0 @"`0`8 "`0`4&`@&`<ጔ`@ 2 `8`@@`0 &`0`0( ``4R NJ{ `, "J @ }2 J?2<`{")`,0&` H&`4&`0&`8`< `@&`D&`Hx`8`4 '' 2ư `0( `  j   e 2 ?2[ `4@o`8䀢@k  ``2H ?2E   T 0 O0-?I̒ ݠ?B )?`T#`#*` € ` `" `` 2 ?2   T  C   `4@ `8䀢@ @J ; `,&`< /&`@ @"+`<`8 2!`@ 2`42`@`4  &`<  ܀  ܀  ?&`@`0 &`0?&`@`4`8`<`@&`D&`H dpHPPPHHPx`4 `8 2`4 `8 ''f 2 `0( `  ; 2ذ         {   2 p  ."  ? e !0QP ^ \8 ` )" ]" "" '`   2 `4s 2t `4@9`8@6 \`` " `!''` `   ) ] " ' V 2 |&`<`, ,&`@ @"(`<`8 ! 2`4`4 &`4  k܀  ܀  ?`0&`8 &`0  &`8`< `@&`D&`H㿘`4  㿈 L&`D P@^&`H 2Y  !`$$ L ! $$ $ P  *` * 8`2  $ " $ $ "$$ *` * 8`   #`#d#\  @  $*@$$@h   4 2`D$ @$$`D $ L`H$ P4Pa"a"a"a@"aD"a<"a@D"((aa : a !!  !"!a *a "   (.!"!@"<"@"D 㿘 4 M a& <a& Da & @ 8 < (  hl€  @ (  < *` * ?@"a?$a" " "" *` * 8` 2a @8  2  !a@a a$a 4aȰ 191|Abbreviation exceeded expansion limit: characters discarded 192|Illegal character; quote to enter㾨`xd`x` \'H`$d   @:$ (5$ $$  $  $ @ $ 5 " $ $ 2& " & $ 8`L $ `P$ d@ ' "  $ (' $ $ d@@   d    @@ ߰   $   $ $$ $ $d@d  *   $` $ $ $ $d    *      $ @/$ d@'' d " d|d|`* * `8@" dx`8" " dpdp`* * `8@ T ', 'd2  d@  *@'d d@'  /#/#d@'''4 '('( $`L  @&$`P ` H 0@d( Q 4 "d 2 '!\ `4@'4" ''Ē%!\%!X%!T@&@& ?` j"*` €d $&$d@&z؀ ɰ 0 @4 >d @ ` `!D  + 'd `2e  !% aT aL`* * `8@ `@aL `*` * `8@ J @" @& a a`* * `8@ `a `*` * `8@ J @"  "D$ 8  $@=$ 82 @O4  !'  c d@h'' $`. "!H*   !D!H "j%!D-`!D"* #"" " """d@ -`"!D* @``"  '    $( ? '( '(`?   ' ( $ 7$ ( 2' 0''`c\   `D`2 @  '?`j"D*` €dh@  @-   d@@c  N   $@q o$ 8@T  @  0@, 2Đ0d2 (  d@@h(d "   ` ?$ $   $ 4$ $ 0 @-  d@ (@ 7$ ,4`x  J@ @  ,  $ ,J " , " ,B"@ J " , 29  , 1$ ,J " , " ,)   a  a`*` * 8` `xa `x `xJ J " "  2 0&`|& `x@2`|$`x"$`|& & ( d `*& ` x@u 2` `` `thT >"hT@    @Z    `8& \` X2 `"-'         ى "֐& `\  X@@@ϝ \`X@  @  & \  & `& (X& '  ( 2! 2      Y "& d    'd*    `& &  @,  d @>`  *@ ` '` 'd@$* ($ $ ('d  $@ $ 8#   $  @  $ 8(d@(T  @  0@r, K0;d(  d@@(d  d ` ?$ $ d@@`x@  (d "    @   (" $ d @ Ȓ`x         ر "$   *@  ?$  @+  ذ 0  @d 2   @d 2 d  W`"  <`"" 0F`}d $@ wd''   h "'  @΁  ' '`^d $@ Xd     *? $  $ ("@  $ ($  `Ed $@?@  @ԙ  $ @d a$ 8 `x@(d kΔ$ #   *@  (   @ $ ($   2  `x@d J  $@(d  @ $$  @ (   @ (?`$   $ ( J? "  "    d   ( $ ($ # "  *   @J?  @ 8 (# ( $ ($ #   *@    J? v u    ?c\ ` _2'0 '0 @ c  ( $ ($ # "  *    @ \ ` _0 0C J? ? = @ 8 (9#  2  `x@]d   $@8  d@@  @ $$   (" @$ (#     ?$ * @ 8 #$ #  /#d$"@c  g d@ ' d*' ^, (   ?'i'( d'd @c\  `   c d@2d#\  ` 5_12 2 T   0@9, 0d @"  (  d@@( #\  ` _  d@ޔ `   (?`$ $ (  `'@u '"@'o$ $ d8@ I0 0 "     ' '       K "$ d  'd  *  ` $ $     '  'd@$2 `!`  @)^  h  "!\`!`2 '@c Y '!\ 2dT d@4   @4 @ 2 `!`2# $`L @ $`P@  - #  H@# " d@(Ɛdd*  $d%!Ld@   H"`D H" H@ x tPP,ȝ㿈'``$@ ` 0  ? , *#\ ` ?_? ` ? `2?_"?? ` ? `_  2?"``$2 @@’  D'@'@ 2@ #\  D 4/    2+    ߘ  " `"&` *` `(&`("  ``(   @+@ `( &`( `$@ " &`' 㿘` ` J  2``  @`$@2@  `$@2  @g  ? &㿘&``y`$ u` q@8#&`&`k&` " ## * * `8@` `?`  ` 2 2 @ْ& ?`? L@  @ ꀢ` <  7 @ս&@շ&%$@ "" %@ʑ$@``"@"`&`&` ,@`  ,@` &㿐'P`' A  iP P8 'P `? 'P J@ "P P@2        '  "  @2 @'   @*' 193|Already at the beginning of the insert㿘2 4@26l / ( $  2  *   `$ $   ?&@&`"`@"@, `@'   㿐#Ā " ## * * `8@#| " #t#t * * `8@` @  `J  @͒$ ` * @ *`!]   ``@ @Ա%@@Ԫ$`$ `    (`` `(?`$`&` &`(`J? "` "`` @  `J  @{$ ` * @ *`!]   5``@*`   @\$@ @V$@$`&`  /@S ?  /@G ? 㾨&`  ` `` ` ``` L@  2` ```$  $@ ͔` "$ &`` * @,@#\     C  2 C` ,@ ,@ " 6 2  d@ @ @@[@# R@*  <  @2ΰ  d@Ȱ &@ϒ 2 ? (`-  `* ?@ @ 2 : @@@  " ݠ`@   ` ?,@`` ``("@&`&`( `(  ?,@`(` `&`&`(`2 + ```  $@ ` "W &````@` &`&` @@??  ?,@?` 29 @ 21 <  2* `( ?` ``  $@ ”` 2&` `` `@ג` &`&`(` / &`,@  %s %s%*s 㿐'L @'H@4 / L@H$L` `$H`*  L@@  H `%L @ @  * @ *`!]   ]  2 8`ߤ@҄ $ "@ *&$ '' 8,%nf@H` `hT`"    ` `thT >"hT@PTf @Q?H@  @JH@< 2    Jn :;n9n7nL,`@bhhB    ` `thT >"hT@ T (H@@ "p&h!xT` Lnh9T`* nbh.T`2ThMT ?%T $ &$ 㿐` 'L!]J@ ؀  @`L@! * *   '(Q```   `p` 2&`K `  "`L@ @@Ɓ``&``(L@`&`(J`  $'L , ` * *  !X@CL 'L @,` ` $L+ `@#i 㿘@  `2`& L & L$& P @&$㿘` ` *``J   @"``$@J  2` ! $" @OՔ " 2`(`` `"* `* ``"`" &`&`*`("` `` @` "  ```(  @ޒ 㿈@`( Ȑ?&`(` `*@ &` "`` '` @ *@ `@!``*@*  * a] @ '~ &`(`J`   `@  *  * a] @j'"c'" 'V``   `R` " &`"` @ `(@` `@c ``(@`&`&`(J `   ??(  *@??`*'  * *  !X@@ $ ?`?    ?*@?` ' `( `"  &```( `  @ "'```    `` 2&` ``  &`2``` @  * ``(  @ ` `* `&`㿈 4 2M 8`4 `8&`D&`HJ?`\2 #p" J? \2 #p " #h#h * * `8@ @qQJ "`" `4@J?`\"`4`8&`D&`HJK? 2 "`4K? \"  `4 `8&`D&`H o.!Ȑ`3!$* &$ 2b   @`4`8`D H`H''J / #\?`D  #\?`Dۚ 2`D& L`H& P . a  @ )  .` 2"  ?Ȑ# @2$  &$@& a@  @Ζ 2  h€  㿐@#`'``` 29  `@!%  2/ ` x@@$`'``  2   `@!  "@  @@ $*@&$ Unmatched %sx`& L`& P@k  2{ ؔ @)  2s ``?' 'ܐ 2g `) { ( %rk N   `` H*` *  !X@q. > ڠ ِ?؀  ܀@*'  & P& L@ 2 "P ""H"H * @*`8 * *    *` *  *   @ ` `H @"J"`$@?D"I  2` "`"`$` 3  "` `( "`(`  #``( ` ` #` #` `(` ` #`#` #`(I   ```#`@#``$@2? " 㿐( / @ x@2``, @@ &(8  Ә @c@("@ " & &&(194|No more characters to erase㿘sV 㿐`0 `4(#`8!``&`H *&`H#@$@&`H? @O ` 2  `  ؀ ? @  &`D 㿐`4 f 2!  `4`8`0  `<"`@@ "`< `< ܐ 㿐     (T!" x'    t x 2$ tF  t x'(T!$(T@@`@  \@   b H*`@ ` / * o 2    ` `t@hT >"hT@㿘&`H   X`*X L"4㿘 , "a  X 2`0   *X@4   "44   `D В`D@195|Movement past the end-of-file㿐`  @@ t @̔ 0' 196|Movement past the end-of-line㿐`@  m `?@t @ 0 197|No cursor movement made㿘u0 198|Already at the beginning of the file199|Movement past the beginning of the file㿘`u@ uupʒ 0Œ 200|Already in the first column㿘u  " J     201|Buffers should be specified before the command209|The file is empty202|Already at end-of-file203|Already at end-of-line204|%s isn't a vi commandWindow resize interrupted text input mode205|Usage: %s㿘.u#h. €uu uu G 0  u>@0 u`8 0u2 L4㿘@  㿘@ 㿀`0( ``4`8 '' 2   '  !`,@ D! `a` 2װ ? ?D#%5D|     2 `,` `@Y@0U  l נ?h`,   #\ ` 5_ 5 \ `_ 0  `_ + S :   ހ `,@D!!P2 `,J "`,O    O   ?`, " @`4  `8@`4" `,&`<  &`@ @ 2`,&`@`, " `< @"`<`4`8`@&`D&`H 㿘@  㿘@ 㿀`0( ``4`8 ''p 2ǰ     2      ђ 2 w w?l  n  2 E t "\`,?   #\ ` 5_ 5 \ `_ 0  `_ * E ,   ހ   "`,A    \   ?`, " @`4  `8@`4 `,&`<` &`@`@"`<`4`8`<`@&`D&`H 㿘@  㿘@ 㿀`0( ``4`8 '' 2     2      O 2 w w? ~ n  2 E0 k \?   #\ ` 5_ 5 \ `_ 0  `_  < ,   ހ  - 6    ڒ   ?`4@  `8@`4 `,&`D&`H&`<` &`@`@ `8?&`8 206|No characters to delete㿐`4 l   x7  2 `0x' , (`@`? &`@`@?@*`8`8&`@` &`H`0" ``<`4 2  c 㿘`8`2`0:' ( ` "@ &`8&`8`@ `8?`0&`@b&`H``<`4 R 2  3 㿐`0" `3  `4:`< 2# `4 t `<`" @ & t`D   `0   >`H @ &`0 &`H 㿐`0(` '  Ғ  `4'`8&`D`0 *&`H` "'`$` $X * * `8@  ``$X `"  * * `8@&``@~ 2y ` -" . + `K ^% `E@T = @N 7 `0(@E  2Q `D @"J &  <`D `0(@/ 2; `D @"4  23 `D@    <`D @< # 0" 'S 'R  А   `(  0 @    4"<@"D"D"<< (a("a@"㿘  X`            $ "$$110|Vi command failed: mapped keys discarded231|Interrupted: mapped keys discarded236|Interrupted0`  L@ې0` @h$0  ``  h  ```  h`Ȓ`40@ 20` L@D `Ȑ "0d``Ȑ("```Ȑ >"`0 ! "*D % "0 " @"$H0!" D0D@ @$H @ 4DzH )D@D$`LH$`P0@@@  @ 'H  " `  z `(T`2`    2d`(T`"d`T  "T zȒ dz d@*@ $d` `` h`Ȑ`4@  2+ d( 7`$d` h  (T 2&d "`&@ `  *`" *  `2 Ȑ @  2 Ȁa?" @ 4Ȑ $`@j 2 0!` ?Ȑ# @4Ȑ@`T` *`" *  ` '` X' | `C#$(  L@™`` @` |"8*` €=~ ( @ "'0 cX "cPcP`*` * 8`2 0 "0 `*` * `!X@<ܔ  @  `"`(p`0 $0`L'`P'`L$4$D$<`P0$8 $H$@``@֔ "0`(T`2`    Ґ`(T`2`ː0 ((2`,<? $<`, $`,(@€ dF ̒ @"   @#G  W&   `(, ` ~ change case to motion[count]~[count]motion234|Only one buffer may be specified208|No command to repeat210|%s may not be used as a motion command211|Already in command modexب@ `? @   2& &&&&& $&$耢  쀊  '@ "0      @  耢 쀊 2'@0b.&0 @  耢 쀊 2'@#\  `  0 @Z װ 0 (&0' @  耢 쀊 2'@'"4 0"  |   @d  耢 쀊 2'@0b.&0 @P  耢 }쀊 2'@  ~  , * `!X@ u B, #x@ D .0("'0& 7&0  ~@ X ~2&( d "cc`*` * 8`|&( |"P&( 2F0 . , * `!X@k耢   Ő& `t``,! 2 `00D &0&( @20|X(h&`0&`0".`@ L hD2" @b:@ @  耢 쀊  '@0".&0 `[`]`Z>z @{  耢 쀊  '@䀢(2 ~ d "cc`*` * 8`|x |"Xx*  +  z8 @=  耢 j쀊  '@.\ `  @ j 0 &0 @  ]耢 G쀊  '@.  |` "*` * `!X@x5 6  @  *耢 쀊  '@.@ @      " `0 |  d@ @0#  ?????????'  @ϔ Lئ@ '؀( 0( '@0'ؒ w(d'&0@(|0` &0 L &4&8  L@  &< < I c !Cs&@  ?m&@("P@'D#&(  0  !А >&0`ؒ ~ L  P'''''''@€ 2O < `<  c !  : &@`P&(0 !@!&0&0&,䀢   耢@( &4&8&< &@&4&8&<&@&D&H( @ @ L&` 214|Windows option value is too large, max is %u㿘  (€  2r (\  $ " `  $$"  * * `8@" $a !`  $ 4!X * * `8@!X $`  $ 8$X * * `8@$X 4$ D$ <@ $ <$ Dƒ  4?$ @$ @ $ Ha @  "a <  *` ጑* ?@"   L" a"  a"$ $$aȒ`4aȐ   %d screens backgrounded; use :display to list them㿘 ``, ` ! "@ "!@` $`  "` @ $`"@$`$ `@2`$`"$``ڨ `@ $` "` @ $`"@`&` & `2` $`" $` ؖ?1 212|Cursor not in a word㿐 L { 2j   P#\ @ `         `2  p C & P@   @ \ ` _  #\  :"  ` _   ""'a4 a0a4   $a0 a0@@a0*@㿐@ D S C $0 Y  _0  c $ d _ c y/.@     @B*`#x@235|Number larger than %lux/ %, *  ?Ѐ! @( 2# #\  ^?  @  c\ `Ց, &  㿘  2* ?` ! #*` € 2   hd€ 0@  ޖ  ` Ē d|%7lu $@'L'P !\`8J $ "` !&@ *` *  *  *   @  4 :  2/ `L@ `'T " #  tpp a &@ *@ *`@ *`@ *`@ 萟:`@ lh"  8" *` * 8`2 ` `" "`` ?@", " "$"$ * * `8@'`'`$@.'\"`  '\" *` * 8`0" @ `x@@d 8 XLh _L T@ L@T !&@ *` *  *  *  L : "@ 8P"@"T`~`&`&` .`/.`" \@  ~\ `" $  , *  !X@N ,  * a] @:Xl@萰 tp0E`T &`  l` "``3'l" *` * 8,` !@ . "+"@@2&"    l&` .`"` 'l" *` * 8`" 2 8@L 8"    " *` * 8` 0K" H >l   !'l`` #Ā  # * `8* @ # *`  * 8@ܐ$ *  * a] @h  lS 8l$?'lJ$@ Cl   !'l`  #Ā  # * `8* @ # *`  * 8@$ *  * a] @Q h$ 8h  ll$@?'l&` .` &` .`L`T@ L@ T P@  "@T 8 h hx `? 'P'X'dަ l   $'l` ! #Ā  # * `8* @ #*`   8* @'$"   * @ *`!] "ޒ"   2.`$$@.`.` $$@.` 'd&`h HT?F`$ 2 d =` !&@ *` *  *  *  L : "@$@ P$"@" """ *` * 8`2$T T$@ T` P@ "@T T`@  X9x X $,X,(h x,$Xxx ` *` *  !X@@P   @,`h & BP` .`&`&` .` * @ *`!] .` .`h`?&`.`\   b5X ,x$Xxx  "0 @,`xl@x $ ,X萰 tp㿀$  d  a`p aa@M)" """ *` * 8`2`` "`` 2- @` 2  ( a $@ + @ *`@ *`@ *`@ :`@ @\  8 X `a@(" 㿈$  F " !`h"\!\h!\ `$!` 2h $!d@ߐ!thp!l!p7 4 @? h hXhp!hhl@ 4 @? !hhch!``^!\ $!``2!p 4 @? h hl@!ph!lDh 2Ah!` < @z!t G#@ *"@ *`" *  !x* "@  +$!t!d`$!x$!d 4 @? !hh!d\c $!dhX  4 @? !hhh€ 㿘 4 @?  萔  h€ %s 㿐$  "8`"@"@PQ=hp 4 @? h hl@` @ 8 8 hX@ 8 @ "hXhh€ %.*s. ; 㿈$ @ hT ` hT hd€$hT$hT $hT$@`5``` h€  v ߀`h\  #@\`2h\  @g!`$*@`&$ h€ 0`2hp@g0` @ J?` " 4 2'  'X 8`?   P@ P@  @y $P'iJ J " "[X($  J  J  2  $ N " & J " "& & 2 " "  J?`."" @' @   (T`     (T`hh€   'H @ '!X 8  "@ 2[ 4 4.!\ 2!\ @ ? l@@k!!\`!T 5!%!\%!T!\ @@2!\!Ȁ ?!T? %!\%!T5!!\  @  4 @?  !\!T`%!\%!T (T`  f  H (T`v  H @? H ?\  ?x&=N "   ,* a] @@ $@,@X,*  !X@??  @?,@`?` 2Nx@  ,@X$@ H 2l\  l@%!X `4' p!Xt.x  &@!!X ` 4!!P  $!P$!X$`  h€  "$s @2 $!\ *@g&$$* @ '&$ (T`2#$    2$ (T`2$$" @`?`@@@@ 2< $ " !Ȑ 4!  @"!$ @&$!Ȁ "h\$ &$h\  $?# @&$!\  '!\ 4@ " ''$!T$!\$!X@p $!T$!\$!X p ` hpԟhT  ?$hThd@$@*@&$ L  `l "(\$ 2`l@_  "`lJ    `"  "` "@@ @`l 2hȐ 4\  2 @'  Ȑ 4  @  4 '\  "@'' $T $\$X@h԰ Ё㿘 4 & a\   @@ "@ "( (t€ `  4 @? ( (@aT @@ @p 4 @?   h  4`       @OhX!\$!T`$!\hl€h `2&@؟@ ]   2hd q/hT $hT   q hT $hT :`2&@+=+=+=+=+=+=+=+㿘 8`8   (\ (XbH(\  %.*s 㿘 @E  )@ $ @ $ $  l`2@$ l& l$ @ 2@@ $@" "@$  @!b@~㿘` `8  *@ !*`  *  "`   `  &`  㿘$ @  @"$ &$  "  " *` * 8`2  1" " 1"$&2 ` aȀ" aȐ `@9` aȐ 2a耦`  $  !`  @"   '$  2$`€ $  $$h$    $$!  L L   @ 24 $ @&$ D @ "  ! L@:*!@a @`2` V 4 R   < @@`@T" 蠄? < v& < @@ r@(m @5 @`2` * 4 & \  < @@W@`  a "a  ! ? < ?& < @@ ; 4 @? ( (l@ < D($ L  aa" *@ *`@ *`@ *`@ (:`(l€ < & <?" < D@8  L   L@ 0@("$!2 2 L <  2  @ <`2` 0E C??""@  @??"$!x 2r L <  2   @ <`2`* > 2;  a ??"_"@z ??U"܀ 2"    L'!`' <@S' <`2` * L 2' Lܐ(  '!`  <' L`'2` @1 <`2`   L 2 L   @- 2ٰ $ @&$" " "" *` * 8` 2t$  L   2h$  P@R a L@2* `@:&  <`"2`8  (  a" @ $`@ &$@ ڐ 2  !`@  ! L@2-$@()$ <`$@2`8᐀( ᐐ"` @ $`@&$ @ ($@  2[  !`@ $ @`" """ *` * 8` !  !""Ȁ 2  L2  P@ ؖЀ Ѐ 2   P Vؐ 'Ԕ"@ @     ? 'ؔ  * @ *`!]  dؐ   ? ,`@*`!]  `L ` ,` * ]  "@ < "@ \"S$` '" 2   K'ؔ  * @ *`!]  " """ *` * 8` 8  8?:$$" """ *` * 8` 8  8?:  (p̟ ! L " "  2  * @ *` 8  ?   P@" "`" * * `8@2  "   )$# "## * * `8@ M   * @ *` 8 # # < `8 "  * @ *` 8  8   8?   ".$ 8 :)$# #* $ `* `"   8   `" ,$ !! ' $   a($   @2 ?'$ ! 8Z L@T ̀?" H$ !!  ?,   a(, ?'$ !! 8$ ì?" Ā "$  a$ @  D @ " <@ 8( (l@ @`@ (( Ā 2  P$` &$T$ L$" """ *` * 8`2` `Ȁ  ` 23 `2`` 4 `Ȁ  `$@`@<` (̟`@w T (€ `$? >&$ȔJ @ 4Ȱ ????p?`219|Replace218|Insert217|Command216|Change215|Append%lu,%lu x A 4 @?  (   @   "(l  L` 8 L 2 ?29 ` *`* @ *`!]  :`}(#   bq b*  #   ` *`* @ *`!] $ :`|$8  ?`L /  9   bq(Xbl  b(Xb'L `* *  !X@*`:`|ː `8 *` * * a] @:`|(X L  (l@ 8#( #  *` * 8`8## 3@ܐ L @T 2`$@ 2` ' 4 @? (  (Xc ؐ (X؟# # *` * 8`2  #   X`2 L* &تؠ$- 4 @? (#`" ## *` * 8`2 0   X`  bY(XbT(X؟㿘 " " *` * 8`2  " " @` 8@ڐ?"  " *` * 8`2 &@" "&@&@ 㿘  " *` * 8` ) 2 a a   @ 8@8@ݐ@ " "!"a㿐` 'H H` H  2'̰ ", " "$"$ * * `8@" " "" * * `8@"   " *` * 8`2  "  2M??' !`#Ā  # * `8* @ # *`  * 8@b&@*  * a] @{ @ 8  $ @F$@ ??'E` !`#Ā  # * `8* @ #*`  * 8@&@*  * a] @zג @ 8  $ @$@ 2`   "5@ $@'㿐  ~ј    ?0  T @ 㿐 ~` ˰ ", " "$"$ * * `8@" " "" * * `8@ 8@@Q : 8 $ `" #Ā  # * `8* @ #  *`   8* @w$@s$  * @ *`!] @ z-@ 8@* a 2 8  8$@Q ! ` #Ā  # * `8* @ #*`  * 8@'$ *  * a] @y@@* %?80 @ 8@  &@ @$@ 2 ?㿐 ` `      ` @ ( @1"  < " <s @"  L?" L ?& L"  L " L  & L!Ȑ 4!!$! 4! L2$`4!$@2 `2! !\`( !Ȱ  04!Ȑhp􀦠"00@ @ 2 !Ȑ  4!@# "   @ h 㿀  <??!*??$ @ &$ jK`0 <'''䀢  2 @ʔ < 2 @`1 Ȱ '  < `'2`@ < 2 @( 2 <`8/ < !" !" !j" "    a" a"  a"   maximum option value is %d -- %soption requires a numeric argument -- %s㿀b`'  @h 2bX @hؖ 2] `&` 2 N"@㚒@ gN u2 Nb@L "  N <2  b@L  `( 4*@  @ `" @o@ <J`#@e@ 2 `(* N ^N `(`? `-   * `(*  &`  illegal gfmt1 option -- %sillegal gfmt1 option㿘 a0@ aP@ gfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d 㿘 ! @ ` `%   @ @  2 @q@e!@:%lxcflagiflagispeed%ldlflagoflagospeed㿐'H@@G : 'H H+ 'H/-@@9 = 2,@,@`@*N@ c b@K 2N@s&  i2 N@b@Kܐ 2N@f& i2N@b@Kϐ 2 N@b@U& $ l2 N@b@K 2N@H& o2 N@b@K 2N@;&  ob@K  b@֔*& ( `  ' N@J@2  @K 2  ? @  , 2 H H  H@‒′ N@ ittyspeedsizesanerowsrawostopostartospeedoldnlnewlcaseispeedextproceverythingekdeccookedcolumnscolscbreakall㿘@K0@illegal option -- -%soption requires an argument -- %s㿈@L@ -2&` &``]`"4' @g  2 # 2  ` "P@͒@   "  & &`"h@ἒ@  @ 㿘   D@ 㿘  " $@0 " `  & & & & $㿘@  & 6 F $  ߆C w   " * +* -* 0" $"    " * +* -㿘   D@Ö 㿐    ``'@   '``@ & 㿘 @ @[א &  @$**@"" "$@$   """$ "     " "  " 㿘 @ @l & 㿘  @0 @  ?` # & & 㿘@c  & 6 D   $g`  ˒  " " " " $" %d %d 㿘 F"@ D%d 㿘!"@cd @ŐTIOCSETD㿐 `'@ c@^ TIOCSTART㿘@ `n c`@N TIOCSTOP㿘@`o c@> H@80(   #3#3233#@@@@xh`X-mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5  @@xph`XPH@80(   -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-iuclciuclc-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrkph`XH80( @@@@x h X H @80( @@  C$CC$Cx-xcasexcase-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoecho  @@x-onoeotonoeot-oxtabsoxtabs-tabstabs-onocronocr-onlretonlret-onlcronlcr-olcucolcuc-ocrnlocrnl-litoutlitout-opostopost㿘c c @F 2    ` *@&`   &` U&`  2"L`"L @FՐ 2    `*@&`  &` ;&` 2!`! @F 2    `$*@&`$  &` !&`$ 2!x`!x @F 2    `*@&`  &` &` 2 tablet disc; slip disc; ppp disc; strip disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-xcaseiflags-istrip-icrnl-inlcr-igncr-iuclc-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-onocr-onlret-olcuc-oxtabs-onoeotcflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8s%s Ȓ& ```" `"@ @ @  @!@~!@k@_ ! @q!@@k`@@c!P" @\!h @!p! 4 !x `@@  4 ! `@@$ 4 ! `@@  4 ! `@@  4 ! `@@  4 ! `@}@ ! @s@  4 ! `@h@ @ 4 ! `@]@  4 !Ȓ `@R@" 4 !ؒ `@G@ !4 @=@4 ! `@1@4  ! `@%@4 " `@@4 " `@ @( 4 " `@@4 @""( `@@@ސ"0  4 "8 `@@! 4 "@ `@ܐ@ @ 4 "H `@ѐ@  4 "P `@Ɛ@4 "X `@@" 4 "` `@@$ 4 "h `@@( 4 "p `@@4  4 "x `@@ " @@  4 " `@w@  4 " `@l@  4 " `@a@ "  4 " `@V@ @>" " @H@  4 " `@=@  4 "Ȓ `@2@ @ 4 "В `@'@  4 "ؒ `@@  4 " `@@  4 " `@@ "  4 " `@@ @"(2 #4 # `@@ #!""  4 #4 @ؐ#4 @Ԑ# 4 @ϐ#4 @ʐ# 4 #( `@Đ@4 #0 `@@4  4 #8 `@@4  #@ `@@$ 4 #H `@@4 @#P `@@4 #` `@|@! @b#h ` %` @@ dp@n@b` @ 2`@G 0C@D   `2 #c d,`` " ` @%@n\`( @c@nQ 2 ` @Đ @` @ ؀ !#@@(㿘! ! @!h$! "!%s: %s %s %s㿘! !   !@#$!@!@`H @##@ $!@z#!@$!%d㿘 ?  1 !P@m 0% 1  X !ؐ M.!ؔ -*  ^* ? *4* ^*@**!؁-aefgaef:g%snot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZH@Oz'H"# '#'H8@[?2 e"  f a c+ gc% ! "@m9  '"a@@ؗ  c@H*` @wa0cH*`@ cH* @,'H aH@ `@) aX@j `h@ `@؎!h` `H H` HHH''@ GH -+ 4Hђ .H (Hc\  `  @  @̐@R'x@D!  H`'a@d@1H 'H Ő  @^Ē a@    `g@ @! usage: %s [-a|-e|-g] [-f file] [operands] 㿘P <aP@\y!@n 㿘@ Ffhns.%s8@Np+) ' % ! #5/ 9_7e -* c@€  %!  $ $ $!@@YaȀ??!* @ &  "  . " `. @@a@c @ @^@@?@l aؔ@_ <  "@@@  @@? `@@@0```````````````````````````````<`H`````H````T%s: is a directory%s/%s8 !耢` @k U! !` <   @Q hG !쀢`#P#€  <   @ /  @k$ !`  @   "`2  !€ !ؒ@ܰ 0 usage: %s [-fhns] file1 file2 ln [-fs] file ... directory 㿘P <b(@[?!@4 㿘@fRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsBEFf:NRWb:cdenrs:tvw%srioctl DIOCWLABEL㿈@Lں '7!^)'5 #-+%/9_'쀢 8Z* H@€!$  @& $!$N'!$  @ E$!$!$  @  ':$!$" 6%"⼐ 2$!$  @ )$!$!$  @  $!$'b $b %!$  @  $!$bĐ %b $@@X ??!$*@`&  $!$ b "⼐   !$ "@!$ @` "⤔  `@" !$"`@Հ ?`0*` € @@ @ @z @@o "@ @m @n@] @  `@o0a`@@ R? @RȔ@`@\ ``@! @  4/bĀ . @ʒ`m '` @  ? (`@$`  `@]"@@!@ u @@4|hT 0xunknown disk type: %s㿘@ b0@ @^!&&& `&$@ E DANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.ioctl DIOCSDINFOwriting label to block %lld (0x%qx) lseekwriteioctl DIOCWDINFO㿐" ` @ԋ"!"@Ԇ""@Ԃ#(@#`  !W&&6@bp6bĀ   e`f@   "  i#"`#  aD + 3` @;   aD + 3` @ ;  @1Ā 2H'  @ 6 #' `m@ 6@/ @  #@/ 0%Ā !' `m@e  @/~  "Ā`2  e`g@S  #@J 0 %s: No disk label on disk; use "disklabel -r" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk㿘 "   0 0@Ӗ"0@Ӓ"0 @ӎ#00@ӊ#X0@W reading label from block %lld, offset %lld disk label corruptedno disklabel found. scanning.no disk labelfound at 0x%lxioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO㿘"`t"`  * 2`   :  @@  8 @,  @ "@#c 4 @"`@Ҿ  !W@ @  @ *  b@ !`"   !W !2  2    h@ *  8Ⱂ h (@ې 2 "` `s@+ `@l "`"e`r@ `@[ "e`e@   `@O  @ҩ& Bootstrap doesn't leave room for disk label㿘`( 2 @"&`&`( @!@d !Ԁ@ J c@C *J\ :%.*s|Automatically generated label:\ :dt=%s:unknown%d:se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%u:%srm#%d:%sil#%d:%ssk#%d:%scs#%d:%shs#%u:%sts#%u:d%d#%up%c#%u:o%c#%u:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:㿘N`` X`` @Vv`N` `` @Vm` h@7`8 ^ * `@V]`(`@VX`(@VS``,@VN``0@VI``4`@VD`8`@V?`<`@V:`H`@V2c`J`@V(c`L`@Vc`Na@Vc`Pa@V c`Ta(@V `\`',8@U,` L ^ `)@975/-+@ 7@UےX= @!@@UՔ`H@UД ` a *@@UĒP ` @UX `  2` ` ,`@< h@U`@Uap`@ ¢` @@[ `*`@R`K   %c: %*u %*u %c: %*.1f%c %*.1f%c %8.8s%8d %5d %5d %5.5s %5d %5d %5d %22.22s # %s # (Cyl. %4d- %uH. `@   b*   /??* : ^@ ` !(!`*` €' ^!0B`('`^!0BD?' ^!0B'`^!0BÉD' ^!0B`8'`^!0B?' ^!0B'`^!0B' ?^!0B?`($@' ^!0B艠?' ?^!0B?@u$' ^!0Bg' ?^!0B?`(@[' ^!0B؉?' ?^!0B?В@B' ^!0B4' ?^!0B?`(@(' ^!0Bȉ?' ?^!0B?@' ^!0BĀ`^!(/ #\aHa@TQ  : #l #\#`#d#haX@TAa  ^ `* ap@T6 ax@T0  ! !@p ## a@d@Ta@T  .ma@Ti `8`d!@!@S@`8  ?`&  @& * *@.?`&  @&  * &@!!`8  @f??@S`8@S  ?`&  @ * ** &@ ?`&  @ ) )* &@ ?`&  * &@ؐ P$ӈX# %s: type: %s type: %d disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld rpm: %ld interleave: %ld trackskew: %ld cylinderskew: %ld headswitch: %ld # microseconds track-to-track seek: %ld # microseconds drivedata: %d %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] sizeoffset㿐"a@R` *^  a@Ra@Rܐ`a@R֔ aȐ @RЖ`a@R̐`X`a@RŐ`X a@R`X a@R ?`&  * & @`(@Rb`,@Rb `0@Rb8`8@RbP`4@Rbh`<@Rbx`H@Rb`J@Rb`L@R|b`N@Rwb`Pb@Rr`Tc@Rmc8@Ri`\`    ,``"`&  4 `', H@RN $, `@REcP ##`ch##\@R4` @    ``@@|w # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '1024 8192 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, amiga, sun3...) No changes.re-edit the label? [y]: ^!@_?@Qc ?@| @| @k @I@s c@Qtc@Qp@I-/+P) !@@ @  ْ@u!br @H@ a`@|?`? "`@L ?  $? ? n%`? $`@Ls  $` 2` n N@+  @ 2`@̎@" sh-cEDITOR/usr/bin/vifailed to start editor%s %sfork/bin/sh㿀chp''#x'@' #@^a@@I  @Q#I c@t' @  @  @ 1  #@j @ &"#@@ @+#@B '@=@  ``@:  @  @  @ 䀠 `? 㿘@j\apL  㿘!p@L   , @jCL  # line %d: syntax errortypeIDEline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedata%d partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %s㻐&`  &`b@А ,$ "@( : "@K ,b0@4q 2 # b8@ ^"^ `<@@ "`@ v `@*@@ '"@@n6`bh@4; :'􀤠3L /-+'#א@4'p  '@4b  '@4∀  'b@ܒ L 0&`Xb@3  &L "`\@',`$  `L `b@ ? "@ʢ 6``6`#b@3Ð  `b@3 `@ b@3 @ 'a"&`(#@n˨ c @3 @ʐ  '#@[ &`,c0@3 @  '#@F &`8cH@3n @  '#@1 &`0cX@3Y @  '#@y w&`4ch@3D @v  '#@d b&`<cx@3/ @a  '#@O  L6`Hc@3 @K  '#@ܒ9  66`Jc@3 @5  '#@ƒ#   6`Lc@2 @  '#@ɰ    6`Nc@2א @   '#@ɚ &`Pc@2 2 @  '#@Ʌ &`T L  *`: `@ `Ȑ#ؐ6`*` @>@Ɛ  ' @X &@#@N %@  ' 0@? $4, ^`` `P@  @ "`@ ``@*@c\  `  @|'$@ : '  X@' ,  "^#YӐ@[ Q$#@H @K@'>, #@ؒ5 @7 -$#@ǒ$ @&@'􀤠, #@ȵ @ 4$@: 6` @Ȥ #@ >@`?sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %dwarning, partition %c: size %% cylinder-size != 0warning, partition %c: offset %% cylinder-size != 0this architecture requires partition 'a' to start at sector 0partition %c: offset past end of unitpartition %c: partition extends past end of unitpartition %c: block size < fragment sizewarning, unused partition %c: size %d offset %d㿘 (  # , 2 0  2 4 @ƒ   2 H 8@ǽ   H 2 8 P@Ǵ  8 2 < ,@I 0& 8 < 2  8@A 4& <  p@ǜ  @} ( @Ǔ   @Nj  @l ( @ǂ  `!@{   \)@ 753/-+  a 8@d= @F 8 ,`:`@[h @= 8 ,`:`@Ra2  "    @E!ئ  <@,`:`@<  < ,`:`@1@ 2    ,`:`@%bx @  4, !a  " @ " h`!@jȒ!@eȐ'`LX'P'T7'@Y.! usage: disklabel [-nv] [-r|-cd] [-t] disk%s (read) disklabel [-nv] [-r|-cd] -e disk%s (edit) disklabel [-nv] [-r|-cd] [-f temp] -E disk%.*s (simple editor) disklabel [-nv] [-r]%s -R disk proto (restore) disklabel [-nv] [-r]%s -w disk dtab [id] (write) disklabel [-nv] [-N|-W] disk%s (protect) `disk' may be of the forms: sd0 or /dev/rsd0%c. `dtab' is an entry from %s, see disktab(5) for more info. /etc/disktab`proto' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s installboot(8)x'b @~@V#a,b@J~bД@Jyc@Jt!#@@A?@Jkc@Jfc@Jac@J\`0 c@JW`h@JQ`@JM`@JG0@}<  (   @*`2 RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsout of memoryYou need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.This platform requires that partition offsets/sizes be on cylinder boundaries. Partition offsets/sizes will be rounded to the nearest cylinder automatically. Initial label editor (enter '?' for help at any prompt)> unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lesswunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?yunable to write labelRecalculated free space.FilenameName of the file to save label into.cannot open %sNothing to undo!Last change undone.%s expert mode EnteringExitingUnknown option: %c ('?' for help) 'P0@} !P    @M   @M    @M  2c@zC `@,@1((@w$@y@   `8@z(  䀢 2@b h`8$  7$ l'$ , 4 , @b `' z'z 2 7z@b!@`@|!05`@F$@>?   ?`$ `* &`@  q/0/1!@@q @@k @*`:` p=* ÒX@€ #@uȒ!@|X@|T!`@9@6@@V! `@|<!`ِȒ!@|2!@|.@#@U! 2АȒ!@|!@|@v@U! 2uȒ!@|!@|e`r@| @\@V!Ȓ!@{@{!`@ː@Ȓ@<@U! `@{Δ!`3kȒ!@{Đ!@{@ @U! 2bȒ!@{!@{,(@q@Uw! 2IȒ!@{@{!`@v@s@ٔ@UW! `@{y!`` !@a@R@O@<@k "@B  L@ @zU @{ ! L !b@! !^"@{ @C@"@‰@z. "Ā`"(`P@K@T! 5"P@`ݰ %# h@b   `H*  R  y n   H*`@ R` y " @zڔ! @j" @ m@`"4 "b@ L $b@" # @@>@T|! Ȁ` @ @`y#0Ȓ!@z!@z!@z@ "`@k@`_#H"Ā`@`V"(`P@@T?! @`C"P"] @"@zQ!`?``"#p#@ɐ Ȓ@z9!@z5!@L@@#8888888888888888888888888888888888888888888888888888`888888888888 888888888888888888t<8 ,`8888  (8  x  8 T8 8No space left, you need to shrink a partition Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' exists. Delete it first. partitionThe letter of the new partition, a - p.Partition '%c' already exists. Partition must be between 'a' and '%c'. Please re-enter an offset and size for partition %c. 㻘 ! @a0 N    , Đ!aP@E% p0 `E  `AĐ!@Ea0 -Ā` +Ġ   , @`2  "    a//%)'Ē@D p@-aж N,  ` @ @D!   6 ,     6 & &&& & @ &.  . $  &. 6@ " {&$&@ .   +  ". +      "  +  2  `+ . @[  2N& ϐ@J Đ"H@ a&&@ 28&@c 21&"`" 2@ 2"&@ 2&@ 2&" &┐ @ ? @Cpartition to nameThe letter of the partition to name, a - p.Command aborted Partition '%c' is not in use. You cannot name a filesystem of type %s. 㿘Ő"b@; 2J"@ƒa07*   & Đ!b@C`0&    `Ő!c@Cٔ0 `   * ^a*@ Ő!@CĒc00@partition to modifyThe letter of the partition to modify, a - p.Warning, need %u sectors but there are only %u free. Setting size to %u. Please re-enter an offset and size㿈Ɛ `@ 2J"@La0,`    `' ' '' @&  Đ!b@Cc`0    Ő!c@CU0@ w    `  " ` `      ƒ`А!@C( , &" &@d D@ 2T$ N$@ڔ @]! $ $@ #"`"'   2! @L @   2 @  $$ $ $  b @? @ϐpartition to deleteThe letter of the partition to delete, a - p, or '*'.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. 㿘ǐ `@ 2J"@>a0q*!  j" `  " "``""` &"`"`"`"` `0O   .Đ!b@BB`:` `  ` Ő!@B0c(`   @a` b"      ` &" " " " ` .@ @s&@device: %s type: %s disk: %.*s label: %.*s bytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld free sectors: %u rpm: %ld %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] sizeoffset㿐".@I# ^!* @A#ǔ  @<#ǔ  @7# (@3# ,@/# 0@+  8@'  4@# 0 <@ @@ X H@ p @ >ϐȠ`#\Ȓ Д@  #a`> 㿐@ b"b" `@@   * @  8? @ ?   + @@  @  #@S    "&@+  "@ @    +  +   `+ &@@rxpartition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk 㿐ɐ `8@ 2Jj"   ,Đ!b@@f`0o `  Ő!c@@Z0c@@ p@  ` ` #\`  #`@ڒ??/"2@)! 9 `   # @ ɐ!@@a 0'" &@"@ @ &@ ` < !H@֒a0`b  $@@˔? @㿐@  @"b  @ # `@@qn@"@%s: [%s] 㿘  ʤ X*b'#@_b$@| 2b ` ,b X ?4  " X* $ X @ $ b@tf $L?L ", L ?@Y Lb Lb@#,#Lb ?b%s: [%u] Rounding to nearest cylinder: %u 㻐 8` \@v !/+ʒ@a$@  ` /X ?4  "X* $X @膐 Ӱ?@t ?L@ O ,@O ?O@Y$O ? *`O `tr p`&? @   H*`@ `?* : ` ː!*` € 8 (,@  ($ ( (@u,@O + -   ! '$"@]~" "4?J` $"-? ^' B" '@Đ '^ " 7ā@' B'-:  + -"'`@?> '^"B 8' ^"B^"^B"7ƅB' B' @uŒ"8@u" @u"ʐ!@ ++++++++++++ Error, partitions %c and %c overlap: size offset fstype [fsize bsize cpg]Disable which one? (^D to abort) [%c %c] 㻐@ܒ  0@o @`@ s!` ˑ-`,`@@   `l?l""@2 2``a`a(@@W"P  荚   膚 Ŧ/ˤ -`'%"$* @∠/$@ O X` ?"` X* $ X@ # O` ڐ?*  *  @ @ @oO&`@ -`(2 @@o= Changing device parameters for %s: disk typeWhat kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).IDE"%s" is not a valid disk type. Valid types are: "%s", label name15 char string that describes this label, usually the disk name.sectors/trackThe Numer of sectors per track.tracks/cylinderThe number of tracks per cylinder.sectors/cylinderThe number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.total sectorsThe total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %u sectors (only %u sectors left) rpmThe rotational speed of the disk in revolutions per minute.interleaveThe physical sector interleave, set when formatting. Almost always 1.`!@pʬ@O!^ ;975/ ^*`0 Ғa@ "I@Ȓ!    a  , @ 2  )@'᠐@J` #)̦a%̑, @!؀ @<a`  , a`` ?"`a`* $a`@媐   6 !a 2 "@a0" &@a@"@pZ!0ޒ@G . ')'%# ,#\#` "@PŚ ?〤?@a ,& ,)'%# 0#\#` "p ?ˀ?@ؒa 0& 0)'%# 8#\#` " ??@a 8& 8)'%# 4#\#` #(} ??@娒a 4& 4)'̀ >b <"@ ̐!@;ƒc <#X 4 h@s   4@s #\#`L ?j?2  <!@ta <#Δbˀ @$ @&@@U#b8$b& <)'%# H#\#`    ?"H@L;"x@L8"@L5"@L2#\]]]]]]]]\]]]]]]]]]]]|]]]]]]]]\\\\\]\]]]]]] ]]\|]l],]L]]<]]\]]]㿘'  @ "@@f@ @c $@@c[ @X@ ` "`@cy$@`<@㿘   `" `2 @ ` ``  /dev/%s%s%s%c %s %s rw 1 %d x @f. |   , @ " "@ "    `eآ @  N r ؔ@A$@v / "`N@`r2G ؔ.@$@A`.@@f6?,ܒ @ @b  )  "^ bH|   @*  ` a*@ @#\#\@18  `@ 2@@( Starting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. This architecture requires that partition 'a' start at sector 0. 㿐.` ش`خ"!-+)'% ` #\`   #`< @h!% 2a@a! ` " !@0# ` " !@0 ` `!@0yH ` $` Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors 㿐.` %%#ـ``2   < 7!H  "N$ " @&E$ِ!@0b  a#\``  #`? ?"@ٶa&  !@٭a " ِ!@/Ӓa  b ِ!@/ƒa $ fragment sizeSize of fs block fragments. Usually 1024 or 512.Zero fragment size implies zero block size㿐.` -+)%'`#\#``, ??"@X @R` 2$`@I{ $` block sizeSize of filesystem blocks. Usually 8192 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. 㿐.` ` 9, J "@aC 7)5/-+ @fg@fc#\#`!淪ᰠ?߀?@: @!@. @f (@e bh@ظ! @e,  cpgNumber of filesystem cylinders per group. Usually 16 or 8.㿐.` ۪` )#%   #\#`R ??"@a  24 @xa  FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).㿐.`  ` `(^!*` ې `   , @@ 2 ,` 'ے@!( !,` "@a +)'% ` #\#`ah!Κ ?ꀤ?@ ` ,`  mount pointWhere to mount this filesystem (ie: / /var /usr)noneMount points must start with '/' 㿘. `E A ? = ;.#!ۀ /@ @_@ X *&@c@_V #@@׬a@b#۔#8  "@כa c8@ 2N@  @_Z&@ 㿘 2 @@ 2  2@ `?@Can't stat deviceioctl DIOCGDINFO8@bs? ܒ`@ @2! #ec@^ `r@b 6 &@`e@b 6&@ܒa@Ő &[d]isk, [b]ios, or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.dBIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd', 'b', or 'u'. 㿘  ܐ!ȒaH 2 g"?* : `3dݐ!$*` €2(U"& (,& ,0& 04& 48& 8<Q& <`2`(B"& (`,& ,`0& 0`4& 4`8& 8`<>& <2(/"`& (,& ,0& 04& 48& 8<*& <(`(@%,`,@ 0`0@4`4@8`8@<`<@ "@ma0"@gasusuuuuuuuuuuuuuuuut,uuuuuuuuuuuususuuuuuuuuuuuuuuuut,㿘 " " " "   <& 㿘@9ŔFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s`p"?"r@Vr lpp?_ $"" "`# d" Ѐr#bߐ!( € ݐ"X_"a$" @;ϔ!  $" "ݔ`@I "R_!,`N @ K"  ݐ" _"a$"&@;!  $" "ݔ@I֐ " $"+_!,`' @t $"  ݐ" _"a$" @;! $" "ݔ@I  "ݐ"_p """ ?1_! "@yn  "!@I  p"@`I 6   "_!ݔ@I "< @ _!ݒc@ID "@Uװ??$"$Ѐ@2 "a@`M   @" $  @UĖ ?2 $2 $ "`2$ `2$ l  `_!Dp_p "`"bs#!<iߐ!*` €c? l  `p_!Dp_"#`Z"a<`p @>c? !__"!<_"a< l !_ p!<p>"#`?;"c` l _!_!D  : `p@ 0@_%!D_?"!<%p1p>$!<!<  : `p@u 0@!<  l $!< l ?!< &#`&#`"p_"c`"<%p $Ȱ |{X{X{P{XwwxTxyT%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. cpio%qu blocks tar%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. 㿀pb   _"! "``"d_a| # p"`#p_!h`'r?`" * " @Ӈ _!@*3a0@T#pbЀ  p@_ r <   r 4 0 r_@c.a$br l`_!` !p"Ԁ @]( "Ԓ@h @T!|`p"`2 !r @!`_ @T"ah `?$d _r p"``"dpbĐ "b!| __f"! !h`'r?`" * " @  $!h`p !___!aah@)@Tj_>"a !@! _ ሢa ሔ _` @%_ @)0!@g! %_`p_!p_bĒa`? #\#`#d@)p#h@T,$ ?cp"`pbȀ   %p#?@T? 4$ȁUnable to truncate archive file㿘p"p"b̀ 1p"  @SΒ    "@     "8@GN ?Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s spec㿘p"`b@F ? Ѐ` __!<!c@F ? Failed read on archive volume %dEnd of archive volume %d reached㿘p"Ȁ 3p" pb@Sx _<  "" `!"<" b@Sf  "`` $" p""Ĕ@Fʐ 0p"c@F Write failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWED㿘p"Ȁ pb @S  p"``"6$"$"p" @ & : !b  @RÒ .  > b b@ $  $"Ȁ  "?倢` E0  "  a@F $"C    $"Ȱ p " "``̀  a8@E 0' p"c@Eې 0 r p""Ĕp@E 0 p``"@B a@E 0a@E Cannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.㿐 h`g?pbȀ b r`l? W`h ` "`dp" 4=# `9  # `2$pb7  a'@\w 6&$%Ȁ # `b %p"%p  @Q  > @ @ d@Qܖ   $# `Ȁ `@E1  `@E+ ?Foward positioning operation on archive failed㿘  >2@ `(= p"Ȁ 4p5"`21 !p"  @Q    p@ 0C 4 p2 > 4(>p0@ b >0  "@Q    " @E?$bȰ?Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %d blocks.㿐p"Ȁ 6p" K  { `(y$Ȑ @Dx`p? !pn `(l$"  @Q    " @D0X?b p"Ā` @DQ``I?    "@P B  " @Dm7?@r 1_ "!<0 `(.$Ȣ :`@@ @D#`? 7@Lp' a@[+    " @D7?$?$Ȱ Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %d pad blocks?cp"Ȫ `'p?c⼒ @Pt? 4   "P@Cݐ }?  7'!  @Z!    "p@CȐ h?7'⼒!@Z  ? "@C W?#⼒@P;?   "@C F?@P-? 4   "P@C 6? 7'# a@Zv   "p@C #?!%bȐ@@) `@CH ? 7@L6'⼒a@ZT   "@Ca ?Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again 㳈_al @W”  "@Bt  @W   "@Be `h  p"̀`_ @ ! @A"_ @ b a@ bX {p" w u  p"a@Aؐ#@AՐ#( r"a@Aΐ#P@Aː#xr`l?  @A# ; $" @A#;75/9p!+3')@Ac@A@A(@AP@A, @`x  O ?%h`@A'"_"!h`O 2 `Y `s`S 0 `y a a@Aw@As ' @Anp"@Ag '!!@A`@A]@A[!@@Aj, `x@m O p? %h@AF#"_8"!h 2@A=!Pap@S @A3!x@X:,@A*!Q !p"؀ @Ta$"@ X$ap? "%ha@A; ?could not pipecould not fork-c-dccould not exec㿐@|u bp@ @q5p`""b@t @zВ0@z̒@M@M0" @z’ @z  b@z @z b@M@M@{ b@D ?#p@x@ \r p`D T`p`  N_!|` @  E@  @@F  x %@ (`p@,Ð #`p@1 @,G `p@- `p2@` @B `p`(_al @U *@+Cannot chdir to %sCan't fchdir to starting directory?#p@@ r p`D `p`  @9 _!`@6~ @А f/_@1;  x @#_at ?_!X`8?#@2( 0at _aX 8 #@ ( xq@aX  ? `@(  `` `8 V`@+ `p@,א `p _@4 x E@a4  _!8`B_?#@1Ԓ 9_a4 _!8`8 +_@ ( %_x@a4  ? `@( `8  _`@`x @ @B0!|  r @ r @_ "ah  "  "@oz    `@?   6 4? @@А x @ @ @xB`|@4| n_!h`jr  `?"`@* "@@ʐ Y$!h@ `p x @ @ @KB@3ې0F? < @| `_!h`r  `?"`@* "@@Y $!h`2 ?# x @ @B     _@Qa  "x@?  @ `p@* `p`(l @T@ t@8@*=Unable to open %s to read㿈r p?`'@2 @   p`,  p_` 0@4 @$ /_5_@$@2ϐ       @0s  ' " @>@0@+U @ɒ@3` _!$` @  _@@3 0_!|  r @ː _r @ _ "ah_ `ŀ" @|` a| _!h`r  `?"`@* "@@p $ah@t0H p @ @ha|  _!h`r  `?"`@* "@@H $ah 6耢   @耢 ( x`  ` x @ `@A `@. _!t?+'@3T $` p`4@Kl @S Rp @6@cCannot mix current archive format %s with %s%s: Reading archive to position at the end...done. r p?cp@    p `@=m 0w p`D q p`  k_at  @2 b p _@49 X_a|   r`_@Ma_ "ah x at  @2ϐ " p@4)  @1  p@.  @;B  p`(@2 @# |  !_!h r @Ԑ!8$!h; _!t`@2 @@ r p`D ?#p@ directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %s?b?@?#@_? ' Ḣ @T,l ?L+ /?a&`#@M / /*@-`,"a@.   "a @< 0I<  a`H@@0 :@r 5@5  0_!`@2 '@B5_0'??'@-D  #_at 2 _!X`; * :  /`? @`p@<( 0@.% !-at _aX  8 @ aX  @ 8 @@0A ɒl@( Ēl?c @* _a4  _!8`(_@- 2"_!4 _!8` 8 _@ !4  @ 8 _a|   r @_ "ah_ _!`" @, @G !| f_!h`br  `?R"`0U   ? @ @ !|@02!|  @-l ?b  ' " @;@0 @% 6@@00"@@Y@!| _!h`r  `?"`@* "@@Ɠ $!h@ l @P @4v@Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.㿐r p`ض ? ' 5-r19 "b?  @ `P l A @:ʒ# @䀥 `p $€ #`p` ``8 % ` l  @:#P `@I' Ӑ` "_`8@ _0b+ ?c(@: ?a   "a Cannot identify format. Searching...Sorry, unable to determine archive format.㿘q#X"` q!*` * & 6@ o?@r* @*`@"p@Yc `غ " 9r7퀦 T@ N"  ` l K? @: h @ 4q cX@ q!qcX آ@*` *  . `@  2  l ? @9h  @Hs""@Ơ"`¤ a@9ې ?Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portable㿘_aD  _ ؠ "`r p`&!D!D? c  !`(   "" ``  @9~?0_ap_"`s"a<      ?_!D  @__8`"`#  Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multiple㿘r l _`ذ" _!D? a b "@9)?0_"a  _ _?a<_ __  # :#`ܰ  ?__p "!<"c`Cannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.㿘_!`cH _D  __!<p"D "c`<p"#`  s__   " c`  @ :; F@ @|  @c` :@ D E@d _( ؀`% جc`@$@ % < - ܐ $ؔ"  : c` $% c`$@ % _a_@c`b  %<;a&8`  r "`l c @8V?Unable to append when there are archive read errors.Archive read error limit (%d) reached㿘p#d`L r l`b@8+ C? !_ _7?_ ;   ؔB@ __" 8"`(   :!_#p  :  4c` d   b@@7 0^   _?㿘_`" "`@N㿐  p?_`_ " :   2 @    ದ@fU% _!< :`@ x @ ݖ@r  :?_@ f @ B D (8.  "@:`   ` @:   2@    d% `  㿘#__``؀ !_ ܐ "@M  pc`@$`㿘`$" '_#_%p`"@  @@` @?`@M_`&@@$`` 㿘`$'_#_`"@  @N &@ `@M5`&@$` 㿘' _ "  p@ec` &!?< 2 @ @Mw ದ@ < f $ _`_ Read fault on %sFile changed size during read %sFailed stat on %sFile %s was modified during copy to archive8 H@' _ "  p@c` &G>: 2 @  @CF  ࢤ@ :d $ 4_`8_   "  `(@6i !>@MP   "P@6 >?8 `h@6I > Unable to obtain block size for file %sActual crc does not match expected crc %s( H@  '@M "  ؀ 2   O> "@ @6?  >'/_0-_ :2 @   #\@ _!$` :_   #  : $  @ d ` "@%_@ Ē   H`4   `@ 4 _` !$ _?!$`2   @bh @5  Failed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %s(HP  * 2`  *` '     "2  @   @L=  ؀ 2  '"@ @5p'#_'p`ؐ@A #\@ <@ E`ؐ@A` 怦!   @5C 0 H    @   a  @5 @K   8  H@5!   a` @4   H`4 `@㿘pch  )  $h% #_ !pl _  :`#` __ "a? `ؑ> B@__" 8"`User specified archive volume byte limit reached.㿘_!H!H ` 4+_  1%__!`!`!H  !H'%_ @3'p`@4o   p  _ =a`i"#`_ ؔ  _ "`܀@=a`] && %_'p  =a` M`_؀ "`&& ``@ `a` <`B=a` _ ܔ@JV_` &"`$ _ " a`ؚ@ <`C &!_=a`@J9$ r`p @$ @0ߒ __ "a?Unable to allocate memory for user id cache table㿘!p#  1p#Ā 2?!=@  $#  # &#Ēcp@3ѐ ?Unable to allocate memory for group id cache table㿘!p#  1p#Ȁ 2? @ؒ  $#  # &#Ȓ`@3 ?Unable to allocate memory for user name cache table㿘!p#  1p#̀ 2?!=@  $#  # &#̒`@3} ?Unable to allocate memory for group name cache table㿘!p#  1p#Ѐ 2?!=@  $#  # &#Вah@3R ?%lu㿘p#`Y >1!=@Lߐ#* @ "!p`$!p $2 !p`28 `2'13 #  @` #`$# @F (@   &  & $@%A `21"2& $  @  &㿘p#`+ >1 @L#* @ "!p`$!p $2 !p`28 `2'13 #  @W #`$# @F@ (@   &  & $@$ `21"2& $  @Y  &㿘@Iu "[?N Vpc   &N?@,&!=㼑* @ #p  @e  #p 7?! $c  @ c`$c  @,!=@Eܐ (㼡, "@  @ ?` &@ @ @  $` $ $&@ $?㿘@I "[?N Vpc   &N?@+Ŕ * @ #p  @  #p 7?! $c  @ c`$c  @+ @E{ (, "@  @ ?` &@ @ @ݐ  $` $ $&@ $?㿘@%TRAILER!!!㿘`@   ? H`@  ?㿘 <    < & +& $")40,H'H#"H(0  #&  &  &  &  &  & H   o @6 &  <@% ? %?p#` @G $``" 4 ` $` ` r`t` p$$, $ 4 0@Cpio file name length %d is out of rangeCpio file name in header is corrupted㿘lb@1 ? 2 L 2N   b@1 ?Cpio link name length is invalid: %quCpio link name read errorCpio link name is corrupt㿘 H   @   4!  H H@ @0ʒc`? H,   @"&, c,@ N,  c@0 ?070707㿘`K `@   ?㿘 L h! x   :` @  & `  @  & ` @  6` @  $& ` @  (& `$ @  "6 `* @  ,& `0 @  @&  H 8&  0& `A@E : `;@Ӕ ` &0 < (  @ &,., W z?  W㿘@'File is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %sHc@'\ ư?``x   :`,& ",    A4  #`H  A @  `b A @~  !ǒ @u  ~#`   @k  t`   @b  k`    @Y  b`$   @P  Y`(   @G  P`"   $@>  G`,   *@5  >`8   0@,  5 ; @$  -  L  `  ``b     2 ,, 6 `c@/6  ? c0@/.  070701㿘`m b@   ?070702㿘`m b@   ?㿘_ @#,"a$㿘_!$` n ђ n #`x  :` @ k `& ` @ e ` 6` @ _ `$& ` @ Y `(& `. @ S `@& `8& `0& `6 @  `H:`& @ B `"6 `> @ < `F @ 7 !?# @ `*  * `& `N @ ' `V @ "  @ `*  , `,& `f @  `&`^ @   ??&j 8 n ` "  .< (  @   @  b  `:&,., |   @  b v ` ?  |㿘_ @%("a$File is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %s(?@%q? #?` ``,&_!$`!’ @   `   ! @     @   ` "(`x  (x% #x#`H   `  b `x ;@ 6 @   `Òb`,   ;x   ;@ 6 @ `  %   @ V      @ M  $   @ D  (   @ ;  8   .@ 2  "   &@ )  v `  >@   l'? @ `2 @ F @   _, `  N@   U V  2  @   I ^ @   Aݒ n  ؒ   n  $   "b    # 2! ,, & , $   6 b@,  ? b@,  ` (:`((!Dž0: 2`(0 ?_耠   ?㿘ڒ  _ ! x   S;` `*  & ` `*`@& ` `* 6 `  $`*`@& `  (` *  & `  "` *` 6 ` ,`*`@& ` 8`*  & `* `*`@  & ` H`*  :`*`+ 2 *  @ :`R`` `*  & ` `*`@& ` `* 6 ` $` *`@& `  (` *  & `  "` *` 6 ` ,`*`@& ` 8`*  & `* `*`@  & ` H`*  ;`*`+ 2 *  @ :``*#`8`@`0& `B&& :` ! 3` < @ (@ `H   &,.,   `  b`x ;   @  b  ` ?   &File is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sx?c@" !D?  ?  ,& ؀ J  `x] [x  H * 2` * 2` `@  c * 2`  x  ` `+=  `-5@ *   - @ (`(`(`(``-) ``, x; ;  , ; *  ` **   : .`.`.`.` )x   :(`(`(`(`)  q :  *   ǀ(@(`(`(`  2 *   (`(`  *`2`*  2`@(`(` $ 2 *   (`(`  ( 2 *   (` |(`  " *`2`*  2`@(` n(`  , : *   (`a(` 8: ::*` @ `*  * (`(`(`J(`<  *` @ (` ?(`9  3    |   "`    $ 2" ,,   , "  Z 6  `@*P  ? `@*G  Unable to create %s㿘%   c*`.@.4` 6*@ސ !?!  b ( $ @  @@*A  ?&@4 &_Unable to close file descriptor on %s㿘`@ @6  _ "8 @* _!`  ( $ @Z _ax  `x`  36 x  @ r t`r x` 08  @ Unable to link to %s from %sA hard link to the directory %s is not allowed8, @   " p@) ?<   @g `@) ?㿘`    @P  Unable to copy %s, file would overwrite itself8 @[ _!`  2    a@)?   Unable to link file %s to itselfUnable to remove %sCould not link to %s from %s8@  >% _!`2Q @@`@ bh@) @?<   @&ߐ %   @D % +  "@) "?@) ?#_  ` @`   @f) a tarcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)8  c   ` Z!*` €"H @( +?_!@Z @ ,_!@`, @?%#?" ,@Y < ( ,2`@T 2' &,*  2`@c,2`@ `x, @_~ `@(# ?$ !"  @ɐ ``_!`  $ ( @ ؖ@(, ?_!`` $( @ ( @_ `t_ax  !x  36 !x  @%`J)r_!@ B@Ē  *!x@  " @'ؖ *`2`@u0  c@pa!x  6@>u @  )r   t r x`  t@>` @   t 2r x`"  08 @  @HxUnable to remove directory %sCould not unlink %s8@O !_!`2&?<  @% 6 `  " @BR    "@'Q ?8L /? " /!` @@  6,@ 2 , c@Βa$@ , @ / ,@ @! _,?Unable to obtain file stats %sAccess/modification time set failed on: %s8q X" X%$ 3r`t r x``X@  `t r$`Xr x` `X $ "А @&Ж`X@bq  "@&Đ paxUnable to set file uid/gid of %s㿘@9 6 _!3 @h! b  _!|` b@P 2 ?b@& ?㿘@nu 6 _!3 @A! b  _!|` b@) 2 ?b@&l ?Could not set permissions on %s㿘o@k  "h@&S File seek on %sFailed write to file %s㿘\H% -+ 2 '&"&`"& N  @ `@ L@ "`@ 2'<   @2   Ȑ@2bؖ@& ?2&Failed seek on file %s㿘??@2X   q "0@%ސ 0`h@2m   "ؖ@%А 㿘@ @2/?&@_!p`  0   8  File changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %s?c8  `  &a  X @8 :D  ? @  @?@1  #`H `   `a0?#@<  `8` "H  `a`@% ?  @1  ` "@%2 ? & Unable to allocate memory for file name buffer㿘_!@_  "`  "_!P` "_!0` @"q `@8O,_ "`c`@$ǐ ?@ _ ?!p` @? 6 Invalid file name argumentUnable to allocate memory for filename㿘 N `@8  `@$ ?@;g?`$qN /". q`$$  $ $ q` " "`q" "` 㿘q ` "`_!`_ "`_!` ` q q` @3 WARNING! These file names were not selected:%s 㿘_!p` @Fq )'%  4   2 `2 @$""  @)P 2 Can't fchdir to starting directoryCan't chdir to %s㿘q -q@2/$`1 +_%)'`q!_ ,@Ŕ # @ 2/*._ "$  $ +? ` "@_@6a  ""@# ?@S@   " @#?0 !_%`_  @10 $` File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s㿐_` %q|"`  %q#q@1  $`q а? 8?` 5 ̓*` €_!p`` @ @ ` `0` `@#M 0`  ` @#n 0`  ., `x   ::&,@ : ;` ;` ;` ;`  (;`( 0;`0 8;`8 @;`@ H;`H P;`P X ;`X< "9("140NO``K -0 H?`7:`_!p 2&  8 0@ (`$ " @ & : & , @9, 6 ,`  @" 09&,  & ` @c,`&` & ll l8llTTll%b %e %Y%b %e %H:%M%s%2u %-*.*s %-*.*s %4lu,%4lu %9qu == => 0_!|` @ג?`& * & @@/-0 `@5 _!2  ` ;!@@!!@i` @ @ /`  `H `  #h #`#da #\ @7 ` ? ?` 2   `a8@&`0aH@@`&@  * &@Y @` ?` @̐!P, @S  2 @!X, @G?`& * & @/@.%s%s %s @_!  8;a @K 4!!%8@Ӑ@U @ "/  @ @!r 㿐@8V` N N N @ @f N 2N0@^   J " 0" * 1 Є *`(8*`8( Ʉ*`8(  0(Ѕ8   J`/ `7$(@    8W0*2   0*2    0* :* ? 㿘@  @ O@ "`0"`A@I@Є  2`.* >а*`>@F.> +.>2`* ` >F *`@`@*@2`* >а*`@>F`@ O@/@7$. 㿘@  (  `0 8W.W.* 2`@2   * 2` ` 02 .   0.:. ? %s: unknown option %c %s: %c argument missing 㿘_!  "b`4`I?"J@ -_ a *a "c_J!`@3 . :  ""'?@c  :2J @!ah :2. 㰀 @!a@,  ?*@$"㰱. > ustartarsv4crcsv4cpiocpiobcpiopax㿘@@j  /_`"!`@$!!@# @0!@ؐ# @0#0$!@Wab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLPT:U:XYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedP  5O-r`8J  *` €E# b@!_$!D`=b`@m @5_ "a(/_ "a* "_"a$_ "a _ "a@_ "a_ "a b@  0 "-* : `  *` €r" t __rr" x""x# tr" x_  "a_  "axL`(@ @l L  ӤѤ @ b ɤ_ "!pä _ "!t _  "!| @! "q!'!8 @ʖ Hr "`p"`@@ѐ   X@a '+@!@Вx  `H!@`0P _"a,! @"_:HH H"  aH`@ @aH a ` @"@]_ "!XW ! " @r Ѐ p?J"cd@"p D"cd`@u 0 @Db 7_ "!P1 _  "!@+ _@"!@&  @b  @b _ "!0 _ "!4  _ "!8 @@??B  sې!`r"` !%lqȐ   @@  !  @  ! " %l @a@S@Z ll `q#r"`pl`A  *` €!!#7# *@ @ #@6# $#0&#@a@ʐ @%?. @_"a#p# *@ #@# $#p"#d''(D(D(""""""""""""""""$t&l%% &l%%&l&l&l%&l&l&l%&l&l&l%&&l&l&$&<&T&l&l&l&l&l&l!`!h!!&l!&l&l!&l""&l"("<"\&l#0#8#X#p###&l$`b:cef:hmopqruts:vwxzBC:HI:LOPXZ014578write_opt=nodirUnable to allocate space for option listcompress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8The -O/-o options are only valid when writing an archive-I-rUnable to open file '%s' for readProblem with file '%s'-CTAPE㿐r " |'    )r7 ;r`J #ؓ*` €# b@!_` $!Db`@ܐ @!D* $!D % lp"#d  bJ@ -2 J` _"! '_"!'r}" x @t" w @s  __"am"x_ i"a f% l @+b a@w]Z% l_a| U"a|_ Q"a r" xL% l0  "_D"a_ @"aP@07-`     @nb@1o  b_,"?'"?_ #"a@!' |_ "a0 "@_"a, "P  "`  "p " " "_"a@ϔ؀?I? *`@ &  l 2!!`'` l?   l?@1  l?  rq" "`pq# "`p b@ @ l   y_ -_; 9 7 T5 ` 7 @ْ ) !@wc !_ #@ܔ@ !_@  @@M "@ⷐ !@c! ! @0@@@⤒H 2 @`@ )`% `@` 6 @@  @@~  `@ 2`_"!! p+p  k+p@Vh` D В  ! @F! @R" ! c@ !_ c @S@. !_ @%@Đ "@. !@ڐ! ( c0@4 @! @@cH 2@`@ ".%cd`  @  y` @@  @@b  `@ %cd !_! " J  @0#P $!J  "P$!.. .P.P..$.P.0.<.P.P.P.P.P.P.P.P.P.X-<.P.P.P.P-P-`.P.P-.P.P,-.P.P.P.P.P.P.P-.P-.P.P.P.P.P.P.P++.P,,.P-.P.P.P.P,`.P,l,,,,,,,- -.P-0/%s8 !% + @p@QL `?,@  b @ z! @j ?<   @  ?` /,`ϐ abcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdinP __!_r__r?_#$!x "l"a#a"x#!     / 9`D#T*` €_ "apq!&!_ "a( %`l_ "a &xq" r"`p%`l %`l_ "a!`r"`%`l&_ "a|w  ~%`l_z"aD @b_t"aD!  "@[c  %_ "c@ @%_@ @5 @P`V" c0@ @O bJ - J "B%"?%! "q!'!8 @x Hr /"`p" b8@   "P@Va %)@@x  `H@H @_ "a@ "@_ "a,q!r"`p@@?@?#`l* `G@#@*` €@ ? @~` 6@@y@ 2@01@  _a@. @j@_"a `@a@ p@[p"#d%_!x @!    bp@  @F@D:4:4:::x9999999999977898 898899999899999999999999999797,7897@997P997\7l97x79797779997%s: Invalid combination of options: -%c㿘_!!`h@!  q!J 6 `@!@ 2@ !`?"`! * $!@ 㿘@o@q᠀   ᠁These format options are not supported %s = %s 㿘q!`ax@` !1!@e! 2@ Invalid option nameInvalid options format㿘 N  b@ֳ  b@1 :?b( b@) @+ΐ0?L@ ", 'q@G , 2,@A = @+ 䀤,"@ "`"` q "" `$L@ ې 㿐 @F)  "a 2\ `(Y "V J k" m b /J w)J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& @8"  'J`x 4 ``*2   @Z @  㿐@’  _2  J?` '@*  @-@*_ "a  usage: pax [-cdnvz] [-E limit] [-f archive] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdiknuvzDYZ] [-E limit] [-f archive] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [pattern ...] pax -w [-dituvzHLPX] [-b blocksize] [ [-a] [-f archive] ] [-x format] [-B bytes] [-s replstr] ... [-o options] ... [-U user] ...[-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-diklntuvDHLPXYZ] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [file ...] directory 㿘!!@x!@t"%0@o#bP@j@f"p@b"@^"@Z"@V#@S@O#(@K#8@G#h@C#@?#@<#cؒ@7@3 @/ @+ @@' h@$ @ @+G usage: tar [-]{crtux}[-befhmopqsvwzHLOPXZ014578] [blocksize] [archive] [replstr] [-C directory] [-I file] [file ...] 㿘!!@"@"@@+ usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list 㿘!!@"@#8@#p@# @@* Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %s㻘 N ` `L@` `\*`: @2``g`@(Ӑ  `@L t?,@@* @+$a @8 @(ݐ^?`,@ J \2N22 *@5 @(Ð*`$ $J + !*:  P" g G" 0  p"0 $ $@5| @(,@!P@ ?J  qc $qcİ " "cq"#"c Empty pattern stringUnable to allocate memory for pattern string㿘 N  c@(8  `@ ?$@+$ q$ $ `$ $ qc " "cq"#" WARNING! These patterns were not matched:%s 㿘q#  )'%  2 `2 @x  @   2 Pattern select out of memoryPattern list inconsistant㿘q#`  _!`   \$  _W !`22# 2 *`2)#2*@ҭ   $a@+  ` /*@6$  ` /*@$ @*?$ J / * $ $ & #       2    @'" &a@ ?㿘qc  &_!`/_!(`4?2   #_@.         J@ /2 @1 2  a(a(`? `&  T &?& 㿘&N ?  [  **`:N@-*`6N@N@ _!`2/1?&. N@ ߲`(? N *`"   N@Δ `N@ ?N@` `@ 2N?:  `?J!`?   82J! -(J  ] 4  @$  (8 "   ](  Removing leading / from absolute path names in the archive㿘r |`! N  /|N    . .  @)@!&|   $|b@ | )qN, /%q `qN, 2,  . ., , @)@!b,&,| 4 q $|b@ɐ q#` @B  )     _, ,@2 _!`@j     ,, @ T, ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s 㳐_!@ !-+)'#!e@8@ah@!@ , %@᠀ @a0@(,O@!0〢  .@!!  O  @Ր" ?"(@Β @_@ϫ,&`? 㿘 @ ? ` ,, @ ? File name %s/%s, too long㿘N@`/ "@l$&@`@ ?  ?*@  * . ?*@ .  Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s q?#Pc@PPB X/ @ /\  ,@` @* @!@d 6 @ U@F W d@\"  L  ͐2Ũ>@0,@` @@L  @,@L  $a@ $ OP OP  !a(@ OP!a@@OP  @Ϊ,& 㿘 =:  & \*N / 94 *?Ѐ$, @*:  \2 .N  . ` `  "  '@? @ʔ:&* &.Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.can not gzip while appending㿘@ @q _  "a " @_e!@&l L@ !@': '_ %_J?`/"?@#ϐ  $Ta@H Aᘀ T@&jT_"\ /* "\0@w &+@ %r l`#<*` €ϵ*_!,`a8@mr Ҏ _(ᘁ_(^^^_Cpu time limit reached, cleaning up.Signal caught, cleaning up.㿘 __"a| "hcP@ 0cx@ސ dž@ $_!p`@@$Ԑ LC_TIMEUnable to set up signal maskUnable to set up signal handlerh @   ?@  @   ?@ z @   ?@ o @ 2?@ d @%    _"@   _?؄ؔ"!l  '''@$ΐ   Ȁ    @$Ô Z  @$  Ȁ    @$ H  @$  Ȁ    @$ 6  @$  Ȁ    @$ $  @$  Ȁ    @${   'ؐ @$r @$l     "8@5 ?㿘r Ѐ`r@ 2 r Ԁ`r@ 2  r Ȁ`" @B   Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memory㿘 "S?N #r`Ѐ   !=@ْ  $`8cN # \N  #" @d: 2 `@ ,?  @ @f!=@(1`Б, @ " 2@!  `` @v ?, "  "" 㿘 $!=@(r`Б* `"  @ 2` `2@ Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memory㿘 "S?N #r`Ԁ   !=@E  $`8bN # \N  #" @^ 2 bH@ ,?  @ @^!=@'`ԑ, @ " 2@!i  `bp@  ?, "  "" 㿘 (!=@'tr`ԑ* `"  @ 2` `2@ Empty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]㿘  N ``@Wi / "N,@`N & ?А , *: * :  .2`x 2`x @ : J 2 @   `` L@ 2$  *$ L@ & @*:  M"  c C"  L@ m2 L@   $   $ `Ж@  S`L@  @@˄ N$`$ @ 6  ` $ (rL $@~  6   a@ @ y$  $  @ a8@  @ g?r`Ȁ $ r" "`  r`̰ " "`̒a`@  ?rȀ`A@8` "$ #  @ &)  `$   @    @   ` ` `2` `?㿘@~@DŽ . "$@, @#0 2a?L?Г* @L *`В@ `=$@T?@#?`8N?#*` €N?Г* @N *`А@ D$` d$` N?Г* @N *`А@ $`?$` N?Г* @N *`В@`$`  N?Г* @N *`В@`$` N?Г* @N *`В@ `;$`@&@?? oDn<on<nn<nn<ntCannot allocate memory for hard link table㿘1r! 2 )@  &! c@ ɐ ?Hard link table out of memory㿘r!`m%`"`b )@%Ka-  5      @ 2  @ 2  ,@=, ` &,  &  ? $  $@@$ @  @  $``$  `"$  - a $ @ $  "@ @`8@ M ?㿘!r! 8#`"`3` / - +`@$ג)!*  "  2  `   @ 2  @ 2   #@@㿘ra   *@  "@`@@`2Cannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %s㿘1r! 1A !G@  &!c@ Ð 5?_!\# #1_* * * * * * * * * * * * * * @!Tr "a,!T@% 0  "!T@  ?Failed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memory㳐r!`  1@G- @`;+ -@2&``!r!,  @ ` ` !,b @ f [?@E@ӛ ```2@`  8`  ?$`= @  .!r!,  @  <`!,@ɔ  8-  $`$@ $`" "P "p@   ` "8a@  `?@?Cannot allocate memory for interactive rename table㿘1r! 2 "@  &! c@  ?No interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory㿘r!``p@  I @,"a, @`0` `@@i 2```@` + @`@ &``@ @ڐ &@@Ր  &`a,   &` " @@@`@ H ?㿘!r! @@ޔ"!* @ @  2  @&@ 2Cannot allocate memory for device mapping table㿘1r! 2 !=@4  &!  b@  ?㿘` @  ? Device map table out of memory㿘r! `-!=@"a , @` `2` " @L  a , ""  "" cx@  Unable to fix truncated inode/device field when storing %sArchive may create improper hard links when extracted㿘r!  ` }  @ 2  " *     +2$`& `W& `R y  B`25r"5r@ې 9"" "$ 5r0  &00\  0 @!S  `h  &0a0 @  a0"" "$  &   &`h @ `@  Cannot allocate space for directory access time table㿘1r!$ 2 !=@$  &!$ b@ ?㿘ra$   $*@       2<$Directory access time reset table ran out of memory㿘r!$`6!=@!c$,`@     2  2  @'  @  $$,`$ $ $ $  $ " @:c@ 㿘!r!$ &!=@!(!$*      "  2  2     "@ & &@ @ 0?Unable to create temporary file for directory times: %s㿘!r!(?2 _!\# #1_* * * * * * * * * * * * * * @]!T  $!(!T a@! ?!T@"@ Unable to store mode and times for directory: %sUnable to store mode and times for created directory: %sxr!( /  @  ? b@ 0"`' !(7'' @'؀  !(@  _a "ac @ɐ Unable to set mode and times for created directoriespra( R  9'_@f >ؖ !( @B 6!( @WЀ .ؖ !( @2 &_!x`쀢 rWr t`r x`߮  !(??@  !(@!(? $!(!`8@b 㿐`@  @6` `   *  `'  * @Ր㿘 -$ $  J" ?`   " @ 2(* * * *( ( 0(2    0( :( ?   @  2*( ( ( (* * + 3` ` 03 *   0*:* ?  !    ustar㿘a$?N "a@!@     Ғ"? ?write_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.㿘-_)"'"+"/"$%"@ !" @Ѐ  r a@#  !`l? 8 @  ? % ۢ! 㿘" !?  &   "6 & @¯,&`d q  / 6`l j  $& `t d  (&  `|ʒ  H :  W` @&     ; 8& 0&  x:N` `1`2,``5"'.,   & `,@k,  (  &  6`,@_,  @ 69&,@  & 6 6., .&,., &,L /`  `"` &  6 6 `H@`  a"@   b  `` & `x6 a : :L /2 ,?& Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %s㾐 ` -$"P*` €_!`$%°  #a #b #b0 #bP, d#, bp%   c# b !@f  d@ x :?, /,  2  1,, @k d l   c!H ,lʘ  #Vb" @  b a:!   `d} < $  `lt 3 (  `tk * 8  `b  !!ː` X   !  W  ?       #b@C  ,H`xĝ㿘Ϟ ?  ?㿘< ?a  ?㿘a$?N "a@!@}  2?  ᇔ i"? ?㿘ߒ"  ?# `"6  `& `& &NaY   aY@, /,  , @"&`d O  /` 6 `| ᴒ `H :  A``@& `8& `0& `(.aHa)~ 6`$`t / &`$.a(a  ``l " &``x  ;@ :`,& ., &,N``7m%#,*` €  @ 6 x&     "  &6  6 L /2g &c,N` 4 `  ` `  ` & 6 aI ֔  aQє ?c , *`  ,:&N` 2 `  (` &  6 `   `"` &  6 6 `, @,&,`H@`  a"@   b  6` `x& ` a: : @@H Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00Ustar header field is too small for %s㽠`  `&`    , c&, `8 @ &`X !@'x    :,Y@%  /, @ d ?` E*`'  € 53,` ` 4 3,` , ` aI>  ? @ `2 @aQ 1    6,` ` 1 2,`,  d@ߐ` `|   %" `  0 7,`! H @" a  b  x ;@`| +   &b`x"a@ @a&` @ a!   `d  J $`l ז  A (`t Ζ  8 8  `Ŗ  2/  @ߐa В  @ؐa)! `   a!  ɬ  ?       &`@  |`c`  H /" J J/2 J" `4 ` /dev/ttywrFatal error, cannot open %s㿘'!@M  '@na!r  $!'a@fr  "a@!@ Ԑ_!`' aДa@3 ?㿘!r!'H'L'P'T'X H@@ !㿘` r!@ 2. ?@5 2* %s: 㿘'L'P'T'X L_ "a_!|` !1_!h r@ `!@< &!h_!!'c@@@@-  <%s>㿘'P'T'X P_ "a_!|` 1!_!h r@ `!@ $!h_!!'c@@ῐ@p` !'#@@᱐@ 㿘@icmpunknown protocol icmpsocketDI:LRS:c:dfh:i:l:np:qrs:T:t:vw:bad number of packets to transmit: %s%sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1sbad preload value: %sbad packet size: %spacket size too large: %sbad tos value: %sbad ttl value: %sttl value too large: %sbad maxwait value: %sunknown host: %s-f and -i options are incompatiblemallocbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %i bytes (default %i)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrom@  (// @''/ '(`@   @ _ "c,(a@[ @\v @%# @\r%_@%+rrbl Ȕ'T'`'d'h'l'p'X/9r'P'\'t'x'| 3,* @€b @ _ #c4(ba8@А  $/$ @$@\.  !(!`@1 @ `$`@s (b@Ȓ @=b 2 (bah@  / -  -  - "$b@ rⰁ =bxrb r(ba@ " bx@[  bx!(!@ @n rbȁ)=bx $X/ {%X@[ " b!(!`@ʐ @R  @& i((ba@G  _$b@ \$X( S$ O$ K$b @ r`"h(ba@! ?#@9((ba@  $b@ )'(bb@  $b@ؔ /(bb0@ !$b @Ȕ r  "(bb`@ @ (@a??c* & @ @ bxrD#cc""_#’    H`D" @@_ *-`@ђ _"(@< 2 (bx@ -` @L @ה!_#c(  r(b@ "h` _"P` @' (b@Zb  rh @ ,h`@@?c ##c`< 8 _X %X#@"#@ ,_+c@ *" "" @  (b@Z(  @?,c @   ?,c @  <` 8 X %X$ d $ d(b@ %,  @ _#X<* @ *@@ _"cXcX, `4 4 4 , ` $ , $  <` 8  (c@   '///, T @ ( 6X(@#H@Y X , ` @  X(c`@Y X , d @  X(c@Y X ,  @{   (c@Y  ',!?#h#l@b` (c@Yu @1?,#p`@Y  1?(c@Yd ! #("< '"c@YY ,# "@A  "?@4 `)`@Y ` _`_('@X)Hrbh@7 1#()hr@7h1`d@ ,"@ ,@ @2 2,@, 2 * @/  (b@Y |#'  @ ''@., 2 * +  & P  @r  ', \@pt  x ⨀ )@`'@ \@Z @ٔ _#4`_0 @@@X t(84Dd0l|㿘 "@E,b@N _c4_#@  _c @C* $#0` r @1 `" 1r"1`d@* @~$㿘! "@N $"ping: sendtoping: wrote %s %d chars, ret=%d 㿈+rbl -- r"d_ 5 `5 ", 4 5 #c`@: @   @*@_P* ,@ @졐''bl** * * * * **r"h`@_c  5 _#X`5 @5 _c,_# @q  @`6_,@#_#(,#@6  rbq @$ packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xx @ `*`@ _#a !-'!@@W0&@ #@ _0_cP   V"0  / / / / / / //?" "@ ''Вb@ ??r*`" * "* *☪ :@B:☔@vrrb " "B;br(r8r" "1r @"d:1r"d#`@`: L@[ <  _< #0`?"<'#0@K: "d@G   *@ , _#`j`rbp @ y!-'@P!@5-@4"cP`!-"  #@p  @# @4 `-@4"8r"lrh  `E- @ bh@4ΐ"@bh  7)-#-  2 @4"x @4bbh  &  ޒ`_#a  *  @&@ !-@"@4@s#+_)-  "-   - `E "-- @4w"   ` '-#-'`` ?"``* "`@     *   @ *   *  @4I@@4Bb`Ӥz    n_aȀ 'a@r '#  '-@4"ؒ S%'a$aȒ@-$a-@4 " '-#-`'3`` ?"``* "`@     *   @ *   *  @3@?@3ڐbԲ`@3Ӑ"@3ϐ"  `@3ʐ" "  5 #  a``?"`!` * $!`@T @!``  ` `? (?888* 2 --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's printing up packets!%d%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms 㿀!``"@ ` * $`@ @Q` !__#(/@33#!_#0@3. _00 @3( _ c<`0@3  8##0 "0@3 P`*` *  !0 x @L* @3``?"`` * $`@ #0__#P`[<: r@h r@a @@ @Ddr )0  #@L? @ږ#  #@@  #@ΐr  #@2  #@#\ #@&#` #@̴#d @2㿘     (   @@B: 2   B* 2`@ : b`D 8 怢`  㿘 @   _#0 @ `?Echo Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set (MTU %d) frag needed and DF set Source Route Failed Network Unknown Host Unknown Source Isolated Dest. Net Administratively Prohibited Dest. Host Administratively Prohibited Destination Net Unreachable for TOS Desination Host Unreachable for TOS Route administratively prohibited Host Precedence Violation Precedence Cutoff Dest Unreachable, Unknown Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo Request Router Discovery Advertisement (%d entries, lifetime %d seconds) Router Discovery Solicitation Time to live exceeded Frag reassembly time exceeded Time exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply (Mask 0x%08x) Unknown ICMP type: %d 㿐`ޓ*`3!l €1@1 0 `O13!,*` €1@1  01@1 01@1 01@0!0 `1@0!(01@0!P01@0!h01@0!01@0!01@0!01@0ސ!01@0ڐ!0{1@0֐"0w1@0Ґ"80s1@0ΐ"`0o1@0ʐ"0k1@0Ɛ"0gd"1@0"0a  " 11"11@0" 1@0# 1@0#   @0#H @0#p !1'#@ސ@0011@0#0M1@0#1 #@0 0D1@0#0@  2 P2@0q 02@0m 00  22 @0d x0  @0_@ 02@0Y 02@0U 02@0Q!02@0M! 02@0I!80 2 @0D!P02@0?!x 0\l|ʌʜʬʼɸ$(p̰Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x㿐3 ` *`@/!3 2` 2`  @/" 8 3?* 2` @/א"  3 "0 @/) !3'"H@@/Ɛ @ '@/` !3 @/"P`!``?"`!` * %!`@J %s (%s)㿐_#` ' @4  2!('!`@ؐ#_a@ !a!3#'@ʐ#_a@!aTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) 㿘j * `  * 4*`@ @/H P0`   * 4*`@ @/9 patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x (N@ ĠȢ̂ЈԖؘܚ4\  `D`H@ H 2#l;p4#\#`#d#h;x;#ax@R ?#" 8_ @ @ `. @ ( _#`4@.! @ 4#3@.bP`@&4@.!< @2 2 2`((  ``? usage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-w maxwait] host 㿘4c@Կ!@ 㿘@benstuvusage: %s [-benstuv] [-] [file ...] stdout㿘@ƫ5`@. /5%#)!+-1'55-9 8"P* @€ $!$` % $  $` %` %$ !`@gԒ   $ P <5!@h`@] @฀?А?* `@  `  `   @,0@~@Ԑ!` 5`@O @1 \l|ՈՔդոstdin-r%s㿘5b! "+5)5'5% b @a  #@ @O$   %@@˂ 2%6d 㿘   %$`  `` 2   ` `` `5cؐ@Ô `@2 ` `  ``` $?"``` $* $`@| $Ò``+ ``` ^?"``` ^* $`@|Ԑ ^`` I?"`` I` I{* `f`/`` M?"``` M* $`@| Mz`` -?"``` -* $`@| -"e `c\ ` ` /`` ^?"``` ^* $`@|u ^E` ?`@``? "`` *:   ` * ``? "`` ,`:   ` `* $`@|C"  ? & @1  &  @  5@NZ#  " 6 ` `@5`@N 㿘!5R b "+5)5' b @   @ #@N*$ T` %@T` @# 2buffer8Ran#`)+@d  5c@Mϐ d*$ @%c %#7a8@M %5#@@ 6@M @#@ c 4   5@MՐ# "`㿘@H@00 0ttt\pPPxxxp<` XdHd8d(d  : ;4 > ? + + + +7 + B C DHxph` XP@H@ 0 t  <  0Hinstinstance-mediaoptmediaoptmedia-link2link2-link1link1-link0link0deletetunneltunnelgiftunnel-vlandevvlandevvlanEtherIIsnap802.3802.2tr802.2nsellengthsnpaoffsetphaserangevltimepltime-tentativetentative-anycastanycastprefixlenipdstbroadcastpowersavesleep-powersavepowersave-nwkeynwkeynwidmtumetricnetmaskdelete-aliasalias-debugdebug-arparp-trailerstrailersdownupp  2 3 i@i"@"Ph & 6 7 ixi""` ' 9 i@i"P"PX )X < i@i"@"PP ,l = i@i"@"PH 0T >L0iti""hisoipxnsatalkinet6inet-a-A-ma-am-mA-Am-mextra address not accepted'%s' requires argument'%s' requires 2 arguments64encapsulation routingSIOCDIFADDRSIOCAIFADDRH@V   @`9@ax@!? 9E @@a 9 < @@a 9@@ a 9 ,"!@@a 9@@a 9 "! @@a ! ?"a `@@!@@ ?@!@@ ?` 7s)5Ь;9`L"!<@ " !<@@ 2`$$!<?`!<!X ` * &4 $ @] @_@ @!X@p  Ȑ@Q @ ?"p@"t  @ Y)59/97"h`"@@ 2  2 a " $ 9  a@ 4  +? @ ` @ ?`@` "``@ڐ ?`@ !( %!(? `@4  s8 49b@ W 4   >bD7 8bD@=3d -"P  @H  @Dbd "P  @7  @3bĖ  @Q "  9@Jb@#`bD @`@ b`@` s b 19x s9@Jib(s, @` @ b` @` 9@JWb8@ʐ 㿘#s`@?!@S"Đ @ $"Đ?$`@$`@socketSIOCGIFFLAGSSIOCGIFMETRIC㿘s`4"Ā !0;`@I !@ 6V ;@J !?"b@bĒ!@ 6 ;@J "!"!b0a~@ 6 "!P"!P getifaddrs%s: no such interface 㿐@c   ;a@I `~ !@ `@  2p@`@ - ` ` !  @͔!  `"!X!X$ $ $ $ $ $ $ ` @`  @O @` `  `y &B@@  < " ` `@ 25@` ``!<`"*@!<  9` T   @ ` `L `L` T   2 $ @  $ 2` ` ` " @` @J􀤠 ;!a@ؔ@@͐ 㿘  !x`s" " ,""D!<8  2`error in parsing address string: %ssource and destination address families do not matchinvalid sockaddrSIOCSLIFPHYADDRX   2> 2>>"("0@$0@$"8  #>@$b@ &SIOCS80211NWIDh '̠̐В   !!X/Вa@ @bĔ0$ @a怢 >@Fe#`persistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY 'Ԁ''] ? @| ?'Ԑ!'Д?"? 6"H  @|  а !'#\ ` ( N  :$ *: ?'԰  )?| ܲ'|  9|`$$? `` ?@F( 0*'| | !|''آ ` ܑ,`@""@```a@ @bĔ @]a耢??@Eΐ @SIOCG80211POWERSIOCS80211POWER㿀a@ @#b0a@A?b?@E"X0  'a@5??@E"h㿀a@ @Ȑ#b0a@!??@E"X0@z%'b a@??@E"h nwid nwkey *****%d: powersave on (%dms sleep) off!X"!X$  a@ $ $ $ $ $ $ @bİ 0a@ 2 #a`?@s#| ?`$ a` * $a`@s   ???????a@ @Y"0a@   ?a`@sh# @  " " `? "0a@??@【#l      , `"   c\  `   :"    ? @{   ?@"# /? `` ,?"```* $`@r ,@`@r``  ݢ```?"`` * $`@rd   ???a@ @"0a@ ?a`@rϐ#`?@"#0?@#ȁSGIOCGIFMEDIA%s: no link type?p!(`#  ?????a@ @bĔ0 @ޒa6   "`@c@D "!$!$ @c@@/ SIOCSIFMEDIA㿘!(`"#a$bH * !!X$a$a@ @La$b$ 0a5@ A`@C only one `media' command may be issuedmay not issue `media' after `mediaopt' commands㿘!(  AaH@ %Aap@ڐ $ `4`@,`$$only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'㿘W!(  Ab@ AbH@ a$@ "bonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'㿘%!(  Ab@y Ac@s a$@^ "bHonly one `instance' command may be issuedmust specify `media' before `instance'invalid media instance: %s㿘!(  Ac@A 'Ac@; $?# @ ` `@wא`B`@* *` $$ 0 (@ @ `  IEEE802.11FDDItokenTokenRingetherEthernet   # # # # $ x$ h$ `$ X% P% @% 8% 0& & ' ' ( ( ) ) * * + + , , , - p- h- `. P. H/ 8/ 00 0 1 1 C C D D E E F F c c d xd pe e h ` X P H @ 8DS11DS5DS2DS1FH2FH1CDDIMMFMulti-modeSMFSingle-mode16UTPUTP/16Mbit4UTPUTP/4Mbit16STPDB9/16Mbit4STPDB9/4MbitHPNA1HomePNA11000TX1000baseTX1000CX1000baseCX1000LX1000baseLX10FLFL10baseFL10STPSTP10baseSTP1000SX1000baseSX100T2100baseT2100VG100baseVG100T4100baseT4100FX100baseFX100TX100baseTX10AUIAUI10base5/AUI10base510BNCBNC10base2/BNC10base210UTPUTP10baseT/UTP10baseTnonemanualautoautoselect x p ` X P H @ 0   @ @ @ @ @ @ ` `     ibss-masteribsshostapadhocdasdual-attachALLRAllRoutesSRCRTSourceRoutingETREarlyTokenReleaseloophw-loopbackloopbackflag2flag1flag0hdxhalf-duplexfdxfull-duplexB` @2```2@C#B<`"C  @2` 2```2@C#unknown %s media subtype: %s㿘B!<@F? !D p@ strdupunknown %s media option: %s㿘@   D`@@ #?!@2 ?!D @ # @ @` C@㿘  "?` 2   @w 2   2?%s %s%smedia %smediaopt instance %d㿘`  !D"(D@D"0D"8D"@N@ѐCa  16 %? #D-D+D)?`2  @ @ 2 ` 0HbPb@@0` b@@  @@    26 `D@"`6 physical address inet%s %s --> %s xD"@// "@`a@ @bĔ0@ؒaK , @ !#\! @ڱ `D# @ʐ!#\ @ڜ D#ؒ@G   `  @   x no networkinsertedno ringactiveno carrier%s: flagsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %d mtu %d%s: no media types?mallocSIOCGIFMEDIA media: status: , unknown supported media: p Ea@@ǐ!BEE!@T!`E@"H!P`E@"X a``?"`` * $`@mH @ a@ '  ????? @#0 a6@  E"`@?퀦`@K*  Ebx@?$ a6@' 6EEb@? @k" } @;``?"``` * $`@l ``?"``` (* $`@l ( Q ``?"``` )* $`@lϐ )``?"`` * $`@l 耊 U-E@"E  @ 7   'E )*! DED @2 @2 b0Ⱈ@  ` ` @  *@`2і `E@Ґ"``?"`` * $`@lj  )   @  /E-E+E  2@ @  @b`@ $ݢ @`!< 9 @ 0 L` L!X  ,  € $ 2   inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %s㿀 bĀ    "`+;`@= #!Xa@ @I!G @ ''''@m'@1 @2"0a%@  "`1G@= P$$ $$a" 'b@ . #$ahah$ 0"$ $ a"@e? 6X "`12G$ah$ $ $ @=̐ `Xa@ @`!G p'@m2@ G@ߐ x@`0#$ahah$ 0"$ $ a#@1? 6X "`1G$ah$ $ $ @= Xa@@    '!G @l@``?"`` * "`@kD 㿘!<`€ s "`8`??` *` "`*`  inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime %s0infty vltime p bĀ    "`+I;`@<Ր    ! #\ ! @j "HD "@/H@ b@؀ H) ! @!@ @ 0H a"' ' ' ' $' (''@T  "`1" H@< 0  ?  ?//?'L !#\! @ "HD "@/H H@Œ ! @!@ @ 0H a%' ' ' ' $' (''@  !H "`1 H@ %d.%d broadcast %d.%d㿈I bĀ    "`+;`@;a !X"!X a@ $ $ $ $ $ $ $ @0a!@ 6!X " 1 /2 I ] $ " " " @;e"!X @@  ?? ` `I " @x b@ # 0a"@Ҕ 6!X "`1G& $ $ $ @;9 `!X@@_  "I "@R b@  !h I "@F ``?"`` * "`@hݐ  ns %s 㿈 bĀ    "`+;`@:ΐ !X"!X a@ $ $ $ $ $ $ $ @0a!@p aX " 1 /2 I c $ " " " @:Ґ"aX !@@` 7 !J7 !P7 7 7 @7@ސb@ .0a"@9 aX "`12G$`& & & @: `aX!@ @Ɛ  !G7  p7 7 7 7 @7@``?"`` * "`@hD 㿘s (" ( "Ā`  "`+;`@:5 !X"!X """ """"a@@p  2"b ipx %s SNAPframe %s X bĀ    "`+;`@:  !X"!X a@ $ $ $ $ $ $ $ @Q0a!@ aX " 1 /2 I  $ " " " @: "aX !@@3` / !K/  H/ / / / / / / / / @/@ b@ :0a"@h aX "`12G$`& & & @9ϐ `aX!@ @  !G/  p/ / / / / / / / / / @/@А '8b '' 8b'8'̐ ''8bK !7'ܔX''''` # " ``` "`@2```K@ `a``?"`a` * $a`@g3 SIOCGIFADDR_ISO iso %s SIOCGIFNETMASK_ISO netmask %s SIOCGIFDSTADDR_ISOh bĀ    "`+;`@9   Ȫ a@?????? @Y"0 a!@  " 1 /2 K g????@9# a@@<!L @ơ@/"0 a%@ 6!L "`1 L  ??? ?@8   0@ƃ@"@`""0 a"@l a@ "`12 L  ????@8ѐ @a@ @!G p@^@``?"`` * "`@f %s: bad value㿐s D.`  `, ,  @m @m @1 0@   #@ @à$ Lb@s 㿘s D.`  @s?   Lb@_ `, ,     @f 0$  * "@  * *%s=%o%s=%x㿘  N  M.`M X@_2M,  `@X2r a``?"``a` <* &a`@e * &a`@e >%s: %sps T.`  ?ؐ ??? 'H'a @?Ԁ  !M@ء"@판 ` "`Lb@탐  @* ? @?@       $ 4 @lZԁ㿘s T.`  @r8  Lb@X `, ,    @_ 0$ $ $ $  * "@  * *      " 2 $ " 0   8 2 `8 씂8 2  &  AppleTalk does not use netmasks%u.%u%s: illegal address㿐 "`*"``,`Nah@ߐ Na@} N` ?#@  (`Na@  4`,`%hu-%hu%s: illegal net range: %u-%u㿐 {77Nb`@N  N@ Nbh@앐 !02 2 12%s: illegal phase㿘Nc@ N *a0c@ N *a0c @m  atalk %d.%d range %d-%d phase %d AppleTalk address is not in range㿘# a0 a0 ,a0  2  4 4  N #  @t a0   8N  Nc@4 a06  6  6 Attempt to set XNS netmask will be ineffectual 㿈s d.`   ,, #@@  耦`4 4 4 4 4 4 O@4 Attempt to set IPX netmask will be ineffectual 㿈s t.`   , ,#@@ s, 逦`, , , , , , , , , , , *4 O@!X㿘s.`  @  @` `  ,,  , ,㿘@jJ"c؁negative NSEL length is absurdsetting NSEL length valid only for iso㿘@j1s "`0Ob@념 !< OR  b@y  s3* 㿘!s    usage: ifconfig [ -m ] [ -a ] [ -A ] [ interface ] [ [af] [ address [ dest_addr ] ] [ up ] [ down ] [ netmask mask ] ] [media media_type] [mediaopt media_option] [ metric n ] [ mtu n ] [ nwid netword_id ] [ tunnel srcaddress dstaddress ] [ deletetunnel ] [ vlan n vlandev interface ] [ arp | -arp ] [ -802.2 | -802.3 | -802.2tr | -snap | -EtherII ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] ifconfig [-a | -A | -am | -Am] [ af ] ifconfig -m interface [af] 㿘Oc@m!@b  vlan: %d parent interface: %s 㿀 @ibX0a: @^"?` P!P!@ SIOCGETVLANSIOCSETVLAN㿀@iJ,2 ss ""@iT !X#b0& a:@)?bPb@4j  7a9@?Pb@4_ must specify both vlan tag and device㿀s `Pc`@h @i !X%0a:$`@?Pb@45  @s`7 a9@?Pb@4$ 㿀@h !X%0a:$`@̔? Pb@4  @h a9@7?Pb@3 %dd%dh%dm%ds%lu㿘! Q@Ē!㿘@㿘 D@i`D㿘 D@c`D㿘`@ @ ` 4   ? $`$  ?㿘`@ @ ` 4?    $`$ ? 㿘`@ @ ` 4   ? `  ?㿘`@ @ ` 4?    ` ? 㿘`@ @ (`( 4   ? ,`,  ?|㿘`@ @ (`( 4?    ,`, ? i㿘`@ @00@4 2  @44@( @ `@00@4? 44@?>㿘`@ @00@4?2  @44@( @?`@00@4  44@ COLUMNS1ACFLRSTWacdfgiklmnopqrstux㿀'H@z  !'R@념! @gs"a`h @쌔 `s"! "!"9 "aи -@3G   "a'#)71/3;+s'~% GyS* D@€ '!%!$a %%!'!$j$a $a&%!'!$b% %!$%\'!А $%!'!$aU% &$a'!O% &!K% %G&! C"a ?@  =&aĠ  8" "3&aĐ /"aܐ +"Ȑ$ 'a&' ""aؐ " " "a %a "  " %a "a@RH@?~?#H*a'H`& aȀ a aᤀ  aa aa " a    aᤀ " a 2 a  a@aaԀ &!: 'aa $a R  !>  !: Q4h2l䀢 Q,b! Q&tQ#䀢 Q  !  ! QaP䀢 Q H! QcQ$!Ѐ VḀ Xa Va"! Y|"aW"ကH@fs!@_ @a JH L L L L L L L L L L L L L L L K0 L J\ L L K L L L L L K L L L L L K K K L L L L L L L L L L L L K, L J K@ L KT L L Kd L Kt Jx J J K K K K K K J L L J %s: %s: %s: directory causes a cycle%s: %sfts_read㿘!܀` U#@   @0 @Q@r !`d!Ħ` `  @L5  ":T  "N`D0B6 "5`0= . !V`6 !`3! T`@ h  T`@ p $!@@0Ā  @ 0 x@1`D0 `!T@3 `D@0 "a@ᩐ 2`8 T`@0 %u-%lu%qu'H'D`H !Ȁ` 'h!` !`H 'hH''' ''|'x't'p  'l8 D@DT@0 $ "!耢 2 LD2(!`2($ .2 (!`2( $  8'h  @`8`< (``<` 8'`  8'`08 `0`4`0!` v'!`T"`   @ϐT"` @Ȕ  ` @!ϒ `@! @^p4'p@Wt 4'ta؀  @Y`DM T"@Cx@ 4'x    @ِ    @/  @|$   @|$ `<  ؘ '|؀ `  $ @|M`-"$@Ԑ$l 'l2-8l`L'h'H 0'|#T''̢b @H@'t x''@<@ݐ' @4@Ր'T @*@ːp?!@!  "aH@㿘`8"2 @ 8`+ `  ` #   ? < R`6 !`2 `  ?! €㿘@ 㿘  "  @ `` ?"``* "`@\Ґ   2 total %lu %*u %*qd %s %*u %-*s %-*s %-*s %3d, %3d %*s%*qd xR 6`"!`!` a!V !@@ +V)<7V9V3V5V-V/V "!Ȁ`@ @ `!`Ԙ ; `8 @ 8@GC @ Đa`@ !` #\ $ , @ #`a؀ a @  `  "`2  `? 2 `@     (`0"@ @  (a@ `0!䀢`@<`0 !`@5`(0@2` @vDa  !` `  2`@``(  @*`` ?"``* "`@[ 2h 㿘!Ȁ`   !`  !`2!`ss!`*  @e&@@a֐ 㿐͒ #s aԀ@!!@*` @-ސ 0| &$a  ᐑ.`"@`2 @+@  2R 6`!`!` a!V!@Ɛ@ ʐ B7)   !` `?`$``@ !`* %!`@[Q ᐓ,  @ِ!`` ?"`!`* %!`@[0 Ĥ㿘!Ȱ `@V`!@ w!`!V?`8  ;` ; @@! @ `@]Da !` <`  @`㿘'D@vD#a`  L?`&  @  a`* $a` @ZҒ  $ !` !` L?`&  @  a`* $a` @Z  $ Ua`D;!@ِ !`  L?`&  @  a`* $a` @Z  $ 0a`a``?"``a` * $a`@Zv !`  L?`&  @  a`* $a` @Z_  $ a``?"``a` * $a`@ZI total %llu 㿐R mR 6`!`!`a!X #@y  @ z  >' 6􀥀`` ? "``* $`@Z   ٬􀥀  !` `?`$``@ `* $`@Y 2 ``?"`` * $`@Yѐ 㿘!Ȁ`   !`  !`2 `M%` E >`` ,?"```* $`@Y , `(sa `` ?"``* $`@Y  ` ?"```* $`@Yu   H ``2` ``?"`` * $`@Y] 㿘<(@- @@ I0L0@-8@8 I0D``?"``M /`F /``?"``@ |`9 |``?"``3 @`, @``?"``% =` =``?"`` %` %``?"`` *` ** "`@X  %s%s/%s ls: %s: %s -> 㷘V 6 2  Z D @$  Z D(@$@,#Z b!#Z!@~Oa0@b0, @ !@@㿘N *%#\J `*a  ?*: !``?"`` !`* #!`@X  N  usage: %s [-1ACFLRSTWacdfiklmnopqrstux] [file ...] 㿘P <Zb@!@  㿘@ $OpenBSD: sysctl.c,v 1.79 2002/02/16 21:27:38 millert Exp $vfsddbusermachdephwdebugnetfsvmkerncryptodevallowsoftusercryptosysvipc_infostackgap_randompoolmsgbufnprocsfscaleccputtynselcollforkstatnchstatscp_timemallocmsgbufsizearandomsysvshmsysvsemsysvmsgfsyncnosuidcoredumprandomusermountsominconnsomaxconnosversiontimexntptimerawpartitionmaxpartitionsdomainnameboottimesaved_idsjob_controlngroupsposix1versionprofilingfileprocvnodeclockratehostidhostnamesecurelevelargmaxmaxfilesmaxprocmaxvnodesversionosrevisionosreleaseostypeuspacemaxslpvnodeminvtextminanonminnkmempagesswapencryptuvmexppsstringsloadavgvmmeterposixkeysipencapnatmisdnpipinet6ipxrtipcntcoipxtplink_layerrouteappletalkhylinklatdec_dlidecnetibm_snaccittdatakitemcaisoxerox_nschaospupimplinkinetunixdiskcountdiskstatsdisknamespagesizeusermemphysmembyteorderncpumodelmachinetzname_maxstream_maxposix2_upeposix2_sw_devposix2_localedefposix2_fort_runposix2_fort_devposix2_char_termposix2_c_devposix2_c_bindposix2_versionre_dup_maxline_maxexpr_nest_maxcoll_weights_maxbc_string_maxbc_scale_maxbc_dim_maxbc_base_maxcs_pathkmemstatkmemnamesbucketbucketskthread_pagesrfork_pagesvfork_pagesfork_pageskthreadsrforksvforksforks2passespass2long_namesmissesfalse_hitsbad_hitsnegative_hitsgood_hitstk_cancctk_rawcctk_nouttk_ninvsyncblankled_blinkconsolepanictab_stop_widthmax_linemax_widthradixAanw㿘@ !\# n A0 w 0 "b  "b "b "b@ @#h?߀ ac* @ "`"` @H @u s Pbt @@ `0 2 @@ @@ `@ 2@ %s: name too long㻘@ 0@K$#] @(` ., @  $"+])@,`` @/ `@@'"@~``@&@must specify -w to set variablestop%s: class is not implementedsecond%s: kernel is not compiled for profiling%s = %s offrunninguse dmesg to view %suse pstat to view %s informationuse ps to view %s informationuse xntpdc to view %s informationuse vmstat to view %s information%s = %.2f %.2f %.2f can't find ps strings%p use vmstat or systat to view %s informationuse netstat to view %s informationuse nfsstat to view %s informationnfsillegal top level value: %dname %s in %s is unknown%s: illegal value: %s%s: value %s out of range%lld%s: value is not available%s: specification is incomplete%s: type is unknown to this program%s(calls = %llu total_allocated = %llu total_free = %lld elements = %lld high watermark = %lld could_free = %lld) (inuse = %ld, calls = %ld, memuse = %ldK, limblocks = %d, mapblocks = %d, maxused = %ldK, limit = %ldK, spare = %ld, sizes = (%d,%dnone)) tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s = %s%ld 0x%x %u %s: %u -> %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %s%s: = %s%hd, -> %ld%s%d %s: %d -> %s: %s -> %lld %s: %lld -> %qd %s: unknown structure returned%s: unknown type returned㺨Ȓ''$@'@ =   '#]*!u"` =]a@T @**c\'   ` ' @ `  @ߓ'' a@ ?C '@ u@+u ,   s"t]@&T!0+ ]sbt@ 0!b@ p?,  'Ȣ   ['c"X* €̒?`%Uc!*` € ''АȒ  @` ?`"`]]"@]@Z"0"`]`"@]"P]"XQ @P0ΒȖ@. '@0Ȗ@ Ѐ "$ 2'`]"``]"x`]"`]"   ߬"(ܴ ̀ `]|"̀   @b ]#@]#@#\0e)  'Ȓ  @Ś ?`U"`]]"@k]@ÿ#(0I"`]]#@_]@[#@0< ?Ȗ@*= `.]%#H̀ ) Ȓ@  Ѐ``Ԁ `fԀ c` ] "#\@XR Ȗ@ `E` `Ȗ@ ]ސ#x '1 Ȗ@`(0̀  Ȗ@dȖ@ ` `]]#@$ߒc0]#@$ڒ 0`]#@$Ҕ0 7  )$2' ""@a '@_P 'J`^  " "^ (@$0|  '^`H@ ''$'Ȕ@Җ?#`b " "^  ^  -2 ^^I P^F pD @H @$<0C5"`^]#@W^@T ^  @N ^  @H ^  @B ^  @<!^  @6! ^!8 @0 ^@-!P0F"` ]#@ ^Ȟ!Xc̖gؗ: Ԑc֐gܑ: #\:` #`#d@c )^%^ `!@ @ , `^@!^@!0ƀ"`^]#@ڒ^̐!@0"` ^!^'|"8@md|@"@0 "`!]"@  "` !]"@ @i@0^"H@ 0~  "`2^]#@^"`^Ȑ"X@^@}"P0^["`2]#@q^;`0"h;8;@;;h;p ;x;;; ;(;;#\̤ )^@JԬHH,@@" @@ , ," @4 , ," @( ,^@!"0 fb  ^`"^"^"ؐ @  "- )^%^#^, 2~2 * Ȓ `@.  +  "b@2 *`2 #  )b ^"@Q` " 1^)^%^, 2~2 *  `@.@  +  ""@Ǖ2 *`2 # ``?("`0,-"`]#@-^#%^#^ b@2``?"`` * q%`@P2 0m?`ec!*` €  "`2^]#@u^"`^Ȑ#@i^@d#0E  "`]#@X@07"`^# @M@0, "`]#@>^#0@90"`^#8@0^@#H @) 0 ^#P@".0^#p@")  h P  (  } X < ` h ~ p ~ ~T ~p  }  (  | Tkernel does contain bad dynamic port tables, cannot mix +/- with full listinvalid port, range is %d to %d㿐@< + !@6 - ]! @'" @ ?`\ c]"@c@"0s ;c%c-5c + -@` @V`~* 2 ! +ؐ "@R# *`2 >2* ,@@ $ 2 >2`*` ,@*$  ;b@! 7bJ@  @1b" @? @@Uʐ * 2 !*cbؐ "@#22*b  * @#   cb@! bJ@ b& @'㿀u  (`(@b# (  "' ' $ %''  @Y ?$$&c@confmaxtypenumsd_dir_entrysd_direct_blk_ptrssd_inode_bitmapsd_indir_blk_ptrssd_sync_limit_hitsd_ino_limit_hitsd_blk_limit_hitsd_ino_limit_pushsd_blk_limit_pushsd_worklist_pushsd_tickdelaymax_softdepsdoasyncfreedoreallocblksdoclusterwritedoclusterreadiothreadsnfsstatsvfsinitffsmountsXu  P`   ''''  @Ӛ !`*`@J' $" @W*!@>*  $"@_0 @H*!@/*  $"@P@N0n @7*  ( c@' N'u ua" 5d3d1]?'  @І   "`-/@ @ b0@@bc  ""`@W#Ȁ  ""`ԑ- ☠"@@s+b "@@"`@0  bd"c@# ""#u?`# "P"Tthirdvfs print%s has %d mounted instance%s sh "0>"ebx@6 &&  ('̐& Ж̘ @    "`-"e@"0耢"`e!`be"^" @0^!`c@ ?No variables defined for file system %s㿘"* @  @$e#@ ? e" ?@bx?b* + &&@   '?setuid㿘 eua<?!ubx@x!<  &!<*`  '?keysdeletedkeyscreatedenable㿘 euӒa\?!ubx@N!\  &!\*`  '?ipcompetheripmobileipahespgreudpegptcpipipggpigmpicmpipipsec-comp-algmtudisctimeoutmtudiscipsec-auth-algipsec-enc-algipsec-firstuseipsec-soft-firstuseipsec-soft-timeoutipsec-timeoutipsec-bytesipsec-soft-bytesipsec-allocsipsec-soft-allocsipsec-pfsipsec-invalid-lifeipsec-expire-acquireencdebugmaxqueueporthilastporthifirstportlastportfirstdirected-broadcastsourceroutettlredirectforwardingredirtimeoutrediraccepterrppslimitbmcastechomaskreplallowackonpushrstppslimitmssdfltsackidentsendspacerecvspacebaddynamicslowhzkeepintvlkeepidlekeepinittimerfc1323checksumwccpfourth level name in %s is invalid㿐@  e @R"@w͒b|0Vwbx|@H?M&@ g@!`0C3wb  '@  @D 2 &b"`?]#@?`$g#*` €"@"D "H "L"P"T"X^@ʐ"@0"\^@Đ"@? 㿘 ewcb?wbx@ޖ℀? & '?㿐@  e @R"`wEbt0Uwbxt@?L@ g@!`0C3wb  '`  @ͽ 2 &b"`?]#@c?`$h!4*` €"`"d "h "l"p"t"x^@C#0"|^@=#? .fourth level name %s in %s is invalid㻈@ ewВbl?wbxl@J? K&h@XaX ?$' &'  @H &Ű?& @  J ,"`  *J`@U  '' 5^  "  @ / "@  W@Q9&     ' $' &'  @ h&@aX @ @  J ,"`  *J`@  v'' 5^  J` ? "` @ʐ/ "@   "   "@]?05@iP h!`@j+?@ՅL`, @L` 耤L? ,  @   J ,"` @*J&  ?' %s: no variables defined for this protocolfourth㿘@ evΒb9?vbx@H.`l &v#*`  @  i@!X?@ i?a@#  & *`  '?pim6icmp6ipsec6ip6udp6tcp6rr_pruneuse_deprecatedkame_versiondefmcasthlimauto_flowlabeldad_counthdrnestlimitlog_intervalkeepfaithaccept_rtadvsourcecheck_logintsourcecheckmaxfragpacketsmrtprotoforwsrcrtmtuhlimnd6_debugmtudisc_lowatmtudisc_hiwatnd6_maxnudhintnodeinfond6_useloopbacknd6_mmaxtriesnd6_umaxtriesnd6_delaynd6_prune㿘@ exc<9?xbx<@.`g &x#D*`  @  i@O!X?@ i?a@j  & *`  '?spxnetbios㿘@ ey̒b9?ybx@F.` &y"*`  @  i@!X?@ i?a@!  & *`  '?%s: incomplete specification%s level name %s in %s is invalid㿘  h@aX  j"@ǒ? . @`" @ 2 j"Ȓ@?usage: %s %s %s %s sysctl [-n] variable ...sysctl [-n] -w variable=value ...sysctl [-n] -asysctl [-n] -A㿘jjjkkcؘ `@ʐ!@ѿ 㿘@sumo:12illegal argument to -o option%sstdin㿐@'Dk`@ P`<k@` lmm!am#``! 7k1k-m+m)k#k9k ;k o"@b "mm!a@X H aP@! @QD@MD@`?݀ ?c * @  @  `@A  @ϒ    `@ 0Ā@@ @(cksumusage: cksum [-o 1 | 2] [file ...] usage: %s [file ...] 㿘!Pk <@b k!@b0k <!@ b@  ;n C&vkkMGP&"/+Ka5 d1͆< 8OLpHEAR_[԰VRVuj6n+c gZy@}]p{zt^f͘#W`9'<݋Rd+[XF﷩`6h}/-03l ]2mp'ݰVqKI6Lδ "u=:(Fy>C͚}-4pw0Gm=K9V'#C.=* rOx ͻK} x|VqiuԍkoRlbf^FZ^[W}S`fM0cIZ-D @Ɨd 'NK`#%▒+/l6/A ]h@D+f{*uP6&;>k;qv2PUMƼ_}>1ֆոy4:Zi mY`ۀdO7z2~ɋs\wKO VKF68BG+\{Xf=U@QC]S%;!&),(^G6MB2P?v,;Zk&ˑ HVнMR#/VKm`lp+ =eh 'ޥdo#j͡`볽>~ɴ}:̣y{6`Ɵ}q[uF2 -tq0]YK.TPɶ@NEJOG +C{}!C`rFOv[h lGJa0e-$KZV^pm0=5^ [7Q3R>?:Ѐ$Ѝ V:-)Tũ&yh;+֭PlM/kv|`v#d'sĉ yྀ:gК՞}b> q 2+ߢ6hfmu{ڵ6]@?cz` 8"`  !zk #`4`0 @ * *` ,`(  $ ?@NJ 4ߤ  &zk#` 4`@3`*` * ,`+`4  8&@  8% %lu %lu %s 㿘m @S "mm @Lm@I 㿘m @@2 "mm @9m@6 㿘m @-2 "mm @&m@# ?c  ?#@`2@ 4`  ?@ 4  &@& ?c    @@`?@ 4  ?# @4`@ @4` &@&  㿘@tsetJ0 J@, @Hc\  * PJ ( P"J@"2  J` J@ @ c\ H(P* 8 @c\@ *`HP"(8"tset: 㿘!!nH'H'L'P'T'X`@@an@`@Ν 㿘na@En @rɐ@Γ write to stderr㻘 @   @??2nߐ!@-$ Ԑ@㿘!`? "`` *:  ! * #!@D Terminal type? [%s] Terminal type? 㿘! @n@B`@7 %'+n)n-n`b @5@0"8@H!@M?P 2 `2@@ @t9 2*LH `"b  2 K n x p h, `X X P H ` @ 8% 0K ( 0K ( 0K (  23040011520057600384001920096004800240018001200600300200150134.513411075500unknown baud rate %s㿘N B  n#D` ` 2  `2 o ڒ malloc><@=!:illegal -m option format: %s㿘@v@  oҐ!8` $"`" `""`o$ a@@P$  $ K$ @2$  @?ߑ* : `o#h*` € : $  4 $     $ `*:  : "o `@sE : .@u`$ ` $ , 8 $    "$ o!HN$  \ t 㿘 G  " @~ 2; `1p!*` €+ R`* @$`?R * @  R * @  R * @    R * @    `"  2  H P l TERMunknownTERMCAPTERMCAP=tset: unknown terminal type %s tset: can't initialize terminal type %s (error %d) 㿐 2pp@e!8 @  " p@N@ "p !@tp@M!H ,J /")N% @ "#N)p b!P@  b`" ⠠  ` "N @ bN ? !N    !%p#p!@`0!@a  @Jd 㿘 H @  "  `,    ,   `,    ,   `,    ,   `,    ,   `,    ,   ,  ? ?  c @ # k!, $$ $ $  @ƒ 㿘1 8J `"  ܀ "  @d 2  8 `J㿘 H `zȀ & `HȀ ,  `, `H  z`̀ & `H`̀ `  `*`H  z`Ѐ  `Ѐ `  `*HH ! H`8" " H  `8H`8 >"# H`8H*  H  H  㿘@Iz `Ā$! 8 a耢 n@鱒   8 a쀢 n@駒   8 a `̀ " f   a`?"``! * $!@A2 @ !@*# 㿘 8`b I ` E a`?"``! * $!@A  8n  `@Q `  #r!@Aw`8  @@! !!`?"``! * $!@@ڐ  %s %s isset todelete. backspace. control-%c (^%c). %c. 㿘`t` @ H  @: r!`ar!hr!p @T `r@Max0" 8`܀`` @@ `J` `r@:a0 r`@a@1 0ra@+-q-e^H-i^C-k^U㿘 >'r%r#r!rJ@ -  J 2J@( -2)   "J`J -2! J` e i k2 J` 2 J i" b k e  " @sT&  2usage: %s [-IQVrs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] 㿘s`!@Ô@ɸ  H^ bH?  bHstandard errorreseta:d:e:Ii:k:m:np:qQSrsVarpanetdialupplugboard%s Terminal type is %s. EraseKillInterrupt%s No termcap entry for %s, only terminfo.SHELLcshset noglob histchars=; setenv TERM %s; setenv TERMCAP set noglob histchars=; setenv TERM %s; unset noglob histchars; TERM=%s; TERMCAP=export TERMCAP TERM; TERM=%s; export TERMCAP; '; 㻐 H@F @= `Hs `H  t" t "` "` "`  "` "` "` "` $"`  ("`("`$@]2`*@K@s@z` z  *`      L!s`4Gt#*` €B  "so!< "sh!5)* : z-"`+  * : z$"`* : z"` "K  "sD!      @۰ @L@@` 耢??#*`& @ @5@@ &/ <%81 !R@& R` $ `h@ʙ `       `77`g@ʂ "`J t`H@\ ,  @ 8@Nt@ s! @s!a(@Ms!@ Ք s!H Д s!P ˔ O  s!`@ڒ@fs!hoAs@! "s@s?@ya  sO s!s!s"s" b8@O`!!``?"``!` '* $!`@>? '@%s"x@>!`@>!`  И И И И И И И И И И И И И И И И И h И p И И Ј И И И И И И И И И И Ϡ И И ϼ И И И И  И 4 Р И L Ϙ x Ѐ()%'&*+#   $ "!$"#%&!     tsr2  u0kbok p r3iv4jzj`% w.-/f l43n5m+, 601279:O=SW;<@?ABCDEFGH    IJKLVMNTPcQRU>8Z[\]^_`abcd1vwxPJOIQKRMHdLg*)hstuiN!\~]ye"}qAB&()C*Xe|~+,z{|DEFG@lmnoZ-S[6hg/x.'7y8TUVpWXqY9Yf{}#$:;<=>^?_5 !"#$%&'(a%#&(*  )$ '+!"$ "% !  #&tsr0123b ku  v4jzw56789:;{!"} <#=>$?%&'()@*ABC|~D+EF,G-./f0123+,456789:;<=>?@ABCDEFGH    IJKLMNOPcQRSTUVWXYZ[\]^_`abcdefHIJKLMdgN*)hijkOlmnoPpQqrRstiuvwxyez{|}~Slmnohg/TUx-.VpyWqXYZ[\]^_` !"#$%&'(a() !"#$%    '&*+  $"#%&  !hgn ijk    fl+,copqdpez{|}~mq/.rrytuvwx0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abs&5 k  j%)*./ 024361ABDEFGHIJKCN9;?TPM<>QRU@V87=XLOSY:WZ[]^_`abcd\' fe!"g*)hwstxvuz{|~}ylmno+#-( !"#$%&'(,$- i㿘     @Q& & @? @& * 㿘`|a(& 0@[ג㿘@ @L ",  "R  0! 0R z `R#z! `S !R z!0 `S#ԓ*  SVr1SVR1UltrixHPAIXBSD, , :\ :%s: sorting by term structure order %s: sorting by terminfo name order %s: sorting by C variable order %s: sorting by termcap name order %s: width = %d, tversion = %d, outform = %d 㿘z*`"Ā 5"#|bH@qא |bP@qѐ |bX@qː | b`@q | bh@q |  @qbp  "` " `I" }# .` €c̖ # #` |a| # #` |"x|"|" "aRSS||#aԖ␘"!#` #$!"  0E- 0@>z |!@ab7 z |!@Vbuuu ap  z |!@Fbwww a4z |!@7cyyy H`"# #`쀧  z |c!`c@@  P P    0  0H ? *` P? ? *` ? P~ (" ` 0A 0>`< : `"` 1 ````(& "瀢`݀ `  z 0  0 z   z0   @ 㿘!!  " $ 㿘@S`@N  ` z#@ @ !! ̒אԐ$%?%pe%? %%%%c without %%?%%; without %%?㿘~a@Sڐ    @ 2~b@Sΐ@ N +`خ 7~*`:  e"$  p ;"j  ? % 9 \  9 t   `a    9`~b *?@rc   -~  #~ ؒbD ? ؒ= 9 n  -~%~` ؒ- ? ؒ& " N ?~`P`2NNN@Mϐ INA9` `؀  *? -~3~ ؒb ? ؒ  0+~@M"8 9``-~  *?#~` ؒbڔ ? ؒ Ӕ  9 ذ ˔ N F@%s@%s#%dim=ei=%s=!!! %s WILL NOT CONVERT !!!..%s=%s=%s=meml=%smemu=%slqkxjmwuvtnbox1=x?#?'Tc*@  "@` }"!c ! ̐    " ? ܶ"P5?#7 +  ` -  +  " " $ * @ ,    (  X`  L O L T"  @@RZ @X04X    +ༀ " =  V?#+% &  ` -  &  $  "" $  * @ ,    *  X`  L O L T"  @?,  R@@R2a0@R. 4    &` -@= 2  2  &,`"  Ȁ "  @n9 2  "  a쀢 "  @n-f, 2  "!  ?# ؀!  ` -  !  & "" $$@   *  ,   2    X` L OL T"  )   Ѐ`ᰀ   ,  |@    !Ȓ਀@    !Ф ^' @?/  ,    ?  ?c@"@ a@Qh7   ^"V4 {,  RT @ק@y <  ?aؖ@QC6  c a@Q5@X @*` ,!` \L : \, ,2 @ @ ,` @ *` ,`  b@Q   @-@֐,  T@P`? b Ȁ` #   ` @@ `  ? *   &l ?#b@P  &pD?#b@P09 ;` "H?5 3?#@   `L@`  @a H " , ,"0?"0ccc7  ' T`?@ΐ@VH `9    ̐J?`  J?  ?"  ̒ J :J J  J \ ?" ` `* "?ܖ@W`́older termcapterminfo# (untranslatable capabilities removed to fit entry within %d bytes) # (sgr removed to fit entry within %d bytes) # (acsc removed to fit entry within %d bytes) # (terminfo-only capabilities suppressed to fit entry within %d bytes) warning: %s entry is %d bytes long # WARNING: this entry, %d bytes long, may core-dump %s libraries! 㿘 ` !p# @y !#   V` S@੐! Fb !bH"b @ "bH"@ #3` &`@y"8{ #!a@?ؠ"@"@`&`"" "bH`@0|a`%s%suse=tc=   ?#```  @O< ?#  @0Va` ` comparing booleans. comparing numbers. comparing strings. use㿘2`!p@03a`` 5 +  ` ,  + `"`" #`* @ +   ` X`  J OJ T"`  ` р +2`!@/a`` 7 &  ` ,  & `$``"" # `* @ +   ` X`  J OJ T"`  ` π &2` !@/a``  9!  ` ,  !`&` `$" `"#@  `*  +   ` X`  J OJ T"`   `  ̀!   㿘  ? " @^ *  @5 `"  2 D !? " @^ *  @5 `"  2 F f(? 2  `Ȁ? " "f( "  f,? 2 a쀢" a耢? 2  a? 2 "f, "! R`B?2 R`? `  ? 22`B  !  `@j `?, )  8? " @^B *  @57 `"  2 H "? @^. *  @5# ` 2 J㾘 "H?[ Y  * :     "H J` 2J *  `< !@c  H `H J@ +@   HJ `2H  ,`K@ "  "H*@   H *@  (K@  "H*@   "H*@ TERMCAPTERMPATHHOME%s/%s.termcap /usr/share/misc/termcap@x >@} L /.@t! @`"$)$@@i! "L "@8 !# a @M $@a @`$*@_$$@`O  J@  :2`*@`J@  "` :"`  $@`@ܒ`J@ 瀢 $@L  / @ԭ +?'t@t t t@_$@ : ?L 2,? t ? ?@? ?termcap names not colon terminated| %s%s:\E\040\041\054\042\047\140㿐 :@\'D 'c@ *@ 'cD)!- `@9Ӑ 2 # @N#@ 2N!``?"``!` :*#\ @ `   N  `2 oWN倢`E?#l*` €@ @ FN@  (AN@ 08!@1p"@03.2 *+ ( & # !               2`*Ԑ ے ~ݐ ?' #"L"''//aa (' ' ' ' ' ' ' ' ' $''c@M ?2$WARNING: terminal cannot %s㿐!8` z#`'"@/oLINESliCOLUMNSco㿐zc?  #@  $# $## @`h  "!@ސ#H "@/@Ȇ#P"aa # "a#`h@۔  򀢠"!@#X "@/@c#`"aa  P"akrklkukdkPkNkh@7kDhЮ '@p  1"В@H@\  ,@  ,@ @G@O  ,@  '@M "В@G@=  ,@  ,@ @GԒ@0  ,@  '@. 3"В@G@  ,@a@@G@  ,   '@ "В@G@  ,@a@@@G@` , ` '@  a@@@G@` ,@` '@  a@@@Gv@Ґ` ,@` '@В  "А@Gd@  ,@  '@Ǿ  "А@GR@  ,@ !@Ǭ'̦ "А //Ҧђ@G<@  ,  , @G/@  , aè //ђ/@G @| a ,a䀢   //@G@j , a@@@@UTERMunknowndumb:hc:hcamxndadbsgpcksketitececlear to end of linecdclear to end of screenclclear screen cmsoseusuemdmembvbbsbchohome cursor|^llmove cursor to lower left of screen alsrscroll backwards㷐@!P !X@Ÿ 4 ` `/?@Ƈ!p@.B@ƀ!x"a@{!"a@v!"a @p!"aT @ƒ! "`"``#!"a#a"` "  d"!<` '@ơ!`" ` @* (@ƕ! "`!"`@Ɗ! "`!"`!!`#z#`2  @t!$ !@o$` `!$ ` 2!$`@\!В " x`J@ 2 V!!$ x@E!!T`" | J 2 <!!$ x@+" " t`J@ 2 %""($ t@"0 " p`J@ !% p"ah "ah@"8" `2!$`@"@" `2!$ @ې"H"` 2`"`@ΐ"P"`  "`"X@" ` " "@ű"` "`!"`"h@Ŧ" 2` " "@Ŗ"` "`!"`@ŋ"p"` 2!"`@'"x "@t" "`J ""`"@e` p! pJ@ !  @  @D@C @'@r"`d"@:` p! pJ@ !! @ߒ @D@ @'@E"`l"@ `!"@ a!aȀ  " h@"`h  hJ`"!tค ฝ㿘!!`@͘$  㿘N  N@ 2Nϐ "N@  ݐ6㿘!``#!#a@j`@eaz "c㿘!`%z `#!#a@O`@Ja$㿘`d@@ 㿘`h@6㿘`l@- 㿘`p@ @! 㿘!x`@@*] 㿘 J`! @㿘`t@㿘`x@ 㿘!T``|@ 0`x@ߒ 㿘`@֒ 㿘`@͒ 㿘`@Ē 㿘`@̻ 㿘`@̲ 㿘`@̩ 㿘`@̠ 㿘`@̗ 㿘#!#` @̍@)Ӑ `@̇ 㿘`@~ Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracket㿘 ?@*?@  "!  !@v ? P0񀦠@  " 8@) 0#T   @A ?@H$?쀢 p@)ǒ seek errorread errorWaiting for data㿘  `$  2 `( @+` 2 `  ?`a(    ! `@ 2$!(` $ & & `  $ *` @ @Ҧ ? 4`2?@(?``2``{` 2` y ?@ ? `2 : !@)I g?: { ?   $` # @'   `  ?*#  ?怤  z!@)% j z#䀢   `@p ` <  B;  & !` ; 0 "@)C @  !`2?`` "` "& &" "`  ( j`  ch_ungetchar overrun㿘? !{ ?!@(͒ $ Finishing logfile㿘zc䀢 $ { #z `0?`4? "!@( !@?! @?$$cWarning: log file is incomplete㿘 `cB  gB 3` +    )'z``@2 ` "@(q    2@` @``"  2  2 㿘@ U? 4Y @ 8T  cF  3` + @ 1 @*`Ð %```42 `8,  `@?!```2 `@ `  $+   cF + 3` @* @ ( 㿘1 ` @`  :0@;? 1  2 @B?! 㿘 w   2  `@&  2` "`("`$?0?$(( 8㿘 $@ (  ?  ?`(#4`$ "`("`( "`$㿘 `( ?"`(`$$#?`     ?# $" (" $ $@ ( @ Cannot allocate %d buffers㿐!#  @6 @I   `` & @''  `2    seek error to 0㿘`  ??#:0  ?"  2"  @`   :0  :"$"(  @ ? @& 㿘 @|$  ?   " """"@" 㿘 @   # @" @  `" 㿘  @ۖ ?  㿘#z@(c  "` 8@|M ?  ??" : " : 0$ " "" " " $" (Ր  ` "`c@  ` ?""` d㿘 `  ` `` 2   2`@` `?"`  @`zc$`@ڒ 8bcccbcc18b95.bb125.bbnext8bcccbcc18b95.b128.koi8-r8bcccbcc12bc5b95.b.dos8bcccbcc18b95.33b.latin18bcccbcc18b95.basciiinvalid chardefchardef longer than 256㿘N Ѐ` : +*:  9   06,  . `0 b c`0     * N?? @% R !%@*,@@%ߒ G ,@? ` N !Ѐ@,@`@*,@invalid charset name㿘 "  N {  0 `  @[/ "   2!@%  㿘b@3 #\  `Д  J ` * "* *  *s<%X> J*J*"{J k{sd { < u{ <  <  <{  <{  < { 8LESSBINFMTLESSCHARSETLESSCHARDEF㿘@֐#@ѐ#v @ʐ#  J@  0    %cESC^%c㿘   !` !`@>J  { @ܐ  {!`@>:   8!@>3 Ȱ ȁ""L("bH"P㿘@G!Ё㿘 bL!Ѐ@J !$LJ"H@1"HL"@$"H. N 2 H@jH@LN *: @$<@ N@`H@{LH@{ `  L!Ѐ@M!Ѐ   㿘1"LJ " f"L`@$ &"L@ߐH @"H㿘"L aЀ ("LJ? "L "LJ? 0Ѐ J?   o"LJ?  㿘bLJ  "LJ@ 0 "LJ@   㿘%L!Ѐ@!bL$bLJ@|"H"@$"HN  LbL 㿘J!Ѐ`  bL4*{ `?㿘1"LJ " "L`@#x&"L@JH @"H㿘L!Ѐ@"LJ!@5"H"@$"HyN   { 㿘{ `̰ 08   ` @"   ` "0!"bLN %bL *bLuJ@@H@$H@#bL $bLN`L *㿘{` * @ؐ!Ѐ #``  @XܒЀ 2``  `$ $`$ `""``"`㿘{ { @?`D  `@ Đ`"Г*` €{@" @{R" @{"L"`@J``  "L,"LJ@  "LJ` { "LJ@  0rL a{" @  K? "L "LaJ? "LaЀ U J? %  "L(K J? E {" @@{L" @J@  "LJ@  0/{" @, {" @'{" @"{G" @{*" @{l" @ "bP{" @  @ {" @  Z Z4 XX Xl Y X Z Z\ Y Y ZH Zp Z Z Z Z Z Z Z㿘!@ uK!"H_@ݤ"H  $"H@ѐH "@|$H0G@ɐL  , L? : L* $LLJ?`%?0L@a@@ @H$@@ H@VG 0@! L H@ ӢH@ 㿘 *`:   (L   㿘bLJ   ! "L"LJ@  !@ "LaЀ  J " "L!Ѐ@  N?   ? N? 2?㿘%T @$T 'X`""\@ !"L " "L"@$S$X"L @@ *@"L$T*@?㿘   1 "@"d@"d㿘{ @` !"T`2  ""`"d@N$`@ Ґ"b` "`ː$"`%L b\  "L"\@` bX$`@9 $`@d 㿘bP "bP@<      㿘@!Ր!Ё㿘@ @H@"H!㿘@ u㿘O""GԀ @ @*!/?㿘b؀    ("b"؀!!@"؀ !H"؀ @!P"؀ !X{!`{`T!done|done㿘bԒ`*e#*` €"@:0YL@!zL@ +"` "`#Ѐ "L@@L@ D$#@$#"!L"@q8,""ܔ L`WL@00"ܔ L@PL`0)@0&L@ ! !{ @@ =$  @t" @p"(@ K 0 Jb@ݒ"0@ B  b| c c c cP b c c c c b| c c c c c c c c c c c c\ c c c c c c c c c4 c c c c c c c c c c b㿐"Ԁ`/#*` €?Ѐ v@  dr "b$ ! d!L `J"  + -X + -! " "b "b䀢 ,b@  Lb"@b P Lb + -1,b@  -/// / 8   *  @ !0 0 @! bذ  "b0  M   ?݀    ̰  e f f f f f8 d f f f f f f f f f8 f f f f f f e f f f f f f f f f f f f f f f f f f f f f f f f e[Press 'h' for instructions.] [Press space to continue, 'q' to quit.]㿘{ `"p@Z@ _    ?    @   @  ؀`!!| @/$!|$!|!` ! ` z@ )cԀ a E!!  T@#X$!@#' @i :0C@{!`@t#Aless version %s㿐}`'!@Ò㿘{`"p@"J" @ "Ԁ   g   0 @(ungetcc overflow㿘!{  "p$  "Ԁ@ "@   * $ 㿘@? Lݠ?:LPattern not found㿘 bz#Ԁa `@ @ 0bؠ  >$b%@Ɛ  @ؐ  ` ؔ@%  b؀ 逊 `#X@*  @ 튐 :%s helpExamine: -Cannot edit standard inputCannot edit file processed with LESSOPEN(N-th) No %snext fileNo %sprevious fileNo such file_+mark: goto mark: |mark: Brackets: 㿈a 2  :    ""@+%3)1Z%b!$܀  .b@&!`#?! ! bԀ "/  bԀ "/[  '/'@D쀢 ` ``c/#*` €` l !܀`"!l܀ @Q$Uܒ @ ] 0܀`"!l܀ @>$Bܒ @  0}܀  $6=܀  $-?܀  $$+ ܀  $, @ !  " "a   @  !  A$!܀ 4%@@ @  05܀ 4%@@ @ K 0* @@ p܀  $@ ՞H܀ &$܀ d d$@ 0܀ @ ܀ &$ :@ 1\0@ 'Ő  ܒ  $$ܐ `$ؐ $ ܐ $؀` $& 0؀ ؐ ?  ? " ؀ ؐ ?  ? "@ܐ $؀` $[ $@!:L!`x0@ F@  0{ h`D 0!z@ #@Q` 2{[ "4`T 'a,@  @J@#Ԁ ]댐 0Y܀  $@܀ P!`! `w ܀ $!" '!܀  $@܀ 0܀ !" '!@0"܀  $@܀ !0@ݒ 0` /֔  $"ba@ ͐  a !L b @ 0aH  0{ |aP 0aP  a !L ؀ ր @0aX  a !L   @0ah z %a !L    .@m { |*aP] %0apW 0bԀ  aN m0!  |"a p o q rp o0 u w s v q0 o o` p rP q qd v s tt q w t rH qT v8 v r p, pT r8 s oL o w w v uP s w w w r r r s u w w p| q w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w m㿘{ @)!L{!@= C@O㿘  @p  @&""" ?Warning: some commands disabled㿘{"$ߔ "@ Warning: some edit commands disabled㿘{"(ǔ "h@ @ 4J@K)`J@ g`"#!" ?J`g2J@ fJ@`J@`J@2``@ И  d㿘 d     d"㿘{b$㿘{b(H"H("@㿘@J J ?l 㿐@N E26?N n22?N d2.? ' J `e'`x`c0 0ĐC S'@"?  㿘@zi H @~  @o    @ ?  @@)?@@ݐ< "N@? N  M N  +N  Glz .lessCannot use lesskey file "%s"㿐@:"   "'@t@x! I !L C `` ܲ` `$--,   ` 6 d` "  d   d  d ܀  M`0 㿘z@&@@  & N@ ".@ `@*N@㿘`@s@ @   N@ "`@  `2 @ J"?8J?   ?J?8?㿈zcԀ " @耢?쀢?@;@L#{b4 " $@)b@@b4$b4$ԁ㿘 z#@ 0 @-%s"%s" may be a binary file. See it anyway? 㿈z#Ԁ cԀ  " @'@   S b@M {"0 H'@Ӑ '"@U@쀤`@@@cr @xҒ  '@'"@8@s䀤`!p`@ @w "'@w쀢 y Y@FȀ`z"#{""4"b@%cc@` "0fz#쀢`#a z@ z#Ѐ !zy#܀@\`?a `$#@@ @  !`'"@֒ 㿈#zcԒ  @Ő    @+#Ԧ @ # @ #Ԁ     㿘z"#@  㿘z"#@ 㿘z#Ԁ`  @? ` 㿘z#Ԁ`  @?Ґ ` 㿘 @~ "  @Missing filename ("less -\?" for help)㿘{@b0 " #@/ 旐 "㿘0@?@Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"㿐 H@w~ @ z#耢` O '@5!? 0$* "X@€!@玐z"c @w\ !z$#  @ ?#䀢 @#? $#"  @  א?#䀢 '!@   P                              P            %s/%s㿘 % L@ !@ݐ@ڐ @l   c @/@v @ @yHOME㿘@ߐ#В  LESSHELP/home/dest-sparc/usr/share/misc/more.help㿘@Đ   `㿘L@ # @'z%z*`:  # %2 Ԁ 0 ؀ C4@x`@r`L@  @ E L@  @1z'z*`:  # %2,#@W`@.@N `L@  @,%s*㿘@=  @/a@@K@ @ @X !  @ݖ ?2    @ @  u @   㿘  @ ??? 㿘 dŒ  d@ ,,乐@.{@@Ԑ, ? $@aA  $` ݒ$,SHELL%s -c "%s"r㿘@`@" @  @.x@#ذ N c@@ g c@._@Lc@@Decho %s㿘  |@N`@(0@%LESSOPEN-㿐?@t!h " !x@JT ". L |    `T @   @ߐ O&&@ 2@АN@` LESSCLOSE㿘"@@/"x P@8@u. @)'!p`# < @   @ 㿐 @-{b8@ @א 㱐 @-s{bH@38@֒ Đ 㿘!x`cm㿘!`!`@??  @ a  "a 㿘a @<"a...skipping... 㿘    a?4 !  a?   F){!|`a?Aa|@   "` Ͷ 0){@G? @ @ '@ @\a|  '7?"` '@J '-?@C &"` 3?a| a|  {"` a|{"`a|  "aa| @x? ` ͢ @?Ǣ Ő¤ @ߐ ?ᄀ "!  !`a  "a  %"`"%"`@i%"`@ ?㿘@   a? "! @`"@? @1? `@)@ܐ?㿘!`! ` s  EW 0A@d??5 3` ! @ )!`@   @E     @=??  ra   "a  㿘@! ?  `@?@PUt  | #?Cannot find help file-%s -m -H -+E -+s '-PmHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when done ' %sEnd of help㿘+ #@O 0@#@a ᔐ a@+c@y@[ #@4 @o{h   " 2 㿘`2@{"h@ && @" `&@& {b "b㿘 ?" "{b?"b㿘 (E 0& ??> & ʐ㿘 !z#Ԁ@#$#Ӑ@ @ {hh  {h h 㿘 2  {㿘{"h"h "   @G$ 22  㿘  "   @: `:  :@ :` "   " 㿘?%!<`{"*` : @ F @>  @@? @?Z? +# (#B? @ !`! ?  B? a ̀ ?u!  @` 0a l  ?W 㿘 `!<`{"*` :  @ @ f   @xF? q `'-0.QO  -% ZB  ?-0N `B   D, ? 9 2 @Ǩ@Ғ-/B? @   2" @Ð D@? @? ?D  @Cannot seek to end of file㿘S #@4 0I?   !  @”0!  @Cannot seek to beginning of fileCannot seek to line number %d㿐@x?  箒  !\@0(  T@\ @ 0' @ݒ㿈@,@@rDetermining length of fileDon't know length of file㿘?  !@ ?  !@ 0> @T @Rd d   2@ 8D?!\ @ 㿘9  ?  @Cannot seek to that file position㿘@А@l & @ΐ?   ?@Ɛ   g  #H@< 0}@  @??   @ @8;'+a@8 "?   0N#? ހ@a"a ""ؚ%?  0/+4 @  0a? h? 瀤@" ؐ@a?   "#"c"* %6d㿘!Ѐ`B@q1"!!pb@@'"@ b   "b"b * ?`#b!  #!!!pb1 !""&" , , @y$" """#      0   0  d      0   0  `㿘 &? ! "`  "J ` `"`"J 㿘""J p#"J !""@$"㿘`B @7 2 !X`@@@ 4J "# B %#`?pJ ` bN `Y   ?." `5bJ   `2 bT  ?&b* p*  &㿘J# ` #  @ ",    !؀`, :# @㿘#c /!"!pJ . :`@$c  _ _   ) U G  " $" $ !؀     0|8y  * r l"`k   f$ca   $a!1    N"`$""@xga  J ֐ 7!X`ɖ֐{`<{@K@@@@4' N "!*: і "  $"N`   b "b 㿘J# ` `  2 #  2 b!` !` !X` ap + *"ap*@*~ "@P@H H H "@p   㿘??  ?? ?!p, `   !o B?,ap&㿘 42 ?`㿐F? ??  !p?<,, ?8?]`B 2&@   #@& c   8#c  8"& 8  @ b ; 㿘##Oc  4 #8 8 #8  @5##8!"!"`:`"@"`$  &@ #cc  `   4 2  8` 2 #a " "@Calculating line numbers㿘#@  { "b㿘!!   d$!@ $!` ?$!㿘!Ѐ`?   2 `# ### 4 @8 x@ u@ # "a   b@ f 46 4 2Y "! 8 ?"E @{""421@.0+m 2( "!  ? T@{""ې㿘` a ##  & R @ #"     "@$@ !   25? 6 % & ? "!?"  2?  %(  ??? ?q㿘@  ? ? ?a  @ ?   !& ?Ò@"?! /dev/ttySHELL%s -c "%s"sh㿘N -  (@ t!8@ r@ o!@z#C ެ@ 8S @ @ @ !H@jK 6@x@N!X  L@  N @@  a`@"  N 2!p@u@@ @C@@n  D "` ِ @M 㿘@͐ 7?@ א ?   @ ̐? .   4 ??   @Cannot seek to start positionwCannot create pipe㿘ƒ   X`x@  @  {?M@!8@@!@հ?@a| @ސ  @  `E 4' @# L?  ?` $  @ . :    * $@Ӏ #?!'? ?` $  @ . :    * $@߀ @ @] @  V  " @f А?? 38"??: Invalid mark letter㿘? . 1*  ? #(@^  . 1* "Cannot seek to end of fileMark not set㿘 '"3 . $0.! ^+z#԰  > & 3"G )#z԰a> & #az> & ""  ?  ?#@  㿘`?㿈  @ Bz> &> 㿈@ 6耢?z쀢? z#"#";`;`㿈 &bz ?2  ?2  c!\"b  ; #  ? ?cԀ@"" EMark not in current file㿘T  z#@ "h@ ??Input is not a pipeLog file is already in useNo log fileLog file "%s"㿐 %z  z0-0*)"# "z#䀢`"ֲQzY"޻<#䀢`z#@C 0#'# @<㿘z "cÒLine number is required after -l㿐  l'@d 2`  8@ 0{"b藐Cannot use lesskey file "%s"㿐  # ' @㿘  0){'""H@`!܀`z#: @?   H  6 0!\ e Tags file "%s"㿐 }  "" 0}"` '!@/㿘  { ""$!"h%s㿐 )  "N@0,+N@ M" m = ! !  `!$`} `!@ժ &a!* '"@`㿘   !%!$!㿘   @ 㿘   t բ Use "h" for help㿘!`    @" 0լ ؤ@f z"c} l4There is no %s flag ("less -\?" for help)㿐 'D" " J@ € $$⨀  DJ ?`0+'D#\*` €DJ@ +`?`f`d'D{ D"J + 'Dz"cI D@O'DD z?'D@ 2  @' @    "`   `, # D&     `?"N   @[`? J@  @'DD@  "@  €DJ`2J @                       @    @       ͸  ͐   There is no %s flagCannot change the %s flagCannot query the %s flagCan't use "-+" or "--" for a string flagCan't use "--" for a numeric flag㿐'H@f @'  ` @ @ڐ'  82 ! @ΐ' X@0   HJ`"  ` @ h "m``  "&   a`> 5[`"Q` "` R`" `N` `?H"` `?C"@":` "N@;`" N@7`` @`@b`?` )"@4(`$ x"`  ``H@ 2 ``  "`"@ @c 05`  €H`  @ `  "`   ``  *@> '@7``  "`؁` @  ` -%s㿘!#"`x @b㿘@n    S@ 㿘@b  ` 2`@ String is required after %s㿐͐'!(@㿘"J@㿘N = $2``*@J@  @ Number is required after %s㿐 L -2    ?А  &%?'!@  А  * .  @*`: В@ Ѐ$&`2 Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminalTab stops every %d spacesTab stops: Display ~ for lines after end-of-fileDisplay nothing for lines after end-of-filePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modetags file: tag: Chop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters as ^XDisplay control characters directlyNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Log file: log file: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileBe helpful in promptsBe less helpful in promptsRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffers%d buffersBuffers: Search skips displayed screenSearch includes displayed screen{H  "    J2 {H⸒J   ( P  J򀠀  㿘'D'H'L@U2" @! $ D?H@|L $ " @J ?㿘"@U 㿐@.%s: %s㿘 b@ ߤ@Ő@ Л c@#?㿘!|##`@ # @C d<## . `@   d@C . 6` .`@B2`* @ *`B2*@ *@C 㿐!` m"`ؠ  M>    0  h v քJ       @ N \"  `r@9D 2   0  0 *:㿘%| "آ@z#܀`  @{ڔ "`$ 㿘!|# "؀@ a4 # չ"a4# * $# 㿘N  * : N`㿈6 2 @k 0,@wВ   -, $?L?㿘N) *`:  % `N d  s2N@L`  *`:  L`  N@ `@N 㿘!#zcܒ`"! FY c܀`q 0'|#(Q! @ 6@  q B   ?<!  "`2㿘  |T#@!! "a4㿘!z#܀ q@ #܀   0 ԣ! @  "`؀6???? |`| 08|`* 㿘7ᔴ  |c`.8ᔴc`#`(8  |c`* 8#`8! @ |??c`*`:!`@c`㿈ᔢ b؀$ |c`  @c@J#`a???aU a$#`$耢?쀢?#`*  :?|`4 ?   6?|`42 ( ?㿘! @  |`*     @ |` 2`"``"@??: ᔐ $ ᔀ6?㿘|;#h!$!|!͸#$ |ʹ#$ }Ͱ X}"`#H c܆"cH c܁%qd㿘cܔc@%d㿘cܔ@c㿘cڔ"qܐ ?( ܝ㿘? ? ?a  ?   a& ?g -㿘?. > `6U"`*` €#b@ J@ 7 C! z]c@3f`88!!Ѐ`3 6!?&  $* 0(&!0? ! 4 `  ?2    zcԀ@    T T T T T T T T T T T T T T T T T T T T T T T T T T T T T  8 T T H T T T T T T t T T T  T T T T <㿘?`6!l*` €4? V0ta0pzhczc& Aբ B 8 4`2  -?0LߞՆ ? 4ڐȞr   0$О"@ J  cܐ? "cJ? c0 zcԀ ` d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d 8 d d H d d d d d 4  J:" ?." \ J2 02 0?㿘N l"   p b" 0"! ?* : `2#*` €&@?&@? &@? &@a\&@&@? P p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p D p p p p p p p \ p p 8 p p p p p p 0㿐""N` 1T PN :( ? %' .2c* \c* ($cܰ c*@`!$cܰ N n 2 E N ?Zs N Ā :ܖ@ "!0  `*@ܐ@ "㿘}` 㿘!!`"@*"@  J@ @&    #\`H* *` @2* (**`J@ @*J \   J  }Ȁ@ 㿘# `4 %#!h`*%#a ?# Ȑ    @  ˒N/a?%#No previous regular expression㿘  H 0  `?"Invalid pattern㿘 X @~ݔ  1}@}<   ? Ȁ "& @& Ȱ 㿘!} Ȁ "$ @$ ȁ㿈}`Ƞ @v˜ `? &@ & 㿘} "?@} ??:$`:<- }2' }"" 42 2" 4 2 ( 2 㿘`@@ 2 ` @` ` 42` " `4 >`2`` 8>``>` ` @ 4 >`2`` 8>``>```@4 `` @8@|t0&@#㿐    6    >    2 J@ 2J@> J@ `'@`J`C '`JC `Ҁ J ̀ 㿀'PD'T A'PT  , PT "@@ 8 F :`@ F :`:`HT(N  P۔T P!؀`` 1}@'& `2@㿘#`!D"c㿈耢?쀢? ? @g 㿘!<"c㿘   ( ?"  wѻ!H`  ? a\   㿈\`/ἀ ? 4 2(<y  Δ   ?  !Ѐ??<S!Ѐ` @, $8#`؀  ؀ @ "0쒏 @ 2 `  "ἀ  Ἲ`!<` 쀥2= Nothing to search㿈`N@ , 2R H!<`% !< 3c "5&c&c1&caD  Ȕ h O? "#D "#D"#!<` "#!< ߐ???2 #\`%"X@  ?#\#`??  !<  Đ 0 !\!<    㿈#c #? 耢`?#??" #@ #`@##? @?{?O*  ; B?D #?#?? #2` ({*  ; B  ??耢 #`{*` :  b@*   * @ :`@ f #?D{b:  2 #@b  #: @ c @? @ 2#=(=#\#`  @? @4 2=(===#㿘c@{  ` "㿘’`,@z ` "㿘’`p@z ` "㿘  c@zՐ ’`,@zѐ ’`p@z͐ 0 @zʐ  @zǐ  @zĒ Line numbers turned off㿘! Q ""! @z 3 Oj  @z  @z @z@z ’`,@z Z ˖ "`؀ #%aHa  2  :  "@"؀ {b Ѐ "b "`"А!  tagsrNo tags fileNo such tag in tags file㿐}`@b "} {"!@{)f-@.v 2aL  2[ "`Ȥ @%!ž"̒'J@ K %!ܔ'J   *` ť''J`3 `)$$J@`'J@ ^`'%`J \`'  *'J@  2J@J $"*@>E0 @w @>:" %!܁Tag not found㿐 ̀ "  e5 ! ?/?곒   /-+ἀ 鍔   Ѐ"À `@{6@-Ē ἁ/dev/tty㿘Ò @VB" "`А "`Ё㿐# `В ? ?O O "/ `㿘@  ` P H @ 8 0 (             @       @ noacnfsv2porttcpsoftresvportmntudprdirplusnfsv3intrdumbtimerconnbgupdateforceunionrdonlysuidexecdevautorwrogroupquotauserquota23a:bcdD:g:I:iL:lo:PpqR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -a value -- %sillegal -D value -- %sillegal -I value -- %sillegal -L value -- %sconflicting version optionsport=illegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %snfs%s: Filesystem not supported by kernel%s0@7*! #$"}a''@y3 X+})}! '}7}5};y9Ā FtƑ* @€a  Ēa@vm g%!! "`Ēa@vc   =%aZ$`"@1 J@ Ā6`"a@vL @$`8C$` ?$` ;$`"@ J@ Ā4`"a@v- @$`@$$``( $`"@ J@ Ā4`"a@v @$`( $`` @$`"@ܔ J@ Ā4`"b@u @$`<$``@ $`Ò"@n` $耊`` $` `($` ` @$`  a  Ēb @u %!@ ! "`Ēb @u   =%a$` @@` $` 2&(` $`@  $` &@ "@ b@@3 }2a @ ` $`$`H$`L$`P$`T{'"@R J@ Ā"bH@um g"""@> J@ Ā4`"b`@uY $`$ Q$`` M$`  $` H&"@ J@ Ā4`"bx@u: $`, 2$`"@  J@ Ā4`"b@u$ $`  $`"@ J@ Ā4`"b@u $`0 $`&@s@A:!p??c* & @ @c@@` 2@vp b@t  "`-ĒbȔ@tܐ b@ @vY  | 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 T 0 0 0 0  0 0 , 0 0 0 8 0 T 0  ( 0 0 0 0 0 0 0 0 0 0 0  4 D  0 0 0 0  0 0  0 0  0 0    0 0 x no : or @ speccan't resolve address for host %sNFS PortmapCannot MNT PRCMNT RPCbad MNT RPCnqnfs 2/can't access %s: %sh?' [@"H@ @ @ : @# !*@[ }@ 2Ɛ#H@s @v }!` ' ` Ԑ =$&`'   'ش ";' `'a7-a+} a9}!  o-` 5`   ؐ@,`  }a耊 2v@֐#pq!2`''` 2  ܘ @m  ''@ܠ  a耊 2L@#G@>$ $''$'' #\`@Ș`  " a؀ }!`wƒc@a@B "a耊 2ƒc@@ǐ"  @ @$? #$!}!耊  ?@ $!耢  ?ƒc@I @t @ @ly @lw @lu @ސ#!`$!@[/ < L}aa}!耊` @tː ""!Ơ#@ @} !2  &`&`&` H&`D&` 㿘'HH@!j$㿐@ J @ "`E    >  &` `@  6@]` "1 `  ?+@ ` &@N ! @@D `@"` `2  ` P`  P&@ usage: mount_nfs %s %s %s %s [-23PTUbcdilqs] [-a maxreadahead] [-D deadthresh] [-I readdirsize] [-g maxgroups] [-L leaseterm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node㿘Ȓb(`"b@A!@t ,-o %s: option not supported㿘@s  @R ;'Ȁ n L  o  @ = 2*`"@ 2  }  @2   "*@ ""(`2 ȒcH@r8  @8֒@ 2L@rV㿘@ DEFRHLPXabce:f:hilnqsvwxz㿘@2 P <Jbt e l f"i hɀ`6bʐ p*`  ["cY`W`}bl R"bl}bl M"bl}bl H"bl "bB}bl @="bl 9"b 5"c$ @"1 "@ + &"c$`  "c "c  "b "b "b  "c "b "b@ɔ@=ْ?2? ` !@# #* @  #@s  @# 2 !#* @@# $## " @r # !#@x&# @    # 2 "b *#@ "  `"耢 @rÐ @r @r @r  %D %T %\ & %d & & & %x & & & % & % & & & & & % & & & & & & & & & % % & % & & & &( & & &0 & &@ & & &P & &` & & &p & & & &usage: %s [-E|-F] [-abchilnqsvwx] [-RXH[-L|-P]] {patt | -e patt | -f patt_file} [files] 㿘P <aP@?m!@rb arg_patt("%s") adding pattern "", length %lu too many, exiting ... 㿐% ʐ!a@?K@t '@Y 0*# !ʒa@?7 @;:b@?-# $ ʐ@?$b@r @5 @ 㿘 @"""!"Ԁ "" @t$  "&@""@"$""&@$"ԁmallocrealloc㿘`ؒ`""# # 7"cc @pF $c ʒc@ "#}p# *`"p @pt*` $c ʒc@  @p)` ʒc@ @k+,c *`"`"r㿐˒a@" @ @ J? '* @ @6㿘#  @o,  ʒc@Ð @,`@@q "`@ `@ %s㿘 @Y6 @oǢ ʒc@ @Y)˒b@o 㿘   @V`fts_open%s: %s%s 㿘}"l@i * ˒b@q  #  # 2 `!@ `"Ȕ@oz # "``@"`@@j^ 2`8(standard input)%s:%d:%lu:%d 㿀   ˦!c˒a@] " ː"@K "bݰ # `  Y  ?  ?? @h b 2B"쀢 쀒@29 ? 21 2-. # $耒 @ ?#\@  2`_"  "  @ #\@  2`_"  4# 6 "耢 1#$ ("䀢  # ː#@# ː#@" ː#@ߒ`@99 @@b䢒 g` @ ː"@ -"b"耢 )#$  "䀢 ː#@ː#@ # !`@ɒ" @n< @n8 !@4{㿘@㿘@.?͒`@ѐ `@j@ N ( /@`` /?"```* "`@ /`` ?"``* "`@ @o Հ ` N 2 ?N /"? .@?*N /2?  @qU@qR@ "@![ ".@Vt@oj usage: basename string [suffix] 㿘͒a@X%s: not currently mounted%s: not a directory or special device%s: unmount from %s %sCannot MNT PRCBad MNT RPCx@X? @KV h< @   @ٔh  hΐ!)@ΐ!#h @ǒ  2! @   @ 2 @  Β!@ 2@ Ͱ bX@"g  !@ @  ,@K @,@ :  @@, :, @! #4`ΐ!В@#0`2f !#<@i ΐ!@LY "X@"(  2S O#<@L ,  ? ?/7  @g- ?`'\'`'ab''d @+\ @!( @7,$ '`'x'|'d #\@!  ΐ@גb   @ @ getmntinfo㿐@A!   @!7 @64  ``@4 ` `D@nf  T2`@ T 2` `D@nP  @Ҡ! 㿘}#Ԁ  c(`?  #@!w    2c(@ empty type list㿘 N  nϒc`@kl  N  o "c( "#( %}  @ , ` @kR*  $Ԑ @, $@ , `$@  @ , 2*@, $@㿘 #8 "- @ "( @Ӓ . " *#8@ 2  @ " @ . "  *#8@   #8 㿘'HH@A$usage: %s %s umount [-fv] [-t fstypelist] special | nodeumount -a[fv] [-h host] [-t fstypelist]㿘Вa`x@9b!@lW 㿘@Grsh8KLdel:nwrlogin/usr/bin/rloginrsh: can't exec %s. rsh: must be setuid root. rsh: unknown user id. shelltcprsh: shell/tcp: unknown service. RSHrsh: can't establish stderr. rsh: setsockopt: %s. rsh: fork: %s. 㿀@+ @ ''@  /       @Вb @ " ' ,` `J@ -",`' `?ѐ#*`    " @},`В@ (@6&??!#  $#*@$#`'@d#* @ А"8&@@!@}̠"@@@}@А!bP@8@k @y@ А!@8bh@k @v@|  А!@8b@k "@@ݐА"@b 2 А!@8zb@ko @}v" )@#\@Ik#@ #@@k_   А!@8`b@kU *'? @   #@ "!#Р!@3c@8G#@ @    ! "#Р!@ c@84@}J@}P '@k  @kO  Ӓ`@kI  @kF  Ӓ`@k@  @k=  Ӓ`@k7 `2@ 6 "!#Р!@c@7@j ! #@"~@l"~@l@O`@k  D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D C D D D D D D D C D D D D D D D D D D Drsh: select: %s. 8 PN @b#@ "" @b:$ <  @l 6* @ *@$@  @ Q 6@ " "!#Ҡ!@P`@7d@jY : ؐ@b & Ĥ΢" #ɐ@ @jB  @j ؒ  @k̐#@ 2 * +@6$ * +  $ ؒ@kJ '@     @  @ " "K6@Ґ!@7`@j 2*  :  5 &@a$  #@ 2`*@ `* *&@ @a 6* : % $@a$   #  @**@&@@a 6* : @2 *` :@`؁㿐! "/#@@ai $"rsh: %s. 㿘@   @@kt `@`@h !#Ӡ!`@{ @6@i @ @@@@L 2 `  , `@ 2@usage: rsh [-nd%s]%s[-l login] host [command] 㿘Ӓa@6W!@iL 㿘@mkfifom:invalid file mode.㿘@(H ӒbP@5 P`<@bX`? ' %+ m@ 2Ӓbh@g @!@g@@3`?倢 ?c* @ @&@ڐ `  `J`p   &``@ǐ`"!@ - @2@h@%2@hnode must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%s㿐`J c b `@g  `@$ `@"J@ Ԓ`(@g ` @ ` @"J@ Ԓ`H@f ? *# 2* @ ? 2`  ", Ԓ`h@f @@2` @`@  㿘@  .!@@@œ6 6`@@א  `@ usage: %s [-m mode] fifoname ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p 㿘  #PP <!@5$bP0 !!`<Ԓbx@5`<@5b@h  㿘@;hms:r:t:/dev/%s%sopen: %stcsetattrTIOCSDTRTIOCSETD%sslip.%s.pid/var/run/w%d Failed to create pid file %s: %munable to delete pid file: %m`@&#'~)~!+-Ȁ`5Ր#*` €@@,@ @b $ @b%!@@2Z#P??c* & @ @ @`@   !#PԘh@D @D|  6kԒcp@ڐ  '/'''/@@@6  Ԓc@Ő `y@iy  Ԓc@ `@in!Ԁ Ԓc@ @f Y!֠ `@g} @gz @gh%"cH @iN@ /'1)N@ /`4N@ /"`@ H$@D\  @h@诐  &#LcH@4 c@+#L 'Ԓc@ ,H'@P#p`LH H@m"   "`Ւ`@  T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T Tp T T T T T| T T T T T T T  pslipstrip㿘֒`x@   @`  @usage: slattach [-t ldisc] [-hm] [-s baudrate] ttyname 㿘֒`@3!@f 㿘@o_block_size_block_count_block_tableusage: installboot [-n] [-v] [-h] [-s isofsblk -e isofseblk] [-a ] 㿘֒a@3a!@fV a:vnhs:e:sysctlSUN-4sun4csun4boot: %s proto: %s device: %s architecture: %s sun4mUnsupported architectureopen: %sproto bootblocks too biglseek bootstrapwrite bootstrap㿈@%)!+7)#%5-'/%耢` א"*` € "$  %` &【 %#| @b~ "b @b~"b @0b?ؒ?& ~* @&x %   `%$$#   '''  @^ ?֒b@   ֐b @  "0֐"($ #| x@U"8 @Q"H$@M"X @I"h @0 %` @wb(  @qb ֐ %`b@c  @ƒ $@ev  @Bj x$b@Ȑ @ڒ @ed @\ `2"@$֒b@cҐ  @BI $b@  "@\ 2րb֒b@ @p@\耢 ֒b@ @\ [P [ [ [ [ [ [ [` [ [ [ [ [ [l [ [ [ [ [ [ [ [xnlist: %s: symbols not foundnlist: %s: wrong typefstat: %smalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x %s: a.out header %s left onstripped offproto bootblock size %ld room for %d filesystem blocks at %#x 8~!ؤ@В א#     "   א#(@R 0@A ֐"@ @fr א#@@0HȚaB + cB + 3`  *`  @6  א#P@'01@\: Ȁ̀ג@#h0@[`      a,c?   ?# ! ? ?#   F?2B  ?  ?# !  ?0@! *? ?c@  ̀@ ?@ ̐ ? ?c@ ! @  @!   #?9 ?  ?# !  ?/@! (? ?c@  ̀@ ?@ ̐ ? ?c@ ! @   @!  2 ? ?# !??? ?c@ ! @ ?%" @!  ?" "  ?c@ ! @  @!  #? "? ?c@ ! @  " @! @" "      @ # " "cג#x`ג # ג #@@aߐ@Z̐3 c|"  @ې# ؀`  ؔ (@ΐ ؒ@ʐ 8  X@&@ @a &&  `  %s: devread: lseek%s: devread: read㿘. >@Z 2ـ@ْcP@B @Zْch@7 statfs: %s%s: Too many blocks%s: %d block numbers: %d ffsufs%s: must be on an FFS filesystemfsync: %ssuperblockNo memory for filesystem blockinode%s: block numbers: %s: block numbers (indirect): indirect block㽐@? ֒b@ @ ~ڒ`@א b F #""~ "" ` * "`  ڒ`@`ڐ #|`ڐ (@ ` @|'%", * "@ |  @@` @"| @ H04ڒ`P@   ڐ`X@  ڒ``@` @/1 ڒ`@q @c גc@@h @Ycxڐ   @`{0 ڒ`@`t ฐ@e@fG༠@e* @f? @f@ex`ڑ* d0 Ȑ, ߒ@frxc* 0@"0 ;  @ C@#8   @ ڒ`@`3  "@|  ڐ @\ ( (  `|3/d,`*"@ |  @F@   `2d| `@4 H`>| ڐ @+ X0!}t|+)d,`*"@ |  @ @t `2d| `@ H`ڒ`@_  㿘@eroute: botched keyword: %s usage: route [ -nqv ] cmd [[ - ] args ] keywords: get, add, change, delete, show, flush, monitor. 㿘 !ےbx@.!!ےb@.ې@. b@a route: %s: %s 㿘 a"ےcX@- ےc`@-!۠#h@ِ@-@` nqdtv/dev/nullsocket㿐@ ' /+)'#%!795;- * p@€ %c  %#  $Ȑ $c $t @+]#؀??㰓* @ @`ð&@'"xc`&|c@= %̐  @~ %̀ 6@c@ @B?`)ܐȓ*` €&|@;'&|@U0 @ >@0U@@`e qx q qx q qx q q q q q qt q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q p p p p p p p p p p ph p p pt p p p p pmust be root to alter routing tableroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) route: write to routing socket: %s got only %d for rlen %-20.20s done x"| `   "bސ"b̮ @& B .`@J@ -)@`?`#ݐ#*` € ,"cT ("cT $"cT  "cT "cT "cT "cT@ b#!ܢa@#p@,ܐ#@B0   ?''''   @X} 6"܀ @] 2s#  @Xd 6f#ܪbȀ  @#0cT @#X@`` [-"Ȁ " @  ,J#T` L ` 2C ` >"t`2; , ̒@V$ #耢`*"Ȁ @ ]# #`@m@T@ @ `? @`@[@c@ "@] td tt t t t t t t t t t t t t t t t t t t t t t t t t t t t ( Q(( ~:* b0  .*  ?** *`(defaultinvalidiso %s(%d) %s`~bԀ  "bԤ"@ ! 2 ,@ . @` ,  2  :a?`ߐ $*` €  ' `ޢ `#`̒ @  @{ . b@8` ",@!`̐@<'@!l!#`  !  ???ؒ'@_P  /Ѐ/؀``ِ  `!ِ    耢 !/'/! Ф!#\! @@ -ޒ`@!(!@d$@ڐ @* !ޠ @4 #a@;!!ޠ ؤ #a@; !!! y { { { { { { { { { { { { { { { { { { { { { ztaf %d: %sh ?` ߐ#\*` € ޤ (!#`$! 0?    ??   !:@ 2:@` 2``2 @.Ò  2 `#'@n@$!l##`  !  ???ؒ'@^  /Ѐ/؀``ِ  `!ِ    耢 !/'/! Ф##\! @@1 -ޒ`@B!(#@$@  @);!ޠ @38 #c@:I! !ߠ @#c@:;!# |    ~ ~           ~     ~ }㿐 `$' ̓*` €#\ #` #d #h #l  #p  #t @#x c " cX "cX 2"@Ȑ$  d d d d d  d d d d d d d d d d d d d d  d d d d d d d  d H X d ( d 80%s,%sold usage of trailing 0assuming route to if old usage of trailing digit, assuming route via gateway %s %s %shostnet: gateway %s (%s) not in tableentry in userouting table overflow: %s 㿐"|a` ('5  &2"@M@ g"?b@v ? '/#7`@J@ -@ Ӑ``-*`! € ~   ~   ~  ~ * ~  ,  ~ "T"p $p 7$ "c "cĐ %  !"(?2`@ @ ?2`@ @ ?2`@ @  ?2`@ @ @ w??2`@ @ @@i?2`@s @ @ cܐ [$cܲ`@@?  $cQ $cN ?2`@X @ D?@P #쀊    @6  @z0?@p ?耢 @@ /ah  !pax@ & $p  耢 2$p@ސ!@ې!$p@ @K ? 4`Ā 2 c܀ 2   p "  3'cT 2$M@M " M@`"M@` "``@\ &M@@  3߀ cTM@ g@Z 1!!" @M` "@z` #T` #!"'@Ҵ@f  @`" `" `7`"0 "0 "("8"H@@F"`@  $ H ` \ h H 4 X 0 H h 0 <  X | P쀢   '  ? ( ?* ??* ? *  ? ???"`"`(*``H 8 *@64128㿈    2   2   2    2 !h    ?? @4  "Ж"؀ `@"Internal Error%s: bad value route: %s: bad value H#T`~  #""Tc?T "c#$* €"##"D#(  T b,#" ,`,@  ? "',   0n  0kܒ "ܐ  b ,`"ȓ*` €  ?ؐ ??? '''ah@B  ` `  !c@&d@YY ` @Z|? ? ? ?    $4  @֦ 0 ~"`"2c *2 $c2 2 2 2 2 2 * #@@l Ȱ 444Γ*`4Ѐ`4 4    ~ "" 2 c2` 2` **`$c*`*`*`2`2`2` 2` 2`*`#@@ *  ,,,,,, , , , , ,`,  @.@Y   2   ,@"@ J@ ""@ ,@$Q} @ >  @sq ,,@j "&@ /   @@ ,@?   @`N ,@@? 2$#܀` $'@  7 @+? "Ā`@*/   !   @ '& `  ,`` @YW0 !c@%2@X'  t T  @ h X d p | 㿘@ # ` "#!c@$@Wڐ  *ㄒㄔ `*`"`>  $`$` $`  @YY?#:,쀊    "  (*( ( *.**.0x%xany*0x%02x%02x%02x%02x%02x%02x.0x%x0x%x.%s%sH 7  7 7 * 77777+  2+` 2 2,2 211D  `@0=~"ޒ@2^  ~ А"ؒ@2T  2  ؠ #` `    #\ `@,2 a@/К1 @4a!2*.0x%XH%02X%02X%02X%02X%02X%02XH.%XH%XH.%s%sx ? / / // 7  / / / / / / // ////2 2 2씓211Z !Pb@쐐0S~"@1Ҕ  ~,  А"@1ǔ  2  , 1#'%# b #` b  #\ `@dLb,`01#%    K 0 *  2b@Hb!P,b!Pb@3!2actual retrieval of interface tablex   ?''''   @Oh 6j"܀ &@T 2^#  @OO 6Q!Hܢ @*@Tgot message of size %d on %s㷐"t "b@V% )'"̒@MԔ(@ '@h@|Đx@X"uwriting to routing socketroute: read from routing socket: %s 㿘  D"b  @W"L a c  g  #(    5  & *+#(5X#X `$ ``" ` " `* `" `" $`" (` " ," 0" 4" 8" <" @" D" H*  " @쀊 % " ?   b@VbȬ  @rc(쀊  # ?   c@VȀ`@Xc(쀊  # ?   c@VȀ`@>c(쀊  "D ?   bD@VlȀ`@$c(쀊  #( ?   c(@VRȀ`@ c(쀊  "Ѐ ?   bА@V8Ȁ`@c(Ȣ% 5@H"t`25 b̦ @L  @##0'?2% %̒@L"L  `@`x@̀ "!#!@¢cP@!֒ @ ?(@J@@"@ +#쀈8|(b # 4 # (? * ##"@  ? @@ *@b"( t t t t t tRTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routerouting message version %d not understood %s: len %d, if# %d, flags:metric %d, flags:pid: %d, seq %d, errno %d, flags:㿘"Ȁ`D `" @z^#0;~* @zU   "  2  @zI ( ~!`@ @ T0 @z; 8 ~!`@x @ 0   P@z+ ~ !`@֔x@r route to: %s message length mismatch, in packet %d, returned %d RTM_GET: %s (errno %d) destination: %s mask: %s gateway: %s interface: %.*s flags: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8d%c %8d%c sockaddrs: 㿘!!y"@yĐ     !@ c0!a@    !#!@a @0  L 39-~/57+;  #" "  @" ` @  2 @ ` 2 @ ?` @` ܀ `` `,` !"@y[ #c $c!" @yN$c`   !"8@y@  "P@y9 @y7bh x@!`@y0x $ 4   L@y' $  8 L@y $  < L@y @#@V ! $ @  L@y  D#@V! $   L@x $  , L@x $  ( L@x 0`" $@  0"@& 0 $b 0   L@xݐ "Ȁ`" @%0?H@xА"!` @{X ?`$ !` * '!`@b  locks: inits: 㿘@x#8!#~ $!`c0@X@x#H @Q @  L sockaddrs: %s㿘`@@x#a` @8X ?`$ a` * $a`@  %ꀌ"$@xo ?  @ a``?"`a` * $a`@ @Iia`㿘`Y ?>@ 6  , < ?`&  @  * & @ג !  ?`&  @  * & @ 4  8  ?`&  @ >* &@ǜ >㿘  " @$ 2  %s: link %s; %s: iso %s; %s: inet %s; %s: inet6 %s; %s: xns %s; %s: ipx %s; 㾀 ?`Z*` | €!"@)*!"@'& $ !'"@!"  @! ! " 7 7 7 777@\@w# ! " / / / / / / / / / ///@]<@wn@H!` L h h h 4 h h h h h h h h h h  h h h h l㿘@@ @R-    `А *`: ?А *`: ? *`: ?ɀ`2    !,  €* ,`  *  **".@ $OpenBSD: show.c,v 1.21 2002/02/16 21:27:37 millert Exp $UGHRBD M@dmCXLS1@2route-sysctl-estimateout of space sysctl of routing tableRouting tables x  %  `@J@ -̐`?` ȓ*` €         @   ?''''   @H 6@"@Oې  "@NS 2@v"@Oΐ   @Hƚ 6@"@O @@vm"؀`@  L 2@K @NK L T d t l t | \%-*.*s %-*.*s %-6.6s DestinationGatewayFlags㿐ahp#\#`!@X   @v %-6.6s 㿘 L   @P" 2  @ $ @  L ?  M@ P @   @Ga``?"`` * "`@Ń InternetInternet6XNSIPXISOX.25AppleTalk %s: Protocol Family %d: 㿘?`#ؓ*` €""" " """ `@u#0#@u P h t \link#%d%s%x:default(%d) %02x%02x%s %-*s %-*.*s  x x  "9 u "C o     2   `8@H   `   @ w`@)'@@3 H `@ P`h@d `^ XʐXT `  `  `   `ﱐ X@j : 4@P/@P*&  @`` z:)'@Ԓ h  @̒p * x@t0#` @t0 @t pR"RЀ` "RR@"` `*`R@  *@t xresolvexnsx25staticssthreshshowsendpipesarttvarrttrejectrecvpipeproto2proto1prefixlenosinostaticnetmasknetmtumonitormasklockrestlockllinfolinkisoipxinet6inetifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpiredstdeletecloningchangeblackholeadd㿘 @N *  *.`.@L p r h2*LN p"L rL h p h r .`2 ` .` L p h r p h뀢 pL ,r  L`N `,`%`* :  . :2 ^ @56`  .` А 20 .L ` `,* L A 6` L``* @8``6`L   ,V` "6`L 2V`!  `   L`,@L   V` 2 &6` J\2 J/7$ !*@J ЄД ** 8?А ?Ї+ 8* Ѐ4*@*@ 㿘@5C/LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ] Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %s㿘 !!@"D@IaL!`L"D @<aȰ `!"D@!$€  "DÒa@%5"!l"L`"@` 2  2  "D`@b?"al J  @!"   @!"0  @g" "!"ainternal error: unknown type %d.㿘!€ ! %4#8 `"$!"L"L` "2  #@n0͔#J# @!i"  @!d"0 "$$!type㿘!b"`H 㿘!b"`> 㿘!pb"`4 We only support %s mode, sorry. 㿘"D͒ax@q?"alWe only support %s format, sorry. 㿘"DÒa@[X?"alWe only support %s structure, sorry. 㿘"DȒb(@D?"allocal-fileremote-fileusage: %s local-file [ remote-file ] STOUSTORAPPE㿘 'D'H  'D` &`D  D@=ڒH D  DD@=ϒH D $ HH"D@b ``@?r` H?D"al`"H`""`H@J a "L """  #L  @`H"`   8 H@k H"`H  @  @"H @IFlocal-filesusage: %s local-files Continue withmput%s: not found`'H 'DD@=RH HH"D@`?u"alH͐ "#"ؒcH@J '@ " H "!! H@> y! 8J  #\  2J J  @  "J  *` /#\    H+  * *` *#L @$  8 @ "L ""؀   p    @!!! H h 1 p & p!@>a ! $!& pH @= 2uLD Ĥ #X M! H@= #L H@  8 @\ "L ""H   p  @! !! D h  1 p& p!@=a ! $!p& p  ,@KH, @V  HȀ 2 H@@! @YWD QL! DH@= >#L "@ ` 8 @  "L ""@   p  @! #a 2  h ! p $ p!@=Ra a $a$ p  @YbD?@I5 "!r+w㿘h@( w㿘#P#P`#h#@ usage: %s remote-file [ local-file ] local: %sRETR㻘 'D'H   'D` &`D  D@;H D  DD@;H D $ HH"D@c ``@=#` H?"al ;! 6 J  #\J  @  "J !   *` /#\    H* +  *` +H"   #L H@ g H"`   8 H@  H"`#H@%L   (H`@ (@:PHH @=?  H H` ` @ @$  :P@@F㿘@A !"D?`" * " @I "D@?)!  h !#"ؔ  pcH$ p!@<$cH $ p$cH @, $cH%! @& remote-filesusage: %s remote-files mget㻐'H 'D(D@:H HH"D@`8?"alH͐ "#"ؒcH@Gѐ '@ܐ nÀ h"!! dH@; _! N` #\ `   H+    +@J`*#L @ x  8 @   #  p     @#R 3a  h 1 p & p!@;m`P "& pa &a& p" @:oH 2N@GU "!onoff Connected %sto %s. and logged inNot connected. Connected for proxy commands to %s. No proxy connection. Gate ftp: %s, server %s, port %s. (none)Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. Use of EPSV/EPRT cmds for IPv4: %s%s. (disabled for this connection)Macros: %s 㿘!"H"D##0 !@Z "D@!#@" +@+_ "H  "DcP@B0"D@ #x@+M +bDc!!J 2#"В@%bD!!#@bDcؔȘ"X@`bD!! #P p#X@bD!"LϠ @"@bD!  h@ݐbD!!  x@Δ#L  bD`(@–$bD@  8  bD`@)bD@x )"D!#@!"|`@"D!# p!H@"Dahf! ! ! @z%D "D@@!D ¢ Ô"D@ @eaD `"!lusage: %s [ on | off ] %s %s. 㿘  `? & `@{b耢   & `@ob  &"D@@/b? "D!"(@ Bell mode㿘P"alEPSV/EPRT on IPv4㿘 P"al"Packet tracing㿘"alusage: %s [ on | off | bytecount ] %s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark). 㿐  #@ `?:"#@"D@)c`@b耢 ͐ ("c@`@b 2`"#@@ #@J  "D``@?!"al͒ """@31"D!c@_ (@|c@ ""D@s`@"D@= Xc@"!lVerbose mode㿘 "alUse of PORT/LPRT cmds㿘 "alProgress bar㿘`"alInteractive mode㿘pٖ"alusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. 㿘  "D@@b?`"al  ! `?,"! `@&b耢  ɐ "a `@b  "!!@H`"b!"`!@~ɐ "a"!! ! "J "D@c$!"D#!!J 2#"В@!"!lGlobbing㿘XA"alPreserve modification times㿘-H"alusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). 㿐 "D@'a+`@ˆb耢 ͐ $"c8`@~b 2`"#8@Ɗ J "D`a@1?#"al#8 `?"#81#8 a a ?"a"D!#8!#8@#8   "!lremote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %s㿘'H  'DXD@5H HD  H"D@Ւcp?%"alH`@#``!l!`! H"D@#H`@n#Ȓ`͐ "cDusage: %s local-directory Local directory now %s getcwd: %s㻘  "H &`  "D@@``@7` ?("al@]t`  `@ ?"al@,$  "D`@h`@!"!l`@@usage: %s remote-file DELE %s㿘'H  'DD@5H HD  H"D@9b ?"alH`@"8mdelete㿐'H 'D(D@4H HH"D@`8?I"alH͐ "#"ؒcH@B3 '@> -H !&"!! "H@6& "8@! H h 1 p & p!@6bȀ ! $!& pH @5 2N@A "!from-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s㿘'H  'DXD@4vH HD  hD@4jH D  HH"D@`p? "al`@G H`@@ -usage: %s remote-directory local-file nlistNLSTLISToutput to local-file:㿘   &`  !p&`   "D@@Wax@@2a !!`!@&!p " `@5` 2`?1"al!p@ `J |"`@5` `@5V! ? "al``㐘 @ @8"D`@?@?usage: %s remote-files local-file 㿈'H  'D(D@3H HD D@3H  DH"D@ ߒc`!H*  ?ap''"?@ HJ |H@5F @4! H?P"al͐ "#"ؒcH@@ې '@ !+  a w/H,`@! @ 3a  h 1 p H& p@@4! a &a& p!` D?@Ҁ`@@ "!耢@@? SHELL/bin/shsh-c%sTry again later㻐 @@  @@~ @[^ S @7֐   @@p  @@m @A9!آ !@u5 / " -/ @ڔ#@ a耢  +/#8  !"D@"D@>a @7"D  #\@d˘ @dŔ !@?"al@? @%@@ @@ ?@n""!l"!lusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. H'H 'D D@2HD?  H"D@ c?U"alH`@_ ( 7 D  H@ 0H"`D 'DH`@K @ # D H!"D@S H@7A"D O@G@AL?,H" D 'DH` @) X  "D@5 `0  D 2 ?H` @ XÐ?"bHPWDPWD command not recognized, trying XPWD. XPWD㿘!! $!@"0 2$!!l!2 $!"D@"8@"h$!Local directory %s getcwd㻘@)$  "Db@ @""!ldirectory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD. XMKD %s㿘'H  'DXD@1H HD  H"D@ גch?"alH`@# !l!! H"D@#H`@s#RMD %sRMD command not recognized, trying XRMD. XRMD %s㿘'H  'DXD@1dH HD  H"D@ ch?"alH`@@ !l!! H"D@D H`@+ command line to sendusage: %s line-to-send 㿘'H 'DȐD@1 H H"D@ Na?"alD @.Harguments to SITE commandSITE㿘'H 'DxD@0H H"D@ $a?"alD"@H㻘@$`@?ߐ  $" @沐 @?Ԑ    *@ . !/@ @- modefile-nameusage: %s mode file-name SITE CHMOD %s %s㿘'H  'DD@0H HD  D@0H D  HH"D@ `?"al` (@_`SITE UMASKSITE UMASK %s㿘!!  $! !@F`$!SITE IDLESITE IDLE %s㿘!!  $!!`!p@,`$!HELPHELP %s㿘!!  $!!!@`$!㿘!"H  @ @"b "H  @ @=> QUIT㿘#bH @"h!#T "@"?"cD$#T$bH" Dusage: %s [password] Account:㿘  "D@@ b? "al2`@ "@ X㿘@6 " @" "H  "a"!@" Ȑ @ ; commandusage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. 㿐'H 'DАD@/H  HH"D@ cPH@(f ? '!"D@|#@4j"Dh"!l !"D@m @4["D2J`  !"D@` @4N"D%@ Ő  ch@< @! J "H !"D@A#@@4/"D@! @< ?("al"`@@^  `@>."@5ؔDH? €`"H  "a"!@!X @:#PSYST㿘@"Limit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. 㿘! D'H 'D"D"  DD@+H D  H"D@֒b p "D@# D#Ñ*`H * b@n  DĒ  p"@ "D@#Pz"!l" " `$ Dq"l*` *  @* *  "@ Db* * ` @'%Ȓ`? "`@Ӑ   "?̑. :  .@ Db*` *   @ƐN "Ė.@`p@3a`? "`@ a  &a ?23?a`?  "`@  3a  ` &a"D#x@ ?"alfilenameusage: %s filename %s %lld 㿘'H  'DD@*H HD  H"D@b?"alH @, ?  H"Db@"!l%s %s㿐'H  'DD@*H HD  H"D@ݒb?"alH @, ?'H"D!`#@ސ@@Ô"!lSTAT %sSTAT㿘   @ j`Local file "%s" is newer than remote file "%s". 㿘㐒Ĕ? "D``@`PAGERmoreCan't allocate memory for $PAGER|%s㿘'H  'DD@*=H HD  H"D@hb H @+  ?@"al@8R!H L !P@9@5  2aX@5 a@)#P %'  =#P@$@H$   h @.@5Đ< H=#P$@$ @@5?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestartresetrenameregetrecvquotequitpwdputproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendmputmoremodtimemodemlsmkdirmgetmdirmdeletemacdeflslpwdlesslcdimageidlehelphashglobgategetftpformexitepsv4disconnectdirdeletedebugcrclosechmodcdupcdcasebyebinarybellasciiappendaccount$!macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. 'H 'D  АD@)H   H"Da  1 D HÒb  @ꊔ 2  D0H"Da@?"al̒b@˃/Ò,`* ` @ Ѐ#c\  2 N+ Tb*`:  $ \"B A c\@  %*`    * ,  * :`  ?D?#?H,  @:H :  i2D  H,@(H@7@.@`N 2 N @!.@#bP@!M `"D@b"Q"!l2N` "D "( "H  "D"@@K?9"al! !"D@?b"D@3 bP!` €!#P N`  "D`?"``@* "@@ ̒@ʼ"@!)!bP'D@'H* `@2 6#D#/ÁExtra `@' characters in usernames and passwords should be encoded as %%40unknownCan't allocate memory to parse URLhttp://ftp://file:url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %s-Can't open %sWriting %sReading from fileSuccessfully retrieved file. host %s, port %s, path %s, save as %s. %d%s: %sTrying %s... socketconnect%sRequesting %s (via %s) GET %s HTTP/1.0 %s User-Agent: OpenBSD ftpRequesting %s Can't allocate memory.80GET /%s HTTP/1.0 Host: [%s]:%s %s GET /%s HTTP/1.0 Host: [%s] %s GET /%s HTTP/1.0 Host: %s:%s %s GET /%s HTTP/1.0 Host: %s %s Sending request: %sWriting HTTP request200Error retrieving file: %sContent-Length: Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %s?'?#"@@x?c@"@  c @2q ?cH@F  ??#* cP@6   ??#  cX@%  ?#   #c`@28 `@ܒ /  L@ 2,@ 2.#` L@  2!#?#"@ %?!?#@"@%?   J  ` #@|50=`@$ `@1 cH@    cP@    L  / (@|0c,@o / ?L@ 2,@?c@@`$@/ 'Ԁ?? @@{0E#H@@5?2 0??:x?#@`X  &@!'Ѐ ?R!n'?c" @C!@ 2?`@3- bԘ ?c:# ̔  ;a@)3?O?@B :& В@*?怢 2#@ 7 24?! +!2 @&"D #`?"``@* "@@  #"Ԓ :@ F @(@*e"D?#ؒ@Ԓ@*M 2#@ H C!`!<  8"! :` !2 "D?`"@  #* "@ #"D?`" * " @ @*"D@zϐ 0Z@( ! #?"D@ #?c@2d @)R!nЀ c@)c ? @0?L [@g ] " J ``:2* @g  : , #8  ?#@D`@ؐ @3}  ''"!?#@`"`#(  P@@  ! @K @zu0Q?#?'ԀJ!??cؠ  #\  @"D`@@Ӆ 'Ԁ?'!@ ? " @)?'a㸔   #\ @q  !??!?#@Ԁ !@y0r# ! "Da@T#0!H@yf?! "Da`@@@[ : 5@ڧ ap@/ @M % 2*a@ aH##\@F0 ?#@aH@9@/$?a@ aH##\@"??#@aH@?#ؒ@@2c8`"Db0@ՔԒ@(@yN"H0ِ @2P??#ؒ@&0:./Ԓ@(g  L   ./@ʒ  b`@  "h@yP0 @2" Ԓ@(?  L  2 `    ?#ؐ/ ?cؐ */L   H* R  c2 b@  2 L (  @y?c _' * @ :  !x:!x!x ?P  K?#J F???:x?#@`X &@ !'Ѐ  ?@x `0*R!n'?c" @L!@  ?#@ @ @00 0`0@0, bԘ ?c:# ̔  ;a@&2?O?@B :& В@'?倢 2#@ 7 24?! +!2 @&"D #`?"``@* "@@ #"Ԓ :@ F @(@'d"D?#ؒ@Ԓ@'L 2#@ H C!`!<  8"! :` !2 "D?`"@  #* "@ #"D?`" * " @ @'"D@wΐ"0Y@% !x!x?̔!! @ ! @"D@"0:! #?"D@ #?c@/G @&R!nЀ c@&c "? @-?c@@@- 0'@w"0 ?#@@wz p0#@wԀ??@&v?#@ "?@ @-}?@-x? http fetch aborted. 㿘@(W !"D@ @&"D!@@  file fetch aborted. 㿘@(C !"D@ h@&t"D!@@ ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'cd/*?[]{}Retrieving %s/%s %s/%sgetmgetp'D'H'L!'@  "H    'a@. 'b @. @/K @/G Ȯ ܦ H* @@׳   `@, cH@   cX@   L?h0dcP@q  g L?W0S /@- :@)@% @ < :8`5`*  @,@ @ @ 2@v#0  M L  H*` @v!0@<@9`@ : `. @Ӓ :`L@ `.@``N@  @b /  * #8  "Da#\#`@#@f 8@"H  7 P <'''耦  N !'' !Ā  <$ < @"H  $ <  @* 2 !@@v0ᮒ !hap? 'Y#D  #X  ` `N@ ax@T@ ` `M@ ax@H 2 ``N@ ``!h' ''%#D K`"J?M@ D?!  "D`!! @` @ $!''䀤` '耤 L! p!'$ p   $ p " ''  ϒ!l@  d ܰ @+Xܐ '܀ D 6 ܒ :H* @ `"H ? _ Can't allocate memory for URL decoding㿘 < @.]@*   a@tא  + L +  ,@ %2,@#\   D ",@   D @,@ ,@ L ۢ`$@,@ \` `(8 (\8` (`8Б(: :/㿘cP@v  cH@o  cX@h  @bЀ   unknownftp%dftpgatehttp%s: bad port number `%s'%s: %sTrying %s... socketconnect to address %sconnect%sgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopt@¦#X"a)Ē  @-H Hؒ  @-C  ''''@|{.`c`/@݆ cp@݀  h @Ė Ocx@r  Oh @ PO @|M` !#@t'  #@@t?"al ` @ ! @! %$ G?     #\! @; "Dc@>  @ 6 %#@{   " " ``     #\! @ #@s@"cز?  `6  @s#’?@c"lw  H @, @Y'Òb'@# 6 @sm#E€  '  @   @sZ#`@!$#<` @#<#̀ $cT`2@st (#<! "D`8@@ #< "cT@?cT @9?"al '?c!@ܘ   #8 @s P!@" 㿘@$  !"D?`" * " @Ð @"1"DHcL `"HÐ"x@ ---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT㿘#8!'H'L'P'T'X 7$#H3bD@!H!@ޔ  bD@"bD"@އ  bDbD@"bD@͒bD?`" * " @W @!bD3cT  @r"(?"al& a`@*! cT@HcT@"P@!cT͐ "@ƒbX@%`?#H ƀ @* %c%c%c421 Service not available, remote server has closed connection. %s:㻘ˮ! @+@$9 @)ݒ!`    ¤"!l ֦ '@c#<`΀` `@c# 8@!,"D!"al ` >!`4€5 541!耢 ,!  À` "D"D`@A"D`? "`` ,`:  @* "@@y #\ `   l*` * ?А"l  !l?    !l " d  #\ `  2   d` `)"---  d`("  `- "!l "!,!@b#<` '`! 4 !À? 5!耢 !"D`?"``@* "@@@ h"D $8$!ؒ@K !l`"# 1,""ܐ @(!l!a@'#H  !`@`"?П@  ?ƴ@(  "al 㿐''   @= send aborted waiting for remote to finish abort. 㿘@!Ԑ !"D""H@"@ "DÐ"@ sentlocal: %s remote: %s -local: %s%s: not a plain file. STORAPPEREST %ldr+w%s %snetout" :?x"'l̔  ?? t8;ax'D'H'L'  LJ -"Db@L`"Db@L" DH@ L0a!   '''` ''t@" / "܀ 1#D @@?&#D @'א  @'А  l@'ɐ l’?" A"lb<@' '!cT@' 'H@lb  H!'`"c"0aJ@ |( @' H'`@Kx' #@o@' @' @' ` ""`a!'07H@ڒ`' H@oː"@'p @'m !'@)R  <  "H"D@,b@'S @'P @:x@~ @'A @'>  ?@'7 ?"ll"`@;" d1#P#P`@QD@גb  D@Вb耢 EL! ?` @    #PR  @d  1H@oL"  :Pl G"#P u"    >#Pl 7"`  >#P'tLD#\ ,@&Ɛ @&Ð l`" J# @& @& l`" @&  "@pt@ 4' @? @& a'`7`` ""S ! >`B;!` R @ 4&@#@ ; !x 3!!x *x  | !|"D #`?"``@* "@@c #"Ԓ :x B?x!@"DpR @$ #@ M` !x C`!`!<`  8`"! :` !2 "D?`"@  #* "@ #"D?`" * " @ @n"D`H@n+" "]#@3 !!x 8x  | /|"D #`?"``@* "@@ʐ #@7"D"͒ :x#@ B?x   !x  @; `?"``@* "@@ `B :`? "`` .`:  @* "@@`B :@_R` #@ B !x :!!x x | |"D?`"@  #* "@B #"D?`" * " @2 @"D @H@m[" @  " @mO#̐??:@ l`" @@L @$ߐ @$ܐ  "@$Ր !`!M  I@ 0E@$Đ @$ l`" @$ "܀ 1?."al#D @ ?&#D @ ? "al "@!`!  @}  receive aborted waiting for remote to finish abort. 㿘@ː !"D""H@ "(@"DÐ!@ receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %s"'H :''X''?'T”??'D̘  :!x t;'L'P'Xb'@ջ`?'܀ #!  H X HJ -"DbH@L`"Db@L"  ܀ HD@ L0T' x'䀢 ' ܀@ '@ϐ!؀ +Ґ "܀ !#D @?$#D䀢 @# 耢 X@# X"`T?""lb`@# '!cT@# X'耢 H@;b lHJ |gH@M  UH@XF / "   H@k"0m 2,H H0""@)   /,H@k"0O"耢  "  H@S! H@k"0;"耢  " H@ w'HH 0*"耢  H@ j'HH ܀  !   0a!   L@ :x@4  @" @" ?w"al@!؀ #܀  #P`#P o" cL  D#d  0\# 0@] ' X 2XH@pb X!`'5"``#HJ | @" 'H @F}` ' H#@j`0` ""`a!"`H@P' H@jؐ"0!'h@$/R   !$'!!@#a @ @  $a@j"$!$!p<  ` ""`" @^?! "  P P    PR  @  ""^  aR @@2  "   $ Pa͖ <`#@B <;a !x 3!!Ȁ *Ȁ  ̀ !"D #`?"``@* "@@ #"Ԓ :Ȗ B?!@c"DR a@L #@ M` !x C`!`!<`  8`"! :` !2 "D?`"@  #* "@ #"D?`" * " @ @ "D` " @iĐ"̐??:@H@i"08H@i"04#P#P @ @1  ` @[D? "   @  H@i"XT" 􀢠"`@q` Ԑ 'l` #@3 !!Ȁ 49Ȁ  ̀ 0"D #`?"``@* "@@ #@"D"͒ :#@ B?Ȁ   !x aB@Z:a` ؀ `  @< `?"``@* "@@ݐ `` `? "`` ,`:  @* "@@`B :@Zn` Ԁ  !"Db@]"D@'#(#@ B !x :!!Ȁ Ȁ ̀ "D?`"@  #* "@u #"D?`" * " @e @"D @  " @h"̐??: @H@h"@9 XT"` "@@  @   @  @p !`!܀ `  @  u!@oL@ʒ ?j'\@7 '`\`H@Fg'd?_"D!H#X@\@@졔0PXT"` "@  @ "܀  ?"l@ @ 03@e#cD ?`"!l@ $cD쀢   @ "@!`!  @{ @~ @{ use of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)bindlistenEPRT |%d|%s|%d|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d㾸Ô  't` '` ? ?@?@@g:"Ha &à(Ò @  @] "#D@f#- @cD?"D $!p!  ?c t@  @f֐"xÐb(   7 S! ,#a '"al@    "D @"#8 `$a"D@"!""͐al@    "D @ϐ""!!p  @{D? D"!d$!p"D@"!`b@Ͼ DÐb(  2!l @   "D@#@v!#\#`!ch@2њĀ à(  @7*`* @*ÖǕ*@  (( @ 4 , )$ b@v !l @v 2 À "D@Q#4!ô"(  ? !ÔĘh#\#`#d#h#l!cpl@2~ Pp ^l Zh VÒ  @ڐ * *` *Ö Ǖ* *b( 6.&ĘȚ̄ІԞؠܢh#\#`#d#h#l#p#t;x;;;;!`pl@20 "D@ݐ#!p  l h "D@ː#!  @˦ϗ*ۅ(ߕ*+ *  Ó*`ӡ, @+`@(+(@+ @ǐ ((, @$ @6.&$Q$b@Ξ m!!l'@   "D@x"[!#\!`@@1 OO@ O@O@"D@X P;!à"(Ē`H@ 4  "  !!p @d#$!!cD "(@"( "(  " D 't'à(Òb@v )# 24 #cD?" @  @,   $cD@dĐ#` %# # cD ?c t@s  cD@d `!(@P ( @d !! cD?c t@V   @d"x 'd(cD@9d cD@d#!@y  6# @dy # ` ``  6! /! , (     (x #\ . @ɚ    #8€` "!"D@" Aà"(    9    #\*    #\#`#d #h #l#p #t #x #| # ## # # ##1 # ? %# '`&@ ` %#    'tcD  t@   @cԐ# !@#D`?$#D͐ "c  acceptp "a ''#D#cD@Ԡ  !@c"xcD@ ?$cD@cDـ $cD 'А  @Y  6cD@c#cD@"㿘!# b`!2 $b  ($b@ $b㿘@{ cH "cH㿘'!c$H@     "#  !c""H%&@""H  @q!`. `!Ġ H$ @א! a @Ӕ !à" @͐!a @ɐ<&!<a<T"<&!@a@!"T&!DaD#!&!HaH"&!LaL"L"&!PaPb#"L&!TaT#b&!XaX!L"&!\a\!("L @%!`@a`!͠#$ @!qaq@ߐ`8!&!a!"`8$@!@ђa!Ƞ!$@%e@Ȑ @|H $H 㿘@̐ !"D?`" * " @ @"DTɒ`"T#!"H"x@w STOUproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s aborth"'D''H'L'@ޒ ' "耢 """'!  1!  !Ѐ 2 1!" "耢 "D"@"0 ݐ "H  !"D"@# ѐ ?"alԒ "ː#8ja @"x < "b\@ΐ c'DWL @  0@ސ  `'CH  !#L `$#L ￐ @  ""D$#LHc@@oL0@ "#LD@Gb  " p !D@8b  !" "` !"܀ 2! 2 !#H &0"܀ "@ "C`?"܀ 2#! 2!#H "!1 "܀ @ ) "T ?"al@6 0J"܀ "@ "`?"܀ )Ȓ  @#< R 2* + @ $  6"@ad#X"T ?"al@~  "  ߐ "T ?"al@ resetxؐ @A #< R 2*@ + @ $@  B$  `@a%?@D"al   ́runique: can't find unique file name. 㿘@M / ` 1,@@`""@r ` /,@+@`"; "D $@.!003`@ΐ@* .*&`  d,,@: ` 9,@ 0`@A ,:  02 L .  1,`,"ߨ 1 Lost control connection for abort.%cABOR x!#T $@`Ɛ""T ?"al@`0   @#TR  @ܖ  "#T"@`z#X#T$c@ @#Tؒ  @u#< R  2`* `*   $ V 2 * *@$ l 4 6"@`N#X"T ?"al@h V 2 *` :@` V @a$ 4V  !l"(  ftphttpFTPSERVERPORTftpgateFTPMODEpassiveactivegateautounknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpTERMdumbemacssuAadegimno:pP:r:tvV--r requires numeric argumentRetrying... 㻀'D'H@O %%a%"#"@3!̀  "b%! "bа ͐$3#%"b#cX p <""# &a$ap@$"bP%"a "@ !( ")P%@a0 2%&a$apa8@ 2%&a$apa@@ې 2%$aH@Ӑ %$ap&a!P@_P <%@Œax 2%ɐ "a%@Ԑ!ɀ "aJ !%!"a!!  %!J 2%%@_t!$!%@!蠒  %@șa %a@ȓ %@ȍb 2 !@T Ā "`h "a XR@"bD j`h@ $ cȐ `"``5['!*` "!pS"aɐ O"a8 `"F"8C"#X@" pȐ?<"`9" < "%b @? 0!,"bD’ "!&"p "!"" "#\    @X!$!%b(@ Ð  "b "a"!@\H%D@Ԕ#D*`" 'DHÒ@ ͢ "# 'H#""@k"x @V @^@W @q"H@h 6a(@" D $JH  H"Dx &;@@! '@Ӑ a@ 'b @ P <H'@H'`H'`''D@t 1!耢 !"H  "D%"D@"H@!"H "!@!`?  'a@̐ 'b @Ȑ @  t < $ P 㿘@ !@嬒 㿘' @ސ #bH !#T " !R @= @#T$#T!#D & $bH@= @ #D?$#D$bHN bH  !#T " $bHR @=z @#T$#T$bH"!; $⨁ftp> '"sorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. 㿘 "D?`" * " @@ {L dƀ`"', "D'@#!`? "`@! !  &!` v!s'@#a P1"P@r? "D'@#(B2 L "D'@~#@9Ā  "H  "P"D'@p#X+"P"cH €a#P " L  "D `?"``@* "@@̐  )",@' h " Q!@="D@ +"D̠"1$@0!    @0 n'a@ 'b @~  - D   `"DJ@ KJJ@J`J2  "  " `2J@?㿘%Ð"a P""d#!#`#$a $a@P@ a!$aJ@ `d!$ ᔀ J@ `"#aJ@!((fxd" \J@ "` ?`ᔀ  J@ "" \J@ ' @"" 0 \2 *` `J@ @ *` J@ @"2*ݒ``  " `d* `d #a!    "!"! \ %sommands may be abbreviated. Commands are: Proxy cC?Ambiguous help command %s ?Invalid help command %s %-*s %s 㿘 U?@)%â"D)`!)!)!ؐ @? 3b1!D* `  L b@b!D*   *@ @( 0!@Ȑ? )"Da )"Db@ ?)"Db   @? `usage: %s [-adegimnptvV] [-r ] [host [port]] %s host:path[/] %s ftp://host[:port]/path[/] %s http://host[:port]/file 㿘P <)   c@Ȑ!@ macdefmachineaccountpasswdpasswordlogindefaultHOME%s/.netrc%s/.netrc: %sr%sanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.Remove account or make file unreadable by others.Missing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. 4K macro buffer exceeded. Unknown .netrc keyword %s8*@@   @ # !* @! ?@Z *`@ِ*`@  "` " * @Z @! &/@/ . \*Z  0T F@{ L'ࠐ@0 :#a@* 4a@  . "@  a@4$ a$L @ . #@  $ࠐ@ L@ 0"'@   *D `*@, @  ! @x@ @&@0@`؀ *@x`耢   @oR   ?*@  ! @N@ @&0 @QR   ?*@  ! @0@ѐ @&0" )@Kx  ") ")  '"D*@ !D`%Ñ*` *  *    ``@KO  #\   ",  ,@K<  sDĒ`  p"@ *` * ?`"-$D*` * @ * * `"D%Ó* @ *` #@K EÑ*:  ,L? D, `pȐ p "D*@"7"8@Yq`@7    @,   @Y] *@YZ!` @4 0"D*@j!"D*@c!@YC *@Y@!( @?㿘!  T @J   ` `,3#`"`02.@J . @J `"`\.,`2.@J~ . @Jy  ` ` ` `,퀢`\.L`   H`  H@` "    stringlist: %m㿘@ 2 ,b@Xr & & @ P &,b@Xg 㿘  @2 *@&  &,b@XR  * "  & 㿘  `  @ .` @}` @*@w@u㿘  : , @ 2  * Already connected to %s, use close first. tousage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamfile8binarySYSTRemote system type is %s. 215 UNIX Type: L8Using %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. 㿘#bH'H  'D"D-` D-D@HD  H"D-`@0?"al!! ""H ! H!"-J -`@  E  A  ! H-`丐! ! -"Da@ -a@ $bH@"X"h-aP @""-aX @ -!` ` !`*+ Ȑ "|)-ah  @" <"!"aH  @ #8'€ ጐ?$-h!p #!€`!-%°ܐ@  @  L? ."? ,"D-ax@ێ܀ 2,!-a!@  "  "a "a` -"Da@p"$" "!"!`-!ؒa@” 2$"D-@%!$ጁanonymous%s@ftpName (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$init'L`'H  '|HLؖ| H?"al԰ H L - ! ' !!@ !@@\  'H@V@O 2."0'H!@d.H@@! ."0'L'H 2."H/'H@:  @V@O 2 ."DbP@͖ ."Db`@Ŕ/ O@@?.@O 2'H'HH .Hh"p`L 2..@ܸ"x'L.LY"``| `.@ܨ"'|.|I"`.`|`.<" .@V/" 25 ! \  "  0'.b @"G "P!@05DÐ? @ "bH Òb."@0 D`@  sorry, arguments too long. (%s) 㿘̢"@$ "D/@"p"D/@$b ,@ $"@@ @ ?L@ ",@  !@$ $"P&@TMPDIR/tmp/unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %swNLSTarcan't find list of remote files, oops. can't find list of remote files, oops.㻘! #X !?"! Ā  @B$ #X + ""`"` ""0`Ā 2/@ # /#@`J? /  $d !/#@d ?@U+ @?L /" /, /cȔ @ ;@猐 /#@Tߒj @1€!?&!&!'@`$@"[`?`@0` @0  > `@0` !l@ d !&`"5`?0`&!$@@%`@0`Ā 2 0"D0@ڐ   H&!! Đ@˒$  @Ѝ $ @ 2.%s %s? Interactive mode: off. Prompting off for duration of %s. n, y, p, a, are the only acceptable commands! 㻘%p B#cH 2? !0"Dc@@}"D@$ , `H*  R  n"$  p a1"D y1"D0"D$p@i#  0$cH"Dc@ؒ @؎`!ð %s: not foundh#X ! Ȓ  ,@ @, @ 2@Ȁ  @1@T!`@  @$@@SIZE %s㿐#%c8 ???$1"  !@_ $  @$i J  #\@  2$??"$c8 2 $!"D@!"D@ d $MDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. H#'-c8ጀ l?$1# a`1\!!   " \   2 1c(@-  2"D1@’c0  2 0, ,, #\#`!1Ėcp@ɐȒ  ,@ 3?'''Ę?x''''@?쀦`c8  1"Dc@׈$"$c8 2 $!"D@F!"D@ $ጀ?"%l㿐! Ȁ?@0$ `w @ m?   `?㿘# b  ?2$b@ $b %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d: %02d:%02d --:-- ETA - stalled -%02d:%02d ETAh!¢!  @栐`! #P " # :@擒  +ax ax15!P@ B `5- -@B2`* @ *`B2*@ *@ȯax  d & d4 d2h"@槖 @?․`@ @X d@ =@ :3`""@22#\p"@抚$@  4`  <    4  a"@ , @ @ `J@""@3`  #\ B#\@^   "@'" 'А"@''!!` " " ;!    " @ # '! ! " `'" `'А"@@'' ؀` 腠DA?؅B.'@Ɛ @ @ ""@3 @.@ @ ""@3@(.@@ @ "$@!3 0 <@ <@{@Ԗ%! !`   axax`(@ X@ U""@3@嬔@^%À ax@ H@ E""@3@圔PN%P @b !!@?ؒ. ЅąB'@A @ $@ !""@3 @w.@ @ ""@3@j(.@@ @ "$@!3 ` <@ <@@O%DR @ @͒ `2b$@: @ 0@ D?`" * " @~H @D%lld byte%s %s in %.2f seconds (%.2f %sB/s) sMK ETA: %02d:%02d:%02d !  @乒 ! ! " `'" `'А"@@'' !! 腠D@I?xx B3? ?  @ǻ  4(4 4!#!` !  43 4# tx#\@;``  B`;h4#4##p@䘒 d V! !Q ` M x Ex`Ax#P!@ D 4: x3x@ @֐b !@?px. pąB'@.@@@ d$@!4# <@ <@@B  "DR @ܐ@㿘  @ ,`@@4 `@* ?`@@Ւ "  @ ? @I 6C`@,` "D@}  "D `?"`@* ("@@} %`@-`"D   ?`"@ * "@| 逤Ħ`@ 㿐"D# bR `h@?   P" @Đ P"`@$b㿈'''' @9 㿘@k/etc/dhclient.conf/var/db/dhclient.leases/var/run/dhclient.pid-pbinding to user-specified port %d-d-D-cf-pf-lf-q-u-1specified_interfaceInsufficient memory to %s %srecord interface%s %s2.0pl5-OpenBSDdhcpcudpcan't open and lock %s: %mNBINo broadcast interfaces found - exiting.PREINITalias_㿐@  @@: / @ @ @   ` 6@@ʒb( `@K@@! * 64"0@8ٓ2`6@@bX 6  }"b@@b` 6  s"bT@@bh  6`@@c"!@@bp  6`@@S"!@@~bx  6`@@C"!@@nb 6  9""<@@db 60"!P@@[b 2@ &"aLJ -6@ؐb@ ` 2  66@"@7ҒbВ  `@@ @   $$ L"!"``` 66"a@8! "! ! "  "66#@rc 2  D4""' ! ?4"H@l"H X?"  *X * 2  #",@\ @|#a" @ 6a@7#@ % @ @ 6c0 @  @  6@7Ґ#8@ #a 6 L  26 @ sch P 6cp@ ѐ@  2#a` @    @`@  @l@'#@ " g P "`@N 2 Pg  @"` %sUsage: %s [-c1u] [-p ] [-lf lease-file] [-pf pidfile] [interface]㿘!8 a@7haX@7da@7`#8`@7\a@7Xb(@7T@7R8 @7$8@6!㿘 P@  02  @!0@("` P"`, P@{@ P a$@q  "l P" 4 P @ "8 P@a"`<㿘 P@@ PD ", Pa$@S  P "` "l P" 4 P @ @"8ARPCHECKcheck_㿘8#@=!H@ P  ! ` ,8b@ 8c@ @  $@@@@ ې値` P`"  P "`0@a܀ ! P " bl  P""` P c@   " P   @ @ "  P@"`0 a$@ސ  P "` "l P" 4 P&  @# 8 PD@ ",@ŐDHCPACK from %spacket_to_lease failed.㿀 (P ,@ @ށ P     !9   @@7@6J@ 2P9@6B 0r>"`#@?P aЀ "@:pP`!"`P ` 6P#"`P  "@:ZP`"`2  : "P  "@:JP` "` 2`@ : @:@" P  l` "`P ` 6P#"`P l` "`P ` 6P#"`P l`  "` P ` #"` @REBOOTREBINDRENEWBOUNDold_new_bound to %s -- renewal in %d seconds.㿀 P`< `"`, P@ {` P   299 ##9#9# ,@ I P 9  9c@  P9 c@  P 6cp@ @  P " P@ P:a" P"  P@  P!9` #@@6 P @`l" @5T P @X"`@ j㿘 P@@ P`D"`, Pa䀤 2 a @  P"  a$@y  "l Pb" 4 P   "8 P@h"`  BOOTREPLY from %s rejected.h * (`P",f @   @IȦ @C@6}   @:@6:@4"p0@DHCPOFFERDHCPNACKDHCPACK%s from %s rejected due to bogus yiaddr of 0.0.0.0.%s from %s rejected.` 9;0Q<0N:! cP:#c`:!cp"'Ē`@”  2 (#:  cx@@62  #@א@6(@40  (`P",f @  @ÐȦ @@5 2!:BOOTREPLY%s from %s%s isn't satisfactory.%s already seen.ARPSEND㿀!܀  (:#P;!@P` `,@ @S !;  !P@s@5Đ@4'P&  &  4 * @ w 2& P    2  `@"  g; 2 @ 2!9@3 0e 2P 0 $ 0P; <a $ ,@8c@@ P b@?  4@  @  P $P" P   "l4 $P` 2"`@ 2@"@ "l$@ &@`80;!`@30 !x@3Ē0 c@F=!H@dhcpoffer: no memory to record lease. dhcpoffer: no memory for option %d Invalid lease option - ignoring offerdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.㿘@(4 <@3# {  @(4 , 4@ "@ې  8W$ 8 @{@@ 4"*@ @  L, & ` @f !Ԁ "! 2!J , "!@ A & $<.!  @@L`, $* @@  $ 2! $<@2ѐ!H0 "! "J l @ & (< !`<@2 0< @2@  @`l (* DHCPNAK from %sDHCPNAK with no active lease. 㿀 (P ,@9 4@ѐ /P     $!<  #@@46@2P <@2#0@P>"@#@P "`kNo valid media types for %s!Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %ld㿈 P' 4lb "@  @ߐ0 6 b 1   P`< " P "`< P < 2 P`" P= @1Ӓ  P "@ "< P=`<`@2*  P= <a@֐@L 2 P * P8  b  "8@" P: `8@, $`8 P"f `8@$ P@" P: f @2`@@<  $`88 2 P b "8 P "@l84@ "@  "8?#  P2 H2 H P# `HbX2`0`'!=!@v P`8`@1   P ",'@#\@" P=laH 8@^No DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping. FAIL㿀 P>@@1t 8 P` 2Z P`s P' l I!>  P@@2@1U P>`p ,@ P9c@` P 6cp@X@h 2% P Pl   " P>@ x`@1+"@  P:a @Ք0>"@1 Ӑ@#@58 P` "%@ P @ 2@ "@" P` "@ P` "`  P" 2 P!L >@ "`  P"@0 > @` P 6cp@@ P "` Pf " @ l8bt @~@EXPIREDHCPREQUEST on %s to %s port %dx P! "l4"@2 b $  P "`>#@0J 2 P< 2 P ,=a@F@ 2 P P`," < P 1"l @,>c@/  P9c@ P 6cp@@6 @ch P 6cp@w@ P "`?08  b  "8@! P: `8@>, $`8 P"f `8@$ P@! P: f @4  `8@(< $`8 P`   "l@ `8 "  "`8 P   "l @$?'  P "H 7//    2?0#42H2H2H'!>#@u  @/쀢?" P "   P' @#\@!   P'@#\ @!   P>"lc8@uDHCPDECLINE on %s to %s port %d㿈# bX`'!? #@tʐ`@/  P",'@#\@ ޒ DHCPRELEASE on %s to %s port %d㿈# bX`'!@  p@t`@/  P",'@#\@  ??c  /  @ $@ P %@ @ Ԑ$@ $@  " @ ?" @  " @ "  P($@ &  $(&  `@ "  P&  @ " @ " @ "  P` @x% Ȑ$@ `$@ `"`@ `" @ " @ "  P"%   @ 2" P( , ? @#@ ?, "@ , @"  P& , @" @" @" ښ` P`@#\#`#d   @"  P"e Pe!+ !,"e P *`@ P *`A P *`B P@؋* C P"`D P@ 2`H " P P2 J 2`J P " L P" P P" T P" X P @ \?c  /  $@] P %@X @? Ԑ$@ $@  " @ ?" @  " @ "  P($@ &  $(&  @ "  P&  @ " @ " @ "  P  2 Pa ؐ$@ $!`4@  "`@  " @ " @ "  P ``2"%` @% Ȑ$@ `$@ `"``@ "`@ " @ "    @ 2" P( , ? @#@ ?, "@ , @"  P& , @" @" @" ښ` P`@#\#`#d   @!ך  P"e Pe!+ !,"e P *`@ P *`A P *`B P* C P`,"`D P2 H P`? `L`@=`  P"`L@ϐ " P P2 J 2`J P " P P" T P" X P @% \  / $@ P %@ @ Ԑ$ '  "  ?"   "  " a!$ '`4@   # @ ` "  "  " $ ' `"`` "  "  "  Pf -耢  $ f -'f - "  P& - "  "  "  P`@#\#`#d   @!<  P"e Pe!+4 P!,"e P * @ P *A P *B P* C P,"D P2 H P2 J P" L P" P P" T P" X P @ \P /ǒ $@ P %@ @ Ԑ$ '  "  ?"   "  !" a$'Ȳ`4@  # @   "` "` "` P#\`@#`@ #d P"e Pe!+4 P!,"e P* @ P *`A P *`B P@* C P "D P2 H P2 J P" L P" P P" T P" X P @< \㿘 $ " (@ (  @,  4  8@   , @wcan't create %s: %m㿘%  !@B!@{sc $B!@,W# "` `P " @{  `P`@p @`2`P "``P " @^  `P`@S @`2`P@flease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } p2 `0!#` `$#`[$#``0 5  2C!B!@zʒc &B!@+#C@7``02  "CC@.`C @)a!C` ! @?@-@`(C@a8`$C@ aP`,   C@ah ,`4 #x, `8  @!! Cax@,@1`!  Cal #\#`!@#d@` C al #\#`!@#d@ `Cal  #\#`!@ů#dC!@ūb@g!script_init: no memory for environment initializationPATH=/usr/bin:/usr/sbin:/bin:/sbinscript_init:n no memory for environment initializationinterfacemediumreason㿘 : d P"f P&@*  P"f P& 2DD@*א D@А!  Pf"@ P& 2 PD@*Ȑ!H P8&`" D P@ D P@D P@ip_addressnetwork_numberbroadcast_addressfilenameserver_nameno space to %s %sprepend optionappend option%dexpiry P!D "@&@,w@c< M @@<8' @  @ h#@@+h 3!D P "@@,K@7 2#( @ @P#@@+P #D P b@֐@,'@(D P@ $D P@   P&  V 4M-  "  P O  $0M& `H@  - #x DD"@*%c P @ P8& @  #x-  DD"@* c P8@r P& @@i,  4 8 x-   @!   P @X @  `D( @HD P0@vREASON=NBIfork: %mwait: %mexecve (%s, ...): %mhEc8@  P& b   & #Ȓb  h''''@' E#H@ʐ̀   E#X@)A '̔@E#h@)8@ "@z Pρscript_set_env: no memory for variablescript_set_env: no memory for variable assignment%s%s=%s㿘@m f,  @ 2fJ =2f@ "f@D 2  @0$f $fF@( f" @@@=@:@ڐ f,"@f 2fF@(ΐ f@(@@%@"F`@v㿘& "&& &@&"&  2&&& "* 2 H-2* _* H* Can't fork daemon: %m㿘 " @.p  "@ "a F@(l#00@ @ @z @x @v @Can't create %s: %mCan't fdopen %s: %m%ld 㿘!!&@”! BF!@({#0@ޒc 2!GF!@(q#0 @ڠ @¼@LInvalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%x㿘 4.` 8@ @ @@`"G!.` @P  G @() @  G Ȓ@(   G @(!P  p  p p p p p p p p p     p            p             p p  p p   p      p                                                                                                                                                                                                         J .( J.  .`.`Ѐ   Ѐ -2 `2J 㿐   N .А ( N   N " @q "N option_as_string: bad code %d \%03odhcp option too large㿘1͢#h% `H@&h#87L  #\ @J  `" @@H" @X` `'`$```\2 ,@ \,@ `,@`` @*L4,@H@&e#`1H#x#hrno memory for client state.no memory for client config.㿐5@ y7 @3!"0 @"@ " <$@" $@" "!"!,""$$@"" $@$@ $@ $@ $@@ * $@  * $@  * $@ *$@ *$@  * $@  * I$@ @t` @!? @@ ܒ@ؐ " .  P 2& @& $ PI@%  P @&  P& 2`2 P%@0  I@%  cȔ0@9 P"&  2 P "`?Corrupt lease file - possible data loss!㿐!@!!I@t` @ ? !I@’ @%#H@3hardware address parameter %snot allowed here.nested interface declaration.expecting a statement.semicolon expected.㿐@ T>`I*`J# @,0@(  * "@@  *  ~"@ x *  s"@ m *  h"b @ 0``@3̒`0ZIJ#@%Ӓ`@20R!!@  "K&! @!@0@b b  bbbb @30+@2ːb && `J@% @G0@ 0@  0@0J@% @@2^@ ;J@% X@2T )| * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * ( * ) ) ) * * *P *h * * * * * * * * ( )` * * * * *, *8 * * * ( ) )4 * * *expecting hexadecimal constant.hexadecimal constant too long.string constant too long.expecting string or hexadecimal data㿐@i~   @:> .@ @4~ ) @R`:@%`: 'aK@@T K  h@0  K (K H@$̰ @1expected option name.%s: expected option name.%s: too many options.expecting semicolon.㿐 @ݒ !!? K&!؀  #x,  @pk 2 !K.@ ! @ ,"ۤ ; K0!K@$x"0"(@$t@1G expecting interface name (in quotes).expecting left brace.unterminated interface declaration.㿐@!K!#8@F P 2& @w P& 2 L@ L ?$ L "a@i { K#`@$+@00K@$%#x0@? } Pf @KInsufficient memory to record interface %s㿘 "  @ 2   "  @v 2 @ `  L @"  `@  @+  b$"bno memory for state on %s 㿘@& & PL!@"ڒ  P @& no memory for config for %s 㿘!@Ȑ"0 P"f  P& 2 PL"@"  P"0&  @̔ P& @\no memory for lease. unterminated lease declaration.㿐@ {K@##`@0T0@(4 2 L@"" @(4 0 * .`@$ 0'@ƒ?a }@u@`2`Pސ0^ ` ` PT"   P `  2 @Ӓ  2`  P"` ``P $`P/"  P& "l 6  @ʦ    PL@#"0  P " P@"`  P"expecting lease declaration.㿐@>`:@*`M" `0 ;&`0@!K@"Ґ#8@/0+&`@0 /0$`,@ 0(@/%&`(@/ܐ!&`$@36&`@32&` @3.&`@’`40M@"! @/v@Ւ ;K@""(@/l 5 5 6L 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 5 6 6, 6< 6\ 6\ 5x 6\ 6\ 6\ 6\ 5expecting identifier after option keyword.no memory for vendor information.expecting identifier after '.'no vendor named %s.no option named %sno option named %s for vendor %sexpecting string.option data buffer %soverflowexpecting number.expecting identifier.trueonfalseoffexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.pԐ@   !!? M@!Ӑ# ;"J @.F @>@ߐ  M@ ؐ#@3 @ @ .' @@ !!?2  M@!#耤 ;" @.r "x@ 2  N "@'  @Ԥ  Ԁ@2NN ؒ 8@!}0@츐* : `2O"ܓ*` $@"Y@!N@Ԕ  $Ԑ;@ @/؀ ؒܠ $@;{@v!" N@!8 ;" @. Ԕ @0  @]!NԔ @0 є @M!NԔ @0  @= !!? NN@  ;"p @-ɐl @lȒ`Ѐ N@l’`؀ N /@l` N@l`耢 N/@ Ӑ ۀ ; L@N@ !0"`L@` @`AK?@L@`A ," ;J@  X0 @  `0NN` x@ @-{ @븐 *`@ "` * @  2 N@!0 * @ @M * &@ < = = = = = = ; = = ; = = = = = = 㿘 "` 1  1@#]@ $1@ැ@ഐ :,`"@ ,? #1#]c@  Lease %s%Y/%m/%d %H:%M:%S start %s end %s stamp %s hardware addr = %s host %s `!^   H@ߺ@ @@oߐ (#^ؖ`X @g(^@ p@oѐ , @g^@ @oƐ 0 @g^@u  u!^ t vs @l h^` `^ @a packet length %dop = %d htype = %d hlen = %d hops = %dxid = %x secs = %d flags = %xciaddr = %syiaddr = %ssiaddr = %sgiaddr = %schaddr = %02.2x:%02.2x:%02.2x:%02.2x:%02.2x:%02.2xfilename = %sserver_name = %s %s = %s㿈^ @" `^ @"( `@ ``^` "X@`` '!^"x@U@`!^'"@U@`!^'"@Uܐ@`!^'"@UӐ@ߐ `^ `" ` ` `! `@#\^`l@ѐ"^#@͒`, ^ ,` 8 #x,`  4   @ ^#@``,`^@#(%03x: %02xH  P */ _@m_@$@  *@ _@$@ڠ@Khash bucket %d:㿘 % !,  _!@4 " ` @&  2 ,/dev/bpf%dNo bpf devices.%s%s%s Please read the README section for your operating system.Can't find free bpf: %mCan't attach interface %s to bpf device %s: %m` _ 2@2 @  " ` _____"b@a_@^#` Hbl@ _# @PSending on BPF/%s/%s%s%s/㿘 "< 0 & 4`    Ǡ  ` 8` @` @@ Can't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %d bytes for bpf input buffer.Can't install packet filter program: %mListening on BPF/%s/%s%s%s㿀 'T& 0bq@f 6`@ǐ  ` 2 0`@  0 bp@P䀢 6 0`@!( 0bf@E `@!X @ڣ& < & 8`@!x "& @& D#"D 0 ''bg@%耢 6 `@! "< `!     ` 8` @` @@͔ fallbacksend_packet: %mx`\c'@Ð  '#\@@``#\@~#`' 4 '''@ݔ谒 `@e#ȁ㿀  @ D@2  D 0 8@W < W$ @$ D D @"@  8@ @ܸ  @ D <$ @*`2 $ @37 $ @ 8@ 6 @ @%   8" $ @  '@  @  $ @"  ' 8@z@  @$ @ $ @ " @   㿘  @ "s`4#?attempted to reinitialize icmp protocolicmpunable to create icmp socket: %mUnable to disable SO_DONTROUTE on ICMP socket: %m㿐#cЀ  a@ "a"$c@U 2  @| !퀢 $#a@ l"#?c' @|3  ba@ ^"b#Ԑ<attempt to use ICMP protocol before initialization.icmp_echorequest %s: %m`#Ѐ 2 a@ 8#    ///'77/77Β  @C@^7#Ԓ  @b  6  !b'Ġ 0@RĒ@ J `?icmp_echoreply: %mp  'Ԓ%ܖ @:ޚԀ  /b@ .!(0?쀢`'  '' @ۋԐcSc㿘  4@(b a@N  " &  `@d !؀  `l@T ! `,@K @option %s (%d) %s.larger than bufferMany bogus options seen in offers.Taking this offer in spite of bogusoptions - hope for the best!rejecting bogus offer.parse_option_bufferCan't allocate storage for option %s.Can't expand storage for option %s.㿘@u@`o`@'@`@ ',!##x, $#bb"@ {## b & b$#@ o"b@ l#b@ i#00M@ f#PJ&  8  4bchX  #x, b@ #@ڽ. 4#"@bch ? 2 #x, b@ #@ڤ@@@ڟ@$@.:%@@ ` @ ` & ``d "` ! @} * 2 \ !* @8Ȑ 5*@  6*@   3*@   8 *@ !` `! !,8!(@O `  !,8!(@C  ! tcx@; t ?"Т@ y 2`@Ȁ#\#\#`@eb! &`@` T` *@  N`z 4 * * **?"А`@@  ' @`l@@ . . $. @`l@ڔ ?bА@' @͐`,?`l *@ * ?`l㻘\'H'P @ $ i P ,`"_` 2[` %@( S`` #x , J t ` A  `<`    '@ 4% H ޖ-* ,@@^@@* ,@@T@  @@Ȧ`@Ppretty_print_option: bad code %d %s: Excess information in format string: %s %s: garbage in format string: %s %s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of array \%03o%ld%d%xtruefalseUnexpected format code %cdhcp option too largep; ? c' d"@ 9  ,cx .    a@jx .   @+ @?* : `3=f#*` +;  @N@ @ @ N@ @ \J  2`@ x t+?+` : @*?ِ t+`+?` ` `x` @ d#0@ cx .  `J @#x.  d#X@ 1dcx` @ d@ #쀥@@ #x.  &d@ #@ @x#x.  !d#@l&@ Ȓ&  @cت @ʐ` ?* : `6*`f"  5 "- 1  #\ @J  `"@@d"@Ȩ  `'`$```\2 - \-  -  @*L "i- "- c-@ ѐ'@NԒ@c!d#@ ̐!d#@ @Ӓk$D!d#@ ː* : !d#@ * 2 @U$.Ldؐ@ dؐ@ d@ d#d#@,$0dJ@ #@-@*$`@  : -  @<ؐ`- @+ ce@ 1d# x  X x Discarding packet with invalid hlen.do_packet`` g@ h06 (8@5'''В@Ô '?'̀  " 'Ȁ Ӧ S ,    " g@`  , consno memory for cons.㿘ga  2&g@ڐ!&& tree_cache㿘gM! " " "" " " tree_host_lookupNo memory for host lookup tree node.㿘g"@ 2 g@"X &@& enter_dns_hostCan't allocate space for new host.㿘g"Ȑ ƒ " g@辐  $g@"@j}$ $ $ $ tree_constNo memory for constant data tree node.㿘g#pȐ 薐 & g@X# & @& tree_concatNo memory to concatenate constants.No memory for data tree concatenation node.㿘 `?2@; ,h@ 2(h`h``V 2`h@ `@տ```@պ``Y`V$``` F$`b  2 h@ H && & tree_limit㿘 h 4$  E!  && &  tree_evaluate㿈 ' ''0 @3$ 쀢h$   !  '  '@' " $$ $ Bad node id in tree: %d.㿘 "  h0/ !h0*!@A@1̐&@"1#%s: host unknown.%s: temporary name server failure%s: name server failed%s: no A record associated with addressdo_host_lookup㿘) "l@t@ 2* " "i   i"l i"l@@ "l@; ( "li@5 P"l@0 h"lJ < @ "  `,`@ 2` @׿ @i  2   "l <(& "&&&   @ן,`@ @h` @.@"ln&&@㿘" $@@E &㿘   5 7   3 8 9 &(&&bh " "b8*8*'"㿘 ? & @J  & ` 2)"``  8 #@   8 "bh"8   8 "# * Q  b8*?b8*@ " 㿘4:  #\     -   ""4"b0@0F#\      ""4"b0@06    ""4"b0"*ؐ++        "$  #  ##\     # "@\ 2.   ""4"b0@m㿘 `   "4  "8 ""   #"4 ""0  #` b8 "b   $㿘)   % 4' 0# $`! $ k4% `  "h "" 0$4 $`$0$   & 㿘? eof in string constantstring constant larger than internal buffer㿘   * %%`j@O#(%  * `\`"  %2 j@:#@%   "`*!numeric token larger than internal buffer㿘# ,`   x  #\   D  `@B   "``* %%2 k@ 0%   "`*!token larger than internal buffer㿘! , ! z-_#\    @   "`#\   D "!  * %%2 k@!8%  * "`@lways-reply-rfc1048ppendllowliasbandoneduthoritativeackoff-cutoffootpootingoot-unknown-clientslassiaddrlient-identifierlient-hostnameomainenyefault-lease-timeynamic-bootp-lease-cutoff-lease-lengththernetndsxpireilenameixed-addressddiroupet-lease-hostnamesostardwareostnamenitial-intervalnterfaceeaseax-lease-timeediaumameserveretmaskext-serverotptionne-lease-per-clientrependacketangeequestequireetryenewebindebootejectearchtartsubnethared-networkerver-nameerver-identifierelect-timeoutendcriptupersedeimestampimeoutoken-ringser-class-host-decl-names-lease-addr-for-default-routeidnknown-clientsendor-class㿘N  H*  ?* : `o *`  kbP@O k!Obh@O} k!Fbp@Ou k!6bx@Om k!=b@Oe ky!?@O]b sq!M kb@OS kg!@b@OK k_!7b@OC kW!9@O;b  O!" kb@O1 kE!b@O) k=!b@O! k5!*@Oc /-!I kc@O k#!Cc@O k!8c @O  kN  k!: @Nc( !c8@O 2N  !kcH@Nܐ k! @NԒcX !! kch@Nʐ kް!cp@N kְ! @Ncx аΰ!4 kc@N kİ!c@N k!@Nc !K kb@N k!c@N k!%@Nc !' kc@N| k!c@Nt k!@NlcЀ !H kc@Nb kv!A@NZc耢 pn!1k @NQc ge! l`@NG l[!`@NY  2T l`@N6 lJ!;@N.` DB!< l`(@N$ l8!B`8@N l0!`@@N l(!#@N `P " !N l`X@N l!@M`` !& l`x@M l!G@M` ! l`@Mސ l!`@M֐ l!+`@Mΐ l!,`@MƐ lڰ!.`@M lҰ!2`@M lʰ!3`@M l°!>@M` !J l`@M l!D`@M k! b@M l!`@M l!`@M| l!`@Mt l!a@Ml l!a@Md lx!/a(@M\ lp!)a0@MT lh!0@MLa8 b`!E laH@MB lV! aX@M: lN!-@M2a` HF!$ lap@MB  l lax@M l3!a@M l+!(@Ma %#!La@M l! @La !5l @LaЀ   !k @Lb ! 0   T  ( < < p exiting.exiting. 㿘! "'H'L'P'T'X@$ "H$@c@ " @Sa !! "o@A@" oa  @ o @SMa(!  o!!a8@Z@@K 㿘! "'H'L'P'T'X@u$ "H$@c " @S& !  @@ oa  @  㿘! "'H'L'P'T'X@K$ "H$@bې " @R !  @ܐ@Ľ oa  @ĸ  㿘! "'H'L'P'T'X@!$ "H$@b " @RҐ !  @β@ē oa  @Ď  %s㿘 " %`N m`@hp(@ &@(. *` 2: .%s line %d: %s%s^^ 㿘 "'H'L'P'T'Xƒ$ "(# ! b4"pВ$@H$@bL! " @Rm " 1 " @Rh b4 P  b0" qp"  @RZ`! & @:@ #oa  @ " @-@  @   "0c @ p` @   "b 㿀@'@@@T 0 ' `  @ *  @?  x@'ؒ@5  ?` ؐ8 @  '@ 0<     *  * ۘ?@  㿀@@@'@ 0 6  `  @ 2@*   '@  x ' `  @ *@*  ܒ @Ȕ ܁㿘@2  @``?㿐   q" a'@Cw  "@t+ 1 q"a(@t$ 1 "     @ ?8" *@  ? @ (8"?(㿘@x<*@ * @`@'   \7///''777  7@ @A   & "*`77ܕ277ސ  7ސ@ @   &㿘@y%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packets㿘@@5  `* & B]  3 b  h&b@ 4h?qb#t&b[& @q# %&5 ``  &1 " ?&"@d 4??r" K&2&""`rm 0` ` 6` ! " $" 1 " &"@3 4?r" `"&"$"?@ 6Can't create dhcp socket: %mCan't set SO_REUSEADDR option on dhcp socket: %mCan't set SO_REUSEPORT option on dhcp socket: %mCan't set SO_BROADCAST option on dhcp socket: %mCan't bind to dhcp address: %mCan't bypass auth IPsec on dhcp socket: %mCan't bypass ESP transport on dhcp socket: %mCan't bypass ESP network on dhcp socket: %m㿀 "   ?/7'  @k  r:" #?'c @j  6'r*"'c"@j  cr"c @j  6r#0@jĔ  6'r#h'  @jϘ ?  " -r#  @j ?  " -r#  @j ? " -rא#Sending on Socket/%s%s%s/㿘{ b<`& 4 s! s"s" s"  send_fallback: %msend_fallback: please consult README file %sregarding broadcast address.㿘 4 @Q ? s" " 3ss"bfallback_discard: %mx   4&'ܒ @)M܀ s#h㿐@ 㿐@  g( 3f+gf# g( 3f+gSf#㿐'@ 㿐'@ؔ 3f g2`* *#3f g2`* *#㿈  @ɻ   @!   @ɯ  @ (7@@ɣ  &㿈@@ə @ɕ   .. eoption-endoption-254option-253option-252option-251option-250option-249option-248option-247option-246option-245option-244option-243option-242option-241option-240option-239option-238option-237option-236option-235option-234option-233option-232option-231option-230option-229option-228option-227option-226option-225option-224option-223option-222option-221option-220option-219option-218option-217option-216option-215option-214option-213option-212option-211option-210option-209option-208option-207option-206option-205option-204option-203option-202option-201option-200option-199option-198option-197option-196option-195option-194option-193option-192option-191option-190option-189option-188option-187option-186option-185option-184option-183option-182option-181option-180option-179option-178option-177option-176option-175option-174option-173option-172option-171option-170option-169option-168option-167option-166option-165option-164option-163option-162option-161option-160option-159option-158option-157option-156option-155option-154option-153option-152option-151option-150option-149option-148option-147option-146option-145option-144option-143option-142option-141option-140option-139option-138option-137option-136option-135option-134option-133option-132option-131option-130option-129option-128option-127option-126option-125option-124option-123option-122option-121option-120option-119option-118option-117option-116option-115option-114option-113option-112option-111option-110option-109option-108option-107option-106option-105option-104option-103option-102option-101option-100option-99option-98option-97option-96option-95option-94option-93option-92option-91option-90option-89option-88nds-contextnds-tree-namends-serversoption-84option-83option-82option-81option-80option-79option-78user-classstreettalk-directory-assistance-serverstreettalk-serverirc-serverfinger-serverwww-servernntp-serverpop-serversmtp-servermobile-ip-home-agentbootfile-nametftp-server-namenisplus-serversnisplus-domainoption-63option-62dhcp-client-identifierdhcp-class-identifierdhcp-rebinding-timedhcp-renewal-timedhcp-max-message-sizedhcp-messageBAdhcp-parameter-request-listdhcp-server-identifierdhcp-message-typedhcp-option-overloaddhcp-lease-timedhcp-requested-addressx-display-managerfont-serversnetbios-scopenetbios-node-typenetbios-dd-servernetbios-name-serversvendor-encapsulated-optionsntp-serversnis-serversnis-domaintcp-keepalive-garbagetcp-keepalive-intervaldefault-tcp-ttlieee802-3-encapsulationarp-cache-timeouttrailer-encapsulationstatic-routesrouter-solicitation-addressrouter-discoverymask-supplierperform-mask-discoverybroadcast-addressall-subnets-localinterface-mtuSApath-mtu-plateau-tableLpath-mtu-aging-timeoutBdefault-ip-ttlmax-dgram-reassemblyIIApolicy-filternon-local-source-routingfip-forwardingextensions-pathroot-pathswap-serverdomain-nametmerit-dumpSboot-sizeXhost-nameresource-location-serversimpress-serverslpr-serverscookie-serverslog-serversdomain-name-serversien116-name-serverstime-serversIAroutersltime-offsetIsubnet-maskpadunknown-255unknown-254unknown-253unknown-252unknown-251unknown-250unknown-249unknown-248unknown-247unknown-246unknown-245unknown-244unknown-243unknown-242unknown-241unknown-240unknown-239unknown-238unknown-237unknown-236unknown-235unknown-234unknown-233unknown-232unknown-231unknown-230unknown-229unknown-228unknown-227unknown-226unknown-225unknown-224unknown-223unknown-222unknown-221unknown-220unknown-219unknown-218unknown-217unknown-216unknown-215unknown-214unknown-213unknown-212unknown-211unknown-210unknown-209unknown-208unknown-207unknown-206unknown-205unknown-204unknown-203unknown-202unknown-201unknown-200unknown-199unknown-198unknown-197unknown-196unknown-195unknown-194unknown-193unknown-192unknown-191unknown-190unknown-189unknown-188unknown-187unknown-186unknown-185unknown-184unknown-183unknown-182unknown-181unknown-180unknown-179unknown-178unknown-177unknown-176unknown-175unknown-174unknown-173unknown-172unknown-171unknown-170unknown-169unknown-168unknown-167unknown-166unknown-165unknown-164unknown-163unknown-162unknown-161unknown-160unknown-159unknown-158unknown-157unknown-156unknown-155unknown-154unknown-153unknown-152unknown-151unknown-150unknown-149unknown-148unknown-147unknown-146unknown-145unknown-144unknown-143unknown-142unknown-141unknown-140unknown-139unknown-138unknown-137unknown-136unknown-135unknown-134unknown-133unknown-132unknown-131unknown-130unknown-129unknown-128unknown-127unknown-126unknown-125unknown-124unknown-123unknown-122unknown-121unknown-120unknown-119unknown-118unknown-117unknown-116unknown-115unknown-114unknown-113unknown-112unknown-111unknown-110unknown-109unknown-108unknown-107unknown-106unknown-105unknown-104unknown-103unknown-102unknown-101unknown-100unknown-99unknown-98unknown-97unknown-96unknown-95unknown-94unknown-93unknown-92unknown-91unknown-90unknown-89unknown-88unknown-87unknown-86unknown-85unknown-84unknown-83unknown-82unknown-81unknown-80unknown-79unknown-78unknown-77unknown-76unknown-75unknown-74unknown-73unknown-72unknown-71unknown-70unknown-69unknown-68unknown-67unknown-66unknown-65unknown-64unknown-63unknown-62unknown-61unknown-60unknown-59unknown-58unknown-57unknown-56unknown-55unknown-54unknown-53unknown-52unknown-51unknown-50unknown-49unknown-48unknown-47unknown-46unknown-45unknown-44unknown-43unknown-42unknown-41unknown-40unknown-39unknown-38unknown-37unknown-36unknown-35unknown-34unknown-33unknown-32unknown-31unknown-30unknown-29unknown-28unknown-27unknown-26unknown-25unknown-24unknown-23unknown-22unknown-21unknown-20unknown-19unknown-18unknown-17unknown-16unknown-15unknown-14unknown-13unknown-12unknown-11unknown-10unknown-9fddiunknown-7token-ringunknown-5unknown-4unknown-3unknown-2ethernetunknown-0dhcpCan't allocate dhcp option hash table.㿘|#p% !$@@ "`|^#x , cx@ , `" @  `@    a""x@"x5 㿐 텒 } {`V0 ; ` ` D0@?ޠsemicolon expected.㿐1 ;}  Ɛ filename must be a stringno memory for string %s.㿐! }Ӑ!@ @A@  }ڐ!` @4 @h  2expecting an identifier in hostnamecan't allocate temp space for hostname.can't allocate space for hostname.㿐  ǒ !!? ! }" TH @@  }"H`@ @g隐@ِ@쿒 .쓒 ."Ȧ@n 2}g"p,@@$@@@@~@ .,@ 2㿘 &@` . @ @ expecting a network hardware typehardware address too longexpecting semicolon.㿐A!$" !K!~0 ~0   .@ .@ .@ Xǐ01'  : @|  & ( `@~ݐ ` `.`@` `" @@ @  ;~Ð Expecting numeric lease time㿐!~!0 @) can't allocate space for numeric aggregatetoo few numbers.unexpected end of fileexpecting numeric value.no temp space for number.can't allocate space for numeric aggregate.㿐  `  "@R & @s:   ~l"p ~Q"b !릒 R } {"~p~5" ;"q m c`?Ӏ! ~! "W  @``: @|@  ~"@q @fI(  )@ے & @:  @~#@``: "@&@T`&`:`@$ @2Bogus number: %s.Bogus number: %s: digit %d not in base %d value %s%o exceeds max (%d) for precision.-value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %d 㿘L@ -  `2(L@L@ 02# L` x ` ` #\@   `!朗"" L@ `` ? @ /??Ѐ@-L@` *  *@ & "8 "x"h"p c ""h"p W "  "ؐ %. 0!Ғ 0;0, "  " .ē2`00!numeric day of week expected.numeric year expected.expected slash seperating year from month.numeric month expected.expected slash seperating month from day.numeric day of month expected.numeric hour expected.expected colon seperating hour from minute.numeric minute expected.`Đ鲒! u! ;" E  @9''韒! b! ;" 2 @9Ā'l'ܐ8'ܐ鈒 / K! ;"  x! ;"( ;"԰  а @8Đ?'ؐd / '"@ ;"  T! "p ;"  @8'ԐA! " ;" Ԑ @8'А. : " ;"  ! "؀ ;"z v @8'̐  : ΐ" ;"g c ! "؀ ;"W S @8p'Ȑ'' ;} }B ܐ* @*`@*`@,ؑ: `  `?Ԁ`Ȓ*` x   ?* @*`@ *`" * * "@*`@ @ *` *  * "@*`@*`" * 㿘@  @xpsoftdepforcereloadupdatesyncasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:ffsmount table fullspecified device does not match mounted devicefilesystem not supported by kernel%s on %s: %s @y}'   """c' %#- /  o@e@O@a? ?c* & @ @@@?'`' '' @ ⨀ "  -  0  0  !(!@!p@V ba@ @ usage: mount_ffs [-o options] special node 㿘c @!@ ,-o %s: option not supported㿘@cg  @F 1' n L  o  @` = 2*`"@9 2   @2    &*@&cx@6  @~Ԓp 2L@T㿘@Qhaltdlnpq%sreboot???halted (with powerdown) by %shalted by %srebooted by %s~shutdownSIGTSTP init/etc/rc/dev/consolerevokesetsidopen/bin/shshSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): h'D@xh'HP ؐ    @> "a @>ΐ a8a0@9H @Ā @ ?2 aP@" @  @ !`@M’ ?J?@?D @ !h@(?@3!x@?2@+!@ ?2 @!! @R @O@L  $@Ȓ@ ̔`'̒ @  !a@<@ @ ?@ ? " @a" @ @@  @,  ?@~ ? "  0@a@ @m ?H!@ usage: %s [-dlnpq] 㿘P <c@@!@ 㿘@ cannot seek temp fileout of memorycannot read temp file㿘 "` {  H  H   "`<  @"   = H @:֔ 6 @[ S#'—  >%#c̠  |$c̔" @f 2c@[֐ @ #c̐? $c!#؀  @H #؀ 3 @{ / $‐?$| $c!#؀  @3 #؀  @f    |@u   H@[ #@ Ұ 0 >  B|= H+|line too longcannot write temp file㿘@ʐ  @[| 7#N 2 #&@+!+ `< ' ࠒ @:D  6@[_ #@! : < H%`<ࠐ @.  ! ?? : H@[F "@ y 0  H<@ $ H <`B< H 㿘! @5 T &X"` T"& `"X$ Tinvalid address㿘 "`@  ``@ @  @@@ `@@ 6#?㿘c"  )"c `X :  A!"`"℀@#"7c"d" /#"" "℀@#"%c̑:!" "℀@#"c "` "b  #"  `@""c̐? #c1#؀  @ #؀ "@Q "/tmp/ed.XXXXXXXXXXw+cannot open temp file㿘"  " (" a @^@t? @Za  "`?@ǐ@Zf@ "? cannot close temp file㿘1  " @z  @ZJ"@ ~" ?& @/"    : H"`< 㿘  @z@"@㿘 `!@(     "` ""`"`*  $*" "((  #"    * 㿘 P"b"*P* * * * * * * @_; @Ҡ   x@2 ,@  㿘#!b"@ "H@*$b$"" b "H `$b?㿘#b ! "H@ $"$b"  b "H*@`$b ?㿘#b  ! "H @$"$b"  b "H@z  ?Enter key: 㿐@i"N  @  @А@2  ? 㿘  @Q!b@ ?Ѐ6Q(K I `F?D `A?? `<?: `7?5 `2?0 `-?+ `(?& ` #?! ` ? ` ? ` ? ` ?  ` ? `? ? . .. catchmodchgrp cp dd df edexprhostname0B ln lsmkdir mt mv pax tarcpio rm ksh shsttysleepsync . ..chowndmesgfsck_ffs0Bfsckreboothaltifconfig0Binitmknodmount mount_cd9660; mount_ffsB mount_nfsBnewfs mount_mfsBpingrouteshutdown0Bslattach0Bumount disklabelBpdhclient0B @ :]U!<߀<߀<1->Ia<<<?g!<<<1-?}xa<ܓ<ܓ<@':J!<W<W<@wa<ׄ<ׄ<A) 4!<G<G<AM|a<t<t<B+\!<8<8<B.a<e<e<C?!<(<(<Cw;þa< U< U<D!<"<"<D]a<#F<#F<E6ѣ!<% <% <E"{a<&6<&6<FD!<(<(<FWga<)'<)'<G~g!<+<+<Ga<-L<-L<HX!<.}<.}<Hta<0G<0G<IR!<1xˀ<1xˀ<Ia<3B<3B<JJѲB!<4s<4s<Jha<6=<6=<K9 (!<7n<7n<KBa<98p<98p<LU8 !<:i<:i<LM5a<<<M͝L+!<bZ<bZ<MMTWa<<<NZ!<]J<]J<NIua<w<w<O=|!<X;<X;<O La< h< h<р&!< S+< S+<р:{a< X< X<р-!<N<N<р:ATza<I<I<р!<I <I <р:îEa<z9<z9<рټ!<C<C<р:NJa<u*<u*<рZ͗W!<><><рja<<<рA!<9<9<рj#DAea<<<w=k3!<4΀<4΀<w  a<<<w+%!< /< /<w ~aN!<+<+< X +|'a<,<,< ,:!<.}<.}< X ,a<0G<0G< -K&!<1xˀ<1xˀ< X -_oa<3B<3B< .zf!<4s<4s< X .,keZa<6=<6=< /uq!<7n<7n< X /wa<98p<98p<沀0Xʚ!<:i<:i<沀 0a<<<沀1h#!<À<À<沀 14a<<<沀2^,!<]J<]J<沀 2.%a<w<w<沀3F%!<X;<X;<沀 3rWa< h< h<沀4/r!< S+< S+<沀 4hubfa< X< X<沀5~T!<N<N<沀 5$Aa<I<I<沀6ȵb!<I <I <沀 6Jma<z9<z9<沀7;oH!<C<C<沀 7xa< < <沀8!<><><沀 88-a<<<沀9Rj!<9<9<沀 9{pa<<<沀: !<4΀<4΀<沀 :B'`a<<<沀;!< U< U<沀 ;f@Ka2!<)'<)'<沀 >>a<*T<*T<沀?A~!<,<,<沀 ?!ka<-D<-D<р=iaa<7n<7n<р{ga<8ـ<8ـ<р0?a<<<р? !<À<À<р6H!<<<р6ܛ!<Ĵ<Ĵ<р6\ua<<<р˙a<<<рoa< h< h< h)D!< < < h6/':7!< X< X< h6!< < < h66a<I<I< hCa<v<v< h .a<z9<z9< h|!<C<C< h6U!<u*<u*< h6X!<><>< h6xma<p<p< h&a<9<9< hZl[a<k <k < h!<4΀<4΀< h6@!<e<e< h6LFM!< /< /< h6޿pa` c4P @ )#8  >%#c̐ 4 $c̔" @ 2c@Vc @ c̐? $c!#؀  @Ր #؀ C?@ ??%#8?$4 $c!#؀  @ #؀ "@ c4@'c4 "`L  @8 & @  &  T@w     J`@ T 㿘 `% 8   9# 1#̠`&#`@,  2#@U @) #̐? &#!#؀  @g #؀  ?@ ?$8?$` &#!#؀  @R #؀ @  `* "  $㿘.   6%3 ; `h `h. ` `h`  ! ` !    (     " (@  @  *``"㿘!## `    `$#"h"# @#`8#$`? $#!#؀  @ʐ #؀ @ rcannot open input filecannot close input file%lu 㿘N !c(@ @@2}c( 2@U#0@; 6N(? ! @g  #@uk  @T#H@2?0#a#`#h @}” `T&newline inserted newline appended 㿘ސ `X  @  (`?  cĴ  `  # ("  " TRc `4&c̀ c̐? K&c1#؀  @) #؀ z?@\ v?`$``T @( c̐? +&c1#؀  @  #؀ Z?@< V?̐? $3c؀  @ c؀ "@( @N 3 :?    @&a (      @&a (  "    %("%( cĐ`&   " out of memorycannot read input file㿘 + O-i`0  ?/ #c̠  $c" @ 2c@T @4#c̐? $c!#؀  @r #؀ ?@ ?%`0?% $c!#؀  @] #؀ @ ,*`  "` Ā " ? & @wܐ  &  @ `0  ? #c̐ ` $c̀ " @) 2c@S @͐#c̐? 4$c!#؀  @  #؀ B?@> >?%`0?% $c!#؀  @ #؀  @)  2   *@ @ @Sb @#? /  *@  "(  * `  (` ?wcannot open output filecannot close output file㿘N !c @ @$@0`2@S #(@2 6N+? ! @l  #@sp  @S#@@7?0#a#`#h @{ǔ&  㿘cĮ  `'@&- + )   X@ ``  ( *@ @ 6@?`@Ā   " cannot write file㿘"  !##Ā  N@ڲ`  N@@` @R @a?#İ unexpected end-of-file㿘  J "@W &?& c| ?+#c̠  $ccx" @ڒ 2c@RJ @~#c̐? I$c!#؀  @ #؀ Ӱ @ ϰ %|?%cx $c!#؀  @ #؀ @ڐ cx@cx @`* 5?@ `*?@ &   "@@ J |@20  ?%̠  $cx"" @r 2@Q @#̐? $!#؀  @T #؀ k @ g %|?%cx $!#؀  @? #؀ "cx@r cx@@`cx@ cx|  = #c̐ cx$c̔" @$ 2c@Q @Ȑ#c̐? $c!#؀  @ #؀  @9  %|?%cx $c!#؀  @ #؀ cx@$ cx*&cxstdincannot read stdin㿘)!  3 / ? %@uk!  %!X' d >+ !#̰  b@$#̔" @ 2#@Q- @a##̐? G$#1#؀  @ #؀ K?@Ґ G?$d?%b@ $#1#؀  @ #؀ b@@ b@,`*`  "` ` 2`p b@&`p*@b@! @ ?@P"@" % ?6 ?6 + b@*b@%%d \  \abfnrtv\㿘 @9  !!'  `@ @#L!` !` ^*`: \!``?"`` !`@" !`` \?"``!`* $!`@" \N``!@Re !`"@?M "`  !`]* @" ^!`2  0`"@  !`* $!` @"f !` 82  0`"@  !`* $!` @"N !`  0`"@  !`* $!` @"7 ``N?"`` !`* $!`@"" J !``?"`!` * $!`@"  @(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. *usage: %s [-] [-sx] [-p string] [name] 㿘!`@TG!'HOMEp:sx ? interrupt? invalid filename%s warning: file modifiedscript, line %d: %s unexpected end-of-file8'D'H@ju@a! H "b@3  H J r`?"#/- ' % !)+"$ x p"0 0 %$ $#H!`@x6@+ H(D@u?• sH*@'HD" 'DD`HJ@-D `"#"H 'HD'D@ ! $# @   <      @ @ $#@%!`@ @ѐ cT@  ah@   @ a@  @{"  !0@!a-!8LD +"cHJ@%H@@ H   #` )HJ@!#H#@SG D a@!^!HH@J2!P#`t !`?%#!7 5-+') ;   Ȁ ha@wh!`  $ @!/@. ?'  #Ԁ`a@!Hap 2 Ȗ a᠐  p@w=!`/  ?&)  "@ J  ! ? ?5  @["  ?@ & ?  `T@  ?a??+(a a&@ ̐H^ap!  Ȗa a᠐  p@v!`0 a!h᠐ @v!`Ԑ a@ H`h Ȗ a᠐  p@vΖ!` Z 㿘 T   "`P""X"       &"X$P$ J`,`; "X`;# $`T@" "X 4  &"X  $P ?number out of rangeinvalid address㿘  T # $``#\  ` `J?`U L*` €``$`#\` `$` @  ` 2   @,  @$<#@r!8 - ^2q o&  `2Ŗ - ^2d b?Y``@,v  $<#RL!8G` . 4$`GT?@W / @ `? 9`J@ `$`+``$`J``@$`  (? ` ;X` $`"X  T"`  X` ?  X@ !P5?\ MOOOOOOOOOOOOOOOOOOOOOOMOOOOOOOtOOOMOMOO(NNNNNNNNNNOOOOOO(OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimiteraw%d ! unknown command㿘   ! $  #\  ` *: `p $ #*` €  J`n" `p`l   2  $  $  $   J ` $ !  ` @ @ x`΀  `T @J Ӕ  J`n" `p`l   2  $  $  $   J ` $ !  `2 @b `P @  &?@ 9T ? `T @   J`n" `p`l   2  $  $  $   J ` $ k!  `2 @  `P @  ^T `X   2U$T0S  `#Ԁ`"K? "X`A! #\ @ `7!@ 4 J`n" `p`l   2  $  $  $   J ` $ !  X@ 5  & ?@ &? 6L@?  !#@O L@  @J#耢`!#ג &ݰ?@? "#""c "X`ɐ! #\ @ `!@ "?L@ ! "J`n" `p`l   2  $  $  $   J ` $ !L@ !#@O1 @ #@0  `z"(  X@  ug G Y jG V` `&  J`n" `p`l   2  $  $  $   J ` $ ;!`%(  "X`,!  J`n" `p`l   2  $  $  $   J ` 8$ ! "X`!  J`n" `p`l   2  $  $  $   J ` $ ې!Ȑ " "Ja` Ҕa`!@rǒah0  `!P  J`n" `p`l   2  $  $  $   J ` $ !  ``@Q`@ /?  `T@    J`n" `p`l   2  $  $  $   J ` $ e!  ` @   P` Z@ H   J ` $ G!P J`n" `p`l   2  $  $  $   J ` $ "!N`@ ђ  `T@   J`n" `p`l   2  $  $  $   J ` $ ! `P @ k   ? `T@X  )  P  "X```  X@6% PȐ!P %` "`  J`n" `p`l   2  $  $  $   J ` $ !  `@N@   `T@   J`n" `p`l   2  $  $  $   J ` $ c! `P @ ݔ  ] [? `T@ʒ S  J`n" `p`l   2  $  $  $   J ` $ -! `P @   ' %? "X`!  J`n" `p`l   2  $  $  $   J ` $ ! `$  `$ " 2"  " "X`ߐ!  J`n"  `p`l 2 $  J ` $ !  `?#Ԁ`q0 #\ @ `2 !"X`  X "`@}  J`n" `p`l   2  $  $  $   J ` $ {!  `@0J##耢` L@ ! @L L@  @L#耢 \!#  N &T?R  X N  K"`#' )#-J` > J`g" `p` "0+`9*`0&`r 0$  $  $ @&`  @@an8%!%! ?$a   `2"x"! J@  J` 2"#` "#̀ @   ̐? $!#؀  @ s #؀ ɰ?@  Ű?@ @2@Q  "`% ̐? $#c؀  @ R c؀ @   #a@ a &?  `a a ?$aa $aa  ?$a%  J@ n" p l `2 `` ` ` "$ `T@ג `  J`n" `p`l   2  $  $  $   J ` $ :! @ a@ "  `T@ () #  PW` ! "X```  X@6% P!P$`  J`n" `p`l   2  $  $  $   J ` $ !  `@@Ԁ  "X`ؐ!  J`n" `p`l   2  $  $  $   J ` $ !@  J`q`Q  $ ? #\ @ `!@t  "X` % X X  " "`PX@  &?  J`n" `p`l   2  $  $  $   J ` $ ^!J##耢` L@ ! @I L@  @L#耢 F!#耤W""  P  `* 3X /"  `+#Ԁ`'`q%#? "X`!  J`n" `p`l   2  $  $  $   J ` $ !"c  T  "P@^`  ?ϐ   @$$  @<#@ /!8" ϰ?"   J`n" `p`l   2  $  $  $   J ` $ !   `X@  @  ?  J`n" `p`l   2  $  $  $   J ` $ m! "Xb    X@ 0a "X`X!@ U  J`n" `p`l   2  $  $  $   J ` $ /!!  `!h@̒` `@ cԀ "@"0  T  "P@`  ` @  ?"!"H_?sshshshshshshshshshshshshshshshshshshshshshshrshshshshshshshshshshshshshshshshshshshshshshshshshshshqDshshshshshshshVlshY[pshshshshshshshccshshshshYlshshshshshshshshshSdshT(U0VHXLYZ\h]L^@__aTshb,cdfljlYlo shoН㿘 "X`  " P"` P` 4    X  Ӑ!P?no match㿘  T3?1?% ) `X  ?,X `T~e  ` ]   @  `Tڀ`!Ȱ?filename too longout of memory㿐  J@ 6$``#\  `   !P $`J@ !`@}$` ' !  `!h@ś`c ` "M[ ' 9%1#̠"`&#@ 2#@C 6"#̐? &#!#؀  @t #؀ 6 @ 2 $ ?$ &#!#؀  @_ #؀ `@ `'J@   @a`* '# J@  *@@  shell access restrictedno previous command㿐#Ѐ`'!H +  `"` ? a  >-%̠  $̔" @ 2@B "̐? $!#؀  @ #؀ ?@% ܰ?%a?% $!#؀  @ݐ #؀ @  !*@J@ i / 5 7 J@ !T %a < !#̐ $#̔" @ #@B- b#̐? $#1#؀  @ #؀ ?@Ӑ ?%a?% $#1#؀  @ #؀  @   *@ J \% *@' @ Ja >!#̰  $#" @h #@Aؐ  #̐? 7$#1#؀  @K #؀ 9?@~ 5?%a?% $#1#؀  @6 #؀  @i    *% ` 3 J  24!`a =% !#̰  $#̔" @ #@A #̐? $#1#؀  @ #؀ ?@+ ?%a?% $#1#؀  @ #؀ `@ `4  @:i  @`*``4@@ \ Jc耢 c@= @a ='!#̰  $#̔" @ #@A( ]#̐? $#1#؀  @ #؀ ?@ΐ ?%a?% $#1#؀  @ #؀ @ ?? ' @`*@??' `% J` )  l C3 %̠  ``$̔" @^ 2 @@ΐ "̐? ,$!#؀  @@ #؀ .?@s *?!?0$% l?&`` $!#؀  @& #؀ @Y @`` ``" 4*@L@ ! % 㿘  !"`T / - '  # ?" ` @ J?`  ` ?5` u s?`N   J ` "" N .N  X   $!Đ #̐? $#1#؀  @ #؀ ??@ ;? T2 T$ @  #̐? $#1#؀  @ #؀ ?@̐ ? ? " $!#؀  @ #؀ {@ w 㿘  X    @T% 3͐ ) ` @ =/%̠  $̔" @S @?Ð b̐? ~$!#؀  @6 #؀ ?@i ?% ?% $!#؀  @! #؀ "@T `@`@@@ % ` >/#c̠  $c̔" @ 2c@?x ﬐"c̐? 2$c!#؀  @ #؀ c?@ _?$?% $c!#؀  @Ր #؀ @  XX* * @F !<?#̔?`# $`T$#̀ `T @ ##̐? $#!#؀  @ #؀ ?@Ր ? ? " $#!#؀  @ #؀  @  㿘   `X     P  c̪   "c "`TS @g  X   @[ c̐? %c!#؀  @< #؀ N?@o J?㷐P 㰐㭐㩐㦐 @ T$@" "@P $$$" "  `c@c ? " %c!#؀  @ #؀  @&  㿘!  Pj   P ` " ` U"T S`& "N  E1) #̐`@ &#̠ #T$ @˔ #̐? &#!#؀  @ #؀ )?@ %?#̒ ?% &#!#؀  @ #؀ @ʐ  T   ` 㿘%̒ $̐ @ ) ̐? $!#؀  @h #؀ 9?@ 5? X`@  ݦ?ڐ  ` X  X&@̐?$" $`   % X"T# `$!#؀  @4 #؀  @g  㿘  ڐ!P$? X`@  ✐@" # ~ `$`T Ŗ &?@@ invalid mark character㿘c\` `"8? * ` 2" ` "`" 㿘c\  ` ? `*3@ ~"8?        " ``$ 㿘@n     ":@= O" 㿘"  N \2 `?㿘'  9)!#̢"`$#!@ 2#@< &"#̐? $#!#؀  @d #؀ . @ * $ ?%! $#!#؀  @O #؀ @ N`\  `* !* !㿘# b  ?ؐ * @"@$b㿘# b  ?ؐ * @"@B$bed.hup/ed.hup㾘#܀`B ؒ? # `X* * &""" 4  ! " @  " @@֐b  @i`X  @3 㿘#܀`@+ ?ؒ *@*  "ؐ"@hZ?㿐ذ? **@! ""`h @  `" `" $"..㿘#Ѐ`" N ! c@I @= /  3!H invalid pattern delimiterno previous patternout of memory㿘 J@  2 H `"J`   !" :" h5"@C . "  `@ @   $"@;   0"`"@ " "`@Q!'"@ $"unbalanced brackets ([])trailing backslash (\)㿘  L@! ` "`#* :  [ \  L@q   `aL Z L@ ` * `)$" >'#c̰  ⌀$c̔" @֐ 2c@;F z c̐? 5$c!#؀   #؀ 2  . %"?$⌀ $c#c؀   c؀ `֐ `@  *@  %`!B ⌒  J^" J]! 2 J `.`:`=2  J ]   J]2J 2J J] [J] number out of range㿘&@&# `J ` " @5 @D `0?J` @ (&` $`` @ϐ  @  @<#@$&@ʐ &@ ?*:  g2 `$` & no previous substitutionout of memory㿘 ` "`J % J*: @`!  \`%`ꔐ"  \%``*J :` % y)  ` 7 !#̐ \$#̔" @Ȑ 2#@:8 l"@#̐? $#1#؀ |  w#% ?$\ $#1#؀   #؀ ΐ  \* *:`$` `J `\'` \**@: $ `  ``!!  ?6  " "@J?` 2 &M `=J@   ` =!#̰  \$#̔" @R 2#@9 "@#̐? $#!#؀  4 #؀  g  % ?$\ $#!#؀   #؀  R  \" @*@\no match㿘  P  T`   "T u + T` |& T@ &{?] T l g c `%c#ې c̐? W$c!#؀  А #؀ X? T? TI T$ @ϔ c̐? 7$c!#؀   #؀ 8? 4?c̐? %c!#؀   #؀  T͐  T `P"@  T % T``8! ?` TQ ? infinite substitution loop 㽰Ԑ   /  `  ` Ŗ `'  @ 1- + `  @ј   [$, >#c̠  `$c̔" @% 2c@8 ɐ"@c̐? $c!#؀   #؀ ?: ?%,?%` $c!#؀   #؀  %  $ T `@Q @ʒ S$ð?, = #c̐ `$c̔" @ΐ 2c@8> r"@c̐? $c!#؀   #؀ ? ?%,?%` $c!#؀   #؀  ΐ    `@$ L >",  = #c̐ `$c̔" @w 2c@7 "@c̐? 0$c!#؀  Y #؀ C? ??%,?%` $c!#؀  D #؀ w   $@2  ` `?  ݘ `@` @*@ @*`  㿘   @`\ - + /M &A \` `," , %̐ `$̔" @  @7h 睐@̐?$%,?%` $!#؀  ֐ #؀ @  @  `*@ \N, M 0I 94H?Ѐ4D* @  ,"@@ , %̐ `b$̒" @  @7 O@̐?w$%,?%` $!#؀   #؀ @ @=  `*@4 \ *#c̠  $c`" @m c@6ݐ 9@%,?%` $c!#؀  O #؀ ` `  *@ \ `@% &:M, ? #c̐ `$c̔" @6 c@6 "@c̐?$c̀ 2'?!#؀   #؀ ?I ?%,?%` $c!#؀   #؀ `4 `*out of memory㿘%#c!  # d*@  *`@$c $# *` * "\*# @ *` "S*# @ *` &  $@6A u"X@а @# $# $cnothing to undo㿈   `T X? c? T#X?c    "` c̤ # "c̀H(# @*`@  "   2 4.   `"  @ "`"  " @?" ?@" ?`" ?`"   "@  ?" #`?„#2  : *# 2(@*`8: @@('`'`*'  #@ #` #`# # #   `%#?%T%#%`X$ $1#؀   #؀  +  㿘c ??!"c)c* @*`# @ @ ``@ @@@??$  T  X$"c"#㿘@2HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s@O c`@ϐ  Z"b'4  /# Z! Z+' Z; Z%9 Z'0+8 *&* @€ '4   '4  '4   % $b$"a@R`$" $b $⌐ 'b@@[Bh?Ґ?* & @ @b    cx@  c4 c@    2 @B? Z"b@d * 2 "'"@^`. @@'#c@ В@%@$ .*В`$,`0%`&@@m=?  b ?`@~ <  -  ?@5?% b 2 @  @ @m@@@l@<  2    b " @@㿘@Ŀ / 2N  2  N /"?* N /2? %s: %s%s: directory causes a cycle..%s%s: name too long (not copied)utimes: %s%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).fts_read(@Д   @ׯ 1-  " ` `0``!`@+1 @ `@  ;)T`6 2``"`$m``" @A a "``J`$`/"L? / /, cА$#  ,! @׽   @7$,#А@l?`8 `@X  2&`@ Z"`<  #`@'`@@'`@# '`@@$'@ !H@Q0 @2`!X@q`@<`  @W 0<      `!@T#x  < @@ Z @[@O0`@K(@[@iZ "` Z"` `@)!@ I #a@ki  Z`@ַ <  "  Z  "⨒`@֧ "` `@@ 2! #`@@0 Z"` @z  Z"` @I @5 2 @ 2`8 a@r 8  " @8  `??%soverwrite %s? 8` @j 2`@`@n# ` - Z"``@Ѐ`2G Z"`2B Z"`9!c@Z͔В?P`? "`@V  ?P  $?P ? y#a`? &`@Ua  $a` 2` y Y@(r В$ Д &@j?2 #@ '"x )@0@ @2@##@а ` `@#   Z@@ 06"`@ʒ 2#  ,  Z" @ @, @ Z" o*@ @t #@պа @@ #@կа readlink: %sunlink: %ssymlink: %s㻘  @Ӕ#?` ",@ 3c@$ " c@K "@~ 0  Z"` @ @mkfifo: %s㿘` 3c@  "c @eE #@W   Z"` @9 mknod: %s㿘` 3c@Ԑ  "c @R   h@.   Z"` @ utimes: %schown: %schflags: %s㿘 ! Z  /6 $"x "x@q#$  #$  $@j# "`cВ@@  !@ `  @    #   @~#   "`!@ْР  <! @6 `  @   $b@ɐЀ !@Р $b` D@\ b0@rЀ  b - D !(@ԧР lchown: %s㿘# @$   "`"@Ԑ  usage: %s [-R [-H | -L | -P]] [-fip] src target %s [-R [-H | -L | -P]] [-fip] src1 ... srcN directory 㿘#P!!`<c`@X`<@Xܒc@ѐ 㿘@b:c:d:f:snr%sstdin㿘@J'D`8@  \ *bȴ 1/! # Z+ \-% \) \'; 9 4* "<@€"@ᘐ $b"  %b ."@Ȑ $Đ %"@D@V9@?ݐ?cđ* ` @b "@@@b b " "@@@ !@@  P 2@@ X@Ӷ @O`@ 0a`@H 4444444444444444444444444444444444444444444<4444(, [-cf] list: illegal list value[-cf] list: values may not include zero[-cf] list: %d too large (max %d)㿐'D) Z' ZDi+J@ -  `' \   @-   "4%"J -c\ @ `@ J@ - ⬐`'􀢀 $J` c@'  (c8@  \c`  @(b &"b Z"@    *  c@Ӄ '⬀` \ 4"" Z"@ 1㿘+ Z) \"b !`` "@ , :   `* $` @`  ? & @R  &?W 2L B' Z"`, ?`? "`` , :  `* $`@s ? & @Rf  &? ܒ``? & @RS  &? 2 `` ?"``* $`@@ |"㿐 \ "ȸ ҴJ?`  @T  @. @ .@  .L@= "  2`  \"``@RĔ  \" ZbP'M ?=   ``= ?"`` `* $`@ L@ ,`=  ' !`?`$@ `* $`@ȒL@ `2 L@ `2L@   > Z"`6 ``= ?"`` `* $`@ L@ !!`?`$@ `* $`@~`L@ 2`L@ 2``` ?"``* $`@e @ J ,`@usage: cut -c list [file1 ...] cut -f list [-s] [-d delim] [file ...] cut -b list [-n] [file ...] 㿘cX@U!@ߐ 㿘@ʔ Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. along with this program; if not, write to the Free Software You should have received a copy of the GNU General Public License GNU General Public License for more details. MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the but WITHOUT ANY WARRANTY; without even the implied warranty of This program is distributed in the hope that it will be useful, any later version. the Free Software Foundation; either version 2, or (at your option) it under the terms of the GNU General Public License as published by This program is free software; you can redistribute it and/or modify Copyright (C) 1992-1993 Jean-loup Gaillybitslzwbestfastversionverboseno-timetestsuffixrecursivesilentquietnameno-namelicenselisthelpforceuncompressdecompressstdoutto-stdoutasciiusage: %s [-%scdfhlLnN%stvV19] [-S suffix] [file ...] r㿘 j"!cЖ@Tј  file... files to (de)compress. If none given, use standard input. -9 --best compress better -1 --fast compress faster -V --version display version number -v --verbose verbose mode -t --test test compressed file integrity -S .suf --suffix .suf use suffix .suf on compressed files -r --recursive operate recursively on directories -q --quiet suppress all warnings -N --name save or restore the original name and time stamp -n --no-name do not save or restore the original name and time stamp -L --license display software license -l --list list compressed file contents -h --help give this help -f --force force overwrite of output file and compress links -d --decompress decompress -c --stdout write on standard output, keep original files unchanged%s %s (%s) 1.2.418 Aug 93%s 㿘 j"c @Sΐ!"` "#@S’`  2㿘 j"c @S!`  `#@S`  2Compilation options: %s %s DIRENTUTIMESTDC_HEADERS HAVE_UNISTD_H DYN_ALLOC 㿘 j"!! c@Sv08a@Sna@@SjaP@Sfa`@Sb@S^ap.exeGZIPunguncatgzcat.gzab:cdfhH?lLmMnNqrS:tvVZ123456789%s: -S suffix too long %s: -Z not supported in this version %s: option --ascii ignored on this system %s: incorrect suffix '%s' insufficient memory㿘'H@E!'DH! j@@!@$"Ԡ  b?@7b bԐ*?H@!#D k "c`H"!, @  @  k`""Ēa0@  @   Ēa0@  @  Ēa0@ bԒb @:2   bԒb(@:+  b "` @7b0 b@7b8 # k "`"# kchb@ @@v! k$##/%1+)59; j7`Ez!Г*` € v$`@cp"a l"` h"`` c"` "`"Z% U$S$ & O$$L&  "!F"  B"a!@&#  $bbp@RL!o@ t # h@R+,  ""`#"! `"! "@ Z Dbb@R&!I@ N  D"!$?@ D D!<HbH@*? y   $ ` & `D  " !` bԐ!@Qb㌀   ` $ !cb!@Qܒb@  !    `2 ِ "b @> @ 'b@ Z#@6 i "b@ Q#@-@ j "b@ H#@$@ i "b@ ?#@ j "b@ 6#`  `!` D@6#* H $#@@ #D@#@  !``?@-?@ ((ݜݜ ޸DPhx݈ݜݤ|ޜ%s: compressed data not %s a terminal. Use -f to force %scompression. read fromwritten todeFor help, type: %s -h stdinfstat(stdin) OK 㿘 /`3- 0`! X@R  $ j"Ԣ "耢a#0#@ "#P!В @Pːb!@PƒcX@  a    #cp#  j  i  + i cp+b b*` ( * *` *` *` *`***** %b!`2 i k#Ra@k @#x %b i?@"b  k" "b i@b "a @ a(  ib@" 0A# !@lb 9"a  j""ĔaRf"R /   i"` k jb܀ i! `! !@P9c0  jb k k!!" "@@$@P%ap-%s: %s is a directory -- ignored %s: %s is not a directory or a regular file - ignored %s: %s has %d other link%c -- unchanged %s: %s: %s compressed to %s %s: %s OK -- replaced with %s8'Db@4  k! $ #D@p < @ 4 !` X? (08@HP#?D?????????@ ?D@0|!`B j" j!c@O7@!`0 j" j!c(@O% '1 $ `!` j"Ԇa j #`b?  s@Oba( 5 3"a(!# 4 i i""!`   #@!`!`# # i ` `* `*  `*  `*  `* * * @9  j" @_! i ?"b j"c@O!@&= "a(@  k"b@  "a !`! @@y0  R!n k"c ! i"5@ ' k ! i5"  "!` " j" i!c"@Nɖb"   `?$" b!c@  @ ##Ȗ!А@N!#  i"` k jb܀@  $!  j""b€㔀 ?$! @y  ` ! @y㔀 ! @_! ?   G i@"0C < a   !c@N_!a  k kb j!Đ" "@@J!a j kb k!" "@@=!a    ! icؔ@N4!!@N0ap @#%s: %s: warning, name truncated 8' i3-+) j/5@ @x 0L i" &a8*@]!# k? $c@%,@x :%(@ْ "Ԓ@Ma@%@xx @xvc@&%(@   `!`"Ԑa@MӖa(     "a(@xSc@ߐ@0㿘   "b `@]0@]_z-z-gz.tgz.taz.zzp k#h@2y` "@d  А@ $&@@@o@P@L@ $@?M`/" @2P$ "@  .Z㿘 k# c, @*$"@ * j  ?"b"@ : `  "`  @$`  '"a(@ kb@@2 #h "`' @@\ `@ .#h@א@$;$(  %s: %s: unknown suffix -- ignored .tar%s: %s already has %s suffix -- unchanged 㿘 i! j""@^J `K -a   !`2h !`2c ! `  2Z !`2U !`B j"!cX@L"8@`@1 `@1 26. ##. .  .  .  ). !! `  j!`!`  j"!c@La(     "a( i k""@8ch %s: %s: unknown method %d -- get newer version of gzip %s: %s is encrypted -- get newer version of gzip %s: %s is a a multi-part gzip file -- get newer version of gzip %s: %s has flags 0x%x -- get newer version of gzip %s: %s: part number %u %s: %s: extra field of %u bytes ignored corrupted input -- file name too largePK %s: %s: not in gzip format %s: %s: decompression OK, trailing garbage ignored 㿐 ` ` k j"܀   j" @ $@\ /"܀  0 k j"܀   j" @ $@E /"܀  j" @ $@7/ kb? k i "    #ba @Y   aȐ@Y  "܀ j" @ $@  $!   j" jaА!@K|#" "b j"  @ $@   j" jb!@K^ "a(ܰ? j" jb@!@KM` "a(  j" jb!@K: ` "a("܀ j" @ $@ "܀  j" @ * $@ * "܀  j" @ * $@ * "܀  j" @ * $@z *  !` i"""܀@`$@f "܀@`$@] `,"쀣 j"  @ $@O "܀  j" @ * $@@ * ! `  j" j!b@J ? "܀ j"  @ $@  "܀  j" @ * $@ * ! `  j" j!bؖ@J? ? "܀@`$@ ??쀤`K `2! j `!`! j ! j"܀" $@А *  *` i@I" # j" @ѐ#"܀ j" @ $@ *`,  a `2$a`! j"܀" $@  2h!  c&c#0@W  쀢 2c8 jb @W ϐ#"b$@D 2l? B$c8@Wה   ސ" "b4&! c@@Wɔ   ٔ !"b$%&! cH@W   `ݐ"  "$&!  `!`2 ! א ( "b$$&! ! %  j" jcP!@I:"a(!`  j" j!cp@Ia( ? "a(deflalzh pack comprstoremethod crc date time compressed uncompr. ratio uncompressed_name %9lu %9lu %9ld %9ld (totals) %5s %08lx %11s %s 㿐D `! `"D@ߐ!!`23 i@א!. i, i!0!4! `"@   k!` k"0@  kca0`!4" @"@@"@0~" j k? ""`0"b i"`, i??@s  "$b$b@s  "@* *+`(+  @  *@ $ i@" * ! ` .`#H "P@`b@["0b  k"!0 "c$$ba0  k "a0Ā"!4"$$b4 &b "4b㈔`Đ" @"@ i"`@,b `/ @* `% `   ` 0`0 4`4 `  `  (`(`? 8@}` @?` ?`?` ?`(?`0?`8?`@?`H?`P?`X??@X1, 2,@ ,name too shortcan't recover suffix .internal error in shorten_name㿘@|ڐ  `  @#a*?X 2,@#, i "bc@,Ȑ?   ,? ,? ,? ,? ?,@ђ /  L `%@(?L 2 L ```  `* ,@``@ . 2L`@8#0L` " k@ ch%s: %s: cannot %scompress onto itself %s: %s and %s are the same file n%s: %s already exists; do you wish to overwrite (y or n)? not overwritten  ""% i ?2 W@Wc b`     kC@WP   k#Ò ' j"@,  j"a€! #P!Д  @G'["!aH@GQ `<!p ja"Ԧ 7H’ax@G  kb耢 ?P@{T`  ’a@F@qH@ O#\H ` Yy ’a@Fa(   @  j "c@Fϐ!@ "a( 㿐` `''@u  <`  1! 2  j"!@Fca( ! "a(!  i@ɐ"%s: time stamp restored 㿘 `% i i"  ! ` & Ð!a@F| @ o #a 2  j"!@Ffca( a "a(a 2 @ @wq  jb"!8@g !! 2  j"!@FAca( ! "a(! @_%s: %s unreadable ..%s: %s/%s: pathname too long 㻘@&Y 3 j"b!@F :"a(/-+.)Ð@*( (@*Ѐ #@zϐ@z̐ # j@e  /,@ @@]0 "Ԓ"ؘa@E &a(@' Ѥ @'p㿘l ! k@xŐ#` `"l@wb $#`!!, "! j@wZ$!,! j"䀢 "! i@wR$"! i" "! j@wJ$"! j" "! i@wB$"! i" "! j@w:$"! j"؀ @w2$"@x㿘!8` k@pc i@~" 㿐 i i""" i  k#b"c" 77 (" #b *  " #b* ib   `  i#b  *@    $b+  $b2` * $b#@ "``* "$b2 *@ $b`"1* @$b@"b2 * `@$b@ @  \"bА@ < ! @a$@b1 *@ $b@b *@ $b@b) k + k j@"" *@ &"@L  b@%cb# *$b2 *@ $b 1*@$b@z b2 * `@$b@ob#@ Ж``* $b2 *@ $b`!* @$b@Tb2 * `@$b@Ib#" *$b2 *@ $b" 1*@$b@, b2 * `@$b@!b#@ "``* "$b2 *@ $b`"!* @$b@"b2 * `@$b@c  @%c㿘 ib@n?  @ kb \""bbad pack level㿘? @" jb@ \"b @x ct. ```! \@ i j j$" #b "@   k@ 6@ k" i j i"b@"✒ \`"" \ \ "b $"a"" # \@"!"܀  i"c$bؔ  *  "؁㿘 i i i jbȸ┲ & i@ a0` j jc!ذ] X @S  `M ` &~ @6'@` @/'@` @('@` @!'@` @@'@` @'@` @ '@` @"ɲ`'@"@  i   ( 2㿘#p \ i "@"@  ?@) \?";) \ ib! @w> i" j"@b""#" j@#b$ ؑ+  @ 2@2@  #  j ؓ+   2 2    @"܀  ib k b€ ? %"ܐ $㿘 \" i "b ) i5 j#' \/ i; j9@b⼖ @ؒ@ `*  bؐ * $ؒ@ @*2  ibؖ✑*  2"" b  ڐ b 8 C i"?"@"  \b" (% i#✰? \ i j@✰?" bؒ `*  ؓ* #bؒ@ @ *2 bؑ*  2b "⼒@%"  $ؒ@ `*  $⼐ b@O b %$b`̀`  b @Ò" b&b! \b܀   b!"܀ b fb̀ i"@  " @" 㿘 \" ` 8 \") i`5 j7 \3 i;@+ i9 i"#b @ ؒ@ `*   jbؐ * &ؒ@ @*2  j؀  i*  2%b"  \"b@ "" b b  @ 8 ` b""" 8 bL@ J" "@@ ib "  \# i j1@ i$%bb bؒ `*  bؓ* #bؒ@ @ *2 bbؓ*`@2@┐? #"  $" 7 ̀`b  " @" "(%̀b " @h ̀`b  " @" "%" $" $" `?$"$! \b܀   !"܀  <" i""  @, ̀ i"@  " @" 㿘 `!Z i j h h"b""!Ԁ "# c d Ƞ      +  #@ !ȱ(+@ ?` Ȅ <*  d!<    c * +  $ @ ȱ**@ ?  *";  < d!< * c + "?,  `@ ?ȱ(!*@?  $ `"l 2? 62 _ ` ڔbl  .   3 2 ! `"l _``ژ .  2@  3`!! `"l _``ژ .  2@! 3`! _ `"l _``ژ .  2@! 3` _ @&! `!X  6`@ђ 6@  `@ \"t060 ^t060 `ІH060  h(Ő"2$ h h  h h  h h (ĝ㿘 ` b々.`.`5 b +.(`@./`@/ *  .  ..".  b.`  .`.` 'b.` 㿐  ` "l '   ' 2? 62 b# `b*@ * @"<;2  `"l9 h7 h `- b@,`@* @ `$22@ 4 . @   @7@ $@* @@@v!Ȁ@ '!Ȑ @vߒ@̒@&̨ "< `H `"l-. ` l?. `"?.   ?2 *   2  2 & `"l/ `. @`?% h?-  `* @  " @ @v&Ȓ@$4 `2?. x ` "l  ** 0  ` ` ` *` *4 @2 6 㿘` b@ b` "=   "c?"5 ` b# @ "2`*#+@  ` # *2 - h+ h ` bȚ"a̦c   * @   "@ "@ ?* 4@ ,  "   %a%#2  :   &`? 4 ` b"c/ b- b【* %$ , * $*$ @ +`@ % ,4@ @ @ @` -@+`@, 2 @ 2`$h # Ӥㄖ*`"&ㄐ>㿘 ?      .`<`;0 `а ``@"-@.6 .6@ 6@` 4HD6D6H        Ͱ 㿘 ?      @P `!д`*`  @@` ` `!Ш,`@32$ `@ ,` @%@ `@@"`B@  4 `H`D@`F@  @`J@      @    @*`㿘! \R"!4 ^M#!8!X  ` !Д *`   h?  ! * `"?!Ȕ *@   #!ȁ㿘>@Ȓ @Œ @’   \ `!Xa  *@ @ &  \"X? ^#Tblock vanished㿘 h ha d  ib!* ?#@2@[J!F! h ha h Ȑ !Ԕ 2 2@ #!Ԕ`@   @k ! h!Г,` ? $!А@ 0' @Y  _ ` @aX haР @M !`  {` \ ^"@c haР aȐ  "a!@!А $!!б6 㿘 j" ha *   "a \".`  h`92  c!  \a*` ? 2  c ^#䀦  *`> ! @* c > ! *`@ h ja`"0 *2 h h !Ĕ #a +!Ě a!* `+a h h d !Đ!* ` "+a+!!$`$!/2"! i" j ^c"  <+   @sے`@? ! ha2 6`4@  !#@  h!  㿘 h! `  N  caȸ# d c`Ȭ" d`<!< j d!   j"䀌 @ ,`  @r* h@* @j`" j@c$@ j"-` * 2 `` 2 ! * @ @P@`" h@I$@ ha §4$@A$-l used on binary file \   *   @   \*     2 \*   @ i `?2 h h h 0܀?"ańp k 㿘 ha "=  h! i". @ # ܀2 i `√*@$"∑2 *@ $"# i `b%*@$"@ ["2 b* `@$"@ P! " . 2`:@4 %! hܓ.  2#a 0`* 2 㿘 h! 2! i"# h i b*@$"b2 *@ $".  h # ib%* $"@ "2 b* `@$"@4܀ ' h i" ib *  #b@4%!㿘M ib#@  i`* $"6`* `$"  i"`*@ #$"@"6`*@ $"@"# 8*  $"2`*  $"8 *@ #$"@"6* $"@5 i# i!b *@ &@ %s: %s: not a valid zip file %s: %s: first entry not deflated or stored -- use unzip %s: %s: encrypted file -- use unzip 㿘 k jb i""b j**@  ` "ܐ #b**  @ * @#P@ "  j" j%`P` "! ` j" j`p k   "cd2   "t"p  j" j`!@:V "a( out of memoryinvalid compressed data--format violatedlen %ld, siz %ld invalid compressed data--length mismatchinternal error, invalid methodinvalid compressed data--crc errorinvalid compressed data--length error%s: %s has more than one entry--rest ignored %s: %s has more than one entry -- unchanged 㿈 i k"""c @O ap   5t  j" ` `*  `@ `( `( `+  ` ` +`*  ! `p@  @Y"@q7 i7 io9 j@Q"Pkp b`a jb  k *` @ ( ( *  d@ +`*@  " " ` `( `+  ` * !b@9@" ?7 i9 j3 k' j! i% i# b܀" &b@ "* `@$"@ ?@p@"7 i9 jp &t ! k% j# j"܀b $"@ .@  "* +`(*@ (쀢 ,∰ ! k% j# j"܀b $"@ .@  "* +`(*@  + *`  @W @@""Ā@#p D k" jbܐ = j"Ґ@ #P * * @@  *` 2-%p `!`  j" j!c8@8a( 2%p "a( j" jch!@8 "a(%p&t %p&t    'H\'L'P'T'X????????'*`  " H  X "4"@ `   , `" *`@   ,``"8 " *,  @   /`,`@ @  @  '' "@`  ,  *`#`" H`@*  '?'h ɬ / '@H.*`'].  i?!` '+@` " @" `@*8 +@''?@iP*   @h " X#"" 'X h""  //'&4@, ""4'/  c/L    /7LT" * @ /" P* 74@ *  ?, * ""   *@ @" @4 @2@ *@? @  $*.? @ L 0-"'#\.@"| Қ  Ԑ!@3kc #!0&    0 㿘 i i"b  % k) j' j"܀@` *@@ $@ *@  `?& 4`% k) j' j"܀@` *@@ $@ *@   `4`?%b %    㿐 i i i """"b 1 i&" ""8 "&"   k? ""b@ 㿘 j"  "b ' j) k?b% j@"bĐ"  @]g$bĀ $"܀?b܀?  @v%" ?耢` 0(#"8 i j k k j"" "b ā"㿘 j  #"b"' i# j% "b$ @]@ ` "ܐ $""܀  k ?@+ k" k"ܖ  b#"#b @㿘! i"  kc i@$ j" "$"㿘! i"`# iba  j kc"@ b j""@ ""$"㿘@@&@\А?J \@`  *J2 㿘@ / 2 㿘 .@  @"` _J@ ."*@@ out of memoryargc<=0㿘@@eΐ  _ @f@ @= )@N .N  #@KN 2@@cG9  $@@6  2@@5 @&@ @, @$` %א@Ki$ N `" $@$` $ %s: %s: %s 㿘 j" ja@1a!%s: %s: warning: %s%s 㿘!`  j" j!b@1Fa(  "a( %s: %s: unexpected end of file 㿘 jb!ؒb@1, b  j@P"0 jb@1㿘 j"b@1! i@:"{%2ld.%1ld%%㿘`1  @4 . "* * @Wޒ#@W ?`&@& - -* &@+ ?`&@&  * &@!ؠ#X @W @K@0㿘@b, I output in compress .Z format not supported 㿘   "!@0`"!(  %s: %s: warning, unknown flags 0x%x %s: %s: compressed with %d bits, can only handle %d bits corrupt input.corrupt input. Use zcat to recover some data.㿀 kb  j!'D 'H j" @ $bՐ $a ` "b!`  j" j!a8@0>a(  "a(  , '耣 " j" ja`!@0$ "a(] b ' j* ܐ!'`''?' !! jbؔ!@d  i  b*?b jܛ<"    j j *   j""܀ ?  jD@ @Z ?' j k "@  j""` j@ge jܒ"@*` jbؔ!@dM !*?@J$!? ''' jb*  " 쀥 * ?@Jq$a?'䀢' *@ ?' * ?' j<   * *` :  a i*' ! j  j"?#"@a    iH* jbĐ"b `ِ!,   j i" , , " ib ?',b " @ ,?5+ i## j`&4 b@c) 2  HbbĐ$bĨ b"@ &  i−@c 耥6  jb i-2 *2` j    i"H jbĐ"bİ 㿘 i  i*@ 2  %! i % k3 j/ j  & *@b܀ 4 $ & ?"$ $`   "`2@  5`% 㿘 i "@> 㿘 i i i2 "` " Bad table В  *2@   @ *`   2  7    # * @3@`  ؐ!  "   & :2 ( 3@  ,`  *#@ +2 ,`:@  *  * 6 "  *@@?@5`*     :*1* 6#1 3*  j@  ؑ+`2@ 22`* * @+ 21@*@㿘B  =   h!* &* h"!2? 620>,' h- i * 2 ` 2   2`@`` -@  ? !*   h h!* &* h 㿘    i b*`ab  j,``o2 0R@@' i h") i 2 * @  h i j  b@ ,   @ 2av @ ∀        ?  ib?*`@?*@`@ a  j ib*`ab j! 㿘 hb  t  $"-!  (   "? i  j"*`3 ?$"*` ! i j3 "ؖ @@ ,   !2b @㿘 i  h*2b* @  h j"ؕ2 @ .    3 a @ ? *@@㿘! h""㿘 i i" "`㿘 i?  "# h@.@   :"? "r!  i ,"`8?.@ 0#$`&c? ! h$!耢" @.@    "? "0΁㿘 i k"""c i`  1 i!"! `"` " invalid compressed data -- Huffman code > 32 bitstoo many leaves in Huffman tree㿘 i " ) k1 j/ i9 i' j  * ""܀@` %" r %@""܀$ j" @ %"a $$ o#$   i! ' j""܀ %"F $ $@ aN#8$!*   " $  i!( 3 i,  `&`(+ j""܀ b %" `-$, $!* `" i$  i i i i(* :` " " @? $ 4  b(   i  ` i*"`@ *????*@"` *b*@b@invalid compressed data--length error㿐 i k""&"c i $ i` i! *`  i' *  i ?#"h"dh"`@ i% id# k) j' j! id* b"܀@` $b  "h%@"`  $"h ih"`d" 2@ i" @ `#@33 i! 5 ih, `@ - id% k) j' j# id* "܀@` $ K bh%@ $bh ih.`d"2@ @ h i i`$@.`( i i  (   ib*  "b^ ih""hW i  jbĀ"" J J  J(8  J   ibx( (@   i@"@"`@ *@b|c"x"* (@  #"x@"@"`@ *@c"x* (@  #b|@"@"`@ *@POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c 㿘#'D"c - i  i i""|"bx%p%#N - + i "bt i""t @]"Ȁ  i""t""tp  iJ  ibt -  i i|"x@   #"|("|# 2#bxDD "  *@J`-2J  $"|#D@%*`@ @Rb؀ ## i  ib| x  %# bx Dbx"|@D##bxD$"|%##D * i"x ib|2%#e?@J`-btJ bt V?"c%#Q A   -`?`%p#* @J`-2pJ  -`pp L@   L@  =2`  p@c$@ 2pq$@Ȁ2   #` #*`@ !@@(ےbpP p#@%p%#d#%#L@ ) `G"c#`*?J`- @!@(c p@!Jc0@(p p@%p #D *@"#%##` *@@!@(c`pp@%pN :  :pp @%p'`  "@ `#* @J`-pJ %p#`#* @J`- @!p@(Lc #@!Jc@(Cp#ߐ#Ȓ`%p%#\ p @`. :%ppJ `# %# :2J`#`@!c@("# 7 :23. J` :J #'"# # "c%##D*#`@!c@'"# N`:   :@"#%#%p. > 㿘   㿘 㿘@2HLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %sinvalid file mode: %s%s: %s%sfts_read`@ `x@ P`< kJ k o`?#cJ k g`?"J k m`?##J? f'Ѐ`??"''''ܢ   )%'; ?'59• 00*  4@€ +  (  %  "'ܒ 'ؔ '㠀 @*?J`-JJ  $@@$Ӕ?ǐ?&*  @@܀  Ԁ```@X 2   2@' @?А   @u'bb``@C J`"'`@XY ^ @.Ȁ `@XL  8O'耢 2 k@ ?А  'b@ b "'bb `@  J`"'`@X# ( @ '`@X   @@ : `@@ . `@*@'@@'@@'̒`@Q   @ђ * ? ;* @€܀ 㠐@T  㠀 +0w  @Ga @ 㠀 h   @4 @0Z W㠀 TԀ Q   @D "D @D "D @ D@Wg 83 㠀    @@* 2 4@ ؀`" 㠀  Ԁ  @ ̀  0 @Ẁ  ؀  @q! @RS 2q 8b a @6 @Xא 88dd$0<HlTl`lllllll%s: invalid user name㿐L ?@  " @  ?a@א J``@V %s: invalid group name㿐L ?@T " @ߔ ?a@ J`a@VŐ usage: %s [-R [-H | -L | -P]] %s file ... modeflagsusage: %s [-R [-H | -L | -P]] [-f] [-h] %s file ... [owner][:group]group㿘 k#P k#`P <a䀢"H"x"@% 0 kP#`<!b""А @$ @W 㿘@usage: chroot newroot [command] .%sSHELL/bin/sh-i㿘@ !@$גc@W̐ @r` @/#؀ `c@ ` " @} ``c@ @X#谒 #@| c@ 㿘@ lost+found㿘@  l#X   "  (X*  :`XJ "   2 wrong type to dirscan %d 㽘L0`"$@!  l B 6+ B+ 3` @; 2* @ * < l#`4@[@   = b<8 $ @= "(  @XM$(@  @   @X:", - @ 2  4      DIRECTORY CORRUPTED㿘 l#04@[F  @a a8  4  4  (/  6+ @}@ 2$  `cp@. @=" `@6 "@. . .  ,  ~B?< W$   4  Q   M I @ $   @ b !=< 9   3  /@/ *  ! # ""   <b$ `<  cp@- @ܒ`@ 6  ,`   l@"". `*41 2. 2 `)  `` 4  `   `J@/`  &J@J@`?㿘@%s NAME=%s %s=%s DIRFILE㻐@#(@ ?@|#0@,` l"@ #8@Ò0@ڐ@' < cH#P#X @0#8@UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED) ADJUST㿘 @.`T >`  l @ M`H@b 0G# `P<  2#P#X @l @ ,`T : "@@|) ` lb,   lJ!܀`b, 6 b,@|#0@D xb, @| b, 2  @'  "@ 4 㾐 (@W% , /`  `   ?   " 67 4   $ l#``4  l! , ,  ,  ,@VF 㿘 (   ,@0  l #` `$ l! , ,  UNREF %s (RECONNECTED) RECONNECTNO lost+found DIRECTORYCREATE (CREATED) SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY..DIR I=%u CONNECTED. PARENT WAS I=%u `  ???????@<  `?瀥`#X#P#X@n @Ȑ lb,   lJ!܀`",    ", 2 @&ʐ#x  l @{#h lc G @W !c   ''/'@ -$@5#", 2@&# !  @   $ @ɐ   ", @zސ# @m ", $@zҐ#0 T#@< @@ 3@#@&k    @Ր  $(  @v   @# lbb| /'ġ,'`*`::`b|2@ l#XJ  P@ 0N@&@b   l x@ @zu#0;"|.  `?32  @0 @A@  @_4 b|*  `2 @ @zG b|.`  2 ",  @z;#0 `  ? ??Ȓb?/'Đ'''???@k'@ X H l"D`B@@  ????  ???/'''''@H`  B*2 @2 2* @ * @>`@Ԓ  @)А@'@ @  NO SPACE LEFT IN %s (EXPANDED) EXPAND㽘 l#`@ P ` 4հ -`(@     @ɰ @( 8 2° `+`$$` 0 ; B<``  0h: @$h`` P*@ :`   @  `0  <D @L@ @ @6  2r.` "@Sݐ`@'0  c.` @Sϔ"` `0 #`@S  "`0    , .``   `P*@:`     `0  <D @L@ @ @   2.` `@S "@J l",`"@y" @$#  @,  .` $$   0 :`@ c <0h:` " $h@(8㿘 @ l#``"  &` &@@ lc`4@ ( 3@S6 ``4@ #`@S( b`4 @  . @4   3 l l"|  @ 2+ cX @? @a  @@XcX" "  *cXJ@   l"|.  ,2 "|@  2@ @  @x4 㿘@ @k2 @2㿘 l"` @UO  ?$, @V9 0?,@U=  #,㿘! l" ?"@$$"DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS @ 2&@&`$ <>` ('7 l e( :`Ӗ ` ̀`x h ư @3` 떢b> @w! l@"bh x @RO`0?  ;`; @@Ъ @ Y p 95/뢄2  <@ :@L@ B 8T @ @ &`  8&`@`&N`0 20``&-``@' !h@Œ@#B 2 `@` 0@U0<: > @w l@"bh` &``@ ] &`@   8 &` p 05*` * :  @ :`c /@  &`@6 "&N`0 2`@'2 h@n@"ᐨ O  `t @G;  d Ѫ` PARTIALLY TRUNCATED INODE I=%u㷐M`0  `@ 2`0!`@`  ! l#  0@#` 0` : t@ <`? # `t @; 8#2 # `t@"  떢b: @vӐa l@"bhqF@B@ ` d@**# `t6%* @@ l1  " `!@嬐@'= " $- * lbd@#:49 `%`@e "M`0 2`@&` ah@@"!`"`f *  ?%blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > sblock.fs_fpg %d 㿘 l!쀦q@n l# `@Co@SА``@S˒, ` 8@S@S, @K l#l`E#`@S@S, ` @u #``@S @S,  `! @S@  l#l`# ``@S @S{,  `@uΔ  `!@uȒ  bad inode number %d to ginode 㿘  l"  k#@# ) l ## `x 3% l# @R@S< @R * @S4  @@ @Sw@R x l ` c\* @ ?"@!0$\`x@Rj@S%c# x@SW\ * bad inode number %d to nextinode 㿘 l"0 ` ""0 l" ) l @7"t E k# lc`' l @R6$̒@R `@R."t* @R@S"t@Rx` l* ḍ, @6C#d  l l! l"t! l"t %"t lch! l"$@#9"$ k"#c "cCannot allocate space for inode buffer 㿘 l#08e< l`H `  k l l4 l"#"bt# l"̬ "#"0@B$b+ l@5%cd l! l* "Ȁ $!Ԑ %cd$!"! l"$  0@Lb $"$@"00 Z"0"0`㿘! l"$ "$"$@L$"$cannot allocate memory for inode cachecannot increase directory list㿘 l0 0 ;  @ C@͕8 ` 8 `,` $ (@LC 2 l@^#"@R] lb* `$"$ $ $ $ $  ,`$  ( $ $ $ @N̐ $ l" l䀢@ # l`d"b`@LW*` $b`@0#"b`* "  &"cannot find inode %d 㿘 l"@R lb*      2 !8@㿘 lb   l" l`*`   @Kb`?@K@Kb`$b`$ l\ * %s %sDIRFILECLEAR (CLEARED) 㿘. < bP"X"` @ @g 3 lb, @w"h b,  l@s"p lВ?" lb @N+ lcX  *㿘 (  2   ,@N 㿘 ( "  ,@ΐ  2   l" 8 &    I=%u OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%12.12s %4.4s 㿐 @sg 9 l" 5@sZ @ p "@sQ  p@sL (@sH 0 lb, "  !@' @@s=   @s7 H @'` X@s-`%d %s I=%u BAD STATE %d TO BLKERR㿘!x@E@s! lcXJ@ "     l#X4  l  l0   *@*@#XJ@!CG %d: BAD MAGIC NUMBER 㿐 l!    l#XJ@ l   l"  l#XJ`" ‒ J@ 2  l# `@O`@P_``@PZ. ` ` @l @"U@  c#Ԁ "c"P@Βc @P2  @"U@" \ c @Py  *@ , < @ ?@ % (@ 0C@  0? lX *   %  lX *@  * @!  $ (X #*4@($ dc$ $ $ ` l4 :< `4!Б: $ h`E#! l#`` l!6` `*`  ???Ȗ???? /''g l b@L l#X * lА?"ЁdfpnNyYb:c:l:m:numberAlternate super block location: %d conversion levelmodebad mode to -m: %o ** lost+found creation mode %o usage: %s -p [-f] [-m mode] %s [-f] [-b block#] [-c level] [-y] [-n] [-m mode] [filesystem] ... 㿐@ )+ l@V%  l *!';9 l) l75/# l! lK- +B* L@€b, ?%b,", b@  l"@q1, cb8@ ('"#l $%#l",P m@ p&@n"X@qp c,"4  ,c "4,c ,"4P <"@Z @m??#*@  & @J  @Jڐ b, #@JӐ T@Jϐ    ?@@`  @1 ? la  '@J,TTTTTTTTTT@TTTTTTTTxǴTTTTTTT,ThTTTTTTTT@-%c flag requires a %s 㿐@͟"J "@ܔufsffsrwro㿘 @bp "  @bx 2  @ b "   @b 2     starting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) %d files missing %d blocks missing The following duplicate blocks remain: %d, The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** / ***** REBOOT NOW ***** 㽀 l",`` @I b,@ lcl  b, @1# @?s  b,b, m@#0j  l  "!*8- l `@oِ#P@ "@oѐ#h@oΐ#@h lb  b,  lJ!܀`"@#@o#@ b, @o#@/b, @o @ b, @o 8@ #b, @o `@ R!`̠ `# l`8) l@M1b(!@. * (! @<* . ("2`*@ *:@< @0 @ofcl` l‐ !В"@" `%!@oU cl) l 3 l; lP5 l # l,@L"  (@4@ &(@<{( 8@L&(a("@" `&(@o(  @o"!  %# @oa( 2 @o0!؀ @o!8!؀  %# @oah 2 @o0%!% &cpbx  @͐  ,  &L  # l  `,6 l% l@L```@L. ``d d, @ `,& lbh 2/"8@`` 8 872`h`;2`h - l!Ē` ?d# l`(`ch* @ؒ " l@#`#l` ` , `#x@lؐ` @G`($`h e(`:` `` `7 l`h `B*2@  7 l    l#0`t@J?   4`( l, ` l "@lK#  , 􀤠   l#0`t@9|   `X l, ` l "@l)#  , @ ~ l l b|"`. 3T``@Cܐ  2 l@8#@# 2@z  @ `!""!"X`` @X  *@[ l *@ l!5 * l"`" k`?" k<c``$`p$`t4`4` k k"#"c&`` 4`$@Id:` &`$`h / @ , @k @0@X P `$" h0 X@ ̒X *@E#  X*@ lb@F BADEXCESSIVE BAD BLKS I=%u (SKIPPING) DUPEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.㿘   . ' `F kc  "c @   l",`@kO  @#  @  @ .` `$) l' k+-/57    r    l!:`K *$:@ `2  "(  %"( * @ +  Y0㴒 ` $ @ @8 l",`@c K @r @ @B  2 l@  P@c 9 @` @ Ғ#p`" l p"" "@ l""@ p@ `  l#p@@ p`2@p@2 $`2 p $  & $` phase 1b, inode %d/%d㿘 l k#0!cĠ#`,@HF@! `  ? l? 'Ą/ l????? `,#x k  "c" +  `@6+ k) l %c  #X'J@  H ` @  `,&&!DUP㿘  3 3 k  2 c- k ) l+  #p ` $ " $#p#p 2 #p @ Ң`phase 2, directory %d/%d㿘 k k#cȐ@ phase 2, parent directory %d/%d㿘 k k#cȐ@ p0ROOT INODE UNALLOCATEDALLOCATE%sCANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODEDIRECTORY TOO SHORT%s %s: LENGTH %ld NOT MULTIPLE of %dDIRECTORY%s %s: LENGTH %ld NOT MULTIPLE OF %d (ADJUSTED) ADJUSTMISSING '..'..BAD INODE NUMBER FOR '..' lX `?* : `m "d*` €@ "@"   @ސ "@ Nb }!퀢 X#X@ E"@ "@"    h!퀢 C#X@ 0"@# ;#X@ "@ $b@ b#@ސ"    G!퀢 "#X@ "@͐#0  @ "@ b\  o@ 2 #X l#XJ@ #8#X * lc` #X * la *# l! lb`"@є " b` *# k?`:?  k "/' ?????耤q$c̬+@531  ``%̀`a X"$ @c#0 >     : 5 28 @  lJ!܀`  cpc@ Ș"# l #c@ ͘"# lb, @h# b,! >`$ @/#       :   @CU7@  $  ?H @Bh ' M'̤*"`"P&K%̬+)# l1/  :%  "7  2?0   #$ @c0 %#   b|*` ?2  {@Ԑc0 # b|*  3  b|* ?3    $ *b&"`* @  `"   " ɐ $  $ " *鬐 \DD.BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (REMOVED) BAD TYPE VALUEBAD STATE %d FOR INODE I=%d㶀 l" ` (  l"  l!  @ , $   (!"@v 2#     ob $@ڐ#0 "  l#``"` $  [ [b O, Sb l#` `' // /"7  c@8 "@ '2 $ 6,`@ #( $ 7 @A[7 @AT $ l`& $ "|*  ?2 @A4@x#0 "  $ 4  l#``' //# ` #/ $7 /   ?  w "74 $ l & $ "|* ?2 @Ar4 @ 2c` U$  Q 鷒c8 ,@"#0 "F E b@   鴔#P@?   馔@#?$ $ 陔7 @@@#0 "  $ & $` l"|*` ?2  "  `  $L .2`2L  cU$@#0 "   .2 cȐ& $ lb   > l#``!  2   l  2 l 5  $,@#0 "   l#X @ * : ` !*` € $   @g# $ cXJ `2 l  ",`~  lJ!܀`y (  @J# o  l<#X @ @  *  l"| *`2 O  & $ $  @d @_ @P@ l",`@ea x4 @ # /  $ c` $c` # la J @   薔a#0 @, "  l"|*` ?2 * @:`  $ @@@$$"@phase 3, directory %d/%ld㿘 k l#b@㿘 l" l`*` !ܘ  V"- kА % H? ) l#XJ `@`#XJ@ :?  J@ 2  lb@  ` `  #XJ `∀@$  m  l l#b|*$ $  ?3 ~ $  $ " #X  *a`&!phase 4, inode %d/%d㿘 k l#b @UNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%d` l    ?#?   /'#a@????V? l#X k"c' * : `?!*` €` l"|,`R ` l5`!ؘ`0 2!`"  @<(#!cI  cq  @ 2c`5 `* :`@ @ l$ht㿘  `B ' l+ l   4    la:  J* $:@`$   2  & @;$ `  :!* $  * *+ b(%b(`Ġphase 5, cg %d/%d㿘 k k#c@5(DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATEXPANDCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d CG %d: BAD MAGIC NUMBER BAD STATE %d FOR INODE I=%ldFREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPS?b l l! c l` X?*cH ࠒ @> l?b#0"຀5`X $ ! l", @R#p", 2 %$@# "X%$  l,`"aX $   #  # $ %$P@@*  ณ, @,: ତ@@@|@0 , $:`0@@r*`@0 , , :`@! l ",! l#@H%$", @\#Ѐ ?", #@P@@H*  ณ,@: ଢ@ @@9|@/ђ , $:`@*@@*`@/“, , :`@@L % l  l* "L? ". ?༘#<? Tc8@#""@ ?:`#4a#@"U%c?P#0?("?" #,%P![#%`Tഡ,  %`XP@?഑* %`\ฐ`,`: %``?ଐ#,$@"@?@/b| , :`@%`d?$("@ " %`h$ * @%`l@?|`@/E* , `l:` %`d@`\"U`d?`T%`#4?"@ c8?#" @#<#@ "L@ѐ   @<@?$" l"?c@#@  p  *@"@  8?`8  ??$8   6, l   :a*% +@ * , k"#c<"!  k@ N"c k@?<" l@?5/@  ࠒ @G @"U@ " #Ԁ  (@༒@?$@4 %` %`,?@2@"5`5`&%`$ $%`8@. %`p%`%`$%`%`  (`@6%`(%`( ,`@6%`,%`,U` 0@6%`0%`0`@"U@%`4%`8%`<%`@%`D%`H%`L%`P`T`T@?#8 ?#4@< @ L2@"U%cฒ@>Ð?c?`@c  #@`@/`@"@ lX @* : `)!*` €` %`` ? %`  `@"U@:@`\@   ? % *@  *( ณ* H:`@”ศ Ĭ`%@"U    ` :`b@`\@   ? %*@*`  ? %` @ɨ @"U8 3 @"U l @ :`J *`" : 28 `:`c@``@   ? "+@@* 8ז@8e ``%`@> |@-`@-T@`T@ `"|@=@!v@-@=@=@!k@!i@=@!dP@=@-y* `- Ԑ@ `X@@=В*  2$`$>88@-^ &``l:`@8@-U &` ?"@  *@ &,$`$ %`$ `:`c@``@  8 " ?% ::@ `4@ 8@@=$ 4 `l `p@`h @@  @  $4*   #  (  `p 瀋@" ?$4*  # ?#`$@ '` @ '` @ '` 'P@@ޒ `h@#@   l`$@`c$ `  $ `$$ * la @9 l?<@ `@"U@`T`T@ @"U@ T T?#8 @ (`@ "?c<@@@9 @"U@ T T`@"U@`T`T@?8 @9 l! *` lJ!܀` ?c,@@ F?@"U`"@`\@ " \ $ @"U  "3- ."   \ : 2  @<@`   ?#,&`?c(@@ 6F`@"U# `` #@``@ $ @"U  "3- ."   \ : 2  @'< @@#L@# %#@؀  f@] !  @] @ `gâ @ `2 malloc failed㿘 bH@~ @4 bH@~ realloc failed㿘`b@~ @4 b@~x strdup failed㿘@ߊ b@~i RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsCan't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE) cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d clean = %d %sile system is clean; not checking f** F** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED) IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKFIXINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for cylinder group summary area BAD SUMMARY INFORMATION%scannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %lu bytes for lncntp cannot alloc %lu bytes for inphead  lJ! l l?*"l"d @E   b!@ @Zې° <    @z "  @  l  "ch b!@ Ȕ@Z  lb,   @Z lJ#` ,@   &bd,?`&bdɐ @Z , # l@Z!# l l! l l"c""xc8?#$`$ , $ ,`$`@2J$ @2G  $``ch]!@ "" ( l l"b"@  I l la D , 2A ch@0 ": @!8 3 \@@7LH@7,@ 8 ,$@d "`\@ #\!XapḘ!@Z"b  "@U  l#l` J@Z"h  `р,`"x""8 ?, 2/"  l $1 l ,5 l"a @7  0 l*@ *` t  :` :"‖  @<` @ E   `"@s#`2 " ,   <`c#@a#  "`<, ` `$ @ڐ#8, ` "`@Y#`, 2 8@=# 28* ,`   @ *@#p , "@Yt#`,   @# 2 8* ,  `0`H  # `0, "`H@YQ#`,   @# 2 8* ,  `4`L  r# `4, "`L@Y.#`,   @Ԑ# 2 8* ,  , $H0204"0# F , `:%0@Y#`,   @# 2 8* ,  %(`<( , < `"(@X#`,   @# 2 8* ,   H8%8: @ %< "!%< P  H8  ,:;%8@X#`,   @`# 2 8* ,   L8%@: @ %D "! %DՐ x  L8  ,:;%@@X#`,   @5#   8* ,   &#`8  ::8 L8  ::@&#` 2 e,., 2 @  lG   l` " ",` <:%0` "(`H8  ; 88`8 L8: ;%@*`+` ] eLY8, 2 @ܐ!  l b  l` " "L` "P`#\"eT`%`"X`P@5*  , @,: @@5`@%C | , %$:` *@5  ` |@%3*@ , :`@8 L%@  $ * (8L`  l!`  `@2H`hbd@  @:  "cP cP 2``@W!80 4 3/57 ``0"4cP`8@5N ``dch@ѕ* 2 Ɛap@C฀  @  {x  0  ժ` l!쐂`,`:   ? @ l "a!@Wt0X" @  l "cX" !" @Ԑ  l "a"!@WZ`0>" @Ɛ  l  "b|"`"@WK*`0/ l  l # l"a" @$b! l$"`b@ "` l`""b"0@W+*`0@Z Ӏ` l *a l*! @  MAGIC NUMBER WRONGNCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEsuperblock mismatches offset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATE㿘- l  l l" :` @G  l# lch@ 2 !$$ \F!T@ a, 4 a` a@4E  `,`@4<?` &`h b! l ޒb("@4*`d`4 @#-@ $"@#`$ l#8 , @4 ,  @4*@  @ h@ @  2  t@"e "% ` " # # # # ""b *` *` *` *` X"`X <"`< "` @"`@ \"`\"@0b"cL"#LcP"#PcT"#Td"$d"$ @0v` P$\@0pd\ l$@0jd`d" d`" `" eP"%PeH"%H8:8@;%@H"%H0:0@  h $ l#l`+  @U"H h ?% @ `$ @U:`  `b@  l*"l %s: BAD SUPER BLOCK: %s 㿘  l",`"  ! v#@U #%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) 㿘 @?"  ? # \     @ c\ ``*: :@ `` 8 *` #_ e %h@0   &4 &8 &&$`0&`,&`8&@2`(&|``4@2 8? @2 @28?&`&?<``* &@"* &|?@"28?@"-@2&@2@"#&$@"?@"&,`&d <`` &d`( l ""ioctl (GCINFO): %s %s: can't read disk label 㿘 l e`e@0 6    b!@"#bad file type 0%o 㿘< @@"%  (@" 4 0@" 0 @ l#l@ l  #l`" @Tq# INTERNAL ERROR: GOT TO reply()CONTINUE %s? no %s? yes %s? [yn] 㿘 l",`z h`@߁`?@TB  l lJ#` l"d`  l@T1  lU*b8J"4`2    lJ#`@T D !`+)@T`@%)`$@  $ !  ` "   l  `? "`@ 2 y Y n NΒ@S y€ Y l*"8 cannot allocate buffer pool 㿘 l#` l0 l"b@+"\ 2`" l! l?" " " * b@$ "b@ 0@ ($  / ?`$ $ $" $ $@, $ @6"@@+b @+^`0  @`"@" deadlocked buffer pool 㿘 l"@"@ % l l#0`d.  " 2 b@` b@  2 b@H @b@  $" "$ b@$b@"`$b@  $ 㿘 l#0`d .@  lbd@! lp l`"ph @`& & & WRITING %sZERO'ED BLOCK %d TO DISK PARTIALLY 㿘N` B`  l"` @ L!!`/``.`` @&` l#@# `  ' l`#P@@0 8   0"@ d d* @` 0  CANNOT %s: BLK %dProgram terminated 㿘 l",`2@R "ؒc "UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) 㿘 l"d`  l@#bch0 l# b lJ"l`&) l" :`:  @ l@ ! l",`! l #h  ": @Ԑ $d ,9! l!d4 @*;5 l l"@ + l`) l3 l@"@d!`@*'`@*% d@ @"%""@#  %c\  `рcl l",`L# # " ` * d*`cl  l"p l,`b* !#ؒ@3* @Q@"h@"dSEEKREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,㿘 l" >:`@ڒ @" 6" @"W "@" 6"ؒ @,z@Q" : ) l9/!Đ@"!Ā * <` D @ :C  @"e !Ā `@/!@@@Qg" @@Q`ذ !Ģ@@Ͳ@@QW WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:㿘 _ l" >:`@P @" 6"g @"5 l <"bxX А@" 6"L@Q ؤ $' l+ℐ@"℀ @ < D @ :C  @!ޖ "@2@Pb"@@P CG %d: BAD MAGIC NUMBER 㿘 l!   l#`8 4  la "   ``8   l#! l-@  !: * J& : 2` 6` @ : * H" : @6`e`@ђ@.2``@.-, ` ` ?U " `Ԁ "`@ .# lU% l ` `:*"@ +@ * `; c` ` ` ? #@+*@*`b( 8@ $b(?$$"$$` `8"o ` 8 "@ &^` `?/?..`@ 2a !!a    l#X  ``   !Ȑ!. M.   ?? $/'?????#@ .#'̠̐#l''Ȑ '!' "@*$@@*C / @ ,@Ȁ#a'''ע $ ?,@|@* " 㿘 l"` @( returning to single-user after filesystem check 㿘@O# l "a @)  㿘@&  @)  @( %s (SALVAGED) SALVAGEUNKNOWN INODESC FIX MODE %d 㿘 '   !#N 0 Ҕ  l 8 l",` @OK @ &  P   & &' X/dev/tty: x ! *b€$ "$$!@@f  &$!'@*A 'ܐ aP'''@*8'` '' @*5@$⨁㿘8X/  (-.`4  ': ) @@2 8&/@/8 /`/ 8܀ ffs_isblock㿘 8>0#  @ `?>@ *  @ *  *@  `?>@ *` @ `?#ffs_clrblock㿘 8 >  0 .@>@ *` @ *` * * .@ >@+ * .@#؁ffs_setblock㿘 8 >  0  .@>@ * @ * * @ .@ >@+  .@ ffs_isfreeblock㿘 8 ">  0 @`?>@*` @*` *   `?>@>   Y!P㿘@㿘 `  a Ѐ `` ` n# |!ȪБ.``؀`2`"  @@Iؐ`@@?    ?  @ "?`^؀ (&: `@*` @"'@`@*@'@ ̐@p@:C@?`@*@940 )&: `@*`  @"'@`@*@'@ ̐@p@:@?`@*@   *؀ k&: `@*` @"'@`@*@'@ ̔@pT@U@?`@*@0K0G؀ A@"`; ` @2#`@@?    ?  @ "?`"`*0" *㿐@ '@ @! 2'@'@ !؁fwrite@?# # @ c`@nG  @> 㿘aܬ @ n`aȐ ?   G+ |!Ԩb̦ @ +  * `@:6!Ԅ` `2  " @ 퀠#@``  `2  " G#`ő+ ܄ $ |+ "̒@ *`@  "`"@ ` b@@`" ` ` @%  $  2!؀` !("& ` @ &` @@&o 0#` x! |b̑* * ' ' '''' n !    `2  8 ܀  " ؀@ n ! "  `2 8 ؚ `  @;@ 0.  "  ` ` `.    ` @* @ . "   * @.   exponent out of bounds㿘  ?    {# n  n!  `2 - 0   0* .   0*  ϐ   * ` / 9 "7` @ /  9@*`"7` ``~ @.@l  `=4 = `` " `@"  `<*# `     #@ `*  n,! |)"ԐА   @ " @7* 02 0"    ` .  * 0  n! @  |" @ 0+  *@  o"Ѐ ҆ R n*"Ѐ .  | nЄ?*"b"!    * * ``  a̒ @6a n { " (* `@" à` n { `" + `*㿘 <@`y'T 6.`).`@ p *`@@@&`` ?" D% @$<?*  p` ` ) *`H9 @h@* @ p*` @ ! l$#x< @<7 `H < @@* @*`@   ,%@     @ @ *` * @@+#x#x @< < @@#x@@< @#x#x @<  @' D@< `%@T?! l#x @; '  @=cx?% @?#x@;ؔ <"@`$<.` p`*    @]#x r%sfcloseline too long: ignoring %100s...㿘 P@`'L l#| % l @&' %P.  p* `'5; T  $TT %LL@*`z?@ @ ` $TL`h* @@jϐ L $L%T`? "`@괐 @  "@ ,`,̑:  .  T G ?%P" l l"|?"c! !  ?,"&1&@T? `p@j $T%?"&&  x@jڒ!"&T`? "`@d @  "@!̀@&&?line too long: ignoring %.100s...㿘 `` @ lc'$` F?%  .  p`* @$\W?\ # l! X@6N?*`@ @^``  $\ X* @`h@j   X $ X# lc l\@B l`"#? "@ '̖$``? " 0c@8\? `p@i $\. @ p *`" *`<c@jC#P realloc of linebuf to %lu bytes failed㿘Jd  ) l  |`*d%#&@#-' +*`̑:  0 2 # |`ਕ* @ $` $`aP@i `$$ &@ ? & @鑐  &2,# ?# !ϰ ,# $&`fwrite㿘@-  b@is 㿘 `" @  b@ib 㿘.  p* `?@  @9 2@劐$@?'   N@;? a   @鸑*  |"b̀ ' ///    $@驐  $cH@ ! n!Ȕ! @   ,  ,  "#aж D, @p  $@c#` "!! ;9#$/''' :'* p@€ `$      |  oc  n$ m$k"* :`@ /` %@ݐ $$cH@ *"@ *`@*`@ *`" *  :  $"DDaԀ $@%c n   `" * * %aK  * K *D$c@_B ̀ $@c"J & n  * * ""  'aؐ  / /' @ D@schk*  D @D$c@( D㰐 *@%@Ȋ  D*`?'DD*`  " !p@%`@ 㰀 6/!+%. %@d8 @^耢 2 %@_%@D ' $@i  D`h@^ D ڠ   (` "a1$`)* :  2 %@ $$cH@ *"@ *`@*`@ *`" *  :  % `p$ 9$t ?$] o$ D  *a m"%㰲 "`@aЀ t'A   oa%x%`@  j@ e%@I  \   'Ԛ   ?  '''"''ܐ@ϒ  " o%`h@^ %`!В @@HĐ ,`@H2 @? 8@7 a?%@’ '% o`h@] @Rp'#\?'''  .   @ . @.  %@   %`h@]͐ 'D#\"# ? @'D"? @@Z %`h@] @k@= %`@] @^@; LLLLLLLLLDLLLLLLLLLLLLLLLLLLLLLLL8,HLHLLHLL8HLLHLP LLLT㿘@@ 㿘 oJaЀ a@ usage: %s [-T dir] [-o output] [-cmubdfinrH] [-t char] [-R char] [-k keydef] ... [files] 㿘 "P%@] hP <'!@Ւc@ʐ %s%s%s/sort.XXXXXXXXXX%sw+㾐!!( 8@! J?/"(( @ H(`P @ڐ?'@  @ː 6((``@\ @᭒`h (``@\ @ @ 㿘@0init: %s init: already running initinitial setsid() failed: %mrootsetlogin() failed: %msfunrecognized flag '-%c'ignoring excess argumentsX@^@]0  !#(!ax@2 @F@; @\ " ((!@:a@/ ! @> @/J 6((@ѐ!(@ɐ!Ȁ ((@Ȑ!( s (*" "b "bԐ!@(@޸?逥 f#")(@")"| @Q   )#\#`#d"Ē    @D .  #p  @< /" @7      #\#l;p#x ';`#h#|    @C  @/   ?''' @   @ @ @ @ > @ < "@ 㿀  ?''L'P'T'X'H'`L?`' '' @  ?`? #####`    ( ("#㿘 'H'L'P'T'X@XH@t@ 㿘'H'L'P'T'X @HH@d㿘'H'L'P'T'X @:H@V㿘"ܔ `""@ fatal signal: %s㿘!)@C"ڐ@q @9cannot get kernel security level: %s㿈   ?'  @  ?  "!)@"?cannot change kernel security level from %d to %d: %s㿐'DD  ?   D@ Қ ?  D!)"@#㿘㿘  @> *`X@" can't open %s: %mcan't get %s for controlling terminal: %m㿘@I@ @ ?* /@ @ T?* %@ /bin/sh-sh/dev/consolePATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restarting㷈**!PX!PX?' 6 @-, )*s!`' @} '**' ax@#!p@7:!*!''@70@D @  %*!? @8S  ?@1*$؀ (?@8E ?@?  " *%"   *j"H@ ?"؀ 萊   **V"p@ @Ð "O1*" 1+""԰"sh/etc/rcautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode~rebootp@,e 5?  ?ؐ ''' @  @ *!`"1++!!'耢'+! '' @ !*!P@6]+! !@9 ?+*+!@aP͔? @7|  ?@] \1*@7r ?@? " +*+!`aPC1*Ԑ  +*+!aP@ ?Ԑ?Ԑ    "/"x@?'@֐0+*+̐!: 21*++*"Ԑ"b@ X1-""session database close: %ssession database open: %s㿘1 |"܀ "  @   "!,@{ C    @ &"   "!,@h ؒ0 insert %d: %s㿈 | D"ܔ '''' 'D  D  !,b@E! delete %d: %s㿐 | "ܔ ''     !,"@'"(㿀 |D"ܔ '' 'D  @C 㿘@ 2  @* #@+b $   b@" . $  㿘@   " @@   @@ @%s%s/dev/㿘 ' -  )@M , @^ , &@& @B ,,cД@r& @%    & ( |""& $& $$ (%s %scan't parse getty for port %scan't parse window for port %s㿘` @3@1`@e`@b@@ $``-@@4`f`  $``-$ `@ $``  ` @ @`K$`  $` `-  `@  $` 㿘% |؀    " ( (K 2 $؀  1*"`Y 2@B @D1.#can't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %m㿐@*? - "0' @i @* 6 -" @4)@ -@# @ can't fork for getty on port %s: %m01getty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %m㿈@B ` `? @4?w?@)? `-^#k? g@-@M  @$?0Z@!O 1`  R$`  O$` ")`@` @s!? "   2 -c@) @@ .`@! @@@ ` $ 4 `.` @ ` B@ ' @ `@3{@`.@ @`@V 㿘# |b؀ 4 /j   @ ڐ $  $` ("`($b (` $"`$0P?2$ / "b@ $  0   / "/ 0/x ؁㿘!$"؀  |  |"@X & a ( "1  2 (?2& / $" 1 @4& ?"""؀ ?"؁port %s changed utmp index from %d to %d㿘' |؀ D  ?&  ( 2 0;  ( 2 @o` 2 (  & /  "& "     ?& ѐ -     @ & 0y@@ @B5 |"؀ "1. `2 (`&  @ l  ( 2 1.# |؀ .  (2 .# |   shutdowncan't exec %s for %s %s: %msome processes would not die; ps axl advised㿀 |"؀       @ )$  ( 2 /"+*"X@W+!@ ?"> @'?8 *  ? ''' @ 0  @ , *2!` @ = !*!P+ a@1/"[@ ڐ @3( 䀊   :  2/  /"ē,  @ Ӑ??# | " "$b@& ? @3 ?"bab  " ? "    $//.#@Q1*" 㿘 |"؀` +`  "` `(`2` +/*"b@ȔX 0!t.  @ ??! | " ""1*$"@ڐ ? @2 ?"""  " ? "   $0/#1*"㿘@ (   @*`2 ,-o %s: option not supported㿘@  @Td 1'0 n L  o  @  = 2*`"@. 2  0 @2    &*@&c@ T  @ 2L@ rupdateasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotamfsinsane maxpartitions value %dT:a:b:c:d:e:f:i:m:o:s:NOS:T:a:b:c:d:e:f:g:h:i:k:l:m:n:o:p:qr:s:t:u:x:z:%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad average file size%s: bad average files per dir%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: bad rotational layout count spacetime%s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad total tracksffs%s: bad sectors/track%s: bad spare sectors per cylindernewfs_%s%s/newfs_%s/sbin/usr/sbin%s not foundswap%sr%s/dev/%s%s%s: %s%s: getmntinfo: %s%s is mounted on %s%s: unknown disk type%s: %s: not a character-special device %s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %d%s: no default #tracks%s: no default #sectors/track%s: no default sector sizeWarning: changing optimization to space because minfree is less than %d%% %s (%d) %s (%lu) Warning: calculated sectors per cylinderdisagrees with disk labelmfs:%dh@;P1<@` ?'   ~ }"a ""@ 1 @ْ }` 1 1 ` `''''ВP! ; ~9% ~7/ ~- ~''''ܐ@ԟ?A? ;97* L@€  ~2"ਐ  ~."`@" )'`1"@0$`" ~"@" "`1"@H`@"/' 1"@~p `@" "`1"@rА $@" "1"@d`@" ~ "1"@X〤`@" &1"@M؀`@" "`1"@À`@" "1"@5(`@" ~ "1"@)H`@{" "1"@h`@o" ~ "1"@`@c" " c`1"@`@T" "1"@` }  "u`1"@؀ 1 "g"`"@ 1"\" @ΐbY`@ " R"1"@(M` H"a @" ~ B"`1"@H=`@" 7%1"@h2`@" ~ +"1"@&`"1@ 2 `@" %1"@`@"  "1"@z`@x`#`*`@ &  }&  }@f }` 4@ @ ,1@s ' }1$@嶐!1#2$&@嫐@-2$@塐@-2` @P  } %2`0@D  Ȓ @ ! $ " @. ''77''/7?''''7@== /  ~ } 2 @28$@`@5?2 2H@S$ ~` O?@     2@P@Ғ@ǒ  2 2 b@!2 X@Ò2@@_   & } r2 @@P  ,  @ǒ  2`@  2`pT@줄!' }  ~ༀ "@#~ s ~ 2@ l@䨒  ' 2b@P@p@ 耢   2@`P@a<    } 2 @P2< @.6@@ ?"2J?`` ?Ѐ@c\ `2@@7 @ @\ `*: :@ 2 ` 2@ @M@ ` 2@! @M@Ȁ @%@   ~ }`  `2M@!P@@ ~`   ~H "`."` ~ऀ  0 "2@@!  `, %2@@ܐ!`  ( '`2@@А!`Ѐ? ~L"`Ā  J "Đ "Ԁ   ` &($*$& ؀  ` @ 7`  ' *  4 ' 쀢   ~ @@? & "` ~؀ ԑ* " `䀢 耢?2a@Ӷ2b@ӱ  " `Ȁ?@"`̒@ ~" B" ~@ 8"  ~  " a222b@X@Ӈ" ~̀ 2@ ؑ2 "@ ~'P`'T`'X` `'\!!"@X""'`@R% ~`@M ~" ~@G ~"`@B%@@ #$@" `&a:` "'`@  ~%@  ~" ~`@  ~"@ %@@ $@@2 ~a b@"@ q@ $@`&a@@ :` $@ ~`   ~̐@  @ ~ @@ }`/@2@b!ܐ?'`' '' ~ `'\@ 1'`1``@Y؀   2`P@⨔@@Đ ШШШШШШШШШШШШШШШШШШ,ШШШШШШШШШШШШ<l̘0\͌ͼШLΈθXψϘ$LШШxШioctl (GDINFO)㿘 | e`e@耢 6"3 ~`   ~h`@!/"h 2`@4 0 7@M!@!@,"ioctl (WDINFO)%s: can't rewrite disk label㿘 ~!h`6!6 e`g@W 7@MȐ!7!@㿘'H'L'P'T'XH @J   P`< @8 @ @;@M@ -z tracks/cylinder-x spare sectors per cylinder-u sectors/track-t file system type-s file system size (sectors)-r revolutions/minute-p spare sectors per track-o optimization preference (`space' or `time')-n number of distinguished rotational positions-m minimum free space %%-l hardware sector interleave-k sector 0 skew, per track-i number of bytes per inode-h average files per directory-g average file size-f frag size-e maximum blocks per file in a cylinder group-d rotational delay between contiguous blocks-c cylinders/group-b block size-a maximum contiguous blocks-T disktype-S sector size-O create a 4.3BSD format filesystem-N do not create file system, just print out parametersusage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: %s 㿘 }`   P = data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increasedFilesystem must have at least %d sectors Warning: inode blocks/cyl group (%ld) >= data blocks (%ld) in last cylinder group. This implies %ld sector(s) cannot be allocated. Warning: %d sector(s) in last cylinder unallocated cg summary malloc failed %s: %d sectors in %d %s of %d tracks, %d sectors cylinders %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) super-block backups (for fsck -b #) at: %ld, %s/'D'H@  ~? ''"`@ @ } "`@ @ ~ "`@ @ } "`8@(#X@ϐ @V }` "B ~@'Hbt@ @ ?28@#p@ @(! ? @: @ @ x  ~ ~`@ ~` ?@@B ~" ~ ~! ~@ @ ` $ @  ~  ~ ~"ap"!lܐ?"e,"e(ܔ  <"%("%, ~Ȁ ~8#x@( @l @  ~ ~܀`  8@( #@Z 8#@( @Q  `  8@'#@E 48#@' @<  `Ԙ 0  49 @'@.  " ~9 P@'ג @$    9 @'̔ @  9 @'@  9 @'@  ; ;`8 8 H L888@  P =   "`P 4  " T =   "`T0"`T:   "8  =   "`` 8  9 0 4!  @'{:@Ȑ ` ~ 022 4$%P$ t@$ x$ |`| "`d =   "`da4?@8?@@&@?@@|&@z& ?@v@ْ?&  &?=  * "`@* "ܨ  0 *` * ?: ;%0 `t:`@ <  e0@B?#@k ~0 *  "0= X-`*`"X@x@ےܶ"`8`*` "``"8 4 02  89@& !h9@&!@j * `: |* # |# 8# `# 4 %P@*   ,`@,: @ @@= | , :`%$ 0 *@  ` |@,*@ , :`@ ~ @@ ~@"ܐ?`x @@s$`)9 `8  @cܠ"`0=` @* ܔ?`x@@Sx@9 Ȓ@%!ܐ ` 0 8::$ `$ 0$ 8@ג@:$ P@3,`ܑ*  @`,`: @@&@ | , %$:` 0@ *@  ` |@*@ , :`@ @`0* ""`0`@ ~@"`x?@@$`ܒ `0@,`x?@@r` 8ܒ 0@s* ܔ?`x@m@x!9!@Ȑܢ"`0 @]* ܔ?`x@W@x@Q @% ``  ~9@%"9"(@%` 9@$"P9"(@$ ! ~`  0`؀ 99"p@$b  4`Ԁ 99"@$ْb@&  ܒܐ @"   ~9"` 9#(9#8 @$ܒ ?@@^`Ѐ`$  ܒ`@Q ~@"`x?@@F$`0 @ܑ* x?@א@: ~ " @-$@Ő"x?@@# $ %P@*   ,`@,: @ @ @ | , :`%$ 0 *@  ` |@*@ , :`@ ~@ ~` ~  22 : :` ~ #  ~eP؀C`" @$`@c"`x?@^@$` `@*  `, @,: @`@@F | , %$:` 0Ф *@  ` |@5*@ , :`8`  @ |@#$ @ `@, 9@#Ր#P@" 9#x@#͒@ `܀0 ~ Ѐ`9@## `` `@  9@## ܀`":9@##@# :@# `Ѐ`@ P@:*  , @,: @@-@ | , %$:`@ *@  ` |@*@ , :`@L@  $ ~d|<$$@@@$ఠ@ $ఖ ' 4 ~:@#D @@  Ě D ВehL ~ @  L  h XX@Pܥ* #X @ː | `@b* %P  eh`ܒ#\%`$%X$%Tܔ%``"%X"%T |`਑* * :  ::::`#\ p@" "cXD LX "h * ܦ %P .#\? L?, TP@t* 2ܦ%P ܶcXܠܐ@`8 ܐ|@X@@Q@В@@J@F@Œ@Ò@@@㾐P@:@`,L?= .#\ T@'* R?eL?2eXe`@@* ,eL?2eXe`@@L?,.#\ TP@*  ",L?2T.#\ P@* 2`8@t@U$, $, x ` @e:  @ $  ,8 ? 4  @ܠ``@- `` @$&)`,#:a @@-  @@18$8@,@!:!X:@!@- ?@`$`"@ e @w``@r, ܠ@k $Q2`!:8!* @|@[ @!@ %:@Q`'`@K, ` @E`8$@ܒ@ؐ@!!:|" @3@! ,$ , @  ܒ"@$ `@"`@| ~$`$`d`$* #  }  ~%: Ȥh`d`|@:@?`$"@@!V ,# p%D*  0  L2  # #  # l  =   "`pܐ @ ~ "ad:@!3"@   F ~  ~`Tܒ <$%\$ @$ <$ X@^$ \`, $ D$ $"$ $ $ $ * ܐ *`@" }܀`0"|!:$@":"H#\@ `$"P`4`:`#`,` &#`&$" HH?'#\@ ֚a :@ ϐ#@@  , 7 1:5:3:/@ 2%ܢ`@[ܠ@U. ܠ``d , @#p@ x @ c@`ܶ`, 2 ~:@ #x ~ ` } @ΐ @f  ~@$ @F `T`=``0"`d *  ~ad @0 0  ܶ `,Dܒ@```@. ` `d@,`,D *  }4" ;*   `2@ @@ @ @ :@g#Panic: cylinder group too big 㿘 ~ ܴ @ $4@ܠ.@ ༒@$@ $4?@ @ ~!d! }.@ࠒ  @@ "U$ $ $ ,?2@4 4 ܐ&4 $ $`@8$ pܐ $T`,  $XeP@N`* $\``,`: $`e$``@>`@| , `:` '$d@1`@ | , `:` ?$h`h` $`h%$ * @$`l @ `|@쯓*@ , :`$`ddࠐ" $C@]!@ %  '" @"U  : ` "`\@@  ? $+@* ?"  ') ~ 0' ~  @ԓ, ܔ "l0 2   ܒ@```@. ` `d`0,@  8   x ` @D: Ԁ @"Uܐ@6`8`"``cؒ@@~%$`   l;  +  $  * * `ܒ`$`@t |@  * `"`T`T@@ `" |@` @ޒ @@X @T@Ӓ@ђ@N @̐@I%P@ * "X@>@*  Ԓ@@@1@ @,%P* @@@ 2@`8`("`( (" 8 @ߒ$ ( 1$@*4  "  8@ "@@'@"U ``: ` "``@@ `` ? %@+@*`$@ "$ܨ`8@"Uܐ@l`8`"``cؒ@@%$`   l;  +  $  * * `ܒ`$`@ |@C * `"`T`T@@ `" |@ @ @+@ @@ @@ @@%P@ * "X@t@ *  Ԓ@@@g@ @b%P* @@@ 2@ `86/&*`4 @ U"     : ` "``@@   ? %(@*  $  "$%$`9  l  p  h  `!     %$4+    "  ( @ ``p怊  %$4+   " ܒ` $`$`̐ $``Đ $` `Ȕ$`'@'` '`$'` @```@Ȓ. `  `d`0@,㿘 ~ }  `"` "`"`#!4` ~ ` `4   h "X@$`: < ! ~ `@`4 $(`Le@ :`B *2   }$h``d`4@* @y 㿘 }  "  `` `6` @7`?$ @ a, @*` `2` @%"cg 0: bad magic number first cylinder group ran out of space internal error: can't find block in cyl 0 㿘 ~ ܨ ! }d* @ @`"UF+#p` 2`F$# F `` c``@ ܐ@8@  ` 8` &`F#@P 0 @`"U `> ` @ %$``   l: * $  * +* ` ~`  ܐ?#` d# @ ? "` #` `#  " ܐ@ |@M `* @"U@"TT "  |@ @ @2@ @@@@ @ @%P@ `* @"U@"X@y@* ` Ԓ@@@l @`@geP* @?2@ `0E`4@  ܆d`8 "@ " `8`̘#`@ #`$4 "$`8"@*`   `8 ' @"U , : `"``@@   ?" +@@* ܆ 8   d*@A`fsinit: inode value out of range (%d). 㿘@~@@A) ~ ! }& l d*@  @"U@" F@F#p@ 6`\?"  ` * @* ` d @*` ~!d"?",@@  H x@@l  @@ @  * @  @@ @@ x ` d* @,@  0@ ܐ@x*  @j ܐ0@Ĕ@i㿘@V getrlimitsetrlimit㿈 } `%% ~@Ԑ @*? * "@$ @ H@H"?@  6H@=""$*@ 8 " $@ 㿘    @ @㿘@5 @i seek error: %lld rdfsread error: %lld 㿘 } `  ~ ~ @ ~@@ݐ00>  ; @u! ~ !p  @A 6!pI  @M I@͐ (@ !@K > I  @< 0I@ (@ "wtfswrite error: %lld 㿘 } `  ~ @ʐ ~`@05 ~ `1 ~>  ; @'! ~ !l  @ 6!lI  @ I@!P@I #@ > I  @!XI@n!P@8 $isblock bad fs_frag %d 㿘 8>># 8 2 8@  `?>@ *  @ *  *@ `?@ *` @ `?I!@b clrblock bad fs_frag %d 㿘 8 >  I .@>@ *` @ *` * *.@ >@+ * .@I 8!@ϒcxsetblock bad fs_frag %d 㿘 8 >  J  .@>@ * @ * * @.@ >@+  .@J 8!@`PCOLUMNS㿐`h @?   J@~!(  @o " P㿘@ -%c %s -%c -- %s 㿘@p  "#% #J!J-J)J/J  @a`@!`@? ?@㰀@ #!Е*@@ #`@$#@ܐ@)㿘@ycall completed call aborted call abortedinterruptunknown ACU type,call failedr%s: can't open phone number file , missing phone number㾈  R"'b' "쀦   "@B@ bh JJb@ 0!L @ @  ~@!| & @  @ J@h"aJb J @ ޖ"  ~$!L!x`" @֐ 1J1Jð# @b "b1J# J@ @3 !'J1 % ~#J8'@t 'J * '@P쀢 !"`€"܀ d$x"c@@   'J@ U ~! J"@rcP 2 "J@#X1Jt#`)J9'J#@sL  ', '!`@! 2%@@'@Z#*@쀢 1"  ܟ ~ "ax"@`@ E '!@p J@ ~!x` "쀦   "@c@<"bhJ@  0 "` 1J #@"bh1J#Jb@ call terminated disconnecting...㿘 ~!x`  bhJLb@ 0#2!#b!! JLb@ T!N L@[  ""bhJb@ Ж"`㿘 @ɐ ~!|@ 㿘c4  c4@r   2 v831vadict3000courierhayesventelhourminutesecondLocal file name? %s: cannot creat List command for remote system? 㾘``. ?> "`` `* "`@f  L!@<$ @8@=S!# $`L!@ڒ0L!@&! @>0`@[[take] usage: from [to] %s: cannot create cat %s;echo 㻘  L#@$ *% @[   L@#0$ @ @=! 6L @#00 LH$@ L@X %d write error lines transferred in 㻐! '"'H'L@@ `  @"X `@  @]` "/@ ! @Q  O ` ` 2  @  @ʐ!R`x@﷐ @   `X P ! 'M%M b @(     `O  X 2/3*`L@:  -O & #*O`  'VN 0`@"@ XH@"'@8 & X' X    H@M@Ґ 8R# `  !M H@ "@  d@;  b  @ɒ`@: @HLocal command? can't establish pipe can't fork! can't execl! 㾈M#P@ ! M@2 M@#`0D@  M@#x0<(L!@ Ք!  @_@]@ 0+@WR`x@ a @ @Ԯ 0@k @< @:  @M@O#@ 㿘  "`\ @ƒ r%s: cannot open 㿘``. ?> "`` `* "`@dʐ "L!@ p$ @lN@oa 2!N! @0 ! L@ T!~  @b timed out at eol chars transferred in 㿐 `'H@h  N `"\@i   @[  `@  @`)9 ; N% *`@<: N !R!~`@ɔ 0@@b @ !  3M  ? & @N  &\ u' q``Taހ +`'`  Taހ   '2Taޒ!Raހ Ra> @   @    @ "!Taހ " !T!N `0@aT!~ " !! @1$ %   @S  `\  `N@B" @ `   `L` @  ~ ` !R!ހ`H@ H  *`@: N @ @@픐 !RaN ""Raހ MN$@"8"$@ H"` @ `d @p [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo 㻘  O"P@ *$ 8! !@   O@ǐ"X0)!$`@!N@na N! @0R#:` `Ox@1$ `O@)$Ob timeout error (%s) 㿐   /@ !R!~`" a! @Y$ @䃔 @S  `!O#@ w@q` `c@  ἁ㿘P`@   "`can't find `%s' away for 㾐@& `` "@ . :  `* "`@bܒ M#P@ ! g `@쥒  @쪐  @짐   @  `@   @`@{ M@#x#' ,)  @ #' ) @K aR!Nb @ @ؐ   @r  @o @P @@3 aR!N`" !P @ "@` @` d @I  @N  @K 㾐@ `` "@ . :  `* "`@bR M#P@ ! j `@  @   @   @  `@   @㕒`@ M@#x#' /)  @X #' ) @ !aR!Nb @|  @y @K   @  @ @P @Y@릐 aR!N`" !P @& "@4` @T` d @  @  @뾒 [sh] ! can't execl! 㿐Q@-!8 @묐  @멐 @ n@ @f@ ZQ@!@ @땐  @뒒 0 @뎐  @닐 aa\@ Y /  a\@ 6c @Q@!H@C  can't create %s 㿐 `% @_ aT.    @ @` Q@ߒbX `@ @ҒO`nQ @Ő"`[cd] %s: bad directory ! 㻘Q#@ $  "`#(@ 6QQ# @Q@#8 %s [EOT] 㿘 `@   "QQ#@Q@#@  @O`L@ @̐ 㿘#H`  "@읐@~@ א 㿘@    "`X!@ -c㿘!a\@ /  a\@ a\R@`  J "  " J"@J  2 J`"J* J &J %s%d %s%c 㿈#  @@6$@@L`R@!c #R `22쀢 2 2 a`  s@?Q@!@[set] onoff㾘R"@ %! G@j!  ` , @; !%  ?,!% !  ?,!a   ?R.`*a  ?R`*R@"aR@"a   2b*   ?*@ Q v %s %ld %s falsetrue㻘S@ϐ a da%`)S-S+S@`  ``">T ``"  K 0`"?L E `$@ @O ?`$@ `* $`@_`` ?"``* $`@_֐   @+`  ! S S (@    @  @  h! "@eR@>b  Ȱ dd$Ȱ d { ;'"d"@k  d @g 㿘! #"`{@H @φ "`z@B 㿘@". >   @E@K @~{[*?$`'"\pipeecho %s/bin/shfork"Echo" failed read"%s": No match Buffer overflow expanding "%s" 㻈'DSb@ D@? SS@ #}DD@$@G ?# S#@j@h @@d@b @R @ @ ? S@#@N @L0J@I ~a@h$@A@Υ쀢  '쀢 S!@c 0 S@̐#0) $SD! c8  ~SD!cH@ 0!*N   ( 1 ~ J  81 ~*!㿘 N@ "N    send breakget this summarylist variablesset variablesuspend tip (local only)suspend tip (local+remote)exit from tipchange directoryconnect program to remote hostpipe local command to remote hostpipe remote fileput file to remote UNIXtake file from remote UNIXsend file to remote hostreceive file from remote hostshella:l:s:htoe0123456789%s: cannot specificy multiple -l options /dev/%s%s: unsupported speed %s cu%ldall ports busy link down evenoddnoneConnect failed 㿐  @\ !   """bܦ    +5 -T79[v; `DqV X*` € "j%"  P <T!@c@痐 ! "@ / "T$T"@cN b @j֒J`2P  #P@ 26%P  <bT!@pc@e a "! %2Ȕ  ?2b6`?? "܀ "@%"ܐ *? " @ *?@@x??㰓*  @ @ ""@"X@U @R @O @L T#a̒ @I@ ?T@ #@ 2 U@   @ `L@ a`@Gd @i@@ " U UU@c  a@_ a@[ a"!LV`@@ " VU@  (@ @ K`L@ʐ  @@VVVVVVVVVVVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdVdTVdVdVdVVdVdUVdVdVdTVdVdUVdVdVdU@Uusage: cu [-ehot] [-a acu] [-l line] [-s speed] [-#] [phone-number] 㿘Vap@l!@a 㿘   "b0"@ `V'Da@憐 c' ""0@R / "`LĐ "`L @ E`L P R"`Q @z" @  Rb!* R `  @ "b@ ! "  @N  "b0 "0`" "@ Rb!* R `" '"@' "` @   @' @ o`L@D '@  b0 ?āflock???%s (%s) <%s, %s, %s> %s 㿈!Ȁ 0R @  V@#0&@#  @.@' 2V#@; '@x* aVWc`#\@#`@haaȒ @Racan't open log file %s. 㿘!W @g` "aW !@`parercfoexesdiprpnoeieelcucmdvat/etc/remoteREMOTE%s: unknown host %s %s: can't open host description file %s: possible reference loop in host description file brfsdu%s: missing device spec %s: missing phone number %s: missing acu type hdraecbenbsctbvbnvtantrwdctip.record  dlclet㿐W@! !J /W@ ##!"`"`#@ϔ 6G# b  N /?$b@yڒ  ? b     #""22b !  $}"bP?? <0P <W!a@0  <W!@b0W!@b8@䛐 t#4`t- + % ' ) /W3 5 7 9 ; @ 2 @9  `̀  W@Fbp? !$Wbx@;"?T$%"T W 4b@ :@ 42 TW!b@W@L  T b܀ ""bT  "`2 TW!b@?@4 T  "Ѐ`2 W!b@/@$ @ :Ub@  2"Ȁb "܀`  T " 4@@ 24@ 4@ "bWb@ :  "bWb@ :  "c8Wb@ :  "aWc@ : "!Wc@ :  "bWc@ :  "bWc@ :  "cWc @| : "#Wc(@s :  "cXWc0@i : "#XWc8@` :  "c@W :  "cWc@@M :   R"a*`  "@ b W#H&b؀  W#X& "`W@ ~! #`W@ w!x "`W@ p! "`W@ i!pWc`@%?"&Wch@"䀢?"'"Wcp@b? 'bHOST%s: no host specified 㿘#Ġ`1  Y@)"h  YP <!@'bp@ " #"` $#""8"8  @1 , 2*"8 "b&"8 "8 &"8"""cuusage: tip [-v] [-speed] [system-name] %s: must be interactive %s: %s, unknown option %s: phone number too long (max = %d bytes) tip%ldall ports busy link down PHONES/etc/phonesnone%s: bad baud rate %ld %s [EOT] fcntlConnected connected 㿈@ @ @"` @+"b @+~"` "`PY< @cx   ! $ Tǒ9 ;ZY!@c@⃐ @r  <Y!@c@v /) -Y5 7 9 );Z% ! `J@ -  J 0 9 n v<P $P   $ @_q%"<@SȰ? ݲ``,c\ @ `2&![@ ( P <Y!c@8 @- @aB `J@ 2*@ "b"Z@Q !["X@G @D @A @>  ?Z@ @ 2 Z@ ( @x`L@ !`@B] b@Z@ 8 &Z @&@Z@Z P!@`  P <`Z@ X@ @O`L@ΐ Rb @ϐ  % Z@q p@ @:`L@Ṑ T "@"@͒ ?"@ސ`@i" ?@ ?2 @Ӑ`@^  @㥐  % d"`   %   *`  *`!     : ( $ % $d $"` """ """"`"`"`"` "`"`"`$"`"`(" "( *`"$*`*`*`*`@T*` @b% @@P @ዐ % T`Z`%Z@@` "`@@@A 㿘@ @`L `` `` `@G @0 㿘! #D  @I` $#D㿘! #D  @=`$#D㿘 @V` @3`㿘 d @5 㿘  @- %s㿈 'H""\''L`@' ' @# '[#`@ @)#H !H3 a:  H*L'L 'H ? & @ a  &a2*`H*@ @  b  H@  㿘 @ݐ   \"@U  #H@ %c㿐!T!.` @ Z%- + 1\ ? % @Ր  $  ` `L`o -    `2C`\@a " <`\`T   aJ R`?"쀤 Tb/@ Ta î \@   2`\L`2`\`? "`@   $  ` ``\@vT``#\  ` "*@ R`b/@X Ta " O@  㿐! b+?/ "@P !  #!  `  J < <` #[*L2  ࠀ 2  @:`@c` @ L 뀢*:  b @ l l `" J@ @* 8(8`  `" J@ @   J  n r t fEb㿘N @2 ] ^ ? \K  /`  `? HH? .@ `@2 .@.@.@ `.@.@`Nְ.@@* 8``   ^(@@` @ ?*@(@(@(@%c %2s%-2s %c %s 㿘. ]:`@֐"J`< %`<!' %]#]  "M oࠀ 2 M oĠb@N    * @ N 2 h# b@@,@0 Rb!? * @ Rc ' @'Ȕ  >/Ԓ S! :w''Ԁ'/'b@ Lost carrier.write㿘  `  #p ?  @*@h   "`2^^ H^@А Xoddzerooneeven%s: unknown parity value 㿘!" `""" " Z`P@h    ;"`" ^`@\    ! ^a@Q ^ a@I ^ a@A  ^!!a@W@ #pb @  * $ @ 㿘 `D!  @  b @ #@ a㾐   @֔ O%` ) +^1 3 ,−@Ɣ O ` $ (,R!.`, 4 @"!, y/@_b % 4 n/ y/ "a, @` @ՠc@6 㿘R"ꀢ`  4 @m@А 㿘R`?"  #@ 㻐 @  @ ^b@ !^#@ ^bp@ @ _`@ݐ  @#  @+/ @   b$@M h` "`2' @ ' @  L  `,  ਠ @'Ra. "ǒ 4"’R` @g :   *` ``^: | " 4L?  "   ` * "@S * /var/spool/lock/LCK..%sCan't open lock file. Can't read lock file. Stale lock on %s PID=%d... overriding. Can't seek lock file. %10d lock write(_Ȓ!@-*@! M @  @_!@b\?@Ԓ P 4 ,@ @g_!@ؒbJ?@ H@  "`@R:?!_c@  @L  @@=_@c8!?@_cP@rP@s@S@"  @@⪐_@#X?㾀_Ȓ!@@⚐Home directory path too long: %s %s/.tiprcrset %s㻘!`!   @Z 2$  "  $   2 !@ !l $ `!l!@Fa+!!l`$@k`@]a !' %` @Ւ@' 2*@j#@[ P@! `u ?*`uaccess denied out of core 㿘N @r  2 `@#(0A  "1N@  "  5 " "+N@/  " @Β )  P @~ @P & `@#80  ?.   &  !V @ N  &   . all 㿘a`@ #!`!L @  " @y  2L a|@; 2 @ a| a@8 $a|record%s: unknown variable 㿘@ =  ,@ ;a `  @Xb03a@JaP `T0%@{ ? "N,@Ӑ aL`@  a@0 ! @ 40a!X@%s%s=%s=%-5ld㿘!| !``"$a|%`  ?`$  @ `* $`@Q`| `"$|ga|@$a|   "V   "([a|; "BUa| a!``?$a|" !` !* #!`@Q+ !a@"7a|a@|"a|  `-$a| 9 &a|a@$a|@j a|` a"@a$a|a|a@\"a| `  $a|WN a|a@$a|@Ka| "a$a|@D 㿘.`2 .`.`   @#h`?㿘a a@]   " @T    n r t bf (: [ *`8"W) b:\ ^2D+J? +<  Є (8Haa  (8J"J+  J/ 74?(JЄ /  74?( ?+ + +  (:  \) (+ ?㿘t 2    a@Wߐ @ǒaP ݐђ parparitylelocalechohdxhalfduplexrawrawftpetetimeoutcdelaychardelayldelaylinedelaytatandemdidisconnectecechocheckHOME/bin/shSHELLverbverbosetabtabexpandscscriptremoterecrecordrcraisecharraraiseprpromptphones/var/log/aculogloghohostfrframesizefoforceexexceptionsesescapeeoleofweofwriteeofreofreaddialdialtimeoutbabaudratebebeautify starting call...K can't initialize bizcomp.... can't set dialing mode...D%s 7 can't get dial tone...ringing...1 %ld second dial timeoutbiz1022 !TN`c@"c@" "cc$""Ȣ@'/@t cc"Ж (@ b@ڴ@Еc@" 2TNc#@} 0! "cc@v#c@{#(#` c,c0@nlcH` @W㿘d`V㿘d`؁㿘! d"`@P @ "@ 㿘 b d@@a8㿘  "` @ϒ 㿐 "@L@-da`@؝ ' @  @a b @@ @؊  `` @ /Ȱ @~ 㿐d'Da`@v '" @a b @@ DJ `@/'D DJ@   @f  @O ``?Using "%s" can't synchronize with courier couriercan't synch upAT E0 AT C1 E0 H0 Q0 X6 V1 OK AT D %ld second dial timeoutcour!R!N`d#@! x"@@'"@ @g dd@~#!`dd8@S b @cP@ b@ dbcX@ d@t#p @t!`dbcx@ N`' % ,J ="*J  =b@o@xbdc@s @``$d! ,dc@m4d ` d@d㿘! #"`x@~ @ "`y@x @@"㿘 b d@=ctimeout waiting for reply 㿘e@"  "`@ @㿐e'Db4@m '" `DJ@  @b   @m @ 2@a b @ג@ DJ `@/'D   @B  9600/ARQ 9600 2400 1200 RINGINGCONNECT%s e#X e| b@ @# @%b@  x@ i b4@  'x@T  @" ` ?;' ` 0/e#` LeO ech@ eTaN cp@  6e h`0 h@ #   e%* |?''||$e @А @ 2e!@`, b @9@ 4e@)#xx@֨   AT Z +++h'  )fЪ%-f"@ " @E! (@S@ "b@ì`@ ('̐@|p 0 2+ @|j O  @|d K  @ "@ @ "x@A @ "y@; ``!@  㿘@@ @Δ @@`㿐 ''@#) 㿘@ 㿘@ connection timed out dialing...X "Ȓ''D'L@/@'@   @ ' f@v#@l 0hR# `"f@k#@~!`L "Ȑ '@׻@$'$@"$@ @ʔ `k@ׯg `l@רgbD@ @gD* @@` @ߒ fc@@ @Ԑ fc@9 @RDD@3@' L $ Ȓ@"u@@ OÐ A`?㿘! f"c@ @ "@ 㿘㿘  @  starting call...line busy...acu open error...lost carrier...dialup line open failed...`R# `'Dg@ΐ"X @ "` "`gg@"p @"|  @G Cha,@1 @D* @ & @~1@ &! @   @  @ @:  `@ֻD'D@̛Đ @א@  b@ʒ  "b "`gg@x"0@u"@K a @  @M`0,@@ !  @ֿ@' @Ւ  @ڒ @Ē!@@a!` @*`Ā`  b@! 㿘@   @ݒ 㿘@א ! " `x@֏ @ "㿘@Ȑ a $ @ԗ   ! @" `x@s @" dialing...ATv0 ATTD01234%ld second dial timeouthayes@  !R!N`"h@!@!`# b@9@'b@O b@z b!hhb @ٰ"@@bhb@ϔ L` # ,J ="*J  =@א@˸ "$aP@˱ @c*   h@\" * :  1" @  $aP  @/$aP%L !x ,hb(@ih @L @㿘! #"`x@˔ @  "`y@Ŕ @㿘 b h@dbtimeout waiting for reply 㿘i@F   "L@ 㿈i'D`@Ӽ '"!L' @Đ 耢 @Ӱ $ a@  b @)@  `/OJ@"' @>D D쀢   @Ӎ  OKCONNECTRINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)㿘i@"?Б* : `*`i#8 €i@ِ"0i@Ր"0i@ѐ"0i@͐" 0i@ɐ"00 i@Ő"@0. :`i"P@ @"ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 㿐 b @: @E "+"@/ "@0 i"cP@ʑ iB#X* :  0 3i@v#`i@s#x@ "b@Дi"c@u @  "@  "`x@ @="AT Cannot synchronize with hayes... 㿐'  +j%"`@P @ "@ԟb􀢠 !( (@6'@x 0 2 @x O @x K  "x@~ "y@z `΢`j@ Ȱ Using "%s" can't synchronize with t3000 t3000can't synch upAT E0 AT E0 H0 Q0 X4 V1 OK AT D %ld second dial timeout!R!N`j!@ے! "@2@'"@H @u jj@Ɛ"!`jj =(S b @b8@Z b@[ jbb@@ j@t"X @ɼ!`jbb`@ N`' % ,J ="*J  =b@ӷ@bjbh@ @`$ᘠ!x ,jbp@g|j   @ᘁ㿘! #"`x@Ɣ @ "`y@ @@:"㿘 b j@Qbhtimeout waiting for reply 㿘k@?   "@!8㿐k'Da@ѵ '"!DJ@  @Ѫ   @!8 2@a b @@ DJ `@/'D   @ъ  12000 7200 1275 7512 57600 38400 19200 14400 9600 4800 2400 1200 RINGINGCONNECT%s k"p k| b@1 @0 @_b@E x@J i a@E 'x@NE @"! ?;' ` 0/k|"x LkO kb@ kTaN b@X  6k!`0!@˒ #   k%* |?''||$k @ !8 2k!@J`, b @s@B 4k@c"x@   AT Z +++h'  )lЪ%-l"@ " @K  (@M̐@ "b@ң̀`̐ '̀ @8 ('̐@v 0 2+ @v O  @v K  @ "@ @ "x@u @ "y@o `` @  㿘@ѐ@ @ @Ɛ@`㿐 ''@] I  READYcan't synchronize with vadic 3451 vadiccan't synch upD NUMBER?Vadic will not accept dial command will not accept dial%s Vadic will not accept phone number will not accept number DIALING:Vadic failed to dial failed to dial dialing...ON LINEcall failed call failed0!d  !l"`@@@`l"@l@"  ) l@e"llv"@Ѷ d@""@ʒ @ l"@rl@#  l@A#llR0lH 2@@Y@n   l@)#Pll:x@Ϣ !l#@B@?l@S# 2 TNl@#ll "ll@#l@=#@|  l"@   @#llg 㿘 @b㿘 @ƾb㿘N  ! "@ߔ @s N """FAILED CALLX'D'mc@  H'lDc@/Ȁ`? '!'n`h@(  @4! 0 @t , @p%mȠ# `@( " b @ƎĀ  @  *@`'*D@ Ā@ @I  㿘 !@ 㿘 N@@ ` N@   2   J@*:`  `? starting call...line busy...acu open error...lost carrier...dialup line open failed...㿐R# 'D`'Hn@!!H@d  "b "`nn@! e @!0a  @"0 <nct@΄ @)D* @ & @1@[ &" @s  @p  @m @ D@H A@1@  b@$  "b "`nn@Ґ!H0@ϐ!X@ b @B  @ŧb0@  @A @"@   b@ŏ 㿘@  "0@K h@E %  # @`x@ @ @@ `@ @g㿘@$ b # @ # b ! "`@Ӕ @Ob" `x@ʔ @F"/dev/cua1/dev/cua0Unable to locate dialer (%s) `@N <N  ~ Z"  @v 2 # o @2j Kb@ψ)`@)`@ Ԕ ~''b@ b@  /b @ /b@  /b@ N b@   N  <2/ǒ /b@  /b@ @ b@   M/Oǀ Bǀ G /b@ߔ b@Ӕ )/@ībOǁJ  =#\@2J`<"  J_"* * J *acan't synchronize with ventel ventelcan't synch up dialing...#k$ $ $D$I$A$L$:$ %ld second dial timeout%s... b@J  o@w#bhoo !R!N`"o@c#@v!`x@θ@'@Β o@#ؖJ )#ab? ? @N J ba"? 4?o @>c@  @  !@@ɒ #`  ,oc@bo 摖# `@C`># :R!N`6@ru 2* @rn *J 2#JJ " K  \ ``H*@ `*J 2 p @Β 㿘 @éb㿘! p"c@ʔ @Ü"㿐 * /' ! *:  # $"@ê  /" @é  @ä "@Ø  * / timeout waiting for reply 㿘q@}   "@"X㿈q`@ '/'"#*`: #  @"X  @ߐ   *@/a b @X@(  `*   ' @Ő * :` `?*@tip: ioctlP! #"`x@͒ @А "`y@͌  %o)q@. ab`@$ @ b@s @o!@"` <4 <@  $<   <" '@ ``$Ő 㿘@ dfiPRrW㿘@5 qb@"  "` +r) # ! ' %q57 9 "* `@€ %  $`$  $  $`  %  $@"@?ߐ?* & @ ` @@@  @ː &@10@@ `ǀlǀǀǀǀtǀǀǀǀǀǀǀǀǀǀǀǀ4ǀ@ǀǀPǀǀǀǀǀǀǀǀl%s: %s%sfts_read㿘  `    `  ! @     耢`2 @ 1  @ ?` Kr#*` € ``z`!r @f_ @%m `!r`@fT @ې  2 ``\`!r @fA @O  M``@`@ F@  @$` `   2 `8``@`@ 2`8         @` @` ``@ @-`  "`"  `r@   "`@i 2u`8" r`@L 4ʄʄtʄxɼʄʄ%s: is a directory8 m 9 7 5 3r%  +<;r/-8@ʒ   耢 8!7F " @e @r`E$    `r#@a4$  ' @ "( @  @i  쀢`@@ϡ "  "@`$  malloc㽐`  @`  `<   @K ? @{K?*$@Ð sa@  @Δ`02@    @u@ <d <`耤@2 g   @ @_  @ʠ`02@    @G@ <d <`耤@ 9   @ @1  @r`02@    @@ <d <`耤@֐   @O  @[0   `"`@Sr @6remove %s? override %s%s%s/%s for %s? 㿀  ` !t`@!3! !` < ( @]  2Q @Q @ @ Ot Ȅa  q"t  #\@h!@#?P`? "`@ ?P  $?P ` 1! ? $ @!  &!` 2 `y `Y "." and ".." may not be removed㿘 @ % #t@ ? (J /"*@ / J .2 J  .2 J 2    @b $ `&   &  usage: %s [-dfiPRrW] file ... 㿘P <tc@֐!@ː 㿘@6-0123456789an:m:oft:%07lo %07ld %07lx strings: length less than 1 strings: max length less than min strings: %s stdinrstrings: %s: %s %s:%sx@'Du`P@ 7'7 ??-! /u1u9u7u; )J%* :  GCw* @€>D* ?J`- J  *`J  *`@    $7 !7"@Dp@Dl""J o"p x d" x0"  0p@D@D@X* @   u!@%`@  @ u!@`@ @Ņ  2. b!#u!@b`Д@@ ?u**9@#`''-?@ u!`@׻   @b'u @۔(@ܐ?  ""a'aR`  a@u?'a "'a k  @ @!  a  ! !     G 2D  ! ! & ! ! @ ̀   ̀  @    "@@   "@ !@Il ?2  "'a 'a  "a" 2 #\ @J` 2 ",@ `80,@`@#\ @J`   ",@@  #\ @J`  @ࠒO ,@؀ ua@즒 @쟒"@u@웒*`0`; ?"`` `* $`@<* @v*  #\ @J`ߒ` "``` ?"``* $`@<   @Td@ 2@@ťֈֈ՘՘՘՘՘՘՘՘՘՘ֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈֈ(pֈֈֈֈ8㿘 a !  "a  @ 6#! ! `"  `"`? "`@   "?usage: strings [-afo] [-n length] [-t {o,d,x}] [file ... ] 㿘wb@!!@ 㿘@Lshutdown: NOT super-user -dfhknprshutdown: incompatible switches -f and -n. shutdown: incompatible switches -h and -r. shutdown: switch -p must be used with -h. Shutdown at %.24s. Shutdown NOW! ???forkshutdown: [pid %d] shutdown㿘@@    w!@’c(@ķ .. 7/y+ # - ' % 5 ) !w"9 E* @€  %bX $bH %L  $\  $d &T %"P@@9#H?ې?c* & @ @bH  d wX@w@"P  L w@k@T  L 2 @w#@^@~@@%`@ "p$ "@. @@g`@ "  @$@`퀦 .. `"p# #N? * j @C 2N@"p @ ` "` @V]bDw@깐0x@교@e "bh  bh@ @ x$ ?@ @`x`@ A x@ꑐ @ސ @x8 @I @H44444444444444444444444444444444444444444444444444444444444444(㿘 b@!, @U  !(!(@ @А" 0 @ @& @@  @\ @@p@@@l!,@& @ `2 @ PATH=/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin%s -n/usr/bin/wallwshutdown: can't find %s: %m*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %d minute%s sSystem going down in 30 seconds System going down IMMEDIATELY 㻈 a8  "a8 !@@@g!y"pyh$@ ""y@b 'yb@HƐ 0Wy "y"y" "h @̘!@"X !y "@U "D @" ;y#@ < <y#0y"@ y@c8 y@c` "` "p@  @͐"p zat@¸ @  @@  @¯ 㿘 "p@͒ %s by %s: %shaltreboot System shutdown time has arrived but you'll have to do it yourself /sbin/reboot-l-d-nshutdown: can't exec %s: %m./sbin/halt-p/etc/rc/dev/consolerevokesetsidopen/bin/shsh` "Pza "L`z! #zx 8!z#zz!' !z "h  "p@H @b z@軐! b\ " z@賐!@ "H`P@P / "dzz "a a "X`z" z"% zX  b#\@š !z b @G@ V<zL % z4z "Tz zb@" !d  "X  bz"Pd "X  bX b #\@#`b@z b @G@ z"X@V ?K @ܛ?E A z"`@?z@e"p@ܗ?2z@e"x@d ?2 z@e" @" @@  $@Ȓ@a ̔`'̒ @x zzx"b8@  @a @篔  @h @> nowTZshutdown: that time is already past. 㿐{bp@@g  ""@@jN +  c\ `@)@>0* "@*`   ""D"@"#L c\@ `2 : @͐   ,, , @ L 2L{@"x@Q@µ "9N "DN0s  o dNБ* N * ?` $` @`?@6 d`d$` d@`$@$`N?Г* N @*`@ ϰ `$`` $N@NБ*` N * ?А ?`$`  @N?Г* @N *`В@`$` @N?Г* @N *`В@ `;$`@@U$@! ?$"D@"D "  "@{!@lb@a @w/fastbootfastboot file for fsck 㿘|!&@D! |a@ @ؐ/etc/nologin NO LOGINS: System going down at 㿘#|bP@P!|#`@] @Z @W @T &@! |b`@֔ " @Re"D  @ϐ|b @ʐ! "p@@@㿘 "\` |@"P @ @ bad time format.㿘|c@b usage: shutdown [-dfhknpr] shutdowntime [ message ] 㿘|c@ڐ!@ϐ 㿘@EweofretensionstatusrewofflrewindofflinefsrfsferaseeomeofdensitybsrbsfblocksizeejectTAPE/dev/rst0f:t:%s: unknown command%s%s: illegal count%s: %sioctl MTIOCGETP@~@@ / `""`@"}@q]`Ȁ } "c4   @j Т ;} % !}+'95  t@@ 耢? fcc4*@`&  @ `  `@ `? `@`@@eN : $0@eH :,@0@` c4@ c4 "@0 '@`%}`@ @sm 2    "0 @p@ߔ  6  "` }#0a@g@ڐ  40 @`7 @B" ' J` 0}@a@=  '0  W@w  0'  a@Ô 0}a(@  @B@I0a@ }a0@ @;0 @@ 76543210WriteProtectMountedSCSI%d: unknown tape drive type %s tape drive, residual=%d ds erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) 㿘R#8#8T`"~V@2 V ~ @!V ~ @1! ~V @,!``? "`` * "`V@ܐ!p0@4  ~ !  @ $~ 4!  ( ,@ 0%s=%o%s=%x㿘  N  ~~#@䵔~#@䯔u`sN o a``?"``!` <* H$!`@49 <EN * @:`!`` ,?"``!`* $!`@4 ,* : % !` :?`&  @  !`* $!` @4* : 4 NN 4N`!``?"``!` >* $!`@3ߐ >usage: %s [-f] device usage: %s [-f device] command [ count ] 㿘#4`  "!@qaH0"!@ja`@_ 㿘@6@א ! $"@RВ$"bh@ @/ "86 Lost connection to remote host.㿘@"H@V 㿘bH@ shelltcpshell/tcp: unknown servicewho are you?/etc/rmt㿐#\`'"@=Yb %#\b@ @@ $`b@}  b @c" @  ,@J 2 @ $`#\` @"@|   ?"b@ې ,'<'$ b?c@^  b?c@^  $'b  @^ invalid user name: %s㿘N *`:  c\ @ `2  _ - @M   N  O%s %d 㾘!@@ "cX@HcloseC 㿘!#X !@8a$#XstatusS 㿘#X` a@'!   b@w`,`7 "I%d %d ioctl㾘`@!@p"H@?㿘 "@@@@%s: %sProtocol to remote tape server botched (code "%s").xؠ@M O؀ E F Aؐ@C$"@O؀ F?"#X@ǐ@J@ "*@"@@8ٰ㿐 b @ OOProtocol to remote tape server botched.(rmtgets got "%s").㿘`* :`` ,, `  0@b,@^ Xl㿘@m:pinvalid file mode: %s%s㿘@z a@≐ @ 8 ! % '-) p @q 2a@ @!@ @@?• m* @@`2@@@,` -6 @@N @?` @`J /"*` 4`@@%4  4`@@2  !( @@밒?2@@!( @ @/%s: %s8#+-@@1L `?,@   b  `..`2 @   /@oa(?<    /@Vʐ @? /`, usage: %s [-p] [-m mode] dirname ... 㿘P <`0@!@ 㿘@X$OpenBSD: compile.c,v 1.11 2002/02/16 21:27:52 millert Exp $㿘! @!"!@: @#  !*` @ k*  $a`*`@ d! $!unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw command%s: %s read commandbranchlabelempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform command㿘 - @<(   aH@  0`` @ ~#\@ ` `` @ ~@ `2`` L@ #"Ր Ґ@  &*  *@$L@!h@_߰ b @   @$ `+ @ ~#\ @ ~8L@@ `2`L@ ,2B$` @ ~#\@ `  ` @ ~@ `2`@ R  @$   @ ~#\@ ` "L@` @ ~ @ `2`L@$$+L@ 2 @ax@ p  @,M```L@@" L L  2 L 2 L@a@ U   L@a @ L ` -"P*` €` @ ~#\@ ` 2` @ ~@ `2`2   * * @$` @ ~#\@ ` "$` @ ~@ `2`$L@   $a@ "`"L@ @ ~#\@ ` "L@` @ ~@ `2`L@ ;_ La@̐ ࢄ`"L@ @ ~#\@ ` "L@` @ ~@ `2`L@ \Lb @ `"L@ @ ~#\@ ` "L@` @ ~@ `2`L@ LbH@ @<f$ !`' @ ~#\ @ ~8L@@ `2`L@ "b@c "@ᄀ`$ ?=$& @&!?6$ b!@T"@H +ࢄ`"L@ @ ~#\@ ` "L@` @ ~@ `2`L@ 2b$b`"L@ @ ~#\@ ` "L@` @ ~@ `2`L@ $ b@N$ ` @ ~8#\ @ ~8Ȑ@ `2`@2$ @ b@ِ @`L@  \b@ʐ @~ @\$ 2c @ @@. "L@ @ ~#\@ ` "L@` @ ~@ `2`L@ ;~$`@ "L@ @ ~#\@ ` "L@` @ ~@ `2`L@ ; d`Vc@@m P0x |l\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])㿘'D @. `:  h'D \ b@/  DD] Db@$ DJ Q . : !J [ @JD @D @";D \2 JJ [2J.@# \2 JJ2J 'D \2 JJ n2 J .@D``'D \ J \2J.@'D`J".@D @`.@'D`DJ    *@J`^ *@`J] *@`J@ ]=*@ J[(\J . : = \ `*@J` ]*@ "J& `(8]*@ 2J 2Jn*@J` ]*@J]2 "` RE error: %s㷐&  @ &@@  &@@l  !@@*"@@H @ ` *"123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expression㿘   l ,@`$@ @Ӱ c&` !`&`&`@ N =/ : 75/*`:  \$ N@[ "N,@N``   @ݒ`&&` & \2 ,@ ` 2 @Ȓ( ,@N` $@%h - @m "@Ғ( 2NcX@ more than one number or 'g' in substitute flagsno wfile specifiedbad flag in substitute command: '%c'㷐'D ?&@&` &`&` !%#DD  ~#\@ ` D'D  ~@ `DJ@ g"  p 9 ; 1 j h jJ@dDe  w`^D @@!X [&@ X&` @6!XDD@8` &@M 'D ! ` ~ #\'D  ~8D@ `DJ*'DJ  2 *a@ @^O!`&`& @Ɣ!? &`  @Pb@  D J@@aD c'Dtransform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthN  \`@ ` 2?1`c? T 2%` ~?#\@ ` ?  ~?@ `2 ?#@$@@!a@g  @  +@  (+@?O#@`  +@J &@㷐 @ @  ~#\@ ` "J  ~@ `2J `\2 J " J "  +J   # +$(, @@!( @ ,@@unterminated regular expressionexpected context address㿐N 9 \ 06  $ /`8 l` 2&@`@̐ &@ &@ &@@9! &``8@  whitespace after %s㿘L@  #\  N  ` 2`.a@ & @G@undefined label '%s'㿘. ?* : `#"*` € a "a & @k &  a@` @  2 & &4&&&&&&&&&&&&&&&& &&4&&&&&&&duplicate label '%s'㿘    `,` ` *`"@ @' 2  @d 2  @ 2 @ $$ $ $ $㿘 ` ,`  `,` ` "*` "   2  @d 2 $ 2  unused label '%s'㿘 " *` `'   @ @7`2 `*`$OpenBSD: main.c,v 1.6 2002/02/16 21:27:52 millert Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %s㿘@ql +) # ! ' %/5 7;#9  /8* c@€ %! "@$a" @    $!@7a@, @|ݔx?ڐ?a* ` @ @`@ɐ `v@  @@`@ 0@Đ @l@E @v` "@Ma@ @ ***********************************H****T*l********r%s: %s"%s" ..."㿘'耢 V!  r 0#!% `2`  "!! @ `@3+`P "`  !b@M X@    "$ ` `@   h h ` ,  `* `* `* `**    ""`$ @10  a  "aN #2Q N  nM  "!I  a @u"a$a    J`# J  n  "a *a  J    @ !$`h@#!*a #a** a` # #a`*# Քstdin㿐 !`?) ' @u `$  ";  ! c` "!$ `P@2k$!  $! b!@L  X@ `? "`@y @  "@@Y !  & c %!`  \%!@1 `@ " a X @L @ @ `#`"# + 31' @ua ` $a `! $%a $!@2`P  $!@L[⨖ @ X`? "`@x @  "@@  㿘@( " " ""@"㿘@ " "@" "$OpenBSD: misc.c,v 1.4 2002/02/19 19:39:39 millert Exp $%s㿘@   b!@L "@> 㿘  @   b!@K"@' 㿘# a( @`@ږ ʠ @$a(a(sed: %lu: %s: 㿘'L!'P'T'XcдL@|ؐ 4 a    !!@|˒cؠa@{@|’c耦 @ $OpenBSD: process.c,v 1.7 2002/02/16 21:27:52 millert Exp $%s %s: %s %lu 㿀 "!'  $`/ + @ " ?Ƒ* : `C~#*` €x#  al  ! **@ !"W*`$!al*`! * $D " " `I !p`UE D S"`D` N `D@t D `?$ " @$`; !0!0D@Y 2! !0 !0` @L !0D`@G  D  D   D@:!0 @  @D a  D` `D`@x @kD  2$ @ @aD 2 !`   D` @w @ې D` 2`D`@w D` 2` D@ D`?$$`D``@wȒ  2$` !`  aD aD`@w @@ #  al  ! **@ !"}*`$!al *`! * $ $ @^ al$ `}$al@ t@v"t at "ro"atD `2j?D & @Z!? $ b! @JK { DD@   J b! @J8 h ?# a0 a0` @Y DD`'`'` '`''a0 $a0 $D "` "`"`$ "` $ $ $ D` 2`D  @, @Ե va  D` `D`@w @aD  2\$ ;L;L;L;<;L;L;L;L;L;L6;L;L66;L;L;L;L;L7;L8$;L;L;L;L;L;L;L;L;L;L;L;L;L;L;L;L5x5p56;L;L6l67 ;L;L7$;L74;L7889`9|;L;L9:\:;L5p;L;L\%d not defined in the RE㿀  `!D !x D   "`Д  D @   !X"   @  c- P? -   @x = @   !X @n  `@ޒ@`` `   @ !X@V !X @P  ` $@.!X@A )!X`  $ @  @& ?2!X D$@  @% `@  $ @@ !XD   ' " $  D'' !X%!X $  $ " $ " %D"  ''` `@u  `"4   20 ` ?2D & @! ?"`    !b@H Ր  D`  @hD      !b@H   rstdout: %s?c !l  6)+?1 /, !* @  #l@  @u!`l@`@- l @uu!` @a @plґ, !` `@ " a @H8i  "!t%lCOLUMNS\ \ \abfnrtv%03o㿐!@("h @)B$`h @0  < 2$ <$N g!")@ҵ"p N#\ J` \!``?"`` !`* $!`@"; 7!`?bx \"& !`* $!`@"% \N@Q !`"@?M@ " `  !`* $!` @"  @_" N !``?"``!` $* $!`@! $!``?"`!` * $!`@!ߐ !` `@ " a @Gl first RE may not be emptyRE error: %s㿘,  s@: & \ ?#\ ` *: ?? $' , :  \2  N \ &2    @   &  &  &,  4& ᤣ* ? "*?2 ?""  "  "?@* ᤔ  &  &  &ᤐ@ @ @& ,   @   &  &  &,㿘     & && "&  @P @& * %s: %s㿘?'% ?N  w"!  { s" /"* + ?" @5    @F ` " ?"& @" "&  @Fz `& 2N 㿘  `"!p  2 y  `"]  2  "( @  ` DD `@n  2 _    !` "  U !`"Q  * $  &!p@  ` DD `@H  2 9    !` "  / !`"+  @2   !` * &!p $    DD `@     !@ `?! 2  `?㿘   !x` a  "!x J?` "? !!x   ; ; !` @  !x!   !Ր 㿘@hz 㿘 "&@?  &㿘@  2@  "`" "@&@ 㿘 ? `@6?  "&&  2$ 㿘 ?`? "` &@ `"@@LPrestricted shell - can't cdPWDOLDPWDHOMEno home directory (HOME not set)-no OLDPWDdon't know current directorybad substitutiontoo many argumentsCDPATH%s: bad directory%s - %s%s 㿀 b J   ! #"   P ?! !@scb? L! J`* l"@"8@"@`@"H@ b @ 2[ S"P  2 bx@Z L @b @ C <" 8 aJ  0"@>I '" @"@@| ᰤ@@w@  `@ @@ᰐ@@@@ "@Lt  "$' '$' '@p"@/ ' `ᰒ@u @@u@S  "@L<  b!@D4#@Lv1 @> J@ @ J@ /  @u 쀤  @uÐ@Ӕ `@u" 쀦`  #@L can't get current directory - %s㿘 J" # %"   P ?a a@rT? La* `@L".  !J` @u @<Ԓ  &  @t3   b!@C#0@K #@L Rnprsu,ne-p: %s-u: %s: %s㿀 J`e3     L - L    L  n e  E`2L  k   f L -b L   \  6% `63"T*` €` ) '`%  @M䨒  @K   ` L`  @L䨒 6  @Kq @q?ƒ?  `*   @Ybx   ?$ *  '  |' '' {`h ?" @k`Z \2Y*L f0  r a"O  b 0".  \ A \B*A \>* c \8*"7  t n \/* v \)*( ( $ "     А  *`: ?Д  А  *`. : @Р? \*L    * 2` *` *#\ ` "`@I7  !ؤ 쀣 "@Ӣ`쀦  `' @" 6&`@ې⨀ 2 @` @ ` @Ő VV|V|V|V|V|V|V|V|V|V|V|V|V|V|V|V|V|V|UV|V|V|V|V|V|V|V|V|V|V|V|V|V|V|V|V|V|UV|V|V|V|V|V|V|V|UV|UV|UV V|V(pvpvV%s is a reserved word is an %salias for exported alias %s= is an exported traced undefined (autoload from %s) function is a%s shell builtin special is a tracked %salias for not found%s is *GOK*㿘 J@  w`?  #0#8! "  v ? V !    !@p?耢 p! *  `2 ?`2Ϯ ΀   ` ! #h@@/  ` ! !@@!  " @:   `#@@J- ?` *` €~@J#Hz `#`#x" @J  #@J@pp _\@I# @I# @I# 2 @I# `@I#@I#<9 c " @Iϐ + @IŐ   ` #x" @I  @I#@ @I 8  H@I@I"022`- _h^`<_^p^T_㿘L#R#UZ#fi#lprtuxponly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U %s exportreadonly%s[%d]=㿐J`ئ      r7  s e  ! t   !   $  !  `"  5`9' "(*` €! %! % %! %@ ! " %  $ % ! ` +,- -!@n`?Ȓ?`'@k " `'@k " ! ``!* `J`-`+ `J  ` $! ?#@@G s !* `, ,P @  - "*!* `C `"!* `64`"%@@@Ґ@8 ` ! "*" h"`!(!8  @@В  `@ "=`@ Ѐ` `8  @@ "`- +1)-- `(a(!8   @ @@H#@ `Lװ 0@GZ!H԰  ϰ @r@ Ģ`"  `` @ "`    "@0"+-5  " U`R`@G!`"@G!p @G!x$@G! @G!@ @G! @ @G!@@@G!@@G!@@G!@@G}!#@Gy ? 07 !!!@Gh   @G_ -@@GZ - "@@GM! "@GF@@m@G?"0 "@  2i@ BL5 dTc@c@c@c@c@c@c@c@c@c@c@c@bc@c@c@c@c@bc@c@bc@c@c@c@bc@c@c@c@c@c@c@c@c@c@c@bc@c@cc@c@cc@c@c@cc@c$c@c,c4c@c@c  "а  ' ? @@4'@@4 ?   "`  @iÚ >   6+'L % @H 2& %`@e쀢 @B:c ?  @   `@ 6 ` b@9ް @B 0`,` 2L㿘   J"!# `c$  @h"$c$$ missing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARG㿐!  @h! ?! * ` I  B @L  @wJ`  X@A "`L`2`x@A v  2``?@&  ' *`2$@  $  *`@@+ @$ @A 0N$ @g  `? `   +// /` ?///`?$$"  @& {b& " @ $ `@Ғ 0@Ɣ @@  Jb `?    @ ` lm㿘   ! #"  m ? ! + !@gFcx?쀢 l!* `2  @  @B = "*@`@ 2   2kO `TaoX|sw8s0xTpST`aPa@q8\T0t(t |bind+fg+bgwhence+unalias=typeset*=readonlypwdprintlet+kill+jobs+getopts+fc*=exportecho+command+cd+aliasHf`?%s: bad numbernothing to shift㿐 "# ` @fa ?") a*  @7   6 @@e"   +   "   @ " $ $ @@R" Sugorwx%s %#3.3o bad numberaugo=+-rwxugoXsbad mask㿀 ! # S" !@fYc? ?!*  2;@ * 2 @,#c8  =  , *.  .   < " . . .?#@@ # @@  #* А   * - ВБ:  @N "- #(@Μ * 2 @ΘN8`y + g  o a" I N u"@NN`@A#8 2N" Ic@*`@A<` P  ?* : `  #d*` €  < <I"N N`@A_#H 2 @<``- `=`+"  N,N-"-N`,  @A<c@ "NN 2+N 8#X@?= - @2  Tdddddddddddddd@dddddddLdd$dd4d,`%s: %snot found㿐!  @e9! ?G!* ` A ! @1z  !`#+ +#* @  " `#@   `@       @[ܖ   b!#@6~@> 㿐!  @d! ?!  * `  @D  @D `2  " prsu,-p: %s-u: %s: %sREPLY%s%s is read onlyp  'д    # 2+"0' s ?) p a) u" "a @@SԨ a" L   @?Ԩ 6 aԐ"@>G' a@dqa?ʀ ra* `"?&@>  0@i@@ ?  ,@ې " @> !  '"  F' ''ܶ  '"  8'' '  #9 쀤}? #c" ` ``$`  $`@k"` @(`$  @z @ $@ ؐ?$@^/ئ,?$@^$  M" 2 @d - @T8  c@T & # ,Ѐ \    * @` 쀤2 `   2  ,  2`   2,쀤 " , ?* @  2?,@-$ O" @i&"(@=X 08    @ @ʔ   @i&  K @i  ,#\ ` "`@<䀤 @> 8`?㿘!  @cH! ?  " @R`! * " J!`  "` "ct @Z trap -- %s bad signal %s㿘!  @c! ?!C *   "%1 " @=~P@c  @=y ` ) @y_    @< h `"L@ -2L` "    @yD  "?@z 2 㿐!  @b˒! ? = !*  @_    "#tb@!А@`!?倢 ?؀ "!@ % ,  @ 켒`؀, ؠ *@` $@*@ , `$@@   @ *@&@㿘 !Ơ?,? .`?,@  0?,@ `` `㿘 "` " "  b. ` R $L@jL 2    b R@" @$p  bb"   DXph`$X4PxHD@88D0(( d*=unset+umaskulimit+truetest+read+=wait*=trap=times*=shift*=set*=return+false*=exit*=exec*=eval*=continue=builtin*=break[*=:*=.-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$[]missing ]-tx "|c\'''' 'ؤ,`2@FԒc ,, @F˒c( @9#0h f ,  ''܀Zؤ V  " +€  ꀤ#  €   @ ؀`ʀ0ܐ?'܀  M `@F|c@ "'  @ `?`?€  "'ܤ'@3㿘`!"N  N@ *`: N`2`@FB 2 `@  `?怢 `N@ 2N` internal error: unknown opȀ  `# *` €-N%NN !`? 2@Y~ '4'4 " J '4`?@  @ @ @@q @ T <  D @w H < 8 @k < < , @_ 0 <   @S $ <  @p  < ( @;   < 0 @/   (@&   $@   "@ @  Ȁ 4߰ ̀ ذ  @[4 '4 $ 4@X'44@   " @ @  @@ `? @Z @E+: @Z 1@E3@E2 @E  $ 00@.  ,@-    r$`- ؓ*` €0, d`?0, ^@ 0,@Y W 0 ,̀@0,@M K 0,@F D @o > @o8 X@44 @oߒ8 , @oْ X@  @o˒  @oŒ8 8@<  `? H  0H|`H\p`0t 4x 4,``㿘@o8` "`@ov  <   I  ?  ` @'X0@'Tunexpected operator/operand㿘@   €  2  0   `?㿘@ 2   €     㿘@ "   €     @ 㿘   €  `?@%missing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operator㿘 2m  €   2_  €  2X P  €    2  </   2  0+ €    2  H  2     @`? xph`X)(!-a-o㿘   ``? `   "D*` @C`?   $ 1 ` "㿘%s: %s%s㿘 .`   ` &@5#0#@5 xthfPc@d0slmnpprocessesnofiles(descriptors)memory(kbytes)lockedmem(kbytes)stack(kbytes)data(kbytes)coredump(blocks)file(blocks)time(cpu-seconds)ulimit: %ctoo many argumentsunlimitedinvalid limit: %s%-20s unlimited %ld exceeds allowable limitbad limit: %s㿀 J!Ȫ!Ȁ`    /  H-aȖ S* a*`  * * f"  a ?' H" " @ZaȀ?퀢 S##` "L2  a@4o  *  @ 4  !@4! 0 @Aϒa 2!#?@*  䀢  #*` 2 @3! @ : 5c vc#-+' 2 @耍  2@42 2@4~a : @NŐ @4s 2G  *@j 2?耍 2? @vI  " !"@+\"@3"  2 #2 2@43!  : @Nz @4(! 㿘"P? !#! """ ""bܐ@q ! <c "c  @"a@0  *a   COLUMNSLINES㿐 ܀ 4 #` a耢."b@`h %   "bD"   @} "@|  "   @} @{㿘 !܀`@r  b J` J` @֒ J` @?@Y 㿐 !`  @N @p7 @J   @Z  "` ?㿘 @^"㿘 "`2@a 0"* "㿘N  "   ?*:  @` N$  *@`$  N P !؀~ v"! b`# '`(a`! '`'`'`'`'` '`$'' a' ' ' ' ''b` ۖ w$a !'ݚ & & & ܔ & & '///@wZ/L!a 2 ?$aL!  L!?& L! L!?& L!  L!?& L!  L!?& L!  ?& @h   @S0b  @w bJ   J 2JJ- + 8`(8  J            `?J `2"@ 㿘@œ / 2 "<` ,`,  @#"  @S 0``,`2JD #    " J# * `J `? 񀠠"'   J "  &J ?  #J 2 * *  #*  "㿈g @  a  @@A  @ ,`@  @8$`@M,`` % @  J?`/2 `m*`'' @' $< , k, @''',`@@"`@' $< , P, @'''" '4 2 @& "N`fileglob: substitute error( @?1  @   5 N@ \@ 2.@  .@   N@  \.@  #\@E`"" &#\@>ڐ !&#\`@0 U  ` ''' c@$ @  $< , ݔ, @'''"@`'"@ ͔    . `2  @>' @iG J`2@5 ⿒` "&&㿘 @@`@>  `"@FPATH㿈`ذ @# @J b┒`b f` ''' h@: @5 @0b    @& L   !@M@vΐ#@w" @?":   &bN` Ab. * `    $@@ $`2 @@ "$`$`` ?Ԑ@;   b,  &@  b `*t@UK?  @=N  .&@b` ,`@.. &@ @' b$< , , @'''"@`'b"@ ᰔ&;|&()`㿘 &' #@ \  *`*:  ' " ` = :24J #&" : \2   6 J ` "   *` *:  ' " ` = 5$ #\ @ `    `2  N @0" ` `N / N /2`?'&㿐\`i '    #  @  `$  $@$'@*+?@!㿘` A  "`@N.N '%L \2LL  "L `*`[`?`$"LL  (2L@0d  L /"  L  \L  N ~ *`.@*`㿘 $ @@ @*` @`@K@J    K@ K @" @*`㿘 # , @ " b` , b|`㿘`@" (NN / ?N /"?N /2?N /2& *&㿐@h @Qf @` b`$< , , @&`&`&@b@N`@"@`&@@hʐ # 㿀@[   b  ' '' '耦r@/ : @@A@ `-" @M @ 2 @,  @`,@   /,  " @M@_ $@ < ": 6%,",'@ @䀢 6@䀢 b@,  $@ @@ߠ`?`,&M@`ߓIFS\$(){}*&;#|<>"'\㿘 @t#x@u  ) ' ƀ㐐 ƀ &@? @`N@.# N@. ƀ 〦`?`ƀ4ְ֘$րpT`4H|0ܘ`lոtհ<ՠpՐՀp`<P@l8(`\Dޘ(԰ެԠpԘԈPphXH (pӸXӰӘӐӀp$`P@H8 0commentset-argupcase-worddowncase-wordcapitalize-wordexpand-filecomplete-listyankexchange-point-and-markversiontranspose-charsstuff-resetstuffset-mark-commandsearch-historysearch-character-backwardsearch-character-forwardprev-hist-wordup-historyno-opnewline-and-nextdown-historynewlineforward-wordforward-charend-of-linebackward-wordbeginning-of-linebackward-charyank-popprefix-2prefix-1quotelist-filelist-commandkill-regionkill-to-eolauto-insertmacro-stringgoto-historyerroreot-or-deletelisteotend-of-historyredrawkill-linedelete-word-forwarddelete-char-forwarddelete-word-backwarddelete-char-backwardcompletecomplete-filecomplete-commandbeginning-of-historyaborthb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /.&.&_606162636465666768695U5u4L4l3C3c[O%A"BCD㿐      ""a"#a#""!.1 #d"D%     !     "b, # (8#"(#b4 $b$#b "  "@    "##b#" @A ! "0` #\ #dcL#" :  *@s#?$"0 h)  ' @ j @  "<*`@  @  `* @*`@` b8 6 ""$%" * * `h* @$ "  0 0 `".b80"@gz  @I1 㿐 2/@ > 0/1 " ?? &" @C" &"  㿘   @ % 0b@>  *  *` "J "" 㿘# b !@ ! ! "@!@!b@$!$b@ ?㿘 !' @Ӑ֐  ?@ ""(1 a " `?" @  "@tLa8? %"  㿘  㿘 ! a! @   " 4$" "  @$"" @ 㿘  @ @ 0 4"  @  㿘 a 4 %  @ ""4"4 ` @{ b?" "b  ) L@-@ "@~@0%"  " `" `4@J   @@   "b(@ %"  ?@L?㿘@  㿘@ 㿘@T  a@㿘@K  㿘  !  @ 09  ??2# #\   a  ` *:  _ $2a#\    `2*:  _" $" ??# @G 㿘  !  @ 07  ??2# #\   b  ` *:  _ $2b#\    `2*:  _" $" ??# 㿘 "  b   @9"!0a  !$!@J! !0  !J@`@X$!!!㿘@??@T ??㿘N  * @ : N`  \    㿘 "@N` b   @: N  b* 㿘 @;"0c\  `  @ ^  ? @@@㿘 ! a @   b 4"b b  Z"㿘  a  @Ґ    4"   D@㿘 ! b @*# b ??$b %  @)   b @)ْ b @ 0??$b  㿘 @s! " ??#"    b2J@{ 0 "  ??#"  㿘@j @h ܰ  " *@`"" 㿘 cL@6 㿘 cd@/ 㿘 b  ,* @%"@ 㿘 b  ,* @@ 㿘 "$` @cL0  #\ b  #d*@ * @"@ 㿘 #L  #d ! @ 0  !"b,% !@# ! ""@! @$a$@"(@v 0@ 㿘   #\ cd",`" :"@ `z 0㿘 " a􀢀  "$`y01 I-search: 㾐?/B )3  J??..?# %*.@ #` `.! !@f  !&O`^ B?` @"@f ``@#@@\   "<  `@? 㿘 ",`? cL  % @# @T 1@6L@`^ ĐD?0 cL?:@@  #d?$,㿘J@ ^`@@6   ?@ΐ ?"㿘% # *a'  ɠ$ a@$a    "("$#"+@ ""4@ 㿘 bv 㿘 ao 㿘@? 㿘 ?"" @ 0@ U%  " a􀢀   #! # @=  # $   "@  "@"() a@2 b ""  b 8/  ""@  "& / @  b?@"@  a@  > *a@8 <@?" "@} ??"L8? &b 㿘1  !!  @c 03"  J"`" J!J!CJ!@J! ? ?*?!*J!4J@!1J! ?*?!*!J@!   ?          㿘  ! b ! $" #@   " @ @ "" " @ < ~ r  㿘 ! a@E1 " b* @ ""׎" * $@ @hɐ &" nothing to yank㿘 "   "b"" " ?b* @  #" ! "b4ΐ 0@#ϐ? yank something first㿘 "8 0  ' @ې H?& ' % *`@@  a"   ?$$* @`*`         ""("b""#"( 㿘@i  㿘Y !      "("#"#a *@j?  㿘 "@Dݒ`N *:  ^2*@ N>  ?`  +*@`?` N *@ \  `  ^*!耢@ ?*@*!(!%s%s = %s '%s' 㿘  b!Ԡ#@$ 2 !b!ɠ#@$ِ!#@$Ґ b<.  ` *`  h * @$#0  b@.  .` @$#cannot bind, not a tty%s: no such function㿘 "<` @# ð # h  *` *   `2 @$c :   ,  <@     2{<    <,  @     ` 2N@Xl . % l  : . *  "@18 2 ; . `h*   < (@#rB ې @Ca <, @ 1 ` ."@@  չa<@*"@@ "@@ "H :*"  * *+ @ "H :*"  * +  㿘# aO ?"b0Y#   "b< ! "<* "<    + b<@* b<   "  ` <*  ` @ G* `a+,$"@ +   b@*" +  *  H 8("8 <( 㿘`     ` ܔ  ` ֔  ` Д  ` ʔ $  4 㿘 "4`@V 0 !@"@"  Ɛ $b4 㿘 4 !  "40@6  㿘# % ' ) + b"@ab!"" %a$b$@$%"/@$$$b%"%a@?! @  㿘 @`  㿘 @Z  㿘 @T  㿘 @N  㿘 @H  㿘 @B  㿘 @<  㿀  "# !a#\#`" "  7 a@ 0  7@ )"?%.  뀦6 (   㿀  "' !#\#`" "   @ 0E` _ 08" c @ ݐ@ @# ` J /`d"( ` * \ Y㿘 " 2`@ ! :`""   #" "b"b  b>"( 㿘`?"  ` `J@"J``""a 4 㿘  !  "" "" m "" "   " ? $" " ` "`b?@㿘N `"*` : N b*`㿘    % # #\ `   , * ?  \ @ `,     $b$$ h$ $b$ 㿐1 !5% ! "  '"@  !   $* !#a~#"    _  㿘 #d@` S 0"$`:@~4?@(L@(N "? "? ""? '"? , :    " '2?, :    " ' &0K  N )   " ' !N    " '2  N  "  "  ""  '"  ?`" NN     " '2 , < .. 㿘@ U㿘@  L㿘@ C㿘 ! b  0s" ??m!"  "c\ "  `*:  _ $2" L c\ ` `Hc\ `b+  * 4 c\ ` U#+  U c\  ` *  `H*@ `*c\  ` *:  _ހ U $ۀ U" ??!"   㿘 "(`'  b "   "  N  b$ %"(substitute㿘' #  c\@4F`$ $$c\@-n !"b@ `џ$c\ c@@L㿈 C! " f``'''@ b j '''" '`"  @|  b$< , K, @'''"@`'b"@ ; 㿈! " !` '''@L":  " "5`㿈! " ` '''@." :   0" @ƒ"`expand(NULL)%S%s: bad substitution%s: %sparameter null or not set(  '’a@ʐ   @j   " J`2J 2J 2@! "  ''У  '' (@  ' ''Ԧ?$@@>ÐƐ H. €N  Ɛ -  €ب Nհ N Ѱ   ڸ ظ   $,@` (,@N ``?$@@> ,@N `4 )@’2@  ' #  $,@` (,@`,@N``?$@@>[ ,@N ` ),@`,@`" ?/  @@  @eŐL n?$@@>.  ,@L `\  @ ؒ@  @aK ’ @,@_Ӑ ,@a!2D  2   " Ͻ`" " $ 4$@ 444 $` ` %"  = #    ?  ,@` ,@a `b"( @` ,@T T    %"  = #  E ?/?,@` ),@,` T@e T@2' T@@z  H`@ @e@e'؀`2T!@ @ @ݒ”!@ N '   '~ | 'z ) 쀤@~ J  l'd   J  b'؀ W䀢 2  '܀`N'"@  W䀢 X FW䀢 D  A ` % '`  ?"` `  "`@Ji  뀥   ? @J '? @G'W䀢` @") "b` 2耥  2,  #*`   #*` n 2,@i ,@`·$@`@$@ @ @ @ ?(`@7(@``  `b$< , _, @&`&`&@@" &@`  `b$< , I, @&`&`&@@ݒ@"@`&@(@  '   ''  ''쀥 w #*` x v  R,?߀`]OŐ"*` €G [`@ ,@?`< `,@ 6`@3 {`@0 ,@`*`( % '  " ('@  @ 2  #? ,@` ' 2,@,@``,@`  $DDDDDDDDPDt$DDDDDDDDDDDDDDDPDDDDDDDDDDDDDDDDDDDDDDDDDDD$D$DDDDDDDDDDDDDDDDDDDDDDDDDDDDDtDt 0 8 D l ( T d `x %s: parameter not set㿈N@ $`N@ #cNN` _ } `@˒ [ % *O  * @ *O  ] *@iY@a  @2 ' $+  2 2b  @  "`+ @aq@b' b  @xB@ + b J `   2&Ɛ `@[ &@:Đ @:Ւ`$$@    N :   N   N  * c@  @2?N  J  2&?&'N@ * @'  %%=# "`` 2 `" $@ @ +   @`$`` ``?$@$`4`  @ [ t O  * @n O  ]j  %%=#! " >` '''@h@`ɦ  +   $< , 6, @'''@aߐ"@`'2" :  " $@O `@   -`6# ,   ,   '''" '$`@ `$`$@O  @`?4` = @#* @ B? ?@`g@a$`$@ + #. @2 "@@J`" @ += -?b J b  b J `@" @#. @2ƀ +Ɛ `@/funny $() command: %s%R%s: cannot open $() input㿐 "! `@.? #\"`@R"@ $#\O V@ .``)``$`    " !Ǡ" @[Z @-   @CC 0 2!6 ǐ"@ܒ@F @C|  @  @ @l[ 2@ @@ 6 &  㿘@ܒ %2#0Q@0L@8J.@t㿀@`$< ! "' 'ʇ!' ''쀠`  @ ʡ`@&> &.@UG@2|  2   2Z @P  "  @  L / '< %@(@ @P8  ? @   2. @ (*L /%< @ (@2   @P’8  ? @ @<  2 /,@`,@ % $< , , @&&& $@@8"@`&@ /,@`N /?$@@8,@N /`@ /  ,@u7 @;E 2,@$ @" @7@b@u@&@=P @Ȑ#P@ v D  9@ ` . L 1 .2LL +L .N .#@:˔  @t @"@@7@t'@&@ @" 2J`@!2,*+?@! 㿘@   -$@@tL@`" @%ɲ (2 @`L@  @ `@ 2 @ @ ,  ",, , `L@  @,@,㿈  "' ' ' 'L@?"@$ `@79 ``*@L@` 2 *@L` /"耢 :*@ @   @.  N "&@?$@7  2,  ,N  &HOMEPWDOLDPWD㿘N  +@]E"@^r2 NN  2 N@]8"@^e - N  @]+" @^X@ " " 㿘! #P@Pa@P 2 @ 2    @6bH$ `$ 㿘  @  +N {2( N   `N { }   ,?2 "N  逢` # k$0e    b$< , 3, @& & &ǒ"@`L& 0B> "& 4 N { },  ,? ,% 2# `& "`@r@r@@r,g  2㿘 @Ls %sPS4%s%scoprocess already exists%s: %sX'D'H'D   H H DR` H?D@ {@4D  !`@R DR`YD D"b`D  `  *`#c  :`'H$ Dڨ J"-`4`/ "!ˠ"@["@]͒ @D?@  ˦" %#  ` (b0@D( @  @@ʐ"` @LH ;'HD` 2 ! DR`"! DR` ! " @`" @"` @r7 D `%D `#  %'@ 6 '`R$ct` N@J@  D@?* : `<ΐ"*` €HD@'0.DH`H  'HH 'H@! "  2"  @sR @ "` 2DR`!! @ @a DH@` @W @H 'HD`'DDR@ ! " ` @rR" ` 2 HD@`@H`ܠH "'0DR`DHŒ aD`'DDR@ HD a c@pf  b 2 @?    @pX @3@2! `   @ڐ"(@  @ ! "  # 2@ " a2`@2 @ @gP$  쀢`$   @֔ @ $a@̔  $ `$ $  @p  H b ?2'HD H@b0VDH %`D!E'D `D R@  `? DH H!'H03D!(`?D '`֐"ג`'''''0 'D` " D G"`  "' 2@"`?  @2f@2  b @?&   'DR` * `D@Z` '@[DHʒ a'`0'D@Z`@[ DH a'@/ '0 " 2"`?  @2@1 b @>Ԑ   '0DH a'D!DR@@  `? 0D `~D!r DE D Hf a0=D D`'DD`aDR`\D '`  @6;  '@ D 'DD 8DR`01DH a$D`D@HD׈ 0D @^@'@Pi@2DD`@ b !D@@ 1"H@?' @1l"ctH @1  H!  J"`@0 @OB 11135454556688l778l:p959993t_builtin: %s: not a builtin:pcommand -p: restricted%s: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s%s: not found㿈 'H" J` 'P 'J`    2 Β( #@"@\9 ?@ZM HL  ^""`@ 'HH Aΐ#H@H c   JP 'P*H ` < !@7  #Π a@7˔ch p?+   J"#`Ȧ = !*`   @ג 'HH H `H `X  `'H ! H Ha @WH H ` Hh   J 2  @ "B 7  +)  CM!`(`2  @W"@YΒ @@@b ː  `"("0  @@/  ` @<ѐ␒  @[j   @ Ȣ`` "`'0fH  J"#` @ے / ΐ c@͔S @3'HH    0D 0?H@0:H`N H `H `H!`@p# @  ~ c@ H  @- H  !b@S# @| @J@f @  H `  @f 'H 'Hh"&" " `" `` ! "H`"`( `` $ "` $ `"( ", "0 "4 "8 "< ,"@ " K ! 'H H2 + ! "'H""2@;   H P  a "ct  H*-H" }H@ #@ &$H` HH@H ?"@ @TH"`ѐ"(*` € #t'0a@.@.@.ϒ`@@  0UH` H `H!`@ P @? ~ `h@9 ΐ @cp3 " L ` Δ (#@"@Z H @X2 P @lP "!L  !#@N?  @N< H  c2c"  P""@є?'P  "#t@.- DhDxDhDxDxDDDxEXECSHELL/bin/sh%s: %s: %s㿘@V8"H@We L  ! @ L 2 Ѥ"X  "?& " @[@  !b@"`@shcomexec: %s㿘# a@IJ@I c0@g @㿘 "`    @I  L @I& && 㿘 @Iה  2 " ?$$, ` $ @S `2 @Iߐ`?@Q`$ $V``$ 㿘 !  N = *a +@2!@@H͐@Ig` " "" FPATH㿘@H J"& /@   q`  !@I ` @2 /`]   @UA!x@Vnb  & &  @ &   ` @2  ` 2 % `0 !  #@H˔ #`   @      &bH ?&  `  T P`N `     #@Hƒ &  #0 &  &   !"  @  #0  @.DbH& &  &`@T!x@Ub   @_  c0 & "c0& 㿐 c@H̐   J`/  bH $ ?$@H 28@F  '?@u ` " <   I  ?    "&㿈2&@j / Ő 2X 0V"@Q@k    "' ' ' '耦`:@D : @j@$" @-@j. /, "@@-@jy N@ ɲ`Dz  {㿘' @% ! "`$$ @7  #  !@3$a @@8ɐ$a$$%s%s %Rcannot %s %s: %sopencreatedupcould not finish (dup) redirection %s: %s ?      /  J "`     ' ' ' '''' J`!!'!ˠ P@Sx"@TT ԔX  @Nݖ@ /?`PՐ!`*` €I G"  J `B&  @?@E_ <  30.."   @ߒ `'L -  L 2 #     @ ̔| !Ԗ"HX @N |@ 9 ? J ` bΒc@ * ?@D! ! 2~?Ԁ   `   x Ԡ  @b@  c?" *`R   ?@  "` *2 "@_\@ =@    !Ԗ X @N&  @b@ ͐  +?@_;'?`@_5` ` #@   @ @    @6  QQRHRPQRlhere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %s㿈?''D 'HՒax@ v ?! "  @@  ' '쀢`  `@D: '  Հ`! Ԣ x  @ b @ I쀢 T?@6<#\ '@*>" @7   H @*G"#\@6?@^䀢` "! `@ 0 D" "$#\@X !Ւa@ j  c@$#\: @9Þ @9D@*@6}?0@^r?  !b@ɠ!@  X8X0X(REPLY-rreadPS3㿘 +ˀ )'%֠ , `2 #ր` @Q`(@RJ`@;@Q @@R@ hb *8  @Q`(@RJ@ ۲ @㮐 4* ?" %*d) %s㿘.`@ ``@9ې㿈   @h?@&     @ZI   '"h ''@1 㿘.`˰@9㿘   @h @&    ֐"H`@1 㿐   `A`?K  K " K`? ) K  : +@  +@K `@* +@x`    *`  @`?   $ 㿘`   "`1 " 耢   㿘qdbteste_error: %s (offset %d)㿘א &`@  ++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():x"'ؒ'@&@x'ܐ 'D'L'''@(,' b @5  􀢠 *@"@(0  L 1 @" @'ː@l` (2ܐ '@N"`"@ @Vܒ ("D  @C "@Ra 0@P L@Q{D@' end of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variable%s: %s㿐`Cؐ"H.` €  ''&"  *( )"  * @P   X @//@ ד*`!@`p ` ```@m 0a@g @'" a@aabbb,missing )zero divisormissing :㿘 `Y ߀ ```#@ @`! 86& `"` `?.& 2- (& `@ ϐ`$ؐ`i  @t@  @g S `:@ @X02  )״,`@!*`  @A`@5  @  ` ` ` s@耢 ``    $ ؐp `ڐ ̓*` € @g  @Wl  @KM   @  "@  *@  :@  @    @    @    @     ~`?   x@   t @  p@  l@ 2  $ @ `  @ `U   "  $ ْ@ `  "   8  ?3$  @   $   ?$  %ؐM @Z   $   ?$ "  `$ @"@PP@O˒2&   ,`* `@f@fXhDeTehe|eeeefpffeeef$effgeTehe|eefpffghDmissing ]㿘`#\L  `2 &` (  c* @ 4  [ L * `2 [2 ` @U 2ڐH `  ! @&`@@ "`"$@&Ԕ@M="&`ϒ`[ & 6 _'   _  * #@2L #"L $@&@&` }"`" `"` `@O x `' '&` ג! @* :  ` 2  @V  M ` 2&` )&`&`㿘@@K` ` & "@OW @Nѐ"& 㿘N 2@@2 .`ב*   $ .`ב*    㿘! " `"""" " " * 㿘N`  @@" @b @O   @ "$ `ݒ @@ @M&@O @ *@&@$ e:glnrs0,1,2,3,4,5,6,7,8,9,- $_-%c%stoo many argumentscan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e-16 %d %.*s %s cannot create temp file %s - %serror writing temporary file - %s_${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %s(        % ?3ۀ`C<ݐ"*` € ےb@ѐ ,`@b b @%o@b`  @4M"   @"( @+a`* Q   `2 ۀ2ۀ"@Ґ"@ `J@ `@ =   "@%`$ @ ,@    2   @"(V  @< @  G@–B `ۀ@"h6  2  2 2  @s"(  `ې" @ @W  @Q    @ @  @ `@5  `?`="ۮ" ,) )7 5 3+d"`d":@37# $"`@30b@ 2 "`@3%b" ? d@/Đ"`  b @ @# `  `!b@"@  !@2"" ? (@/)?   b!@|"В@l J"$` # ے @KA"`@L1 # c\ې#@!J $c\T`  @-̖ 2 `@#F @aG    #d'`$ ' '' "  $" @#"@@0 & `@.Ő,@+-$@U # $@c8@V@. p,p,p,p,p,p,p,p,p,p,p|p|p|p|p|vp|p|p|p|p|p|p|p|p|p|p|p|p|p|p|p|p|p|p|p|p|p|p|p|p|p|p|p|p|p|p|p|p|p|p|p|p|op|p p|p|p|p|pp|pp|p|p|p$o̝㿘@" )+ ) 'ۤ @  @, L " @#d@    @"@v⨀ ,? ߐc\@ }%c\substitution failed㿈` "@#`0V@`m@`j   "' '  ''$@"  @#@_@_@  〦$ @  @`. "@$@"@_l$j%s: not in history%s: invalid range㿐@% /  #d ` "d* @ d*@  #L `+@P/#d `!@.%"  "L ?    1 cd#L " : ?@u 'ސ"p@ #L* @no history (yet)㿘 #L cd  2 d  @# d?㿘  cL#d@# 㿘!  #dcL # cd%  " 6bHcd#d`?$#d$ T X  dL`"8@*`  T X  "#X T 㿘 cd  L " : `? @_C cLcL. @@ #d@!?- @@  cL cL@@ cL&@ > cL@@ d@怦?㿘 ) "L' % dL"@ : .  "@@V LH,  %"L$d$L㿘 #``! #\   @  #\  bH$#\ @ocd㿘! #L    "L bH^"? "cd$#L㿘%  # L cL* cd  ' qHLcL @V]*LcL*` H@!Q@^$@ (%#dJ "*%#d㿘 #d@^@@^ @J?` "d` $Hd`"@ , @],HISTFILEr㻐 J"`L   "` "d@G!@H  J   8"#\bH@   "\@a -   ,@   cd "k @$@``? $@uJ ݰ @ ݐw%s%c㿘 cP  5"cP   #L dbL" :  *`"  #\ !@ݯb` cd ) "h@) cd`@   2@ 㿘   "ct"N'H'L'P'T'X  3 @ bH@/@.p @+b@ 㿘'L'P'T'X@m! "L@/ @.\@+А%s: 㿘   "ct"N'H'L'P'T'X 3 @L  !쀢`(@/bb@/WH@.4 @+b b   J"!` "!@u internal error: 㿘'L'P'T'X@ ! "a@.ِL@/)@. @+z @R %s[%d]: 㿘 !  #\  "  "  @ K"  " J- b"@.`( ! #\     "a @.#\"`㿘 #l'H'L'P'T` 'X! "@.֔H@+*shl_stdout not valid㿘 !'H'L'P'T`'Xb  "`@.H8@\   <   ` `㿘! "` @)   0@)  ?@)   "cltoo many files open in shell㿘@'n   "` Ӑ#㿘  @5  ` "`  ?#@RHZ㿘 ` "0@* ``@R70Ô @R1can't create pipe - try again㿘@ݐ 6  &  & 㿘@R@R bad file descriptorfd not open for readingfd not open for writingillegal file descriptor name㿘#\ ` ",NN  2(N*: ?А @5h `+(!x(  %` `  2!! p N  @K!&?? !"!   㿘! !Ѐ`  @@Q!В?$!Ё㿘 a   aЀ` @Q?$ 㿘 ! `  @Qt?$ no coprocess   ؀ `"@?㿘  1 ! `!Ѐ 6!!Ѐ !@QI?&!  !@QA?$   @Q9?& /tmp%s/shXXXXXXXX㿘 # ` @[k @ ,$ $$@,@4  @(# $ #`$$&f argument must be %job or process idambiguousno such job㿘  P "c "@Y  "!Pa@;Δ ) '  J`  *`   @'  J  "cJ  "`! .  * $ @; ?.  J` "J`@ @B 㿘 #t ' ) <%  `24  2.  2 " J` "%J` 2!耢2   @   @ܒ  2  @  @͒  2 `@? @m`@2" !"b@V "@( " J` @.*` j_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job control㿘  b J` "J`@A " `'  ! @ $@~  "c b!@M x $㘀  !p@:ٔ ! @Xv @k" &0 #@2 !bР ,   *  @:?, 㘀 9   a 0 @( " b!@ :  $b!@ ؔ0 $@V9a耢   b!@!  $""a$㘀 "a8 " 5 @A%b01 `"#!bР ,   *  @:e?, " "`! , *`` 2` `@:O ?, " J `@Aexchild: XPIPEI and no last_job - pid %d%Tfork failedcannot fork - try again/dev/nullchildexchild: execute() returned[%d] %djw:last proc㿐` CaH  c@W @ <$@$`$``$` ! #x    #``xڐ  cp#x"#"cp@ ` `2$$ $ #` $ $ $$$ $"$$($0  "#x"cp@ Z ` 0@= ) `@=,@rG   "`# #x`  @ _@` @W  `?"$` @W1 "c`$` " J ``   `  $@&`  c  `b@U `@`hb@Nrcb  @WE @b`" J `` 2J !bР ,   *  @9I?, " J ``@" `" J `!#  @9/  @9+ b2  @3 ؠ  @N'@k`   "" "c* @@\* @8|a`@ `@X @GY`8@b  ! $0 " `" `#@x" J `! a@)"(` %` "@)@`2` " @(Ԓ@&H @Ӓ  @V 㿐 c@V  cx `@" @V waitlast: no last jobwaitlast: not startedjw:waitlast㿐 c @V~ cx``  `b bj  @Ve   }@  @VZ %s: %sjw:waitfor㿐  c@VL   &@ #t #`  #`@2 2'@{   #`   @V "? @V `!*` #Ԓ?@'  @V   &@㿐  c@U @@   @U !*`  #0) `2 @ 2  ``2  @Y  @V 6  b!@?#  @U job not job-controlled[%d] %s%s| 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resume㿐  c@U @ϒ   @Ux !*` ː#`  ` @Ug *"Pհ "`(`̐"h`(  +)'  2$ $  bp  "x   2 "0 @$ʐ"`2$` @ݒ `"` @ҐK` 2?` #` ` b @=`4# -`h"```@R !`  "b@=Ԕ  @U `"h"``` b@u 0a` |  ?@ $`"|` A``@n  ;` ")`  $``  b  @=b# !# "@R|c "c!"@7"`  @T !"@)j 0 #`` 7$`@  @T You have %s%s%s jobs stopped and running㿘 #t'  #` a  "  J` "J` 2  2  2 " 2 耋 "## ## # #   jobs㿐  c@T)     @o ` @T !*` Ր#B  #t``    ! %  !`  @ @6` ?   "$   2  #t 3 "@?`X 2  @SΔ  notify㿐 c @S  ct '  " L` "    @ @ ? 8 "$  2L` t  % "@`2 @# ␒ @S 㿐 c @S c|`"` "` @Sx  casyncj_async: job not startedj_async: bad nzombie (%d)zombie㿘 #|  !!2  @cP  2 ,cXJ 0B   c   "# 7$c|) +%#t | "! " @6   c| a# #cx  &#@v#@#t㿘   (& `  2㐀 & , c`"@R j_waitj: tcsetpgrp(%d, %d) failed: %s㿘``$`$ " J `"` @;o# a  " ? @3$$`" @3 2^ " `   `}$ $" J` 51 #`1" .  ! @e{" $`($! "@PG# 6 # b!"@!p*   "4" @;9$"&',   2 $  @;'b,  ?R$   ` "b@;  `2, ;$," J `  2$   "А * "$@2 $   `"D"c|" J `!  "" " @^@!  " J ``@sp  #tb   #`    2  2S"㐀 2 @*D@*#t  (`" `  @`2`  2 (  '''"' $" @# $ " @# '''' `$` `  $`@ ?@w  %bcheck_job: job started (flags 0x%x)checkjob㿘 2 (b 0`  `  4@`2` ,&  ``"  &  : &   &  ? # a 2 0 $  0`"  @2   ? $ a   @b & L : 8b  2L @ L  -b    ' "!   `"R``2 2 #@ #@] @ # ` b  a@tb J `   #|   ㄔ?& & `"ㄐ@Ub؁%d RunningDoneDone (%d)[%d] %c %s%5d %s%s (core dumped)%-20s %s%s%s|%s%5d %-20s %s%s %s%s@ `' 쀢! ,  @#0   ?` ' !!' #t2 +" - ( ֗*';     `0C( `0>:? :* @}1``"./ :  ! `!/!' @@#U!`  2 `2  `2     2  / * @M`` ( ! @#; `a@#`` a@# `2O %`! '!b @"  '!` "b `!b @"   ; 7  3 )'" /-+쀦`` ( #\#\@"2 b(  " @"     ڀ` 21  @"b0㿘  #* &*@V ct  , "  2 ,t |`   z 2 p`:  %`m k&@L`?F *` € #t #t V` R`0T@ ct I  J 2 @` #t 7  ( "  @p  `"`2.&@-    2 (`@P #t    (`@  2`` 2 (`` &@ XTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTXTTTTTXTdTTTTTTTН㿘 c "c bH d  t`" & ` 2@`"& 㿘 c "c bH @remove_job: job not found (%s)㿘 #t#t`@2 @b 0* " ( `   㤐 @"`" !  #` @ c c?"cc#x& #c##x|" | tt2`"`t0t""tt"" """㿘 (   "@M &? 2 no closing quote x'X7 / 3 - ?'xX'|'p't @'h 'l Hh '`'d%㨀&cH   , @% , 7  \J@  \㨀 `"@  \ " #c &cc\J@  \㨀 `"@  퀦 c?&c@ c\`  ?"`  Jb! "''`  `  #*` `?$@``  l-` € [> *`; *,d@=P  @ܐ\ # ,,\L  `?$@`, , L \x`\\ @$\\" 8" " "P%\ @ + ? ! '\J` `\㨀 " @  ( ,Q,@Ԑ '"  \ "+ \098 \\J@  \㨀 `"@ = ,,c`&c t@ p %*  , t@ p %  \ \ ` $9 ,/ ,J@  \㨀 `"@ $͐  \ "` ? `` ?$@`  , \,,J@  \㨀 `"@q (: {\J@  \㨀 `"@^ (t  @p %  % d $ % @ t2 @p %  % % | U  ,,@`\J@   \㨀 `"@ : # ,,\J@   \㨀 `"@ # %@Ґ t @9p %L @Ð t @*p %=  c* @ 0  , X,`?$@!`,\J@   \㨀 `"@ * `2`, ," X `?$@` , X,,, ,, , $,@]\t  @p %  ,%  J"!`Φp @ @ 2% @ \``~ ' p?2@p ,c&c " \p?2@p   ? X* € ("  ) " 'c.  \  (  $%  ? % %  %  % `&c%  " \% 2    %  '2 c% ?&c  2',$p ( )  % 2, ? % \J` `\㨀 " @ )p?2@p,"@d   $ @C , (,  % %%  } *p?2@pϐ  } |p?2@p Հ (0׀ ` \,2,\J@  \㨀 `"@x $", \ " 0  ` ,  2,  \, ) (  ?Z% \J` `\㨀 " @F )y @C 'A '  =%  \ '\J@  \㨀 `"@&  P, "t  @[p %  ,c`h&c8  % , _ " \ , %U % \J@  \㨀 `"@ $  \ " `  , \, ,,+ ) | ,?p@p ( , * , , t@p % \J@  \㨀 `"@ ``?$@ `` @= " d < >` L@ } ` c* @u ` L`?$ >`?$\J` `\㨀 " @G <- & >* &  >  $ 28$\J` `\㨀 " @" - $@$ > <  $$   > $ | @$@Ӑ$$ $d!>l "#@2h,`2e,l3 )"ذ ) ; &\ ( 206 0 |\J` `\㨀 " @ | ; | &!,!!!& &$!@? J"$`\J` `\㨀 " @ (~!@b0zdl$  o"c@@T b `@@@ J@  ` @,@`@ `J@ `E @I$ 2,?L? J? H!@&P #h@&   !  } @`- ) !@& #! \!8 " \ @$ \""" "8%\@]`)?!dpdȘ$tǰ`˸̐`㿘  !aȢ   @a  $ahere document `%s' unclosed 㿀 ג  '`  c "c "!' '! ''+ -   $ ` c\ L@!?$@ , c\J` `\ " @`ڀL  `` 6@`% '@<?$@ ѐ, c\J` `\ " @h` ߀`?$@ , , $ `&  c?"c㿘 #\'H'L'P'T'X`?  H `8`? (`8"\\!" "o  @"ِ㿘? <" ?$`$ $ $ $ $ $ $ 8 $ $!$ 0$ 4*! 0$ , $ ($ ($ ,$ 0$ 4㿘 c\ @J  $@``n$@"*` €m" @b@`   $`$` $`X$@` `"0$`$@M$`"( $`$`G$@`  `8 $\@ P" `  J`"`8@쑒 ?\@ `"`8`8` $\ :$` `  `$\ "  `` ,`,`\ $` $`$`8$@%$\\$@``@ "` Ғ``8$\@`2 ` " $`$`$@  ! "@@$@J  x$@||$hL㿘 " J  ` ,  `?   @  (<$@  (,&` &  # "b<@q ` J`  J` J`  $ & ,F+ "  c@ ? & ?#+ %  ( @"@  `$  ` `"@'3  ("  J "   ,$ (" $٠?@ 9 (Ҡ? `@ ` %c\ #`""<@   , && @}$ ,    21&@# -&+ !` J#` * J  *`  2J ! 2  ,葒    [&   @  PS1%dPS2㿐 "! V0Y@0,"h@1Y'@G*   B@ J`$1J`!  'J@ ! `J'@ "p`  @TJ`@! "'`'@ " @   !  "c’ @ e "c@@/ڐ"x@1! $#㿘! "@@͐missing ] 㿐 ' \J  \  #`" @`k".` €, :  # ^  c* @ V  S  P N  #*` G`, :  [A @[ 2. 0 L # ?&@   .L  b`\J  \  #`" @  #*` ` `2, .: @b 0 ?&@ڐ.p $DH㿈   "' ' ('  '') \J@  @ \# `" @U?$@,`: , [  ]":`  \, `$&`?㿘 c ?"c #\b `#\@` "@`$ * * #\ " " 8"$#\#\㿘 #`  #\@J  7"@ c   #\ $cJ  '"#$c! #\@J  "@ \#\J` "  #\ $c㿘 "`Ԑ!" !$ $ 㿘` ~&``& !tMAIL8@א  #Ā "### cȐ" 9 # ## @.8"    # %%<#   "$ @ 5 2$  2$ ̀@   @$  2   ȝ8 #` ! "H` "H"H"H@w$` $`@  <  $` " 㿘# @>c bH@V$c 4 " @ : , @ % N? \ @D ?@<=  L  @В ? . @ "$㿘 %  #  %H"bH 8 bH $ $$ @ 2 $ <  2$ $ _%s you have mail in $_㿘 @. ! @/  `!! / @2 `XPH@`8fp`0(`0x`H0 xph`XPH@80(whovishsedrmprmvmakemaillsgrepemacseddatecpchmodcccat-tUlogin=exec loginr=fc -e -local=typesetnohup=nohup integer=typeset -ihistory=fc -lfunctions=typeset -fautoload=typeset -fususpend=kill -STOP $$stop=kill -STOPtype=whence -vhash=alias -taliastypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"evalOPTIND=1PPID-i-rHOMEPATHSHELL-xtypesetpdksh/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin/sh-shPWD.RANDOM$ # PS1-c requires an argument%s: %sCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENV`8HP(@@@ 2@"| @!  "H""z  ????????'7k  @*"b' @+) @89 @!a5 ; #@\  !@W  #P@R @'1  !@K @' ``"  B  2 `   2  2!p$  @Ŕ   H% @$@+!H@-b b"  *@B*b?@@a b@c8 b@~a  "  *`  @  ""  *`   #`  @/   `@@ "c`'!    @/"H C"P@+`!@,L /@eP !@_  P@2 T@ @ J@ @ w J@ " @, @@@+'!(@-9@+"!Т@騐 @Dt!@Dr@-,@+"pb@,ǔ b@`b@`    @  &"!!"@@*!   "  @,@  #  ! @,@" "   @R @R   ," ,  @- 6L @?   `. @ $@$` 㲐!. @ R%bN '" L  # Ȓ`. @  $`  @  0  $`  `  !"t@w"ㅒ`&%b `, b$`j   @ $` @A^ @AY   ,,"` `  $` `"$`@AA <   " " J `"L @  " L  @ , L  . `?b@%""&@P L , L , J@ 2 " L  b? " L  "H @[ L `2 "  "X  @O " J ` "h @E 0@)"@+(ג J@    @4 @@ 2  @)!P@+@  Ԑ""  *`"  *`" J`  :@p*`@  include: %d㿈'D'H'L'P'  @  0 'y?L   "`''0''@  b @  4L @#` @   "" "?`"*` € A #wP` #t`7 @E``Ր L 3  ""`H" b `'Db" @ђ` "@6@ ` @u b" " 㿘 " Q`"`"@@ shell: %dUse `exit' to leave ksh 㿈'D'HD `  J ''` H@  #\' '@쀢   ""Pb @   :?`.*`" €쀢  2 ⢐"0 J"`D `  D "`DDb ""  @"#\@ @"c\b'  "  % !`@4 D 8`L  D`  D` ?"` 쀢  >BDX D@ BV .  L  ?'`9D"  3 bP  [  D&bP"`H '@6   L   D `   "ct V  쀢  bP 2"bP@ @i  "c\tLLLddȝ㿘  " J `    "܀` "А J `  ! "@ ! "R`#*` € b@   "` 2`@"㿘# b DH`44 3 b`$ $ $ $ @$b㿘 "` " `  `@"` @&`  ` , R@`"   $` ` R `  @  @c` 'T@ !  J"`Z`  #t  2  "Г, @ @  @<  @()*@#!$-? =-+?#% "#$&'()*;<>?[\`|㿘  – @  2@ ` #  @  2@ ``2# # # #     @ !0123456789ABCDEF㿘 #?!,@@( @?,@?, 㿘   @=Oߐ @㿘` Ԑ`@F* 㿘 @    $  &@ $$ acexhi`kXlHX@m0C(n fbuprshvp`Xxxtracevi-esccompletevi-tabcompletevi-show8virawviverbosetrackallstdinshrestrictedprivilegedposixphysicalnounsetnotifynolognohupnoglobnoexecnoclobbermonitormarkdirsloginkeywordinteractiveignoreeofgmacserrexitemacsbgnicebraceexpandallexport㿘"< . @ " @섒   ". ?%-*s %sonoff㿘 .`@ " J  ! `!(!0@ ܐCurrent option settings set -o %sx "+?!ب"<'ؤ  ,` "`@<*$?$ؠ @'آ``",` "`4 @ۚ 0! " b< !N " `,``"`!``"(N"0pb< "  ` J@  @K@ " *  "` "*`㿘 " J  *`6 5 q1     &b * * * !* ` @! @K$"@K"@L@L @L@L   b *       c`耢b * "o:A:o;s%s: bad optionparse_args: `%c'%s: is not an identifierx J##`   -  4@;`, `` "4 @;Ub< J`  ``  ,@`" *  "`,@*`  J" `-   @n\ / ",` J  -2,`  ,`  @  " b<S7`A2  `o`?`0* `0'? ? Đ8  O.  , R @#i`s"< "< `  " #J`@2`R`@ #P@T耊 !`ؑ*  `J`-`+`J  ``-  " J `2* * !ؐ '؀`   耊 2  ؑ* `"'@ '@ M  @(J` ؒ,?` &?ؑ, `2 *`t$ @j ؐ*@+Y ؑ*`" ؔ*`2'؁㿐 @ŒN J`2   <#$&@  %s: bad number㿘ސ !܃X `+ @:@:@@$ $ @ " `A@  `?@j*+?@! 㿘   U + M  * ? [D  ]`2@       !"   23   ]". -  `'20 #  c@  `  | )`02 `  2 *  ``?㿘 0   @퀦   ?" ` [ * kπ # 4 Ȑ_`"̰ @̐ €Ű ?    @ "   ? 2 @ "  2  } 2|  @֐@Д "m   ?a 2` @ N  F 2E  @N@ E?B  @# @ 2     ި   @* `?     !`?2        " (2 `[: 8  - 2  ]      2  " 4 @4    ]2   㿘% #   ) |?? |2  2 ` `@Wc 2  * 㿘.` @㿘&@2 :  :  [* @@ƀ ?@$@$`$@ƀ $$@2 @$ $$$@$̢`ݦ2$&@:`: @?@$$@$㿘@砒 "" * " " " %s%s-%c: unknown option: %s%s-`%c' requires argument㿘`" @@* ?J@ ; @ @+ ` @ &`-*J` - `J`  ``  &`&@`:-" J`` +2&`J`  `&`?@-`  &@&```&``,  :` `?&``: `; `, `#"N@h 2J N :2` `&`L.` `  Ȁ23`:`;;`,@+`?`J O  `&`4&@`;2N/&` :2` `&`.`M : ؀`  Ȁ  В  <`` #" 1 ? `#@* ?`@ &`%&`2$<`@+`?`K   #*`  &`   c* @`&`&@&`<`%s'\''㿘L   #*` !2 L L  *`a" L  xu0/L '  %1 `'`g$ "`a "` ?L@   " *@`" L  `F %-*s%*s㿘 " 'L`ŐbD @(D " @?@(=` ` @$@8D@()" $  @,   `/-+@8}@ L @nؔ@gb  @@&ڠ  "`㿘`' @6$  `@L@ "` @6& "$@-g@ $,㿘 @56@4.㿘 @+s   # b # @  $$b 㿘 @’   ?  @  ?  㿘   "$`$@`   @5W b "`㿘 @ ? ? ! "@*$"@v 㿘  ` " N@ / .'m 2N` .``*`:  / 2   LJ@  :2`J@"@  `&  L /"" "N "@4"@@4&@J / /,  $'" @4 J / /,  @4 "@t@3 "&Ja/`? 2   . /J@/"`J@ .2K((G(/J`"`/"`.%J`/  "((((`ЖΒ` (J@H/2J@"J@(J@ @/"J@(`J@ @/2(0㿘   Ȓ " @4-  cH # "cHa HŒ$aa@3i "  "Β`㿈@4  b ' ' @ ''@  @2*@ /*@`*@`"@㻘?&@b^N /"N Y@ / $@@3͐  N .F 2 N .2 N .  @ (:N@ /@ 3  /&@.@` @" n@2@.@ @3# 6 . "` O / @ " 2N㿘"! "0`"`0 "$`,$`$@$`(@   4`  @ @)   ,  0` 2@tshf_fdopen: missing read/write㿘`"`` @ i   "`  `0`0```  aե    ! "`&  d & ! "0` 0& b"`  & ,& & & & & & & & & (`&& $shf_reopen: missing read/writeshf_reopen: bad shf/buf/bsize㿘`"`` @    "`  `0`0```  cP?      cp (6  cp0  & & & & & `& & & ` &&& $Pshf_sopen: flags 0x%x㿘  ` 1 " 0`"   &,B B `$ @?& &&&&(&&& &&&$㿘   @e@' &?"$ ,0 , 㿘  @I@' &? ?& & & & 㿘   ` &  @ & * & " ,㿘  @"$ ,0 , shf_flush: no fd㿘! 2 0? 6 c@c h  $"" ?@  *@ &  ;    @'s  & & @ @  shf_emptybuf: no fd㿘!   6 `8) h  $""r?@ `j * &a ` d@$@2Z?  ,*`   &  " "@      @  + & & & & <& @5  "@ $%  @'/ 6$   (&& $@ &  @( @& @ 4 `  * && &     & &  &shf_fillbuf: no fd㿘!2I  6 bhӝ @h  $ ""@ Y ?2,?  && !   J   & " 2  "  4 6  "& $ h&& &  & 㿘    "bW?h  $""O?@  ?2D?@*2&  6   `" :  2  8   : 2  (   "@& &  & & * & @&1 6   b(&& $? shf_read: flags %xshf_read: bsize %d㿘a@ `aX ޔ` 4@/ @"&& &@`@ ?@ @$@( ?shf_getse: flags %x㿘b`Ң `4 `0 ?(  @!,@@0? " $  4@/,&@ @"&& Ң@,@shf_getchar: flags %x㿘2 cY   ? ?  $ @`$ shf_ungetc: flags %x㿘@2@`4 @('?"7?``@` 2.? ?"%?``@2@`@&`@` "` ?*  &` &@ &`*&@&`*`  &` shf_putchar: flags %xshf_putchar: no fd㿐@?aP ?">?@ "*`` /ahҐ @( `$""*?6`  "`@ "` (&`$&@` @%  퀢 0 2 `x ?" ?``?&`*@`&`㿘 " ?@/@shf_write: flags %xshf_write: nbytes %d㿘b~ `6b v `@@`4 @.$@@"&&`9" ?23?@ #`@&@ &@%  @$ 6$`  (&&$&? 4 ` @-ܔ@"&&㿘'L'P'T'X@MLshf_snprintf: buf %lx, bsize %dh'P'T 'X` `ؐ Ȓ P@*DhȖ'H'L'P'T'X  BА H@00123456789ABCDEF0123456789abcdef(null %s)P `  @, `:  %"N@ `2 ̒`& * & ``   U`* : `L#"*` €CA?"<@;N@7 261N@ -+ ) #*` &,@: , ?Ѐ`  ,@.,* :`@  ?Ѐ` "N@`  & , 8 ۦ ۑ* : `S!H*` € Ϧ * : ``\ *` €   ,` @0H 0,@@/L 2 =` u> -9 +42 /`   04  ,@# 0""!!خ`   4  ,@  x X,@ 0,@%$@`!@-' ` // `d`% @"@@ L@`+ @`-` `0  )?"*3 0  ? 0 ?&   @*@`& ?` ` @` x 0  ?*`:  `&   @*@`& `?`@  0 '@, `2 < o& * & ,    @?  ?L@T &   @*@`&  `?$@@, `2 < ;& * & 4 @, W(?DEEEEDEEEEEE(ElEEEEDEEElFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDFDF0DHFDFDFDFDDHFDFDFDFDFDDHDDFDFDFFDDHFDFDDHBC4C4BC4C4C4C4C4C4BBC4CBC4BC4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C4C,C4C4C4C$㿘 #\! ` `?@}$ D D   "`8 $ D)  "`H  H` ` `8 ` @ $`8`@3 㿘@" * # % @   @! 2   @g  @` $ `D H$`D | |$Hސ $`D㿘ϐ "# % Ȑ  !@   @9 `D H$`D $H!瀤! $`D㿘  ) +  D``H% Dۧ %`H  ` @c\ `瀦 0`* &! ; &   @ 2 2  @  @ޖ $ % Dtoo many <<'s 㿘  D`  $ DY ! "`H #   Ha# % c@$ D ! `` `?@, c@ & J`   &  !@ `ܐ#("@"& 㿘 D   H@ "D0  "`H@5 㿐@U  @ @n too many redirections %s: bad identifier forselectP! " ~` " @~` @'''" @~` @'''ز   D`  H%`Dǐ ,  "`Haaa tЀa!a `{ a`("  ," oa  00"  aaa" %`D̀a" %`D`~ɐ" ~Ē`"~`0 @ %`D c\ " $ T耠 ` " `@:  a`$`D H %`Dc%Ha"a`(c!0ja ,% צ%`Dؐ" :  " :  2  @" "4" :   N #  c@@"  "$< , ~?, @'''c@" ' "$< , ~(, @'''c@" '"~1`" : ؐ" :   ؐ" :  " )@  %`D %`D  ( )٤ { }Ԥ@Q  c\$%`D "$< , }ڔ, @'''"`@""@`'!  "$< , }, @''' #@"@`'@  0 `'%`D'''''ڐ!" @ @G! c@@V   "a  !!   `끐"$@Ȑ@I@$0$@a   @ @$ $@Ð !  #@$@! @$@@ m @$$! @,!   @3   @{    @q    ؐ! c@ @!$,ߠ % ,"} ` $ %",|$ T  ;" "$< , |, @'''"@`'""@ |ܔ$ "$< , |Д, @'''"@`'""@ | $|Ԓ`"|В`㿘 `D   H"`D؅  "`H! {! }@  N 㿘 H!@   & @ @& 㿘 `D    H& DR , "`H!!  & D  @c @ʐ  & &  㿘 `D    H$D)   "`H! {!  }@=     @`2$`& D H$D $Hڒ 㿈! " @| ` @'''@z   D`  H$`D   "`H( $`D% !  $< , {, @'''@" '`D` H$`D׸ % H|ݐ! $`D $< , {ʔ, @'''"@`'"@{ &  m )ڐ `D` & $`D׉ % H0 H!Y %s: invalid function name 㿘@ ;L #  # *ab؀=b J 2 @  #\`& 6 `&  {%   "`Db ` U2` /& @Ő b& `{I  b"`{C   ` :"  @* `* `* `"b{+`  "`  "@ "  b` ?2`㿈! " @{` @''' `D    H$`D   "`H;: 8$`D%  "$< , z, @'''@"@`'`D H$`DƐ $H߀ ;@ܐ " :  " z`  , "zː ,   '''"@`'""@ z㿘@" " " d0d(d ddd d Q Q c ccccccc{c}cccccccxcp newline|&((;;||&&[[!}{timefunctionindonedountilwhileesaccasefielifelsethenif㿘  bH#h@# "`" T` "`@@@h" `"T`" `@ 2T`unexpectedunmatchedsyntax error: unexpected EOF %S%R?%dsyntax error: `%s' %s 㿐      H"`D   "#@"`<`< \" g   #@ @  @ "@R` 2`@  //  !(: <<" " \"< " < < 㿘 " y`22 " " " " " " 㿘   a "#\<""<!#   8aliasexportreadonlytypeset㿘 J"!`* :   a)   ch@ʐ "  e rcp@  r tcx@Է  t2 @Ԯc   2 8   "  "  fffff㿘  D` $ D` @ A  "`H  H   J" @ ``H`D `A c@9`7(3) (` #@` ` "" " @ ` ے   #@  c@b@(`? .`,$ D2 ` ".` @ ``@`*`` b$< , x`, "``"`@"``@" "@㿘  D`  $ D[ @ "`H  H!"$ D$  @`* ` b$< , xg , "` " @"`  c@" "1"  㿘` &  ` @ " !"H ?#`D .`  "@4J@  @`*J@(8 @ ( * "* * 㿘"" 2 `2 @㿘.` wV  @*``@$.`6 @s 6 5&  @6/*``%`@ "`V  * ` 2V *  " ?6 w@ב*`w㿘T  ?%  * @ @N N@@2   @ 2   2T *  2N  㿘T ? T?* @`@L`N@@2 `@ /2T* `2L`T TX*`T@" wN $@$`$`$`$`@!`4$"R`"`"      㿘 @Җ`㿘 T`  `w * T``  "@ 2`T` &"@: _, &Error handlerERRUser defined signal 2USR2User defined signal 1USR1Information requestINFOWindow size changeWINCHProfiling timer expiredPROFVirtual timer expiredVTALRMFile size limit exceededXFSZCPU time limit exceededXCPUI/O possibleIOStopped (tty output)TTOUStopped (tty input)TTINChild exitedCHLDContinuedCONTStoppedTSTPStopped (signal)STOPUrgent I/O conditionURGTerminatedTERMAlarm clockALRMBroken pipePIPEBad system callSYSMemory faultSEGVBus errorBUSKilledKILLFloating point exceptionFPEEMT trapEMTAbortABRTTrace trapTRAPIllegal instructionILLQuitQUITInterruptINTHangupHUPSignal 0EXIT㿘!" `    2 *"J 2"@` `T#`T"Ф  T`\ t#!c 4"`#"`"` `\ @$ T$ t$!$ 4$" $@ @ @ ` @! @ 㿘"!"!Ԑ!b(@ٔ )㿘% < "@̐   $<"cx$@$⨁SIG㿐  c* @洒 D A 4@ 1* ";"Т %  /`@N ,@  # @^  2 @=  @ @ ϐ  @[  2  @Ӓ  ΰ  㿘"Г. @ "  b "!`@ "#xb"  2 "! "cx`"$b@$b㿘 #x`@<"@І  "  @   В  " " H2 @  timed out waiting for input㿘<   a`"<H "< "! @ "#x" "!"Т      "  2@ 㿘  & 2L " @ "#t ) "#t   " !  & ~&  a! #t$#t  ! tbH &  & 㿘 "! "cx "!bТ  $  "   J@ 㿘"Т  2 ` 0 @i< 㿘 ! tj"H"HU & a` & N@ #    "@& 2 #  J"` π&   &  &  @( 㿘 p `    @   `  @    @  㿘  p @ 㿈< ";      `P@ 耢 `` & &      J"` @! "&  & #  '& ''@  setexecsig: unset signal %d(%s)㿘  2  b   ` π` & ` `  0 `  &  & %S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T||&&! [[ %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %Twhileuntil%;do%;%T{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T%s㿘 ?* : `l!#*` €   #@c0  2 8@   K#@Ԕc0  2@ H  X@’`3  ` h@ *:` `#p#x# @ @ @  @ # , @c@  , `2 Ȕ @yV 2   @o ` %)@d   #@Zc0  2Ȑ@P @K# @C `'-`+ )@8` "`#  )  |@(  2 `@``` `  @`!  Ȓ@   0@`    Ȓ@   @` `R@ ߀` Ȓ@  8@`' H *: `P `  X  ` @ϐ h@ʐ  p`@Đ   x`@ @'     V        @   @  @ `6@   @@Y`@ 2@ @  ' @   `  풐  ْ J @b @ 2@}   h xx0@| < <<- << >> >| > <> <&>&%s 㿘 `       4`  @ @ `  @ `0/?`."!*` €!` ""!"`@"""  " `"(@ "0@ڒ 2  @ϔ00  !" 8#0@$DP㿘 `    ^ $Ӓ  @ϒ0 2   ^ $Œ ?0쿒㿘 %#N  , @€NҰ NN`   " ` $ \읒N앐 $쒐 (N`&* : N  )쀐 $} (z (N` * : N j ) )g  + " ( "\ $N`{  {UN  sN  NN }   }N>  ( | )7~N$xd|㿘'P'T'X@P h'P'T'X   B @PE`N% Nŀ`:~##ȓ*` €zL s *`:  L  iNbdd 2 `2 ݯ `? -,L K *`뺑:  L  AN9! ;  ;룒 렒+ 뛒`  딒?  $N 늒?  N/  zvNrt00㿘 i o 4 4V  @^$$ ` $  $ ? n$  " $@@@$@  `$@  $   $ ? nϒ$  " $@@$@  `$@ " @$ $  $ $ $㿘@ "n@Wwdscan: unknown char 0x%x (carrying on)㿘 #$N + * c@€N  N N  N`  ?N  N?@? ` 2Nՠ?$N?b` NXX4T``hȠ   8 B#%N  * a@€璐[NO NJ $ (*  : AN`? )8 $5 ( (*  : ,N`% )' )  $N`{  {N  N  NN }   }N  ( | )N(88PPh㿘  & ?mĐ  `- m $@$`$ `$ ` $ `$ ` "` $ ` "`$ ` "۲$  ب - &㿘 7  " m  " m   m  " m   m " @  ϒ ̒m㿘  " mv " mp  "mjmg  㿘@Ғ㿘@ /dev/ttyNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s㿘"  @?$% & p$ @u   b!& @g$ `@^    @W   &` 00 @w  $ b!&@C Ȕn     b!&@3 ^ @ ?$ mb @ 㿘!" @ ?$"f 㿘! " Pl`lt$` "` &"$`$` $```$`` $`Dc$`H`_ `$`L"`㿘 "```L"`T`?,` `@!"?@`@ @1 ?@ ?<`  `("#$`,#$" `0" `4" `8" `<" `@" llR` p ` X P H8( LINENOTMOUTSECONDSRANDOMMAILPATHMAILCHECKMAILVISUALEDITORHISTSIZEHISTFILETMPDIRPOSIXLY_CORRECTPATHOPTINDIFSCOLUMNS㿘  bH ” ' x`  @8`"`@`" %s: subscript out of range㿐&@@- @0L@ [,@ِ ' &@3 bټ` bk`b$@ٯ #(&'"@bk`bad substitution㿐! "`AL@ `#*` h" ""'#@  " $ $ ,  $ @ + `+ ` @+` + * :`  ?Ѐ@4 +`@t $[$"L``U߀` "(!*` € !E$  @$  #t:$ 7$  =x$1$ - =@* <  0L 2Z`@`@L$ !$㿐! " ~  #*`  " $" $ ;$ `#    L  ɔ " L" @ $""$ $  @``@$ !$0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyz㿘! @Ґ T"  M (#(# `  & `" ?.@B ?.@F `  #?. @i ?` . @{ ?.@ 0 0? -.0@@2%s: bad number㿐@?2 !)!`%s: is read onlysetstr: %s=%s: assigning to self㿘$`")a ^ M ;" "7 " @ @ @@ )b   i &  ?` &@@Ґ @u ׌ &   & 2   !&@G 㿘"2&  " """`"`   "`  !&@&㿘! @ΐ L `"P?" &@J @2L@" L@   :` #\c - #- & # $4+?   *@`    ? ??ɠ?  6? @Ғ ?L@ ΢`2 &@㿐2 b  & h  `& & "!&@%0*s%.*s%*s%.*s%-*.*s㿐@0@ "$ " `h0@V @0@#\( "  `2"@ #@ @ @@  @c* @*"0*"@#\" " b*#\ @ ` `@ `2`@ *N@N@ 0"`*H? `@@N . c\ `"*@ `*J 2 0@N  c\ ` H*@ `*J 2 㿘    @j@g &g@& @ =,  $& @  hENVSHELL%s: restricted㿘@P " L [ =@  @  6  # * @` &  L =  "$Ȑ@   J"#`'a@  +a@ +a@ h+!h6` `͐ .@ @$ )2!! "gz`@y  p   b@ b2   bb "       ?$"2` ?$$ `* $ p$ p@2$ " B  `"  ? " g $  ?$`"  g   2l" ""   4&    b    `  " 㿘 " f @` `"&  ` f f `& `! @ a&!@6㿘  c* `  N* `2 ` [@ 2J1 々(*  J ` (2 `J [ H(8[`]2H2H㿘ɒ J`?㿘 @  J@ J` =`?㿈! "!f`!'''" PT? H? ?  ; ŤL  . " L@ ?"@ L "   y& $< , eД, @''' " ' 6L2T $< , e, @'''"@`'"@ e㿘@ ;㿘! a ΐ  @ 2`㿘!  O 0㿘ݐ ?`9. p*` € ~`,&@q  `" $ >@ &?*  L >& >&(  c   >& !&hhhhhhhhhh08 ?`.#*` €# a ! e0"HƐ"H$a 0҉ L""@ ~&pe  Ԁ 0# c  e bH$c L /z@p  u@s p<  j ݒbHe$c  ~&3z4X'F!P`Qo,Ӑ! G$"D D$"Db.^U ~&   ~&@ ?!(& ~@&$ " " `&  "# ~& c  " ?"a&<(T8d`,tX 㿘 ?`// *` €! ! 1 db"H bL"H$!) 0.#Ѽ  "b@1 #  dKbH &# ʭ 0Ր 0 Pp㿘 @`$2$   &     @Lcܐ !@` ~$@$`$`$`$`$$`J@ `]"?["J  ][["  㿘 [@a  ""@ǔ㿘,$`)!&ޒ    ʔ   㿘d8$@@ ~j# a  ` $a `$a@~;5 !( ! @  @2 @Đ~D @   ~r Ϯ @   !$` a@ ?@) ~$a~& ~$ ~! ?!$ @!$ @0!$  .!$ "  /?㿘 !` Т2!Г*` €! !x+  $a ^@j "a ?a a @$a  !x !$ @ L"a@ G@ a    ?π # "?В "$a  *  # @ $a@  !$ /"` "`0 0  @ R а?@  a k @ ! !$""` "`@ @ < 0#   !$`@ h @ a$*@ "@  C$ac\  `  *` * ?3"   * `L" ?π "?В "$a   * JȒ` f# #  1 $ac\  `  *` * ?"!   !$ !@ $    * JȒ` 7# #   @k$a$a  $a  * ` "$a   @ !<   J!P`  @$a` *@ @!P $aaa 2 < ` @  @4"< a$ "@"" @ ? 0@$a@ 9 a2  !$ "a< "" ?  !< '   #\  ?  `2   Д?c\ ?  `" <?   @ @$? "@" $$<  @ " <' @  0 "<* '  J"*`$ M  - * $`"  *@ "  $$ ^  @* $`"  *@ "   * `" $  @ "c a     W 0X  0U`$a @Ȓ`Ȁ "   ?5 0G? ? 0B!x` "!8 @ @ 9   $a ! $!L# !L@aH " ߀   0%!x`LaH`s`c`C @   @@!L @|@ S   @ O  @r$a $@àDDD㿘 "!Đ?# a8         #!"a#a#|"4 x 0@T$a8@    .       㿘 ! ! 2< !x`   !$a(` @ 0!8 ?#!8"` &` ?"  * !$`` 8 ?"8` `?#   #`@c#` 2! !$  "a8" @R !$` `" "` "`$  !$`@  !$   "  @7!$  "@8" " "8# "8!$~" a0   "!4 C3".  €o 0`"# 8 "0 !4 "8  a  *H"L J!H s c C  aL?@uI@  E  a$@  ?  J"+`!  @ @ 5 ! !$  ?@ +?8 !0* # ax`"8  ` "  @!$`  "` !$*@ax  "!$` ` "` "# 8((0^y$%s %d%sfc -e ${VISUAL:-${EDITOR:-vi}} --㿘  %@  @@" @  @ @] o !$ 2$"  2@ !`2@! !$# a("@` @A!$   a(!H# # #aL@4 @?* : `y7#*` €@ e  `!#, # aܐIN` $?  ! JN`@ @ J @ H ᐒ᐀ ``""@  "H ^ʒ @ `,@᐀`  @@ v^,@ ,@ $" 9"   !$ a   "!|`"  #  ("!x !   "!|"a @y  !$ ` "`"x3c` @  a$ @g" 3#hN@N``c 3c` @  !$;`  ` `@x  &?N@ c' N` w W$ !$\ @  ` $ ?  `2? $    N` %  N@ c@@N@ y@ $" N@ c    a$ !  ""a|   % # a@@@ $? a@$` "? #` !   ""a| % # a@@@  ? 4   !$` ?"` a o?  !$ a    "|"! !$ @!$ @!$` D?B"`  !`   #\ `""! ?!@y  "!|'$! !    "!|"ax#! !   "!|"3c` @  a$ " "x! !|# a@Q@ !|$a$!|! !|# a@D"@ !|$a"$!| !$ ` !   ""a|N` `@    *  !     #!"|"x !$ `j   !  "!|@ "ሰ#@  @ "!x !$ R $ !` * c\  $ #  $c\  | " ?"$   3#p3#x3 $ @b $ ! !$    !  @"ሀ"a|  @!$`@’e ! !$   !   ""a|  @#!$`@"!$`"H"`  $!("!(A"$# a ! @! ! "!|3$a  !|@  ?"| "!N ᠐ @ oC!. %!!@㿘 ! + "@o* @  !.$aN@o`! @$!#$a$ao a?@&a$a !" @  $aN@n`! @$!$a㿀  ) !#  !!  a$  %!\$#! " %! !$    #\#`r $@d?0AѢ  %!"$"`5 / + -  3 @ "( Z 2?@,`@@:t? `?!  " `$`"`a %|%x&&aL 㿀 ) !#  !  @  $# !!#  !!  a$  %!$# `%!`   !$    #`#\r; `@ް?0G@@ְ?orː 0s ',`@ rג @+:9 7 / 5 -  . @r’ @   ,`@+:9 7 / 5 - @g @re+:  "`?9 7 / 5 - a$%!ca$"s| 2쀤`  "#J?`/ "(v r^ᄒ &|&x'!%L3 㿀   #\#` q  o  r? 0@>?    H*     ` M-㿘 J"*`  @m"   mw ^ @mt㿘 # !  !% 㿘@m_ mW㿘! !  ! `RzbH$!$`$`㿘@㿐@!A @"Ґ Abt@   %@@u ?* & @ @t@@ ` ! ." @%\@ `,`@c,`@* ?Р @ M`@ `  .\@ .3`.@`@}x!%\ `2@@;@@А?Ц@g `@\@``!#\@ ``@@`#\`''  @H~  "  usage: %s seconds 㿘P <Ab8@E!@: 㿘@V 㿘@if%s: destination pathname too long8@4# ! %A+- /A i  $"t$bp $bp$"t@@Ž? fc* & @ @@ . @%x?@  <   $`@`@@@@?#(?A@b@U @R@M / /-`?< @ /@/ʐ 2L ?`? ` L /"?* L /2? @~ #@@CW  @ @3 2  Ȳ@%soverwrite %s? override %s%s%s/%s for %s? rename %s to %scannot resolve %s: %scannot rename a mount pointcan't remove %s8 @] BА!0 "p`{@W u "t` @L   B!a8@E2` "x`+@:  &@= 2" @(@4i @4 O1aB) HB!hB!p @#\` `/ a`? "`@P   $ ` ! ? $ @<  $` 2 `y`Y2e @ɿ  ] "`B!x@BVS @<   @㮒  B!@Bq> @≒  @Ԁ B@Ba!. @֡ @<   @u  B @@ B!@B 0@<  @,@%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set times㿈 @E   B!0&@8! 6  B!0@AŒ@ː @ " " ?Ò* @g bh ) @ @$h  %"l@A  !0@A0+ @͔Bbl@h "lB!0@A@ C!@A@@Y @!  ,  $"C!@An 3 6 "p`2C!@Aa@ C!@AXD@Ƞ$"  " -CD C!@AG ''''@耢 C"@A8@> B!0 @Đ C !@A% /bin/cpmv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf㿐'D@'H 2!D!DDHDa @+B!0@@@} @˔ ? DD!@@ߒaH DD!(@@֒a? :DD!H5a@ 2!D!xDDDa @B!0@@@K @ ? DD!@@ax DD!(@@ax  :D D!Hax@@ usage: %s [-fi] source target %s [-fi] source ... directory 㿘#P!!`<Dc8@`<D@cX@ 㿘@֔㿘@Y  2"  @@3 "㿘@L   @B &  @@!  &㿘 @] @[2   '"@% J-`?` J \ +  (*J?Ї8 `2 "@ 㿐  ɒ 2  @ $$ %d㿘 @  E @?   @ԓ & &㿘 2  `?J@   Đ "   |&=<>+-*/%:()㿘 b    8"b ."bL`*L   =E"h@F " #""L  `<"  `>`!  0  0  "b  "b  "b,   "b"∁syntax error㿘Ec@i 㿘! "    " @"  0%sh b M+F)F JH`@ "  @ޓ!`(@"  @ Ȁ ؀  *@ "    0 @ non-numeric argumentdivision by zero㿘 "/' Ր FА  Fa@ʐ 2` @`& ` Fa@ @- & @ & v Ҁ Ѐ 㿘 "   F  Fa@  ` `" & G ဤ 㿐Ң  b s : -5 (?` XG!*` € -@@J H @D B  /@1 3 QO?` -G!*` €  @& $! 0 @%82  @%2   @% 4 0  @%`? @%@ ̐ʐ∰      ,,,,,,,,@,,,,,,,,P,㿘[ b  Q   ^ yb 㿘 b  ̐ ^Zb %d %s 㿘@`F`0@   ""̐  "`"@  GG`@#0`@# @㿘@"_msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUF%sh@Ԥ    `N""0"@G@d`M`?䀤=  & в?'Ȑ ̖ @핚 Gc@< ` @ '̠ H`@  @̐ 0''Ȑ  @u H`0@<͐ @  쀢@6'  C  @"N@`>5 2 `<`* `'` ؤ`? @ Oـ H!``Oؔ?"`` !`*  #!`@j  H@Ԓ`@ ```?"`` * "`@jd  usage: dmesg [-M core] [-N system] 㿘Hc0@!@ 㿘@ssethostnamegethostname%s 㾘@ #H')H @?@c? s㰓* & @ @0@`" @@Ð Hc@< @q3! Hc@<  #@Ӓ . 2*#@W@ usage: %s [-s] [name-of-host] 㿘P <I`@!@ $Id: logout.c,v 1.4 1998/07/13 02:11:13 millert Exp $/var/run/utmphI!P @o )  Ȁ @ؔ  2@p @p!@ >Ԓ?@@!, @ !,!,O@RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs%s%sr%s/dev/%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in label㹠@  `mI#x@;Z < @ @ `0#$@q֐/@ II ㈔$@@? @@@? a ,@`:I#@;WP @ώ   "``@g?,@ `I#x@; 3 I#x@;, e`e@  `I#@:@ @. :`@ z` `I#@;  #*` J@   $Id: login_tty.c,v 1.3 1996/06/17 07:46:02 downsj Exp $㿘@ Y`a@H ??@ @ @  $ @鴐 r%s%s%s%c/dev/%s%s%s㿐&   "b?J"J"@$ / @ `@<  ab#\JJ$@# @֒& ?$⨀`?⨀  "JJ@$# @θ& ?$⨁㿈   ?'  @ꨚ ?/etc/fbtabr /dev/%o%s: bad entry: %s(null):㻐K K`@s aW@ # 2,K @ IK`@ݔ  ! @ L 0KK`@ ` a  @r K!K! @w9@, K  a @+ a @P $@p @/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m...㻘@@K"@ .2`@!   "`Kbؐ @v@ : "`6Kb$@o, @  Kc@vŐ 0 -K+K#@ @c(  %@oא@ʐ 2 @S$Id: logwtmp.c,v 1.4 1999/08/17 09:13:13 millert Exp $/var/log/wtmpL ؒ @͎ "@{h Ȓ @o@o @o!@ @<!,!, @G @㿈   ?'  @b ?  㿐 V`@n?N `%#`8`  "DR`"#L "cL`8 "``8 "`,"a`8 "`(`8 "`L"a`8 "a`8 "0`8 R`    "?N@F`x? RcF%H S @E"? $ `8 R` `@<HV"V"@jV`8 `4 ##`, `?""d`b  b 2 aĀ  `8a `8`Ԁ `8 `2   2 X 2 @"`8& , `   ``" @ ".%D .%D`8  `  ``" @ 2 @d,%E@c@k>`8`d`X`X ?`\ ? "`d"`X@C/"`\@DI 㿘 8`"!?` 6?# + , `""@$`* @@Q 2``J  쀤 +?㿘 8 "(?  @ 6#?!̀`& ,` $"@ "$@  * @( 2   ,`R   ?`@ 値`&?㿘 8 "&?  @ 6!?#a ,` &" "$@ $@   * @ 2  ,`@`@ 瀤a?㿘 B b= @N ?V @    @N%  b b,  @ `@Nܒ ?@I F  1@I 1@I@I ' "R` ڀ 㿘 b  =  @Β  #"4?" "" 8@" "` +R "` `   `82 R b@`   4 "` R` "` `   "`2" @R"` "RR`@w* "` ` R` @*` ,`" ""R "" R @ä   bR  @ @ *` `"R`@  ` 0"R*  * @&@ 2`@:``$ R @ ",``` " "R``2"`R`@,`` ZV) "R@>R&@?`$  R`@B  ",``` " "R`"`R`@,`-4"R@R&@?2  : `$  R`@  ",``` " "R``2"`R`@,` " *@""`" "` "@+"` @#?@b""`"b%`㿘"  * b*bf@?㿘 V  bP)N,  J `AJ 9 8` R  4 6/ `L@v@ &    @`@M, ` "  " "   "      @L` "  * V &N. 8 R ` N  @ bt0@ bp㿘1 "?"`2J` ? 2    "@M`㿘1 "?"`2J` ? 2  o  "@L` 2* ?   J%  $ Jp?2 J <"  J쀠%%d%02d%03d㿈 $   @^ N''耢 '3 ! "  b @}$" &b$"N %} N`rd P#*` €\?PY!Pa@, dR$Pa@%#K$  $ 2  $  $  $ b*3b*@.'*' `N @$! N @$  ```'' @* @  $` `: * "@$ b@b@ѐ$:  $  'b* N m! b $@\@ $b*bACTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTBCTCTCTCTCTB0CTCTBDCTCTCTABCTCTCTCTCTCTCTCTCTCTBCTCTCTCCTC0CTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTACTCTCTCTBCTCTCTCTBCTCTCTB㿘 ̔0@tÔ 㿐 @i` `8` 8  8`Q@'b`? , % 8 8"4 8!` @* (L`" 4`" $@ X 8` ? " 8@< *  @h1  8 2`D 8 a? " 8@' *  @h  8 2`F 8 f(?   8`Ȁ? " 8"f( 8 "` 8 f,?  8a쀢" 8a耢? 2  8a? 2 8"f, 8 "a 8 R`B?2 8R`? ` ? 22`B 8``!  `Q@"`?, ) 8 `8? " 8@ *  @g  8 2`H 8 b? "@ *  @g  8 2`J㿘 8`"" ` 6 R#耤 + , `""@$`* @@Ȕ  2``J  뀤 + 㿘 8 ")?  @ 6$?S!`& ,` $"@ "$@  * @  2   ,`R   ?`@ 䀤`&?㿘 8 "=   @ 68 S#Ԥ a ,` &" "$@ $@   * @l  2 `" @,` @ `"  @i @@@ @&@ `@ Ф MMMMMMMMMMMMMMMMMxMpMhM`MXMPMHM@M8M0M(M MMMMLLLLLLLLLLLLxrptNLMTncnsbsYGYFYEYDYCYBYAhlutccNDNPNRHC5inxxoulhzxtesosmsmidbdainhskmhcgneoxnxsxbambwOOOOOOOOOOOOxOpOhO`OXOPOHO@O8O0O(O OOOONNNNNNNNNNNNkndTdBdNdCugYpYoBTYnYmYlYkYjYiYhYgYfYeYdYcYbYaNCpaCoMWmalwlhNlwsvtpbsglmliitcoc ccccbbbbbbbbbbbbbbbbbxbpbhb`bXbPbHb@b8b0b(b bbbbaaaaaaaaaaaaaaaaaxapaha`aXaPaHa@a8a0a(a aaaa`````````````````x`p`h```X`P`H`@`8`0`(` ````_________________x_p_h_`_X_P_H_@_8_0_(_ ____^^^^^^^^^^^^^^^^^x^p^h^`^X^P^H^@^8^0^(^ ^^^^]]]]]]]]]]]]]]]]]x]p]h]`]X]P]H]@]8]0](] ]]]]\\\\\\\\\\\\\\\\\x\p\h\`\X\P\H\@\8\0\(\ \\\\[[[[[[[[[[[[[[[[[x[p[h[`[X[P[H[@[8[0[([ [[[[ZZZZZZZZZZZZZZZZZxZpZhZ`ZXZPZHZ@Z8Z0Z(Z ZZZZYYYYYYYYYYYYYYYYYxYpYhY`YXYPYHY@Y8Y0Y(Y YYYYXXXXXXXXXXXXXXXXXxXpXhX`XXXPXHX@X8X0X(X XXXXWWWWWWWWWWWZLWWWWWWxWpWhW`WXWPWHW@W8W0W(W WWWWVVVVVVVVOxVVVVVVVVVxVpVhV`VXVPbxmumlGCGVGHGDGUGLGRG4G1G3G2kobcnlrsi2sLsAXvXtXrXoXlXhS8S7S6S5S4S3S2S1YZYzYyYxYwYvZzXys3s2s1s0cidvxlABAFGmRQMiKmZyZxZwZvZuZtZsZrZqZpZoZnZmZlZkZjZiZhZgZfZeZdZcZbZaZZZYZXZWZVZUZTZSZRZQZPZOZNZMZLZKZJZIZHZGZFZEZDZCZBZASbSfspIpIcocopu9u8u7u6u5u4u3u2u1u0WAPAfhPUTOQDDIHUWGCWRCDKSCLfMRMLMCcbFrFqFpFoFnFmFlFkFjFiFhFgFfFeFdFcFbFaFZFYFXFWFVFUFTFSFRFQFPFOFNFMFLFKFJFIFHFGFFFEFDFCFBFAF9F8F7F6F5F4F3F2F1RF!3!2!1%j%i%h%g%f%e%d%c%b%a#4#3#2#1*0*9*8*7*6*5*4*3*2*1&0&9&8&7&6&5&4&3&2&1%0%9%8%7%6%5%4%3%2%1@0@9@8@7@6@5@4@3@2@1LFLOeAXFXNRASARXSXkBpnacrPpOK5K4K2K3K1iPhuuctstawistsasrsfsccvrcrfr3r2r1rppopfpspxplpkUPSRRILEALSFICDODLDCpcnwmmmol9l8l7l6l5l4l3l2lal1l0kskekukTkRkFkrkPkNkHklkAkIkhk9k8k7k6k5k4k3k2k;k1k0kSkEkMkdkLkDktkCkakbipalicifi3isi1fsffvbueseeiedtemeaeecussomrmpmkimmhdmtimdmbashddsdldcvsupllndveCMlevihodocmCCchcdceclctcscrblbtJJ " J`?{%d}^%c\%03o㿐? X#P@ː   @Ő b  *  @( "@u% %b `   \' `%t` `~o)#\@J `ib* #b\ L 'R L\N  `~J#\@J `FbL 'BbX@yUcXb@vϠL {3 #\ ,'@fߔ  (bJ }2% ~4" \#\ @J`b ' *`' b* *☠ *@ b* b *@ ``c 0`\^ E` ` L ^*` `,` / B s`,`:`^2 `*☠ *@Z  ~#\ J` `,`: `!`^``^b*B ` `  @ߐ  ` L `  r2  ☔ n*☠ *@$  `~#\@ ` `\b  ` bXc`@x`@  bXch@x  ``%b*b㿘 8`` ?@V@0 ` @M@ `0 *?8?@@S`S`  ?"S@ ?S@*(`((@ "@ S`?"S@ ? ?㿘 5? @<VV  )+: *  (, *: V   *`S`(  $ 3` @ 3`"@`@ ("@*V :   ۞ @ 㿘 ??T* @(* *T:`@  T`+`< @$T`4`T`.> @`4``"<@<+<   .*@: :`"@  @B 㿘 ?` VV @< @^1@+ ncurses %s.%d5.2㿘1 "ZZLUc@w㿘 8J `@'@@0!R`*@#@ @թc,@  ",!`0?@L ( `0`0[!@@ 㿘 " !`@Z㿐 `  e  /`R@@ 0 " !``? "`` . :  @* "@@W 㿘[@ 㿘? ? 8 2 ' ` ` 8  8J `  R ` "  @*R`* 8` R  #\  -`0/[ +  ,` *  `?Е: ,` .*  \ `*Б: @  `2 N *2%0@F %0N '*`:  $  N <"  ƀ $N x`ƀkN\ `.@ > 2ƀ $ƀ <[N\ ` \+  +` *  `?Е: +`N `.*  \ `*Б: @  ` \  `2 N  *2  @ْ N *"N /"N` `  "N@_ N ` N }` ` "@J %0 㿘#`8 $`8 @h!`84 *`!  * (㿘 " ?@b@ؐ`8""`8 22KKnn,,XX ` `%%KK ?  \ 2` ` "*` 2`#b  \  "`` "*` 2`  㿘#`8!@ X* 4 *:``8`2"`㿘  " @?Ր  @_㿘 "O? 8 "K? 0 4B$`" V   T  @41? `V   T  @4"?0?@%.`.* & 0& 4     (@"  ` V  & (  2* ?  5 81R @'8 (S `&R4 ( ((0R @S  $R 2 R 6R2 R`@ނ` 882R㿘 7 8 3V  ,  4 * @ (*` R&V R 0 ("   V  4 R@ $R2R@6V 2V  ؚ` 㿘  V 4@ V  0@>ؔ  8  8 㿘 V T`T` T``@5T` 2`J  6 @6`6 `*`6 ``6 ` 6 `H6 H` ?6 `& `&  `.  `.  `.  ` . `$& $ `.  `. & 0& 4& 8`,6 ,`.6 .T` *   (@`(@ߦ`( (@`2 `( (@`2 V   xph`XPH@8 0 (    x!p"h#`$XPH@80(      .xph`X DPH@80(   I   xph`XP H!@"8#0$(% &'()*+,-./01;2L3456789b:x;p<h=`>X?P@HA@B8C0D(E FG=HIJKLMNOPQRST7UiVWQXYZx[p\h]`^!X_P`Ha@b8c^0d(e fghijklmnopqrs3tuvwxyzx{p|~h}`~XPH@80( xph`XPH@860( FPxpeh`XPH@80(  Hxph+`XPH@8 0!(" #$%&()*+,-./0234567x8p9h:`X<P=H>@?8@0A(B CD F G H I OL%xph`XP H!@"8#0$(% &'()*+,-.E/0123456789:x;p<Nh=`>X?P@HA@B8C0Dp(E FGHIJK5LM/NOPQRSTUVWXYZx[Xp\h]`^|X_P`Ha@b[8c0d(e fWghijklmnmopqrstuvwxytxzp{h|`}RX~PH@80( !%&'"# ()$%&xp*h+`XPH@80( <ybox1memumemlOTGCOTGVOTGHOTGDOTGUOTGLOTGROTG4OTG1OTG3OTG2OTxrOTptOTmaOTkoOTknOTdTOTdBOTNLOTMTOTbcOTnlOTdNOTdCOTncOTnsOTbsOTugOTrsOTi2slengthsgr1evhlmethlmerhlmelohlmelhlmehhlmscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcocopu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoffcxoncrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbtbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinhspinvbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcolslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambwtH}XPz|$} D(xlxLT88{p}~\hztxzh4|<}P,4(@z,`p{Xy0<|t{L8{X|}<`|}~(z~|yL{z@L4Pl`0lXX{(\|}t( |H{@} L ~Xz8|`P|{{|H~\0|lld0{|z Dz$@,,\~4~||ypHD,}\||}zdLDz,X t$},}l\<`~~P 0T ~~4~~L~${<D{@(p|Hyz|d zz z\tyhph P(}{|T 8d~pzP4,}Dhhy{t}yxXPHXPH@8 0 (  @ 80(  !Ը"԰#Ԩ$ԠPԘ@Ԑ0(ԈԀ   x p h`XPH@80(  @ӸӰӨӠӘӐ ӈ Ӏ x p h`XPH@80(  !"#$%&Ҹ'Ұ()Ҩ*Ҡ+Ҙ,Ґ-.҈/Ҁ0fx1p23h4`56X7P8H9@:8;0<(= >?@ABCDEFGHIJѸKѰLѨMѠNјOѐPшQрRxSpThU`VXWPXHY@Z8[0\#(] ^_`abcdefxghijиkаlШmРnИoАpoЈqЀrxspthu`vXwPxHy@z8{0|h}`~(P ϸϰ%ϨϠϘϐuψπxph~`XPH@80( tamd θvΰ`ΨΠWΘΐΈ΀xph`XPH@80( ͸Ͱͨ͘͠z͈͐̀xp.h'`XPXH(@80/( 56789:;<=≯?̰@̨A̠B̘D̐Ë̀xph`XPH@80(^      ˸˰˨ˠ˘ːˈˀxph`XPHXP H!@"8#0$(% &'()*@+8,0-(. /01234506789:;ʸ<ʰ=ʨ>ʠ?ʘ@ʐAʈBʀCxDgpEhFh`GXHPIHJ@K8L0M(N OPQRSTUVWXYZ[ɸ\ɰ]ɨ^ɠ_ɘ`ɐaɈbɀcxdpehf`gXhPiHj@k8l0mC(n opUqrstuvwxyz{|ȸ}eȰ~fȨgȠhȘiȐȈȀxph`XPH@!8%0&(' "#()$%&{*+ǸǰǨǠǘǐLjǀxph`bxmumlGCGVGHGDGUGLGRG4G1G3G2xrptkokndTdBNLbcnldNdCncnsbsugrsi2sLsAXvXtXrXoXlXhS8S7S6S5S4S3S2S1YZYzYyYxYwYvZzXyMTs3s2s1s0cidvxlABAFGmRQMiKmZyZxZwZvZuZtZsZrZqZpZoZnZmZlZkZjZiZhZgZfZeZdZcZbZaZZZYZXZWZVZUZTZSZRZQZPZOZNZMZLZKZJZIZHZGZFZEZDZCZBZASbSfspIpIcWAPAfhPUTOQDDIHUWGCWRCDKSCLfMRMLMCcbFrFqFpFoFnFmFlFkFjFiFhFgFfFeFdFcFbFaFZFYFXFWFVFUFTFSFRFQFPFOFNFMFLFKFJFIFHFGFFFEFDFCFBFAF9F8F7F6F5F4F3F2F1RF!3!2!1%j%i%h%g%f%e%d%c%b%a#4#3#2#1*0*9*8*7*6*5*4*3*2*1&0&9&8&7&6&5&4&3&2&1%0%9%8%7%6%5%4%3%2%1@0@9@8@7@6@5@4@3@2@1LFLOeAXFXNRASARXSXkBpnacrPpOK5K4K2K3K1iPtstawistsasrsfcvr3r2r1rppopfpspxplpkUPSRRILEALSFICDODLDCpcnwmmmol9l8l7l6l5l4l3l2lal1l0kskekukTkRkFkrkPkNkHklkAkIkhk9k8k7k6k5k4k3k2k;k1k0kSkEkMkdkLkDktkCkakbalici3isi1fsvbueseeitemeaeecussomrmpmkimmhdmtimdmbasdsdcvsupndveCMlevihodocmCCchcdceclctcsblbtYpYoBTYnYmYlYkYjYiYhYgYfYeYdYcYbYaNCpaCoMWNlwssglicoYGYFYEYDYCYBYAhlutccNDNPNRHC5inxxoesmsmixnxsxb,d|T@d`h80ĀDLlˆDt<ŠôX¸Ɯ`P8 ,` HltL0Ɛt|PH |`@\8h0\P p$($0pd(ČX T” lD|İD,$hH0( ,X<`$t(<\ ,Ld\<d|h4lXxp<TdŔÜX\p< pƨ,ŬLPļH4\80<TTdH P8(XPhĘTxXH(<hLp t@ňx0H$L Ƅ|lè`|l`T|¬H 48,xlxŸ@$xDLpT4 pt$ƴ`XPH@pH8XH0HPHXH(H (pXѰ0шPX`рЀXxph`XPH@80x8(p8 h8`8X8 8 (8BCKFKEKDKCKBTekKAIRISHSIBMkqGGGcGvGhGdGuGrG8G5G7G6RTPSPNPDLDHMENCOCFGSGEXENIXEEXSDSCVCIAT&TBOBSDsbXXXXXHXkselkbtabfont3font2font1font0 l^ u\hOut of memory㿘1 #X  !@"c\&#X#X 2*z@RŐ!8#X㿘! #X&@E@  \@ *`#X@ "\ $#Xz@R!8@WӒ@/string too complex to convert㿘 c< z@RY"0  #@ b+  "@#c<I'm confused㿘 c< 2 ? c@ 2"c@z@R;"   "+   "@#c< cP "cP%'%{㿘N \ ^": ; N 3 06 % ' $6 * \#%  \  #\@ `  ' )   ` *` Т@  `    ' ) `c\ @ `   , ' \ :TzHc"$TB-". 'zT;c c $T d@NT 0-" /"$T  @B @5 T 0-"  "$T @+T 0-""  }-" $T$Tstring may not be optimal%Pa%ga%p%{96}%^%{127}%^㿘 #L`   " ! #@ `F{@Qf!x! {#Tܒa;$#T#{#TԒa$#T01$#@! '{ 0# #Tᨒ$#T,bb$#T #H`   ! {#Ta$#T #D` ! {#Ta$#Tsaw %%r twice in %ssaw %%m twice in %ssaw %%n twice in %s%i%{10}%/%{16}%*%{10}%m%+%{2}%*%-%?%>%t%+%;%+%-%*%/%+%c%s%-%c%c%2d%3d%d%\unknown %% code %s (%#x) in %s$</>㿘       "P    "#< @#cD##H)"L  "cT` {#0@) 9 #\ `  `@#\ `2`*:  * ."` `A*`: %21-"`cT--"@?ۑ* : `N`}#L*` € %-"cTcL  %cL{#8D  %D{ #PH   %H{#h@PbN@{cTcPߒ {cTВc$cTPג {cTcPВ {cTcPɒ {cTc$cT@{cTc$cT@{cTђcN@ = + - * /YPN` p cSPN` OPN@ =P N` p N`P ?P@@  P?$Pא` @?֑* : `(}"*` €{cT c{cT c{cTc{cTcZ@$cTcL  P   " $@$@@rN@P @{cTecPF @{cT4cP< {cT-c@P2 |cT#`P+ |cT`N@ 3 22) %P |cT`P |cT`P |cT` <$cT'N@P "$PP?$P|cT`( %-"cT"$cT!|N@@@ 0@@Oe N@cT`"$cTN@ Ē#|cTΒ`P$cT!%|`@#\ `2 "*:  * . cT@"cT-"$cTX$cTcT"-"#Xxx$xxxxxxxxxxxxx@0HdDD4Н㿐`@@і  #\ `  ` " \%03oH`c\` J ``:`\ ! !  \,"",""`@ @c@S~`@T"%>㿘~aʒȒ%%%%?%%{%d}%%>%%t%%{%d}%%+%%;%%?%%{%d}%%>%%t%%'%c'%%+%%;%%?%%'%c'%%>%%t%%{%d}%%+%%;%%?%%'%c'%%>%%t%%'%c'%%+%%;%B%%{%d}%%+%%c%%'%c'%%+%%c%D%n%mdoxX.%.%r㿈//@@J >    v J /2sN@%?\ `2?*:  . * <2 ?N $"  # ,b~b \ `2*:  ." *"?N@ \@N` ^ , *`@ *bb*:  $*N` <*`%`@\ `2`*:  . * / >"`:  % *N` %*~a:  %  *bb~a@ҭ ~b@Ҥ ~b8@қ  ~bX@ғ  @c ;  ~@ bx~b@x  ~b@q {@co + {cҲO`'{c@q  {~b}`a@q   {  ~`~nba@q  2 ```o`~_b@?ۑ* : `N\!*` €  %*bMb1  %.""c\ @ #~`z"@\ `2."N@@cb ;N@ d8 0E|&` ~"b{c`N@ 1 2$  22N@2N@~IbȠ  0 {c> @ *b6b N@  `N@ @2N@  #X\tttttttttt0 㿘N  N * :`* N@  @#㿘* @  `*`   o* @@m 2V 㿘#L: 2  @m 2 * xph`XPH@80( xph`XPH@OTxrOTptOTNLOTMTOTncOTnsOTbslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambw    x ` H 8 (  x`P8(xhP@0hPreturn_does_clr_eolhas_hardware_tabslinefeed_is_newlinegnu_has_meta_keyno_correctly_working_crcrt_no_scrollingbackspaces_with_bslpi_changes_rescpi_changes_ressemi_auto_right_marginrow_addr_glitchhas_print_wheelcr_cancels_micro_modecol_addr_glitchhue_lightness_saturationback_color_erasecan_changenon_dest_scroll_regionno_pad_charnon_rev_rmcuphard_cursorprtr_silentneeds_xon_xoffxon_xofftransparent_underlinetilde_glitchdest_tabs_magic_smsostatus_line_esc_okover_strikemove_standout_modemove_insert_modememory_belowmemory_aboveinsert_null_glitchhas_status_linehas_meta_keyhard_copygeneric_typeerase_overstrikeeat_newline_glitchceol_standout_glitchno_esc_ctlcauto_right_marginauto_left_margin      x p h ` X P H @ 8 0 (                      x pOTknOTdTOTdBOTdNOTdCOTugbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinhspinvbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcols p`P@0        x h X H 0          x ` Hnumber_of_function_keyshorizontal_tab_delaybackspace_delaynew_line_delaycarriage_return_delaymagic_cookie_glitch_ulbit_image_typebit_image_entwiningbuttonswide_char_sizeprint_rateoutput_res_vert_inchoutput_res_horz_inchoutput_res_lineoutput_res_charnumber_of_pinsmicro_line_sizemicro_col_sizemax_micro_jumpmax_micro_addressdot_horz_spacingdot_vert_spacingbuffer_capacityno_color_videomax_pairsmax_colorsmaximum_windowsmax_attributeslabel_widthlabel_heightnum_labelswidth_status_linevirtual_terminalpadding_baud_ratemagic_cookie_glitchlines_of_memoryinit_tabscolumns"x"p"h"`"X"P"H"@"8"0"(" """"!!!!!!!!!!!!!!!!!x!p!h!`!X!P!H!@!8!0!(! !!!!                 x p h ` X P H @ 8 0 (     xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( box1memumemlOTGCOTGVOTGHOTGDOTGUOTGLOTGROTG4OTG1OTG3OTG2OTmaOTkoOTbcOTnlOTrsOTi2slengthsgr1evhlmethlmerhlmelohlmelhlmehhlmscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcocopu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoffcxoncrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbtAAAAApA`AXAPA@A(AA@@@@@@@@x@h@P@@@0@ @???????x?`?H?0??>>>>>>>h>X>H>0> >>========x=p=h=X=P=H=@=8=0=(= ====<<<<<<<<<<<` @ ! s$  @ܔ i#  `""ed"` "`$*  *`#!#$ p`@  p` /p@   >``R "@ = p"` @ / p"``2```"2`p " $p` p`cR`% p"D>` @{ `" ` -" (>?  p 쀠  "p ?㿘   ?㿘 D? et= 25 `"et"@ِ  % ')V  @  ( "V @V `@ @ (@쀦"$耦"$ "%  2 㿘%"  `  R "@ `2  R "@  @ S @5 S  0@  ( $ ! @z.@ (*`"  ( .`    " (@  *"  㿘-  * (`&$T @47 T @41 `"2 ?" 2 T T @4 2& 4 & 0 `&  & ./ *   ( (@"   & 8㿘V V & ' * 8 4 㿘  "   @ze   @z` L  @z[ $ (@ؐm  ?4  4 44 4 4    4 H4 $  $ R R@`?, , ? , 4 .4 F, , , , $ $, , $ 0$ 4$ 84 ,4 <4 >4 @4 D 4 B  (@ 2` ( 2   ``R@`   4 R``4 `R  `  4 `et$`$@"et㿘3 x`8 + # - < > | ~ _ : ' o v ^ * ! f&!&!&!&!&!&!&!& & & &!&!&!&!&!&!&!&!&!&!&!&!&!&!&!&!&!& & &!&!&!"l "`8(`8 bH .@[  (`8 "HJ@ a ~ `6  + . 0"   4  f&   "H J `*     * NCURSES_NO_SETBUF㿘@N" $@! ` "` #HD@`j4*  ` @  " `?@㿘 *x RR" RS  S @`&%t ; RR  `.R``&2`R "@ 2`` &R @ ` 2`R   @ 2 @5 "-? 2 8` 2`82 `2@82 ``"2@e `"%`% "&@\`"%&"cD"H 㿘  ~,°?V @V "   8 4R 4? 0R 4?( @;`@ ,,`*  (`@@@ ,@ (@7*` F& ( @,`*  ("@  ( 2  (@ 2` "` 4* @*`  0 (* "@ `@ @k @G  ( 26`  @7|. ("@ (`F?  4* @ 0*` * " (R @&2  (2 , ?"`2  (@2``@ V ,.`: @6 6 6 ,V .V @ @2V 6 .V V @ 6 VV @ 6   ` ?? @ ???@?@@㿘@%㿘  ?@? 㿘  ?@ ?  . ߐ.  㿘@2V ` 8 V @sL 2]V V `  ?# ? @  ?# ? @ ?#@? @@@ V* @ (*` R?2 26R242*" V   *V .`@:  . 6  6 6 6 @! 6 6  V  `L  " L#L@ $`@V .V @`*: ` ??#`* ` : @   @ @ ? @@ @V* @ (*` R?2 26R242*" V   *V .`@:  . 6  6 66   ?@!| 6 6  ?"?V 6@ V .`@ 6   V @!^ { @V . $    n@!N   j ?d6 c ??#`*:  V   @   @ @ ? @ V* @ (*` R?2 26R242*" V   *V .`@:  . 6  6 66   ?@  6 6  ?" ?L   ?66  onnnnnnnnnnnnnnnnnxnpnhn`nXnPnHn@n8n0n(n nnnnmmmmmmmmmmmmmmmmmxmpmhm`mXmPmHm@m8m0m(m mmmmlllllllllllllllllxlplhl`lXlPlHl@l8l0l(l llllkkkkkkkkkkkkkkkkkxkpkhk`kXkPkHk@k8k0k(k kkkkjjjjjjjjjjjjjjjjjxjpjhj`jXjPjHj@j8j0j(j jjjjiiiiiiiiiiiiiiiiixipihi`iXiPiHi@i8i0i(i iiiihhhhhhhhhhhhhhhhhxhphhh`hXhPhHh@h8h0h(h hhhhgggggggggggggggggxgpghg`gXgPgHg@g8g0g(g ggg~_~^~]~\~[~Z~Y~X~W~V~U~T~S~R~Q~P~O~N~M~L~K~J~I~H~G~F~E~D~C~B~A~@^?~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"! ^_^^^]^\^[^Z^Y^X^W^V^U^T^S^R^Q^P^O^N^M^L^K^J^I^H^G^F^E^D^C^B^A^@ * 㿘 C? @  *V :  6 6  @23?*V :  4-?,V :`@ %? ,  (* @R?$ 2 <2V * @@ "  (" 㿐@#'@#* "*"@ *`@*`'@ߒ  㿘 8`` ?F 0 ` =8?H?8?HA㿘 8 ?R (@eْ ``?2b\2b`2b^  ""|   | ""   㿘 ?` @, @`?`?㿘  >?  ,@ `@ *: <" 4"% *: *  (@*`  ,`@:.T ?$T 4 T <?@?4 G  &?R 4?`&?R @4 ? 2  2 2 ?㿘 쀦  @. 0@      *@. 㿘 ? !?  ""  ?H4 @ T *\  *`R :`@ 4V  ?(: * @(*`+` :* T`* (`@?-`T`=`4 $+`: +@(:`  @"" P?0 06P040*`:  `4`4`(`T:   ) R :`@ (   , *`   H  @2  2  *`㿐 Rbb  ``  '7 @ 4    x2bb 㿘 8J` <J`  ~ ? ` ?bh @(   % €  `?"`` @* "@@2 x8 "xbD nb\ M8b` "I8c8`J  ~ ? ` ?bh @'Ő  % €  `?"`` @* "@@ x8 "xbD  ' x8?"xb\0 |`"  Ѐ   bhR` R` ?  8 J` @'o  "x@"t 8"bx"btJ ` ~ ? ` ?bh  @'R  % €  `?"`` @* "@@x x8 "xbD   bhR`R` ?  8 J`@'  "x@+"t R`"bt *"bx  (*R`*  @ ?8H?""tH"t""x""t"x""x㿘 8`` `a䀢 `u5`f @a`7Rt?@ Rx?@8 ?8 J` ~ ? ` ?bh @& % €  `?"`` @* "@@ʐ x8 "xbD ""xR  z`  @`WRt?@ 7Rx?@85?8 J` ~  ` ?bh @&D % € `?"`` @* "@@jx8 "xbD ""xR   ب 8 2   `@" 8 `Y S7J `?l ?# 0  4   8  ?  `? 1 bh"8@%ΐ8 @& Q6h "h"x "t @ 8 J`@% "x"t@ƭ- &@"bx"bt8 a䀢~`y xR   ?h @@%8  - @%הx"x&@Rt?@ 8R?8D; J` ~"`` ?bh @%W % € `?"`` @* "@@}x8 "xbD "&@"xR  e- ,c &@@\- 7,`Rt  8Rx?@8 > J` ~ ? ` ?bh @$ % €  `?"`` @* "@@ x8 "xbD "Z"xR  `@``b  @6^ 7 ,`Rt   Rx?@8 ?8  J` ~ ? ` ?bh @$ % €  `?"`` @* "@@ x8 "xbD ""xR  `h@ 㿘='`   52 +).@@@## .$ "@[@bh    8 J`@$+ "x@@"t"bx"bt  ֢`'.@9`㿘Ð  Rbb bb2bb`bd  ex `@`"d`@@`%X@`""d  ` - ` @ * Q*`  ``R`R 4 @+p@ 7?  v ~  (@R`?  (@R`?@VR`4  `(2 `(@2` R` `(2 `(@2`Р R`4 .  * ?(  2 (@ 2`R  R`.  * ?(  2 (@ 2`R  ` %`` *`2@:`2bh* @  : `  8`J `@#A `"x@V"t`"bx"bt`"h`@#1 ~   "㿘 8` J ` ?# @`  `RR @4@` @ @ 㿘쀢 'bt "R`bx` + "t*` (*  @"   R`쀣 ` ` s?"h  @"Đ`R "x"ܖ" ]``Rt?@ Rx?@>` 8J `` ~"``bh `@" `%`€ ` `?"`` @* "@@ `x8 "xbD "``"xR  l ?0 8`㿘 bh?bt bx@"N  8[`R ֒"@R``,`* ,  ( @ " `R` R`@ R   ,`* `,  ( @ " R`` R`@㿘  `RR  8J  ` ?# @`  `  `  bl ?#@ c0   4   8  ` @ {? 7  `  +` (* @*@ `? &*  +` (* @*@ `? &* " 6Ҕ  ? 8  `:$4 6"h    8 J`@!x "x @"t"bx"bte e R`+`儚`@ " R`@㿘  `.(*  ( e@e .  bl :9R` @66 8? )?' @##  @   @@2` 2 h  2  6`+ c(*  @ `  @ ``R @ ֆ 8J `  ` R      ?@2  4  "h    8 J` @ ΐ  "x @"t  8"bx"btJ `  `?# @`    R ?S   R   @2R   @" R 8$4`" J `l ?# 0  4   8  ?  `?   R       *@"  R  2 b  , @"  b $\ R`) b܀ % bh@ `  8 J` @ )  "x @>"t ?"h""t@ ""x@   8 `)"h  ?   8 J` @   "x@"t ?"h""x@ ""t@  8 |d4%, R  8  8R`* J`?l ?# 0  4   8  ?  `? > R @,`  @ @@@"@ "h    8 J` @  "x@"t "x"t1,$@@*0R ,@" R @,`@"@w@ $܀ q@h@ `  8 J` @Y  "x@n"t ,"bt"bxR`?  8R`? 8 >   J` ~ ? ` ?bh  @*  % €   `?"`` @* "@@ P  x 8 "xbD "  "xR  73G,`,    %G` @ 8 "h    8 J` @א  "x@ "t $b"bt"bxj  "h`@&Y ,`,   `@ "h    8 J`2 @  "x@ "t "bx"bt#]@& `bh@ `  8 J` @f  "x"t@ z&@ 8 "x"t`a "`|  8`  @ "-` 8 `Ѐ  @z" -`А"? -`͒n  $@@ݐh e `bh@ `  8 J` @   "x@ ""t 8 "x"t`ᤐ`" T  @5" , "?(   "h`    8 J` @ѐ  "x@ "t "bx"btʒ   ?bh @ @r$ R @"@,@•*㿘 8``   ` 2 `   `bl  c0  bh[*   @F 8 J`" x 8 ` ?bh  8@u  8 `"bt"bx` (?"h""t  ""x"  J `@X  "x @ m"t?"h""t@ ""x@I  8 `ۚ` ?"h?""t@ ""x@6  R`'"h  ` 8 J`@  `"x @ 5"t 8`"bt"bx  `R`?"h  @ R`}"h    8 J`@ "x "t@   R`"bt@Z"bxRt?@  8Rx?@ 8< J` ~"`` ?bh @ % €  `?"`` @* "@@  x 8 "xbD " "xR  `R`@R`"h    8 J`@t  "x @ "t"bx"bt` R`  R @  , *  ,` (`@ " `R`@ `R`㿘 8`a "L`|@[ɒ``8 J` ~ ? ` ?bh @ % €  `?"`` @* "@@ E x`8 "xbD "° 0X`` T`t `K`8`8 J` ~ ? ` ?bh @Ґ % €  `?"`` @* "@@ x`8 "xbD "`84`8 `؀ ", `8 %`0ON'8 `8`J  ~ ? ` ?bh @ % €  `?"`` @* "@@ x`8 "xbD "`8`8 `؀ " 㿘 8`!  @[͔0  8 `T? 8㿘z㿘 5%8b .@- *  bh@  `  J `@   "x @ "t bh"bt"bx@8[ 2b 38 X`/2.! bh@  `  J `@ؐ  "x @ "t bh"bt  "bx@Ȑ8[ `XS  !`.@2-82*8 bh@  `  J `@  "x @ "t bh"bt"bx@8  08!`2218 bh@  `  J `@u  "x @ "t bh"bt  "bx@e8  @[x 8"`7@268238 bh@  `  J `@<  "x @ Q"t bh"bt"bx@, H7[8  8= 8 X`42ð? bh@  `  J `@  "x @ "t bh"bt  "bx@ 7[8  |X8 ? bl " c0 2 8 J`2  @6~  "h  &  8 J`@ "x "t@Ӹ `R`"btZ"bx Rt?@ 8Rx?@8}<  J`` ~" ` bh  @  %`€   `?"`` @* "@@  x8 "xbD "  "xR   e  R` @  㿘 5%8b .@- *  bh@  `  J `@2  "x @G"t bh"bt"bx@"8[ 2b 38 Ԁ`/2.! bh@  `  J `@  "x @"t bh"bt"bx@8[ `|  !Ā`.@2-82*8 bh@  `  J `@͐  "x @"t bh"bt"bx@8  08!`2218 bh@  `  J `@  "x @"t bh"bt"bx@8  @[x 8"`7@268238 bh@  `  J `@e  "x @z"t bh"bt"bx@U H7[8  8= 8 Ԁ`42ð? bh@  `  J `@-  "x @B"t bh"bt"bx@ 7[8  Դ8 ? bl " c0 2 8 J`2  6~  "h  @  8 J`@ "x "t@ R`"btZ"bx Rt?@ 8Rx?@8戀<  J` ~" ` bh  @  %€   `?"`` @* "@@ސ  x8 "xbD "  "xR     R`   㿘 8`a 2a`X "?a `Ԁ ? bh    8 J`@T "x @i"tbh"bt"bx@D   8 `X [˒  8 a   @[ $7[ 8  X 8"h    8 J`@  "x @!"tbh"bt"bx@   8 `Ԁ [   8 a   @@[w $ 1[ 8  !jԲ2 8 㿘 8`J  ` ?# @` ˢ  X8  `R 2 + /[ bt@@/[8 "` /[!    8  @ܠ ` 8   `?"bt"bxF8` @  `?"bt"bx eF&ؖ񀤿8`J  J 怦値$ ` ` bh@  &` `J @) `"x @>"t` "bt"bx#)`"h &  8 J``@ `"x "t@` "bt"bx `  L8  `F`+/[`"t@@8` /[  a  8  @ V`" `8  M?"bt"bx_8` @  7`?"bt"bx eF`28 J `  J )`( $#+`"h   8 J``@o `"x "t@` "bt"bxg ``.`.::@@ Ĕ ?㿘 "bh *bl  ! 8 d " 8 8 ` "` 8 " 8 8 ` " 8 8 ` " 8 8 `  8 8`"\ "`  `J` 2  㿘㿘! "h` @  bl  c0  *c0[? @=ؒ   *#0 S "x@"t  R"x"tҒ A 㿐 'H1f"@N[``$RN  <N'@1Ò > F N` >4#\ bx ` *: ?')":  * .H" N> ` ' ƅ#D° N > "`2   "" b# N ('㿘аb@   @)?㿘 8`    R` @㿘 8`p  ?bp"bx?"bt@l"bp㿘 8`` W@~#   $b 4`8 "b`8  <`8  #"50`8  #".H`8  #"'8`8  #" D`8  #",`8  #"L`8  #" |`8  ## `8 "c"c ؀ "`8  "c`8 `(  `<" @   `8  #"@ `8  #"@ؒ `8  #"@ϒ `8  #"@ƒ `8  #"@  `8  #"@ `8  #"`8  #"`8  #" 4`8  #"T`8  #"`8  #"@ `8  #"@ `8  #"@   `8#"`@ ْ   "bc@ ђ `8  ##@z Ȓ `8  #"@q  "@ 4 `8" "` p  @ `8 "b`8 "a㿘! ?R` ?@ bp?@0  8` f6 x@P  8 b@   @@F  bԀK8 a& Ȁ@@'8`@@& "8 `,t@Ҧ 6mВ@8  `,@F@` W'А`V@ M@ aȀ&@ @@ޒ8`@@ݐ "8 `L+@ 6$В@8  `L@@w` 'А` @ @а"@А"@7 ' '.'8 b@  @8` @[@  bЀ8 a' Ā@@h8`@;@g "8 `Dؠ@>"`@` `  '`@`  O耢 `.`$(* .@ `\ 2 ` . `* . ``$ (@ bh ? "  ` !`.* .  $`( * 'ܐ*@"'@ 8  `D@*@ %А` @ޒ @д"@@^А@ǒ@͒ 2TS a&#`"@68@8`@@ `"8 `80"@8`  8b@א@Q %А` @ @д"@ А@u@{ 2А"@@㿘@`q ` R   @{R@oT @ O@{`T   & "@ B%#[8 a  Fa?`` ?"``* "`@ ?`8 `  *a `` ?"```* "`@Ő  8R  4 4 @ 㽈В@" @ Т` @@   ?"?R ? ?, , @ Ѐ?"@ Z Дb@ ?  ?+`8 ` "@  ? Дb@  "@ 6`8 `8 `0"@ w  $ Дb@  "@ 6`8 `8 `H"@ \R  Дb@  "@ ` `" `8J@ ' J` #   8`"@ -R`?ؚ Дb@  b    @ "?`I"*` € <`8`@ %`8`@ 0  `8`@ HR  Ѐ``8`@ `8`@ 8R`?y А"@[?֒  lِٴ 㿘 ` ` @Q 2   8` ".  . ,%F ?㿘  `` @ @ . ,%G㿘? 8 ?@` "   `?" $" $ ? 2* ?  2" $㿘 ?. @ 㿘 `` " 8` "`Q 0`    8` C㿘  +bp 1  `0"!` 8`P  ? 8`@ "?` 8`4  ? `""p?   㿘`2`  2@   `  㿘 ,㿘  8`d "      8``    !  4`@  "`4 㿘" `%# `8*   @  ,   2㿘`{@ w c8 s . o 6@       2   0`  `@ "H6  "#@ڴ@V֒ &@  @Vʒ & ,,c8@ .`.6 @ " 6   @V & 2 @ ,c8@* 20  .`.6 @  6 㿘 ` 8 "b"bd*xX  8 }"d"X* y 8 X?㿘 8  #bd*xX ~ 8 >`"X"d*y 8 X㿘 8 dX* "d㿘`8 "" d X 8 X d  # d# X㿘`8 #"dXXa"d׼"X㿘 8 dX@ ױ"d㿘``8 d *@`8 d  "d 8ך X8 Ѐ`8ᰀ `8|਀ `8T2 2 8 Ԁ2XḀ X2 ᨀ2 㿘V  * `7..:":`  * .@ *`* (@?>&,V  .*  (*"@ V $ ( &V ,`4-`<"> 4<* .@ *`* (@`  <&>V  .*  (*"@ V $ ( 4V ><" @T 㿘 "?  `" V .V ,$@@ 4?   ?@hb  " R @4 `*`   ((R 8@  " R  4  (R      `&,?R @@ &?@ 6# @4  *` (?  ( 00 (  00` @ ` R @$ (   @LINESCOLUMNS㿐#@`2&@8  )R`&8` Rb&@ @& 4&@ 4&@ '@ )) 8R`(@q)   ""%8hR(@ " 2 "8 4@&@ 4&@ 4@8 R`&@ 48 R@&@  @ 8 & P&@8 ` 2 8`` 28 R` & %#L㿐 %d€㻘@(C / . @X @   `6` `J@ &*@ `&``   `* ?"" ` &`TERMTERM environment variable not set. TERM environment must be <= %d characters. Not enough memory to create terminal structure. terminals database is inaccessible '%s': unknown terminal type. CC'%s': I need something more specific. '%s': I can't handle hardcopy terminals. 㿘 @# N  Ð?!@Nc@ @^" ?!c@N"@w  @S 2 ?!@Nr`@g F`@ΐ  $$ $  $ $ $ $ $  $ $$ $`?&!@NC`H@8  2Y&!`p@N6@+  8R(,$ ,0$ 04$ 48$ 8<$ <@$ @D$ DH$ HL$ LP$ PT$ T`8` $ @ "`8@A`8#P@)!``8@  " `82(#D>cH &`8 J `&?!`@Mޔ@Ӑ J   & ?!`@M͔@  㿘@ 8  $  @*`8* @ J@  @8*:  "*@`J@  @8 ` 8 㿐@' @ܔ  "?J ?/usr/share/terminfoTERMINFO㿘#! `Q 2 T  P`2 T@j  T@]!  `Q *`P$ T T㿘ݐ *`Q??   2 2  2 2 (2  㿘 @E?/`/` 2/`&@(/`&@/`&@@`N  N2 8&@@‡/`!?#&@&`&`&` &`&`&`&`&` &`$@w 2 #*` 2 @#### # #*`*  *+`+ @  R OM`K -`/4s @~ &`l  ?#""@w9/@Y @Q  +&@@" > ;   @w , ,@Q  &`@w @w ' '@Qs  &` .@w2% ` a!@Q]  &``-`@v2  `@v2 `` , '!6`6`6` ?c @vʔ  X`#?c@v 2ưcc cc*` c **   cc   *`*  4° /4  ,+ '`6`6` 2`@6`&``` @*`&` ` `@ *`, &`` 6`"``,@vq2 ?c @vf , 6`$?#,@vZ2 ` `NU? , c @vE2j ,@} 5&`@v7\ , #6`&`-`?#@ `K * `. @ "fx`x? "?@6?@Pu  &`- ?#,`@  +4 `*  +$` &4 ?. `   &2 !4  . ` !"  㿘@  @  @[   1 @̐@u%s/%s㿘@֐# cX@Ғ 㿘@'a 0 ' L``:2 ` ,pҖ 뀤` @|l%c/%.*sTERMINFO_DIRSp@ 9N`H@e  `P  9  2 @~ 2'@~!  $  @    @~} P !p㿘@q /  .㻘@g 6" ` "`2?@.#@ʐ "@*!7@G ?㿘  "@{ " @{  " @{ " @{  " @{  " @{  "& $@{& $&& & & & & & & & X(XHOMEOut of memory%s/.terminfo㿘@} & ``   @}#` " `N " `@~ $8 `@~@{S $ `@ !#hcx@ `TERMINFOHOME%s/.terminfo/usr/share/misc/terminfo㷈@}耢 @} 8  @%_$#'@} 2@} H J@   P@Yƒ$#$  `$$ 耢 @. 2 @%-$  2 㻘$@%@k / .@e /   *@ 㿈''@ ='@ @2 V @~@z  7@"a : 2& @}Z ,.@@` *@ N`   ,:2\"*@*@` N  *@*`   @u !2  &&& & &&&& & $&$@"쀢 `@z`@z@`? "@ KA \ K ;`J  \  #  2 : `" *!"@  \  (8\J̀ ``2  J@\2J@  @\ "J@` @ 2` J@2*  J@`TERMCAP/usr/share/misc/termcap /etc/termcapTERMPATHHOME%s/.termcap /usr/share/misc/termcap /etc/termcap?#d x'@|D"c @|6! h@"`@ܒa:$M@ /2@|!蒒 @-$!@|/h L@ @!1 h@X7"!@b@@b0$+@$ L ! *:   :2 , L  "  :"   `$ ۠ L  `$M@ /2 !?@U !?d?J?!?#d@ A% #`#\' '  ,   *@KJ 2JK @2 !??#p@,`& "@"  ɢ` :..!?#\   #` 2˒#p?#d "@y   @y  $. @#@ $'|:@{W 2?!@{I ?L /”@y  ?#@"@ #??## ! c# #c@ "`?c    @ a  -? &@ &` &` &`  &` &` &` &` &`  $&`$$ @  #@-b 2! 2@  * 8(| `a8  (8*@|2` * "A J< K@ 2 J`K@ J"`J   J + 8J`J2 `  J  "JK@2JĐ   " "`" *@㿘 @ ` ` 㿘`@{;` ` "`@Ғ`@$`` "$` 㿘`@{` @ "`@@@$`` "$` 㿈   "l  `  bl  c0`?  /"h%ఀ   8` R ?#<.?#` 8` R` ` a*  `?@2@ *`@~ @ . ఀ ?# `2 .?` +.    ` 2     0   @*ǖ e@ 8`  O*@%ఀ 7 8`` " ='ఀ " %E   `  +,  "@ %D  @  8 `  ? @%ఀrఀ`n?# @2  2S `N @E0F 8`b `I`6  !6 6 6   6 6 6 6 6 #\  `;`#h `  @ Ԕ? @%ఀ/ఀ`+?# @2  2 `  @ 0 @* `  ,  " %E   8 `  ,  "@ %D @  8 `  z@,  8 `   n? @@%ఀ"ఀ`?# @2  2 `  @ @ @)@  8 `d  9@  8 `h  .@  8 `l  #@  8 `x  @  8 `   @@  8 `  @@  8 `   @  8 `  @  8 `  @  8 f  ֔@  8 f  ˔@  8 f  @  8 f  @  8 f  @  8 f   "%""h 㿘[a8dh` @l@x@@@@@@ @@l ?@ Out of memory㿘! .  #@" $#@ %d㿘'H'L'P'T'X@H0  "#@x]  ! `" @" $"     ?? ???'# ; 9 K@`%2K@ " '`* K        L* : `X'̐!*` €  *5 `*   ) "* *    "  *#\ @ ` (* +`?Е:  c 4 *  K    %* *   `"*% @?ߑ* : `]9̐ 8*` €1?*`" 'K ?Ѐ "     ? ?А  ` @?А (` K@?? K@ 2`#@&DK@ 4  * `" # $c  " * * *`#@$c*N*`: `%  " cc  c0 " ' *K@ @       L* : `X'ː"ԓ*` € @ *5 @*`  ) @"* @*`   "  @*#\ @ ` (* + ?Е:  c 4 *` K@  @   %* @*   "*% ?ߑ* : `]Rː!\*` €cc`@ % 3c#* `>%cc   "* ` $c `  c`c@ ##Jc  "* ` $c 2@vy cc  #c)c  "* ` $c 2@vT  4c`c@ ##c@ #c@v=@c@%cK`?πư`* c4N *b * "@ $ccK ` `*`c: ?   "* ` $c@  "x *`c: ?   "* ` $c@  "*|" `  `*`:  bxc @ i*`: | bc@c K` *b  *"@ $cS` ` А `* (@*`: В@ cc  "* ` $c c   "* ` $c c c  "* ` $c c   "* ` $c c#@c  "* ` $c c   "* ` $c  @wːcxc  "* ` $c c   "* ` $c  @gB Rcc  "* ` $c c   "* ` $c  @[ ,cc    "* ` $c `)ccc    "* ` $c `2 c   "* ` $c `c c4VN *b  *"@ K$cc  "* ` $c c   "* ` $c cǚ c  "* ` $c c   "* ` $c c c  "* ` $c c   "* ` $c c c  "* ` $c c   "* ` $c @ch`?c  "* ` $c c   "* ` $c @  Fcc  "* ` $c c   "* ` $c @  $cc   "* ` $c c`?c   "* ` $c c8 4eN *b  *"@ Z$cЀ  'Ԁ 2PN K'c   "* ` $c 2;N`  2N`3N 2 N , %  N ? ;`뀢 e`N` N 2 N  %  N ? ;`2N`N  N cc  cc#* #*---'#--%$-$-%------------))T*`--&-------------'"L------- -----(----  ,-#-+-- &0- !--!+--- --#(\-+0dPPPPPPH@@Tp\\\\\\  㿘 #`*# @"㿘 @yc"%s", line %d, col %d, terminal '%s' 㿘 'H'L'P'T`1'X c!̒cp@<`̀̒cx@<ې Ѐ̒c@<Ӑ Jc c̒c@<ʐ@n :@n  @MuH̐@<c㿘 c!̒cp'H'L'P'T'X@<`̀̒cx@< Ѐ̒c@< Jc c̒c@<@mؐ :@mՐ H@M>̐@<c@oz 㿘 c!̒cp'H'L'P'T'X@  (K@ ` (`(-2 (9@  @*` ( (   `ب?" "@'쀥6r' *`- @* *`-``- %'%@ Q  @G `"#`% (,`(`, ( (@  (@ ` (`(2 (@  @*` ( (   "'`ب  "  ``' R`㿘 #R``䀢  `@k  R `*` @k*   $ % "f$`@k "%`$` R $` e 4e . R`@'%#+` `(*  R`?``+`R  `  +  %"@R`@[ e 2 R`@>ݒ  "e e 2 R`@>Ӓ  "e e e   R`@:'%#+```( R* ` +` `+  ` %*"@` R  (`   ( ? `e"`R`@  R * @m*  R`@M +`%`  "   2"  ""S @   R`@) ?+`  `   "   2"`ؐ """R`@  2 2   ؑ* "@ 2 R`@S R @ 6R  ؓ+` ? R `@ +`"`R @ 6ؓ+`  "  `@  +`?" "`#@ `` `:  4 @ 6 6 ?* ؖ " R @ 1倀* R`(`( *   @*? ` 㿘! %Y&  ?"@ ** .`. @d &@@F.`R(* @  .`+  %@"@ 0'.` . @dŐ"@&@@.`R(* @`  .`+  %@"@ Out of memory㿘@ 2]"!""!`""a㿘   "!@i!@ia""aa""a 2 |㿘@  | @ :  #. #  *`㻈"ߔ"$2  @E   @ْ | $@Ғ |  terminal names must start with letter or digit㽐 Ȣ ,`@3 \  А   b "@l@?2a` b "bb 2b",`ȁName collision between %s %sresolution of use=%s failed`!/'Ȁ`A ! ' '-+Ҁ@(!@g "! @F @7,$ !=@7#b! ဤ@` ?"`* "@\ a`2 C a?"`Ѐ`y'`( 6qa  `0@ ,, `4`, @պ `3Ѥ`0 c "!$ ! `3`?????Ѐ '`@h6" b$ԗ*$ ت $ $ $ $ $ $ $ $ $$!'$ (& `2`(" Ґ * &Đ '`(&@a`2`(Ā`x 0π `Z `($Sa  Д`0 (`H   @Ւ`( Р`0`(*` *@W `(? $`(@O` "` @g` "`@g` @gА$@Ԓ $`$`$` $`$`$`$`$` @3$`$ a`2`( !`8 ` 6` `J@ ?"*@ `&`` 6` ?` *R ?"2 `&` `  6a`* ?"" ` &`a`2` a  a?`"!a@$ @a`2a exit_standout_mode but no enter_standout_modeenter_standout_mode but no exit_standout_modeexit_underline_mode but no enter_underline_modeenter_underline_mode but no exit_underline_modeexit_alt_charset_mode but no enter_alt_charset_modeenter_alt_charset_mode but no exit_alt_charset_modeenter_alt_charset_mode but no acs_charsexit_alt_charset_mode but no acs_charsenter_blink_mode but no exit_attribute_modeenter_bold_mode but no exit_attribute_modeenter_ca_mode but no exit_ca_modeexit_ca_mode but no enter_ca_modeexit_delete_mode but no enter_delete_modeenter_delete_mode but no exit_delete_modeenter_dim_mode but no exit_attribute_modeexit_insert_mode but no enter_insert_modeenter_insert_mode but no exit_insert_modeenter_secure_mode but no exit_attribute_modeenter_protected_mode but no exit_attribute_modeenter_reverse_mode but no exit_attribute_modeto_status_line but no from_status_linefrom_status_line but no to_status_linemeta_on but no meta_offmeta_off but no meta_onprtr_off but no prtr_onprtr_on but no prtr_offrestore_cursor but no save_cursorsave_cursor but no restore_cursorexit_xon_mode but no enter_xon_modeenter_xon_mode but no exit_xon_modeexit_am_mode but no enter_am_modeenter_am_mode but no exit_am_modelabel_off but no label_onremove_clock but no display_clockdisplay_clock but no remove_clockset_color_pair but no initialize_pair㿘 ` ?2C``  ?"  ` ?2 @ p `  ?"  ` ?2 0  `  ?"  ` ?2    `  ?"  ` ?2 ! `  ?"  `d ?2 !0 `d  ?"  ` ?2 !h `d  ?"  bH ?2 ! `  ?"  bH ?2 А! `h  ?"  ` ?2 ! `l  ?"  ` ?2 "  `p  ?"  ` ?2 "P `  ?"  `p ?2 "x `  ?"  `t ?2 " `t  ?"  ` ?2 p" `x  ?"  ` ?2 `# `  ?"  `| ?2 P#0 `|  ?"  ` ?2 @#` `  ?"  ` ?2 0# `  ?"  ` ?2  # `  ?"  ` ?2 # b  ?"  ` ?2   `  ?"  b ?2  H a  ?"  a ?2  p a  ?"  a ?2 А  a܀  ?"  a ?2   a  ?"  a܀ ?2   a  ?"  b ?2   b  ?"  a ?2   bX  ?"  bT ?2 !  bT  ?"  bX ?2 p!H b`  ?"  b\ ?2 `!p b\  ?"  b` ?2 P! bt  ?"  bp ?2 @! dP  ?"  dL ?2 0! dL  ?"  dP ?2  " $  ? $ ?"0㿘 "  "Ӱ " "Ͱ   , " $ & " $ &   $ &    ,`@ 2 ` " $@@@ɴ@ @* Ĵ  @#-  ,` @l "   %`0`0  ,'`@* `n- "% " M $"4 I $ "* 2`6 "6  :&   *?8 1 $ $* 2`6 $}6  "&  ,  ??2  $ &* 2`6 &e6   &  ,  ??"  $ " &   P, ? &  ,  ??" @  "@ ?%& 6 6 Entry does not start with terminal names in column one%s `%.*s' may be too longprimary namealiasusetc%s (%s termcap extension) ignored%s (%s termcap extension) aliased to %s%s (%s terminfo extension) ignored%s (%s terminfo extension) aliased to %sextended capability '%s'unknown capability '%s'maMTbooleanstringnumericunknownwrong type used for %s capability '%s'unknown token type㿘@ ư?#@ !8<a@&!&!&!!DL  | *  @ R&p& C ـ@ # ڒ  S @` | $& (@ސTR׮!DcaD@` aD@ ` @  ( ,*@ *`"  (`̕* * 4"@  ( && (!0`aDu!\h Ԑ P0 %zy 耢`G 'u)@aD 2   "\ 64 P  /` 耤`0) d` d'h)@aD 2   "     ` ``@aD`` X`aDٔ  !`oaD Ѐ` aD 0S`Nڠ!aD@j  0ސ@  ڠ!aD@X  0̐@  U'`  s` "   !0 !0!! !(aDR!80W"*T` 0B'?` " T`  "T`0@" T`0= ? * 72@? * 2"@T`  -*  * (20  T`* V@CaD@ T` *`"   (  x0 20!`0  , :@ @@(!0` @ +    ( @ ,@ + "  (`@ @Z@F@ Ò   `O`2JT J $ @J<* c\2+ 8.􀠠*򀠠/>"*8$+ J`<+ `` @c\2`*8.􀠠*򀠠/>+ + *+   8*8 `㿐///ے㿘 @b Nt`tXtPtHt@t8t0t(t ttttsssssssssssssssssxspshs`sXsPsHs@kcuu1uptakhtsstkentnlkcuf1ndkcub1lekICimkich1ickhomehokrmireikcud1dokdl1dlkdch1dctbcctkclrclkelcekedcdkcbtbtkil1al%s$<%d>hardware tabs with a width other than 8: %dhardware tabs with a non-^I tab string %sunknown capability `%.*s' in ko stringko translation table is invalid, I give upno value for ko capability %s%s (%s) already has an explicit value %s, ignoring koacsc string synthesized from XENIX capabilities``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~x` ; `Ȁ 2 af( "a@ G "` a쀢 2  f, " @ : "a  `2  R D `h@!@ " "` 8 2!  R H `h @Ȑ  J %`2 4! @  "`8 ?2"8 `, 2! f0 ?2"`, J )`"  R F `h@!@ "`,  2(  J &`"# 0 ?" ", J )`"  R F `h@p!@ "b  Y` J )`2 R F `h@SB?! ?"  ?آ!     +  ` #?"``, ?آ!    , @W "a` : J`+ " J`'  "  "`2  R J `h(@!(@1 "b R?2   J *`2  2  `2 @ p "` J *`2.  R `$ x#  " ^a(  ! b@   "`2 @!( "b  2` &8 ?`@  i  J` m`?  &8 ""@ "`@_2`@@3 2``  ?ݐ ؒєdau@a\h`` `2T ! * @2T`@!0E* @` @} :!T` *` !P@@'`화,?J" @ $2 J <2 J  >J*@`J  ?"*@@Y@T` *`" @{ , |܀ ` a4  `c `"a4 "# `2%  J `   ܀`2 !<@0!  "` !<`2 @&!  "a<  `2 @! "` &@ ?2>#?fD ?28#?fH ?22#?fL ?2,#?fP ?2&#?fT ?2 #?fX ?2#?f\ ?2#?f` ?2#?fd ?2#?fh S?Q#?bئ#R hH fL j fH k f@ l fD} m fhx n f`s q fPn t fTi u fXd v f\_ w fdZ xL @ "bH졐0bH `d  ` @y! "bHacsc string synthesized from AIX capabilities㻈 &t \?Z#ߐ H ftJ  l ftJ q ftJ k ftJ x ftJ j ftJ m ftJ w ftJ u ftJݒ v ftJ ג t ftJ ђ nO  @ "bH# "&t㿘?2 . !"|# @ " @ Ԓ 2 J  2 V   2 V 2 0 `ȤIllegal character (expected alphanumeric or %s) - %spremature EOFempty longname fieldolder tic versions may treat the description field as an aliaswhitespace in name or alias fieldslashes aren't allowed in names or aliases$[]!*?dubious character `%c' in name or alias fieldSeparator inconsistent with syntaxMissing separator after `%s', have %sno value given for `%s'Missing separatorIllegal character - %s@%   ! A!?$,!հ@Z ϰ?@@@` ` `  \ @   ? Ja : `:`.@l`. !P`  @``.` ` c\ `  `2! `. !P`2 !X,`:`@   ! 8Ԑ@Ma0 !a *a!4`?#!8"<"@"!0 5`,$0-a \ @    ,@` `: p`,@ ,ڐ $0-a,0?   :$0-aᰤL " " ,",ᰐ@ | 2L@\WLl,,@z |  L 2}  @  s ᰠ@\11+#'*: `/ "]a@ja0  2LQ8ᰤ: c\ ` @ ؤ&D !@oc\ `@ `2,!0 `;`_2,,",,`:`=`#"5 `,z z  v \`@ p Ma@<!h"!Dn @3Ma@   !!Ő"!DW  5@c\ `@ `",,  N,@  2J!ÒJ`Ma@鸐!АᰒD&D"`#  a@Z*  `: Ma@飐!ᰔ!D"!D"   ?  !!j鑐! Premature EOFIllegal ^ character - %sAllow ^? as synonym for \177Non-octal digit `%c' in \ sequenceIllegal character %s in \ sequenceVery long string found. Missing separator?㿘'H    ; ^2 \ %/ \@}?y!  c\  J ` ?!!- ?2  ,@a` ` !`" y,@o @N? J!. @: & ?Ѐ ' `/-+@7?4ᐐ?Ѐ  \ @ `a, ?Ѐ " ,@A?`j+!̓*` € 4,@ 1,@ .,@ +,@ (,@ %,@ ",@ ,@ \,@ ^,@ ,,@ :,@!"譐 ,@2,@0 2,@ ``XX 蕐"0 @Oa ? H@ a0 7 5 ^. ,@> dT`Tllx㿘  "a!㿘. > @:?㿘9 ?;   5 7'! /a#&Ā &4  Ё㿘1 @Y#Ĕ?#\#  `. > 2   㿘 c̀   #ĢJ@  ?y3  `" r" #Ā`J@ i3 ! 3 % )/&cȰ ! d a $ %a !@B"a4!@C"@  !  &c  % "`Ѐ "c@-cȀ $c@Y3cİJ@`$J` Ā `@Y$cĔccĐ J?` 2 cJ? cĔ *?c*@ cĐJ?` !J`#"&ccc   Ѐ `? +a# J$cāCan't backspace off beginning of line㿘  cȀ2玐""*㿘 #̀ " @ #Ā  #&   ̀"  0 Ā H`?(null)(cancelled)\%03o㿘`1i#! 1d#. #@X* `$ ".N@ P` \%'怢", \ @ ` 2,  ,3   ,  n,   r,  b,  e,  \ `  @,  ^, , @$@XGN@` ",, 㿘 㿘  , '!6 6 6 6 "6 $6 &@Tː ,&  2 @TĐ N&   2 @T&x&   6   *   &   6  ? *2   &      *"   &  "#؁㿘 @(1" @W1"@㿘! #@Wِ#آ @/ 1 #ؐ@@q#ؒ@$#ذ#؁Out of memory?c` % /)  $ @ & ,` ?"  "@ `@&  ( @ , 2 ( $ (`@ @TZ # " `?#   ??  ?"@""@"@` (?#?  cؔ? , " "" @S؀ & ɐ#@V#   @@&? ?    " 2  "   "@  `@`2D ( " $ & < @ ? @ز  @@W` @@"&@`@S & ~# @ ? @ز   "@ `@@ꔒ@ @V@@` ( @?#@ ,,`@2 " " (`@ 㿘@ؒ` 6``J ` * 2` * `&`` 6` ?` *R  2 "` 2 `&` `  `* ` " "`  " ` &`㿘  @  @. $`  . $   @. $ `? 4@ ?@. $ `    . $  ?㿘`@M     㿘 " $  &'  & * 2`6 &  "  ", @  @  @*  @*@?, 6 " $ .&  * 2`g6 &  $  "* .@,  *?  "  @2@2??6 $ & ,'  * 2`66 &  &?  "*  *.@q  "  @"@"?6 &`" "` `" $  " `"  $4  "`2 "  " " $ &㿘ڐ:? , @} 2 * ?  4 $2 $ "    $ "     & "   㿘Ô c " $ &  ?   +     " ǔ!" E "- A ? 6  "  `*   &  " ?6 *6 " ? 6  $ +     2  $ ?6 6 $? 6  & +     "  & ?6 6 &  㿘4A " $ &    ,  @ X6  ), &  +  ??"  "H%" S": O "* 2`6 "6  @&   * ?8 7  $* 2`6 $6  '&  +  ??2  &* 2`6 &6   &  +  ??" 㿘 " $ &  @I,`  &"" @ *  ;@      &G  *@   А͔   Ɣ   + * ?2`㿘 "`" $`$@ & `&  `@  $`$@   , `  @ "  `l@Pn*  & " `&`"`$ u`& "   " $ " h ``"& "`"`* "  *`  $,`$ "`"* + `  $@ `$,`*`* &`& @ M  "& @PA& @;-``֒&`@R㿘@&`& `& ` & `& `& `& `& ` & `$ @O& $ & @O*` & @O*`   & `  *@  &`  6 ` ,    2   &`   6 `"`,    "  &``"`$`&  , @O& `@RV0& x2d2d2dJ2d<2d,2d2d 4 8   P* 㿘 8`e "dMo 0 Do| 㿘 8`e "d5om 0 Ґ,od 㿘 8`d d  oL 㿘  1![!Β1 8` R -! "#,` "hR`@"   "c(u{` c( , 2 8 R```*`"$! $!l "l@N* ` "c Y? 8 J`""!l J  ``8 d#  # @@ 2@ `2`-2  ? * @*`  2 ` 2`2J` "  2 R@ 22@ #  R `22 #  R `22  ƚ` 㿘. .`: :`@ .*@: @ *`:  &**`: :` @Cܒ 76H7@* :  1 &@&@*` *  *  * * 'А "@"@* @C7@- : <` 2,,,: :`"@*`" < " @C*  x:   ",:`"@ *`" < " @C*   *`" < " @C* !h* : @7w!h6㿐. >  '!h 6Ű? c0.` & . & , !l:`@ `2?l,`:   ?.`: `!l@ 6?.:   6? ?+ : (.   *  ` D+A R  :. (R( * @ @ "?#+` 2" S ?@3  3 6S 3 @43  `R`@$yR`= c(*2?h#* @ `8@ "h`8$`"* J `""`8 d, : * *,` P :` *`S` S`(PS= #\S;#`ml 㿘 8$`. :  !l 6F?.`0#.: ` c4;?.:  #$2?J ``.  *   8 8 .  *2@   2  @ 2` 8 d  , ,`,,:`::; m 8J @ 8` P P`一"伀2 圀"堀2 䴀2 * :   l`"? + # (@3@ + # (2 + # (2 * :  h ?*#( 03*#( 2 㿐 7`7!h@ |` 8` "Jl 0m `.`:  =` 9 . : W`WW  `W .WW )` #1` W  `W #` #1`W  W # lA WW #W Wx7W y7 77W "WW $OpenBSD: kvm_file.c,v 1.6 2001/11/06 19:17:36 art Exp $can't read fileheadcan't read kfpinconsistant nfilesX(0((  @ L  (((?`"@` 8 @ 6 8 8?Ȣ`8@` 8  @ kvm_getfiles_filehead_nfiles%s: no such symbolcan't read nfiles`( N  '' 'Ē   @E ?$((`2(0@ &((Ā :((@&((((Đ&(0  @EȚ ?Ā`8 ((@Ĕ j   a'@ _@ 'X`8@ U&#0c@'''@  ` ` ` 2` @ @oH7 А@   @a`) ` *`" ((*  `'Ē @ &(((0 :((@&(((( Ēܔ&(0 '&(($OpenBSD: kvm_proc.c,v 1.14 2002/02/17 19:42:25 millert Exp $($ 2 ` ( @u h&($`  ( @"i @ 6 ` `X @耢`p@ % ( (2Q ( &@O ;@O* @$@   29 $`@   21 h`(@ 8 82' \(  ($ ( ( (($@P6l ; @( "(   @Pm$&($can't read proc at %xnprocs corruptcan't read pgrp at %xcan't read session at %xcan't read tty at %xcan't read tpgrp at &xh @6̰"ɰ/+-')@!8!8H@j?ؔP@  `Ph@ P` ``@0`@0  lT"@@<`?0'H@\  `p5@F'<7 'L@K 0 0$< ) `&@:!! l'x '@(   x@?0C@'?'?'@ 'Đ`'P`@ @ 7'7`7`   @@P,!8!8H@P(!"`@ЀCcannot read allproccannot read zombproc㿐(@Ŗ    @  8@?0. * #+  '@ & kvm_getprocsproc size mismatch (%d total, %d chunks)_nprocs_allproc_zombproc%s: no such symbolcan't read nprocsP( "(@I&(( ;  ?'''   @CJ ?@ &(  @C< ? @;0\ "@Nѐ  @@ "N @M͒"F'!pax''''ܐ@k  ` ` ` 2` @ @' @  @֔ *@ *`" * @"' &(̒ؔ'&(㿘( @Hu&(out of memory㿘@H @(㿘D?=#8 (4`2 (8 & * &(8@ސ  *  & * &(8ϐ "&(4(( 2 (,( @Ɛ &((( &(0(, 2 .( @  &(,.(4@o (4 ((`(  (,@֔( @ ?(, @ #'4 @Ku $@ (0 *`((&(0r &(((4 " "*  @JL`$ $  @`2$,$  (4:$ $(4"@ " "@ "`@!8!8 4@ O 2 N1 " p! #    ?'ؒ ܖؘ @A͚ $#N`1 #@:   ԟЀ   h a8 " 㿘T㿘hinvalid address (%lx)㿐 %?  @[   @M&$OpenBSD: kvm.c,v 1.30 2002/03/05 00:15:08 deraadt Exp $ pread㿘! @%`$"?" @Bpwrite㿘! @%V$"?" @(p%s: 㿘'P'T'XP!!b@@%ː@F[ 0 @ђ(: %s : %s㿘'P'T'XP#ab@@% b!@נ#X@0 (@ݨ@I b(#$  @c`@%%s㿘@FA   b!@㭠 8exec file name too longbad flags arg/dev/mem/dev/drum%s: not physical memory device/dev/kmem/bsd/dev/ksyms8?&(&(&( &(&(@&(  &( >(H&($&((&(,&(4&(P&(T&(<&(@` &(D@IR#?N`  @$S &( 8@I; 8v<  Q``@*  Жp` @$' &(8T@$ &(8H`!@ݐ?T`  @$ ?2&(`I! @# ?B&(! @# ?9&( @# ?&(`! @#ݔ ?&(! @#Ԕ ? &(8ِ `@ @  ` @۔'@  x(   e 2u??### cʀ@2l?2 # 2g? 2c?ؒ M&(<##  #  ( < 2=(<c @@27(<2` 23(<  &(@ (&(D(  䀢@2(< ( ؖ   2(<   2 2(< >(H (< "(D@D&(<(D "?@D&(@&(D?already has a dump headerdon't use on live kernelinvalid magic in cpu_hdrinvalid size in cpu_hdrinvalid dump offset - lseek㿐(<  h?( ?(   2w??c# #ʀ@22 # ɒ c? &(@ K&(D @ (  D  (@  @ >`D ( >(H!   @=Z$"(H (L  "  (<  &(< 2`(< 2`(< "(<"#"@@U 2(<(< "(D@D1&(<(D "?@D*&(@&(D?clear_gap㿘  xX ? @C?  no valid dump header(s)kvm_dump_wrtheader㿐(<`(D   /V?  @W I(<`”??F#(@ c ?''  @@ 2(<` ?"/?(D (@@/ !(@ "@ ?##''  @  (<`? ?2 0?㿘@Cn(`  X   b@Ӱ @'%s: %s 㿘@CS(`   b!#!@໢c@Δ  ", 㿘(  @( &(@<7( &(@<0( "(P @(P "(D@9(D &(@@C,(< "(@C&( "($@C ($ "((@C(( "(,@C(, "(4@C(4 @C@C%skvm_%s.db/var/db/file %s is incorrectly formattedinvalid argument to dbopen()unknown dbopen() errorVERSION_version@?c $@!`   @ #$( " " O X?(R?HL?"` ?   2:( 5􀢨2@I5(bh ''   2"(` 2( @I ?#@і2 (@s8 2( ( @?$(bad namelistsymbol too large㿐 2@@}?N| 0HvB? 2J .1@E`$ ' '  2 ` 2  ` @H   @H   $J $*` . .  .  > &clearing dump on live kernel_dumpmagcannot invalidate dumpx( * "@''?@܀ ( '@ ݖ   P ?invalid address (%lx)short readno valid dump header㿐`   @ƒ >?<X06< D h(?̒ "$@@ ۀ8 @X ^ &"$@@@$@short writekvm_write not implemented for dead kernels㿘(` R  @c ? [0U?$OpenBSD: kvm_sparc.c,v 1.8 2001/12/05 02:23:11 art Exp $_kvm_freevtop: internal error㿘(P 1&(PUnsupported CPU type㿘(D  "a &(   "c  &(    "c 0?( @6 "c 㿘! Ӑ !?! @@Xinvalid address (%x)㿘=#@8(D6`?6` `?*  *    *  ?$ #@F5 a? >`  ?>` *  (  c?+@ *  &(  & X  cannot read pte for %x㿐=#@A(D6`?6` `?*  *   ` 4a?  >`  >` |@ @.? % ( /   `  ( ?@* &(  "@X E 㿘(D       2 8 B   2 D (H@F@F @  fX  ??㿘`  ! $!?@!` 㿘!! %   `` !, @@?, @Ё㿘 c  "c 2@ : :*:   㿘    b`  ?   b`  8 `R  $D`  $$` $:  @D?  @ @ $@D@`@ @  $@$@@`@ $@:`  $D`  $$` $:u @?n #@a@? ?#@  !3@   2 "  S Q 664+@,   @ "@ B@ `@  "@ "@ @ ` "@ :. >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .        b`㿐?  @  ?@ `㿐?"  Z " B"ȁ7ąB' B'@    @q @> . 6`  `6 @3 @?" $%"ȁ7ąB' B'@@ f "ȁ  D'…B'@@ F #dd#dd`Ё B B؉BD# 2@  2*2   㿐    b`  ?   b`  `V  $D`  $$`$: 7 @B  @ $@D@`@  $@$@@`$@:   @ $D` @  $$`@ $:` @??#@a@? ?#@  "4@   "  d`]664,@ ,    "B `  ""€ `": .  >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@.  @@b  d ,6 @4 =   b ?㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@Bf@Bb㿘 `R  $D`  $$` $:  @A  @ @ $@D@`@ @  $@$@@`@ $@:`  $D`  $$` $:u @?n #@a@? ?#@  #3@   2 "  S Q 664+@,   @ "@ B@ `@  "@ "@ @ ` "@ :. >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .         @    x  'ܰ''ܘ @6  ?8  ! *'*`F <@㿈 2  ''   @5 ?`@;_찒   @5ך ? ! "@;v$" ?@傒@;n  "b " $ 㿘'L'P'T'X@QL : xxswufsswap ,rwrqro㻐- 53 #$ @c#  `@ _ @% + J #" @ & @ & @T   ` @L&   & ` @u @ 􀢀J `#@c$`@\ @ 􀢀J `@ $`  Ȑ@C %J #" @8 $`@4 $` @0 t$` $`$` @( +@W 􀢀eJ a`_#@Z$`@ " @> 􀢀LJ H`F@D$` $@䏐!@ а   @ ) @ "`@ @ "%  @Ӓ`а @=   ؐ@퐒 %    @ O 㿘 #`@@    1  #㿘@0 " ! @a # # 㿘@  !  @K  # /etc/fstabr8! # "@ 0#"@R  ̀@<    O "b@b $#  b@ 㿘! # @$#fstab: : p#b   ''''''@@<''c '' @<Ԕ $OpenBSD: strtok.c,v 1.3 1999/11/09 11:19:46 art Exp $㿘 @   2H( HJ  " H?" J  H  2*? " 2HJ㿐` ``   ' "b? `@<$OpenBSD: sigcompat.c,v 1.2 1996/08/19 08:19:39 tholo Exp $㿈`"  `` @'''` @:ǔ  &㿐'D D@:ϔ 㿐'D D@:Ô 㿘'D@#ZD%02x:%02x:%02x:%02x:%02x:%02x㿐 !"  bH#`  #\@㿐#\   `2   @m J: `\@ `2.@".@ .@``ݠ 㿘  ƒ  %x:%x:%x:%x:%x:%x/etc/ethersr+ ethers.byaddrX```c``@#`#\@}@;#@Qcऒ R\?@8] @R0V@OS  J?` '< @:ː , , c@$ @?̀ '̒c@Ā Ȓ@ @8!@  @n  @ @  "b?ethers.byname㺀@;2#@cऒ Q[?@7 @0U@R  J?` '; @:] , , c@헔$ @ѐ쀢 &a@ϱ䀢 @& @7@  @ @< @  "b? 㿘’ ( N  2! #\@ ` " N  `2 N c@Z@|   "b?`@ 2@l@ڒ #  # .@Ґ@Β :  *  . : .  .  `4`4 % (,( ,  ,  ,  ,  ,  ,  ,  ,   , , , @E @ޗ `*@ @9  @5  (,@ ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` %d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dxN -   b0#\@M=7#b@#\#`@M)#!#\#`bX@M!bp@M @@!0aN  ӑ* : `K`!*` €   0,@  ,@L@  @`"+ 0"""#耢 L@ `" 4  @+ ,? @L,@?@L@P!d\\dddddddd<<\\\\\\\PPPPPP\X\\\\\\\\\\\\\\\D\\\\\\\\PPPPPP\X\\\\\\\\\\\\\\\D㿘`&    @;t `   @+$@? /`4 / &/$̈́ C`4@㿀'@;C ?''@+耢 @:&$OpenBSD: auth_unix.c,v 1.15 2002/01/02 23:00:10 deraadt Exp $authunix_create: out of memory Ц@58 ( Q@53!   `@@!@5PH b#b& & & & & $H$ $  $ @$ H0P' '''''@ֆ!@ ے 4@6O`€ $$ @4 $ @7 &  &@& 0!@n`@ @ؒ!?  @7/@H @ڒ   x   @ #@`㿘` $  !㿀@( $` @`   @4$ @   & &   & '@$ & &  & @f `$`@2`8  $`''``@  @ = @Ғ ''  €@ , "  @$`$`@0$ '@ ``@㿘 $@4_   @4Y@4W $  @4Q@4Oauth_none.c - Fatal marshalling problem㿀 $`!@Փ @{  @v 2 @ٽ  @$a  `@$O C`4@$OpenBSD: getopt.c,v 1.2 1996/08/19 08:33:32 tholo Exp $%s: illegal option -- %c %s: option requires an argument -- %c 㿘  !#J`# #"􀢀 *@$#J@ -"J`!؀ `$#J``- #!"$#m?# J  $#:"b @> 2J b쀢-#X?J`c "c#`K ?N :GP <!2a : # "bJ8bc 2"c#J@  ""$#` "#!$#N`: :#` P <b!b@  ?*`@ "b!ؒ`$#"b (㿘! $" @ " ? @k $d C`4@/var/run/dev.dbwarning: %s??㿀  @`!  D !   @ $@!@} $ D D  1!  ?@ '''7  ! 㿘@`@ @` .`  А  *`: ?А *`: ? `*`: ?` `2` ` `  #,` €?, ?".` ,  ,  ,   , *`$ @$.`.@"#,## #<#P#P#h##<#<#<"㿘    @  H  @9"    @ :, @  .",   @ ` :  , ,  , @ 뀤, H㿘! "@ @匒   @  @| 2  @`` \ `2+` `  `  `  +`\ @ +G` E *` \+  nq+ \+  rk+ \+  be+ \+  a_+ \+  vY+ \+  tS+ \+  fM+ \+  sG+ \+ Є 0+> + 9+ ` @ ` \+0  00+ 0+ ` 0"+` \+  M+ \ `   ^+`  ? +`@+ -+ +  +&''''''&l&T&&$&&&<''''''''''''''''''&̝㿘@N@:`'@*``2`"*㿐@*B #\ `  *       *: . \  @2`*.?  ` *`N@:`ڔ@*  :  .@*`"&`N@:`Ð@"*`&㿘 N@`N@8N@N@ "*$OpenBSD: bsearch.c,v 1.3 2002/02/16 21:27:24 millert Exp $㿘@6h>@  $>>2 㿐  ?  @* ?? $' C`4@/dev/tty 㾰'L'D1   #@̒    &"   #'x''@2 h@2 X@2 H@2  8@2 ( @2  @1  @3  ?????'Ԑ ?'ꀢ  /Ȑ @ ??????'????'@3KDD@),L@"+   /#\ ` `H* /"*`@ `/, @( O` ` Ԁ,Ԁ " c@( @ ( , @O x @1y h @1u X @1q H @1m 8 @1i  @1e  @1a @(a "&"@1 a @1%a   4 &" &&"%a  &" 㿘 `   h`''' ''''' '$'(''Ȁ` ``    `` `@2 "b?./㿘  N   @2f?J? / J /"  J /  1 6!!@" J /2"  1 !@0  ?"b $OpenBSD: atexit.c,v 1.2 1996/08/19 08:33:22 tholo Exp $㿘! "2 ! $ @. " ?""$"* "  " $# C`4@$R C`4@$ C`4@$OpenBSD: sigsetjmp.S,v 1.2 1996/08/19 08:17:45 tholo Exp $`" (0@ (`0P$OpenBSD: _setjmp.S,v 1.3 1996/08/19 08:17:25 tholo Exp $" " " @" `&"`@B6 0`$OpenBSD: setjmp.S,v 1.2 1996/08/19 08:17:44 tholo Exp $  0 " 5H P """  """㿠   @" &  g @longjmp botch. 㿘 ` @'P 㼘 ? c 8 ` $  `-  5 @1 `%" . !/@ *`  @ *   ` 2?@G$ &o @W "j $@1  @' ? @+$ @W ĒG`$` <` @" 4& @ &/J@ @ .   N . 0  b`  @ר@ʼ ے @ "` `  "`  "b bf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpap  ` @?ؐ@ߒ "H @3 O؀  `@   "w /-+)L f"a4e b2b`2_    *2#" ( # $@  $@   $@ `8  #\$ P@   @$ &    "" 2```22`" @a 2 4 L  f 㷈  ` @<?@`B "H @3[ O耢  `@   "/ L f4 ` b2`$@֨  @$ &`X   `@) Ȣ``4 L ـ f 㿘 b @?@_  b  b @A㿘! "@& @   @:  @ݒ 2  @/etc/networksr㿘! "@ !@a $"@@? b"b㿘! "@ " @ $"@ "" 㿐 b@   !@a $@@@ y J?` 2'#@! "H@.l, L@ #@c # 2, ""L@/ "L*  @Ya @, L% L "  " @Gᨢ ,@`@7"L\ " ""`  "'$L " *`:    $@.ΐ , @ᨠ " $,  "$L  $"L㿈N 0   N x X2  N $#\  @1, ?:` D , :  *??  N + :  . @  $@` #\ ` 2$@?$@`$@:   **   x" '" "  @_؀ ?  '㿐 @?.@ .  ?#@.   ?#. ` '@-i  㿘 "쀢`   @L  $b "` % @@ $b8 $"5 b* @*`@*`@"*` '耢 "b@*b * @*`@*`@*` @*$" $"@ $b*` *  *  "* @&b% C`4@$OpenBSD: pmap_prot2.c,v 1.4 2001/09/15 13:51:01 deraadt Exp $㿐 `?'@ @ '@ײ    @  @!∀   2@ @"?'L'P7'T'X7L@* '' ''@ L?  *@*E "& "&@*'&  "b?FFFFFFFFFxFpF`FPFHF8noopaquenodumpnouimmutablenouchangenouchgnouappendnouappndnosimmutablenoschangenoschgnoarchivednoarchnosappendnosappnd㿘@) . !``  ,+  *    * @ `J@  @`*J@  * .  ߑ+ * ,㿐`2&@2&'5+L@ 1! @ܶ  2  `@ܫ 2  `@ &@  & ڤ   @scТ 2& $OpenBSD: swab.c,v 1.3 1998/02/10 02:19:48 deraadt Exp $2":J  *@`*@ `: DJ  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ `㿘 "@d `   А *`: ?А *`: ? *`: ?ɀ`2    #,  €,@` ,  ,@ ` ,@`@* $@*KXKdKPKtKKK    *`К . *@  ` :   *`*@` *@` *  *@#$OpenBSD: authunix_prot.c,v 1.4 2001/09/15 13:51:00 deraadt Exp $㿘@ԓ `@d @0` @+`  `a` @     $OpenBSD: xdr_array.c,v 1.4 2001/09/15 13:51:01 deraadt Exp $xdr_array: out of memory 㿘@@ ' @ 28 @- @   % @'ɐ  &@!@Max @*В  @ @ @'@&@㿘 :     @ $OpenBSD: ffs.S,v 1.2 1996/08/19 08:17:58 tholo Exp $ "2 J "2 J   "2 J  J  $$OpenBSD: xdr_reference.c,v 1.4 2001/09/15 13:51:01 deraadt Exp $xdr_reference: out of memory 㿘@ @   @'  &@!@` @*  @ @'&@㿐@@ '@P   Ė&@  02  "2 2 $= C`4@$OpenBSD: strmode.c,v 1.3 1997/06/13 13:57:20 deraadt Exp $< ( b("" c4" p ?" d ? l0 "  -  ? s8" w ?*@`! - r*@`  - w*@ (@@` 0 @ 0  - x S s*@`  - r*@`  - w*@ $` 0  0  - x S s*@`  - r*@`  - w*@ " `"   *@ "   *@ - x T t*@` *@*`$ C`4@$OpenBSD: heapsort.c,v 1.3 2002/02/16 21:27:24 millert Exp $㿘`  "b?@% 6`? -&   ,,-`@+  6 @+ 4ݢ2ت`k@+ @,` @+| @,`  # @+l   @+]-  @,`  (5 : @+G@+C  6  @,`   @,` ڨ@%n " $" ( H @K D% * @,`@@,`@*` ,  &, @& @/? (* @,`@@,`@*` ,  & , @~& @v 2?* . @m. ?$u C`4@㿐1"07   5 ;  3  &(&b,&"#'b #$  .( > @?*    (@ (   (. @?*? (  0p HP  .@/@.?$   Pȶ  .@/@.7$ Ȇж ./$   , 㰐' ͆㰞 ņ㰺 ,㰔  , "''@#  # 0@4("(' p@4(@'@(#ײ`` ʐ  P  ݄㰞   ՚ 㰪  ) ! "@  @  "("((@'@('$"   " %@  @  b,b,(@'@('` 􀤠O   .$    ( ( . '   (@&@$ . $(   $  $      2*`0" 㿐'L`'P   ' '  0p'' 7 㰇7  㰆@7 7 .# /  @4. 954 @@  ;@ 4#@  @. @   @ @c@    c)>' ~!~      6 . ( 0 .`@.  @6  / 00@@ @@/ 6 ?1 #6` (o  .. 㰄3 . c@ `?   ņ㰷3 3  c 3  +  , 4 * 4  #4c %/ L 㰄  @   @P  㿈"`h֐ / / / / / / //''.@.`.`.`.`.`.`.`㿘"`2 2  3 c  @  ن㰘#6  a" 6  $6  *@ .  a &0`@ * ( 0` a*  0` !,@ ݕ(`#   # . "   c0" &c  cp"#     <c @3 @&5 -22 5 -@ !a@2@ 3 @   ޖc@ 3 *a @ #3`3  @c@ ߖ 3 ߲c@3`  !   3`3 c@ @ @#  ` +`   @ @$@ $$$   㿐" *        * $ $*  㿐"`L "   #  + @ @ @   $` ?"  (( +  @ @   ,@ ($OpenBSD: rcmd.c,v 1.41 2002/02/17 19:42:23 millert Exp $㿐 #\.`2`@dRSHshelltcp%urcmd: socket: All ports in use rcmd: socket: %s (invalid)connect to address %s: Trying %s... %s: %s %drcmd: write (setting up stderr): %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: accept: %s socket: protocol failure in circuit setup. rcmd: %s: %s 0\'L'D'P@"'T  @"! L b@)!  .``2 @D@j,` !@b  4`@  DLP@T@!ظ4` @  D??@ ??Ș '''@r{ а? `! #@O!D" '@" #''  c@ b 0 ?X' =" ` 7/`` !#\! @k HH7?!bX@e @ō%`/`!` #\@O HH7?bp@K`  ` @-` # !⨢a@"@1!`@: "  " # !!@b `#!@b0@`  @!u @l?0-@`@L` q`@^`2 b@ '@!'@ 2 `* @V  @Y @@" @@" @/ !#!.b@6 *   +6`& *``+ &%⨀@   @ : ⨀  !#!b@|@퐒0!@튒b@ @`   #\  @i  @ @@ !#!@Cc@Wn' '@  #\  @=   @Y#@T! !@4c0F@"LL @@!PP @ܐ@!T T@֐ @ɔ  D @#b!a@#`@ O @   @ O`   @ Z @0 @s@@@l @ F ?0p  ? ???'`'ܔ@pԀ ?0@% 0Ԁ   @P   2 @?㿈  ?  ?//'@4 /etc/hosts.equivr/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writeable by other than owner8  !@a0 `@v @[ @ߐ`2V?"`"O?@_͐ I @a8@@h @1Ia0@@1B`2@  #!H<  !`T`@  !` @!  !  ""@㉐?㿈  ?  ?//'@ 㾐@!? # * ( &# \ J ` `H*   *J   * ŐJ  2 *J      J   #\  J `J    * *J  @ 7 L + -L   @ 56 @ɒ -   @fA& L   @ ?@    @f% @N @IL@ + -L`  @`0 # ` @f L`  @ `` @e @ݐ  ?@֐`?  ?   @ 2L?h !#\ /ؐ! @ƚ 29    ? ???''ܐ`'Ԕ@nԀ  0#@ 0 Ԁ Բش !/  !#\ @ 2  @π   2/@ rcmd: address %s not listed for host %sh  `#\*` /! @p 2Q  !#\ ! @c 2D    ?? ??''ؐ`''Ԕ@n$Ԁ  0-@0*Ԁ Բ !/  !#\ @8 2  @   2/ a8 @@ $ C`4@udptcp%d㻘 \2װ?# @    @  *`@ İ? @" ?  /`,   #@#H@  `" @@ 8?@@< ,`P2"@@ p@+   0: < @ 8 22` 2`*`        ?#@2  2   2     ? ?  IG  2D? /@l" 7?@2 @Β- @G  @!@ (@?@ "?  @  0@6 ? 㼘 @)" '?@`@@ `@!   ? @ %@.*` %u㿘 ? ?  ? ?    @6 " @  @  ?㿘 b @!@C b `b @͛ b @㿐@   3  `" ` 2`22  @9 @&b$j C`4@$OpenBSD: rcmdsh.c,v 1.7 2002/03/12 00:05:44 millert Exp $/usr/bin/rshrcmdsh: unknown user: %s localhostrcmdsh: socketpairrcmdsh: fork failedrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: setuid(%u): %s /bin/sh-c-lrcmdsh: execlp %s failed: %s 㿈`!!@[  !!!a@?@a   @Eg 2@?0&   @ !"@6  !" @%?0ys@@? ! @?  !@"8@ @5 !@ "P@ @ @,  "!  b#!!a@"x@Ɣ@ڐ @̢a  /@̜ 2 / J  !" /@O  !@?  @O  !⠘#\@? b!#!!@ub@爔@ @@r No address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): x؀ N   @'$ "b '' @!b@$$  "" $:$$ @  Resolver internal errorUnknown resolver error " "X""؄D* 㿘? @J $OpenBSD: rresvport.c,v 1.5 2000/01/26 03:43:20 deraadt Exp $㿘@ 㾘@!``  .  /("b,  @ &!?4@c44@ @  "`0 4@, @~?@$@C?㿈 ''@fВ 㿘 a ! @ @ !  "bN  "b 㿘 )  @% ! !@.  @ِ "$,` !@B @ @@ɐ  @Ő  "㿘 @@ " @$1 C`4@$2 C`4@$` C`4@$Ä C`4@$OpenBSD: strspn.c,v 1.2 1996/08/19 08:34:26 tholo Exp $ ` (  *88 " (" $ C`4@ x@ѐ#cpؔ  ''''''!`'@ 耢  ?*** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%x`> @5$ !   ` @  2` "`@ `@q$b@@Ő @0%d㿘  "  @ɾ  2 $c@1$#؁$OpenBSD: strlcat.c,v 1.8 2001/05/13 15:40:15 deraadt Exp $㿘 `"@ J@ "@ 2N@@z  @ *@`N &*@$OpenBSD: system.c,v 1.4 2001/09/04 23:35:58 millert Exp $sh-c/bin/shx%%!pax?' '> ''@Ӑ @=? "   @Ŕ '? @  b%!@=@f @x  @t ܐ@=  @ @g @d ??܁% C`4@$ C`4@㿘   ` @4?  !$ 㿘 `` >@wO"`$OpenBSD: sigsuspend.S,v 1.3 1999/01/22 06:07:56 marc Exp $ o C`4@no errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failuresystem errorinvalid value for hintsresolved protocol is unknownunknown/invalid error 1&d(%+#%(#%%#&" & 0& `& & & & & !& !(&!8&!P&!pH<0$ $7 C`4@$OpenBSD: realpath.c,v 1.6 2002/01/12 16:24:35 millert Exp $./8!&#@  # .@ `.`N . N  2&#@$ /@J @`& #@(*`J@ /"*`@0ݐ &h! LL '@ђ #< (@ 2   >M"b@# G! .@@ @0 <&#@'@@$ "2! N@ / N``?O @r@o $  ?"b &c@S@P@g  " @  ! "@Y@ $" /   `   "b@ؐ# #  /,&@@@0Đ "#.@Đ##`' .'-@!@I-`d ' ""' ''@( @"ʠ?! * .* '@Ґ @ ' .- - -@G |`@ u /-   @ b"@.$?#5 @ T"L` .2 `L` `  ``@@̒ ""'"$` `   `c/`@j "&@&@@ 2 `? /, ``$ @@4-f' `'" '"``@'`@" @ `   ` $  @@ @<@: <  "  >(` :`@?? D8 >` > >> `` "`@`  @㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @@?@ kby@@?@ژ 2 8@Ę@? c3> ?'"`. @ . "@2 &  : +   ; &   + : :&㿘  c\#% .> @8 @"A @!@ @C @!@  @"@" &@D(@"f  , N@: @` ~`* @w@@@ @  `s @2   " @:h N @  "s@ :[ N@ 2W  hQ  @    @ N @  @ @ (:  `24 _"1 @ :. %@@  " @ :" N@ @  2 @ : @ `2 _"  @(   `_` . c`$ .  `-.`2@ `.> @P@"Z @>0@"W 0@>@" 0@^0 ,,  @ `?, ` ?,   "@ &@ @ @ 2 .` @ @.@ 2 2>, /` " `/` @>, " &  2`# ?#$!" D/  > > /   @ /  "?>&@ ,   :, :[ 2"  :@, ,  &@  ::B "   : 㿘 @ N * @@   + @ N@" `   `2  `      ,  `        `0 "  @?  `c\ `@ ```_` c\ @ `2 _` `c\ ` ``_{   `{_  {  @2  @ @r`& ` `㿘  0@ N * @  + @ N@ `   `2  `      ,  `        `0 "  @X?  `c\ `@ ```_` c\ @ `2 _` `c\ ` ``_{   `{_  {  @2 2 @ @s`㿘 ك( >+@ @( "m M(NR?~@ Y @o@@_@耦 $@  Z"q &( v82rm   2kf e b( 2a\ 2]X 4YT  ( Q J G((@ @0@@0>@@;  7((@@ 0((@@ *(@((@   >(@/(@@.  @@(@(@0(``   ` $  @@ @@: <    >(` :`@?? D8 >` > >> `` "`@ ` "`$@ `$@ Ű 㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @/@(?@ kby@ @?@ 2 8@@ݘ? c3> ?'"`. @ . "@2 &  : +   ; &   + : :&㿘  c\#% .> @8 @"A @!@ @C @!@  @"@" &@D(@"f  , N@: @` ~`* @w@@@ @  `s @2   " @:h N @  "s@ :[ N@ 2W  hQ  @    @ N @  @ @ (:  `24 _"1 @ :. %@@  " @ :" N@ @  2 @ : @ `2 _"  @(   `_` . c`$ .  `-.`2@ `.> @P@"Z @>0@"W 0@>@" 0@^0 ,,  @ `?, ` ?,   "@ &@ @ @Д 2 .` @ @.@ 2 2>, /` " `/` @>, " &  2`# ?#$!" D/  > > /   @ /  "?>&@ ,   :, :[ 2"  :@, ,  &@  ::B "   : 㿘  ,@ 0 ( N` @   ,@ @n `@ </ @ N@`@ "   `2        ,  `        `0 "  @# ?   \ @ `_ \ @ `2 _ \  ` _?{    `?{_  ?{  @ L@ @ `@ `@ @Șa& L@  `㿘  4@ 0 ( N` @   , @ / @ N@ `  ` 2 `,`    `, `         `0 "  @i ?   `\ `@ ```_` \ @ `2 _` `\ ` ` `_?{    `?{_  ?{  @& L 2`@ǒ @ `@ `@ @c㿘>!`+@ @( "v`M) PV~ОDŽ@ d Ş@"x@@n@耠5$@  h"@&("`8@2@ ``2@{ z@u `2u@n 2o@h 4i@b `(`_ ` X@S   @ @. @@O@ H/@(D A@ `@.`@@6/@O@2@(@  5> (@  @@/@@ `.``(  @@@/@@@(`㿘<"e @ @4"E@ `( "`    "  " @.㿘  "b@ ( `&& & & & & & & & & $`& $@$$@ @ g5 a(@ ]?46 `-  @ * J@s`D&`6`6&` $@ * 2``6`86`8`&` &`%   ئ@(@D &"  2 8 $5!0 @ &  $ & $  "b@L@@ @ 㿘`(`D&`$ @x@; / @2`L`  `@@e &`( `0&`&`& 㿘  ` @k T 6 6 @e  " @  @Y@W  $ `@   " @8  $  `@A ""?@; ..㿘 $@3 < `4<@ &48`&8* 2   @ * 2``848$ 5!0 @Y $  " 48&$: "4:*2  X`"  :$ @ 0 @" : "@  " @$ 4 8ް` *$$@u $  @Ԕ? "" : b 4 :$ "[$ $2@   $$@ C$S@T6 2<$  @ $ $ 〢 2#@H * 2``48$  5!0 @⿔ $  " $48: 4: 4< $  J / @  /*@(`@0DO$@G T6?2 @A ""$C $* T62 :$ 22@s&  $ @h  ! " @  $$"@$$$@ 26@? $ $$$   48$ 2`<   ⨐ 㿘`@  E"b $ @>" 8  9 27   "@w@2  $& $ T 6   J`/ $ @& 5!0 @ @& @ 2 @  㿈  $ 'H @;   HH Y  " % S5 82 $ `  ?`  4 ''쀥 H2'@@z  H 2 :%  :`@V5 :'  ' $ J?`/  $B  / *U 6 `'"'    2 `L` .2 `L` ?` ` `@` "%  `@ '@ `@ː  % @@@  5 8 $ & $$ϰ   "   $  '@ "4 6$  ` $ $ ` ` : 4 :  4 8$ 4 8 6$  쀢" $ `  "  $ $  D $ #4 8 $    ($ @ D D$ @  4 8* 2  *`2  $ &```@  2` $`@耢 @c $   2--􀢠$H 29 U 6  6 $ @     @s?  5 8 $@W& $2 H  5 8@N@@G 5 8 $ & $  ?="b @8 $``@`:    > 86 > X>> > > > (> 0> 8> @> H> Pf ``@y #! "@b` 2 &`$"Q @Z  "&`  > X>> > > > > (> 0> 8> @> H> P:  < @ ((&`0 &`, N`D`.6`4N`E  ?`Dc  2`  `2``0"&@`R`6 6`,  @  @    㿘 ( *@$  2 $   "$ @$ $   "    @y  `"`" 㿘`$ H@M   @Z`$ ``6 <& & ( M ?& @@ߐ D㿘@U  㿘 a   "& @C&   ?"b  @U&  2 &   "& @1&     D" "  2 D""  P66㿘   @28   8 $ ,   @7  ?@" ?`0@ `,@  "b ?@ 7 @&⨁$  C`4@㿘!`@˔㿘@+@1$OpenBSD: rand.c,v 1.6 1998/12/07 21:47:22 millert Exp $㿘q@Ebm `9 1 *$㿘# $ C`4@㿐 '`v@㿘 @? @b6㿘  @b. $" C`4@㿘` ` 2 `@   "b?`?` &``@ , :   @ * &@@w㿘'L'P'T'X@4L$ C`4@0123456789ABCDEFabcdefxdigitABCDEFGHIJKLMNOPQRSTUVWXYZupper space!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL(    " @@+!S 4x * @`*`@ $` $` $`@Aj @$`$`$@$`$` И P` `H  " "  ! $ $ 4$ 8  !$ $ $ $ $ ($ ,$ 0$ <$ @@$ D$ H@ ڔ `?$ @:   "@j  @z  @ `$ $@ z@ @ -@ 4 (< DbE$ L$e& & & @ߒ ` "`@ `㿘   @J @:  J@ | 2@  @&J@ |!` & "@   "@ e  " @  "@ Z   " @  "@ L$㿘 @?ܑ* : ` X&?"* € @ @m   D`" D D  ,  " @  @J@ )} )  ,  H" @  J`)a&@: ]@   ( "( `, N"`,@  `( "`( 0 A"0@ =@ 8  `@P/ @˔ *@E& @ @  , &@:` @  @\ @ , :`@ @  @?֐ , :  ? {Ր`  `\ ` &@ , :  +"(  ? *"  , {J"@ "@b "@u "@V{"@h "@In "@Z "@;  @}" "@2  @t $@) N@r @J@ ,2`& `\  !@\@@E @ @:  J@ }2 `&@ :J@ }"   @ &J  }  @ @ @  @  @?֐ , :  ? {`   `\ @ Hhhh hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh0|㿘 @ @ &@ *J㿘   @ J@ ^2 `&@<  `( "`( , ", @-  @  ` :J@2J`` & @  `( "`( 0 "0 @B 㿘J@ ``\ & @ @2   a&a)xa{`." `[`*`0 a(&0 a}a9a1 ~a?Z0} `@Jy @Ŕ t@?p@ l  D`" D D  ,  " @ @ `  J@ \J` ) \K )  ,  H" @ @ ` J@ \ J` )`)&@ %,  H @k `@O@a @    "`H@ @ ~  @"J *  &"@Y "@: "@M "@.w p n`$J \j`$J {f`$&@g @ J@ ,` & `\ !@P @9 !@ @ ` : J@ \2  J` }2 `*&   : J` &` :J` \2J }2 @ @  `$  㿘  #\ @ ` `. J* ?а  `  ` . ` @ƒ [:<:]][:>:]]㿘@ǐ    Ab@x  2&   Ab@i  2 (@_  & @: J@ ^2`&  @:J@ ]2 `&@ ` ] *] ``] @:"J@ -2`&@ ` - *- ``-,` ` : J@ -2J` ]"@ @ :J@ ]逢@  @:J@ -2 `&@ ` - *- ``-,` J`]&@-   s ` ,`?,"` %@ `@ \ `"?@* :  @ `@* ` ,`?<@` @K- `?, @ `@" * * `" * ` ?,`  `" ` @ ` * * `?,`` @@ݒ  @’@ߐ@P0@n@| 㿘 @ J@ - [    * @ 0*:  : ="40e   &@ J - ]@ @ @ @y  @  `  J@ :J` ]3`@f 0m   &@] J - ]@S @ @ @I  @ ` J@ = J` ]`?&@3 0:@ @ J@ -2` :J` ]"&J` -`& -@, *`: :`@@  @ ` * `@   .`㿘  #\  @  &   ` a"` @  @ 2` @J`2`@ǒ 0!L  @ `@* ` .`L `  `@Ӓ@ L 㿘 =@L@ ` + `@.`㿘 @ @   ` :J@J@ [2 J@J` .2J@`$J@`$ .@ @ ` J@ . J` ]`$@Z . > 㿘 @  ` : L@2L` ] ` &` :J`2J ]2  a" a@@ 2`@J`"N``@   @ 0L@\ H* : (H㿐 &  ]&///+& &㿘 ` `8c\` ` ː* : ڒ0@`   `4, "`4㿐 &  ^  ]&////& &㿘     .  `yE!*` € $" r&  "@_`Ԕ  "@;  @}" "@2  @t $@) 0M "@; "@  "@^"@  @U $@  ` @ 0% "@ "@0@ِ~0@ϐt0@ `4\ ""  " " 㿘   "    _ `& 4 @   @,  "`@,  2  @` " "  ` "4 ` @ !"`@ܒ 2  @` "  "  , `  :`@]` @$ ` " ``%   @ @       -   @3:`$   %  * --%% `  (  @ (*@   *` 㿘   *`   7` 2. * @% @  @ ` @  @ @@`@ ` @ @ `@ @ @ "`@ *   &@>    `@ @" * :       `@ @2  㿘`@`  @&`@ @  ` "&` @&`  0 ?@&` ` ` *? ,8    ` "     ,8   `  "     㿘  '`8? @  Œ `4 &`4,@ @ 2  ʔ 2,@  $ @ $ @㿘  @c@ .` *  @ŕ. @$ 㿘      `2`@:`*` @E @ *`"`& 㿘  ' ߐ ,   H.    @ "@ @  "@ ` ` "@@@ߕ* "@    (@> "@㿘   @.` 2& ܒ 0& 㿘 &`  @*` &` ː &`㿘  w `  >1-+)'%#@ `:0`@ "3 / &`@" !`@""c>$""`@ * @@  2`(  `@$ &`@ 2@`@ $@E  &`<&`@ &`(`@`>@ `@ `*`*  ! `>   4  2`("`(㿘<"e@& "4"E@&  $@   " @  " <@ < @@$$ C`4@%x.0.%x%02x㿐!   !77Hb8  @@C  ` @ @*`@2 @, %H@Βb@ HbH@Ȑ`@,'HL`  @ L 2  @P@*L@6 HbH@@ aJ@ @ υ(85 I<( @*@  `J@ @ H*@`*@ #########$$$$$$$######$$$$$$$$$$$$$$$$$$$$$$$$$$######%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%u㿈 ! +   *` *    *  !p I @ #\ a#d#`#h@㷘`&`&&~@  & && ,` ( 2 :$2  2 `   \2 2   \? 2 :2  2` @0@㿐 {  }   @ " @’ { @㷘@ @`2@ 2  " [ {  ] 2  "   }`2 `   〢 [` @P&@L@ [ { ,`>` }`8``@ ] 2`@ "+ *`'``#`," ` 2   * 2` * 2`Z&``@(@& HOME㿘 ~6 (2.?  *@`@  /2*@N @L J@@! @; @4& "%  @2Ő 2 *: 2`J@  @: 2* 2`2㷐'$@`a  `? *`]`?"D` `[`*C `M4J ``!"   [@ ] 2   [4`!8 6`[4`! `!4 `- `4`-  `] `4 4 `]` 4!&` 4!&` ` !&` ?"44 `4@- "@` 2 #"?@  `- `*` K #@  㿘@Y@㷐  #\#`@  (\`  : /6@ܔ " a "$  /;< 9@(@2 @۔ 2  2  @ /? 62@ `$ @4  2 `3@  /22#\  / 8  6 /  #d#h@#`㻐\`dhe 6' $⨐@I 2  @$ Q?€ J? "F 0DC @ /41 )# .` ." @4 ` @ ? 6#\#`1 2  2J` @@0@㿘`@`` *  @)@` ` N?@J&`  `` *`@,&`?$@&`  @ `"@: @@& @ "@@Ր?` * $@`&@@` * $@` @   #@ "" ?㿘@:a `?`]@ @``[`*@ @I@"D"K  "B   =  ,  * 2  @`! `?`2`@`* - ]@ @ 2`@( `" @`* @  ˰ @*@`?㿘 ` * ?? @@ ?@<?`@7 & .㻘  @O$  0M! 7` @2` @@㻘@5$ ? @2$@`€㻘@$ ? @2(@X€    (*@ ` 2  㿐@v  @  `2V @UV   6  ?`" @ V  @ 6 􀦠" @ @! # b?逢    @ @ڔ!b@"  @  " 0@w  0& & && & ` &  @@"& 0@h & 0 D & 4@a& D`& H6 $b&  @ @m @<4444 x`̔6 6 & $& ,& (& &   @ $OpenBSD: setenv.c,v 1.4 2001/07/09 06:57:45 deraadt Exp $㿐N@ ="`@S@? "w @H*7@* ,`` i  " `  `  `@ *` *,`$ `"@*   ,`@$ b" 'L% L  =2 $@즐  *`" (?`*`* : , *`: ,   =2 =,@ *`,   @* ,``  㿐 "*`  "  "@ $ C`4@$ C`4@$+ C`4@$/ C`4@$ C`4@$ C`4@$OpenBSD: getrpcent.c,v 1.11 2001/09/15 13:51:00 deraadt Exp $㿘1   @$& 㿘  @/ @W  @;㿘@ 0@c  @\    @4 2@r㿘  O" @na$@o  $ 㿘  `   @Ԑ $㿘 "  2 O" @na؀ &# @l "  @@  # 㿘l `Z @$ ,L` #Oc@p'  O .@@pc 2.@>$``N@` `N@ "` "`@i$`$`@p "&$.@``"!$N@ @`*`:    $ @o " $.@``"$N@ @$㿐`w@ ? ? ? @  gc" "" " `@ 2@<@ #  # .@@ :  *  . : .  . ",",`% `  4 `4 `4 ` 4 4 4 @9 @s `*@ @-  @)  4@ 4` 4` 4` 4` 4` %d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dxN -   Pb#\@%7#Pb#\#`@#!P#\#`b@!PbЖ@ @@!0aN  ӑ* : `K`Q!*` €   0,@  ,@L@  @`P"+ 0PP""P"#耢 L@ `" 4  @o ,? @,@?@@P!DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD㿘`&    @\ `   @$@ϒ? /`4 / &/ @ 7'''L'P'T@'XQc'''''@L     @ `#\ `  % ?& &   4@ 2@\ @ `2 @2   @ xe`U ,  €  4@ 2B @A` ?& & ޤ@ l2ڤ`פ,* Ѧ?V 0 > V# 8 V3#V#/ - @@& @# V#   2@w2s"?\ `VV 0    @@ ـ@  ? & &@} 2ɰ\ @ `2  8B@U ,  €"   @@[& @$`%@$& &@ @ٖ "?/ J #  ?& &   4 @$  "n0 L`  ?& &  a@  4 @ @J@0 L`  ?&  ,@&`@"=,@"? \ @ ` ?&  &  4@̐ "\ @ ` ?&  ,@& `  4@ "$@v,@8!H ?Հ`MBT#P*` €` ""  #l-`R  #l-`R `` %   @  ,@ `? &  &@[ 2 @( @  x X@s$@,@   x: p2l"8!1 ?Հ`:+T"d*` € "   $ !,@ `? &  &@ 2 @(7 @@@. @ e E@ @@$@,@@ 2":"$@ "?0PQlPPQlPPPPPPPPPPQlQlQlQlQlQlQlQlQlQlQlQ QlQlQlQlQlQlQlQlQlQlQlQlQlQlQlQlQlQlQlQlQlQlQlQlQlQlQlQlQlQlQlQ O@OO@OONNNNNNNNOOOOOOOOOO,O,O,O,O,O,OOOOOOOOOOOOOOOOOOTOOOOOOOOO,O,O,O,O,O,OOOOOOOOOOOOOOOOOOTKpLM|NPJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJI$JJJJItJJJJJIIIIIIIIIIJJJJJJJJJJJJJJJJJJI|JJIJJJJJJJJIJJJJJJJJJJJ4JJJJIIJJIJJXIJ@IJJJIJJI @^` @ `  ( 6( " * @- `]** @]6` -* @ 㿘@R 2 * $@Ꝓ% &&@@ @@O&$@ @8@"@&&㿘;'Dc\'H  `-+L  L0 L x XL )0  ) #?)  >P    $ `%E    7 G "T @ 4?@  @  ?1  *&⨔<@  b 41@ @  1?#? &⨔<@ B   c\     H  DH"@㿘/\  `-+M  M0 M x XM 0  >?ڒ? ?@?   ( 5 ! @ @    ""b?? ?{<@ B   \    Ӧ ̦ ``` '@㿘 0 @2 4@$ $& 0& 4c  @,@< @& ,@0  @@摒& 4&& 0 ?㿘?,  `2` @ܘ` 2`0  " ` @) E?` &` ?6` &``  6` `0  ``4@& @ "@-?&@*` %&`` ` ?߀6` @@ (` 2 `` &`&@``@@ `B &`&`<&`8&`0&`4&@.`B$  C`4@$OpenBSD: fork.S,v 1.2 1996/08/19 08:18:06 tholo Exp $  C`4@"` $ C`4@$) C`4@RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdxXa` "8''@#  @ag!''T?XX'`'d'hl'   * ` *J`|`:2 p*@Xx@XĒ@  X@Ԓa 2X    X@Ȓa 2XX $XX@ : XX $XĒ@?"XĒ@$(XĒ@$0X!@$,X$4Ē@` @` 4Ē@m?  4XĒ@cT?20@,$8X@VX?24@8$<XĒ@I?. 4HX@?? 4JXĒ@5?  4LX@+? `4NXĒ@!\? $PX@`? $TXĒ@ d?$X @h?X(XX8"0XXH$"@X  `(/7X"0X  a7X8/ '/7 `@/7X"H b7/ʠ /////@̔?8$$@”||$ @x? x $ Ē@t 2 t@ , , pĒ@?    , @~ @3, `*`:  p  X. P : ?4P "7/ 0Ĕ/@w? l`*`$:  4   aW$@8$㿘@  @@aȐ "&@`@ 2@c\ ` > @_ 㿘 1 #Ԁ " @ &#"# @2! `@$#В 怢` "# #"#ؐ @n ?J:   JJ2JJ@:  :2J0 2J J@ 㿈#\?@ %s.dbtc㷀'X'D'H` 'T?X  # cԀ @T ! #@k$ #Аc@#' dȦ`@\$ }      @k A'Z$@#0#/!`+   @> #T@C ` @@P@@# D@Ȕ @ H"D"" @ h '`9 .M@  `(;,L \27, , %$@0 $@ 耢  @ '"?@*M@@ $ 4̨耢 @ߐ ̶? , L " #"T@ 2ݦ\  @> 2Ԧ ` P` @Đ`??x  ?L: ,?#\$ ? 耣 @،@ߛ0" ?2 :,??L %L  : $ " ''L?`: :, '"@ #@%$@߈$&@ '@c耢 @L@[3 @$ @3@.@G?Z8^ = X耣 $@($H"@L 2 @)  ""b@ ?0D#@ 㿈@K''`?''  ? J ? ?  &@J `?  JJ|:? ?J:|?  㿘@@㿘1 #܀ " @&#   "#"c" r|:㷈 #䀢`$c c܀   c\@ac r$% Ԁ`  ؀ ܐ "P @a) ܀`` @W@x c$ܐ`$c` \ 0@aac $0C*? "##\  `   *:  : ##  J?`\2## ##J?`\2" "9,@ $LJ  : \2$@"%@ 'h?0; @ਐ ޢ@ @` ܀` ` @@ $ܐ*?\c @'@, #\?N    -㿘 = ?@ݼ d 2N? dmS*2Q* N :s "q*А  ?  *`* Б: @  N/7$*`*1* : `2$ ^ *` € * ? *? *? *? *? * ? :*???*?  2N"@ݘ`d 2  ,?@u(? dN :  ^ \ N`:`2 *" @s 2  ?@P?&wPwwwwwwwwwwwwpwwwwww`wwwwwwwwwwwwwwPwwwwwwwwwwwwpwwwwww`㿘/ = ;?@ d 2L4? d  `"@@ d 2 `"?@?@ dL : 2*@*@`"@@ 2 `?@ڐ?&㿘 # 2N@2? 0  `N@ x X `    @k`@А *`: ?А *`: ? *`: ?& 㿘N@ :`N@ :2``@.`.`$OpenBSD: strcspn.c,v 1.2 1996/08/19 08:34:15 tholo Exp $   (8 J2J " $| C`4@㿘  @^ $9 C`4@$OpenBSD: random.c,v 1.9 2000/04/04 14:27:00 millert Exp $㿐"`"O"@""@ - #)|b,  ##@@l+ @ +` *`" *" *  ** " b"@ "@    b#*` *  *""쀤  "b@ *` * /dev/arandom㿐b   "*`_"X @$ ? "@ڔ @Ա@ @;  z?@Ԡ0  #*` """㿘"b  """@ :`*`  "C "# $"#"b?        "#" $"  ? $""c#" `* "c $b"b "?"b"@ :`*`  "㿘 @u @Ћb " """@ :`*`  "`4. `,`"X bD@  ""#    $c( "@:* @""* @"㿘"`"q@bm `9  * $! b@ "# 2` bb   #bb  #b"#b$OpenBSD: ldiv.c,v 1.2 1996/08/19 08:33:35 tholo Exp $㿐@@'@ߒ ' "`?$$  /bin/shsh-c㿈'HN@ r'D w HJ`   "bn @[ ' g @$耢 @u 0]@2?` H耦 "`@d @6 `@2耢 "`@X @*```D#c@U @۫  r@@0@H@ " #"`"##㿐@  c    2 ?'  @ǔ ?⨀ " %#$@??$Z C`4@㿈P 'P'T'X'L   +  ?#`L "@  "` + "@ "@Z㿀P 'P'T'X'L   +  ?#`L "@  "` + "@@3㿈P 'P'T'X'L   +  ?#`L "@  "` + "@@1㿘 "@?PATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin:.execvp: : path too long sh/bin/shx  N   "b@ / 'K- b h@ۃ b p@U  ?#` '  u"b@ob-   b @>@;$bb `Д  '''''' @- Ab@ߒ /,`@ߋ, "@{`=6b#p*` € @  **@`2*  ?#`b`$`* @`$ bb @S0 b`@#ܨ 2M   %?,hhhhhhhhh(hhhhhh,hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh,,$; C`4@% C`4@$OpenBSD: Ovfork.S,v 1.2 1996/08/19 08:18:01 tholo Exp $ B C`4@"` 㿘@ " $Q C`4@${ C`4@$OpenBSD: index.c,v 1.2 1996/08/19 08:34:02 tholo Exp $*`:`J   $ C`4@$ C`4@㿘'H'L'P'T'X!`@H㿈`  `@''''@$ C`4@$ C`4@LC_MESSAGESLC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALLPATH_LOCALE/usr/share/localeLANGC㿘@ ! ! 2 Jc@#0 $!!J`c#@$!̀` ' 怤1, Ȱ  `  @nM` ? N@ B! ,@@ J@ `@ٽ cJ@ `c@ٳ#X cJ@ ,c#`,@Y p   , @ٜ "J@ @E   ` Y , @8 P@~ / 2N  #  @( ? = /  N  /" N  J #, @&4 @ N` `/ `N@ /"`@ N  /2 `2&   #, @m  @N    `@D  2  ` @ %s/%s/%s/%s/%s㿐`   Ъ@m~ࠢ )d @  ##\#`` В @(@ Т``  ЁPOSIX%s/%s/%s㻘 #`,` @ #cc`@ dc@ @m@0 ,`  d!Ș@$` `$ C`4@$  C`4@-_/㿘*`$ #e  А :``@} 2  .2 N .2 *`  gethostby*.getanswer: asked for "%s %s %s", got type "%s"x @''܀  "" 0  `#`?c$ '耢'`    @K9$ e`@쀢 `    @ @"'' %  "T'"bb""""T  2?0 @K e`@쀢 " @L* 2 @L* 2 @L* 2 w 2u5 2  @ @JӘ$ e  %@@أ  `"@?@ؚ @ 4Ԩ @l4@"''%(%@J$ &  " @u @ 4 @l'ܐ"'' @C @C@Ce %@\j : 07 0@U܀  %!7@JV &l 쀢  e  % #@%@`?U @ @"'K'@Up쀢   %!@\@ @2  @% "@''  " c '!  "܀@ ' #@C"'@ ''䀥 "  ? 쀧 3  !d%@` "  "T@耢 @נ @  @k:@"%''   @ ""  "b 㿘@k"   `  @N? @(   @  @  @jbbf㻈   ` `@N?`@` ?       /""   "b  "" " @{r . @02 2 #\ ` C/N? ."> #@SY ! #!@}ܐ`  !#$"bT''& bT & #`@ "" #\ `.2 J 2 J . #\  `D`@{ : 2NN :2CN &N? .; #@S ! #!@}  !#$""T''b& "T#b&  #"^  #\  `D`2 *:  : . J 2 J .  "H @ O  gah@S   1 L f"  y b 2`2@ @.v$  @`2L Հ f%u.%u.%u.%u.in-addr.arpa%x.%x.ip6.int㷈"@i   `@Mf? @א)`&    ?#@"           ?    /  ?  ""@ic - , h a  @i- ! +h1h 2a@i "" , ,  ,  ,  ,  ,  , , H@ O耢  gah@RҔ   Q - TM f"= y b ;`29`26`@1  @-1$ '/   #& & @Ԕ%T%   @L  & &  ""@*`` M  f@h/etc/hostsr㿘!!Ԁ ii!@Ta$!@U "!؁㿘!!Ԁ !؀`@ِ $!ԁ 㿈!Ԩ` + ii!@Ta耢 %! ?!@Tf  %b J?` 2'#!! #@5, N #ߐ@y, # 2,i @V+bp  #, @Q   @Q    @ '  '  b   ! ""T"T""" "L)   L "  " ""`&" @Up & ,  !L  `*`:    @$@`@UȒp   ,   L      $@$''"@f%b"㿘   @   @ 㿘  0 @Q   "   @Q 2 㿘 "" "      @  㿘  bb   " " " T #b   " / Lai @U>bp Z ,%@O L  jL "  " b@U$  bL " , b耢  %b@ϒ  #@$@`ð $bL   #*`:    @$@`@Tp  b,  bL  b耢 b$@% %u.%u.%u.%uhosts.byaddr㿀 ""䀢`  @Q 2 *  k ` @g?' L L@("#k`$L@X@h 䀢  HL   "bhosts.byname㿐@<    "` "@Pِ % ! % P P@"#ka@$P@gԚ P   "b㿐@x  .@?` .@`.@`@k 㿘  , (   & &    @ &@ $&@" &@@$@ `&@?&`2@㿘P  @ '  `~ /   d .@2` 2 ?(R& `@  `.. V?V 6?6@?`&@&`@ 鶇$OpenBSD: bcmp.c,v 1.4 1996/08/19 08:33:57 tholo Exp $2J  J@ `2J 㿘 (   "b?6?@I @2 P (    ? 2 0    : @  0f  < :@ f  "  :@ F㿘 $OpenBSD: strsignal.c,v 1.3 2002/02/16 21:27:24 millert Exp $㿘 @6c$OpenBSD: __strsignal.c,v 1.6 2001/06/27 00:58:56 lebel Exp $㿘 逦  @ے  0?,@  @Β  0,libcUnknown signal: 㿘l#@u  .   @t@x 0l?㠔 @t @x@џ "@x@t$OpenBSD: strcoll.c,v 1.2 1996/08/19 08:34:13 tholo Exp $㿘@ 0? (?#$OpenBSD: atol.c,v 1.2 1996/08/19 08:33:26 tholo Exp $㿘 @RԔ 㿘`^@ь $ C`4@$ C`4@I @ Jg" 8o-"H XJ+"FG* ?`C*  u2?*  !00  `  `+ *`+ *`` *``*`*`"   *"* 2 㿐L V?'@h @ -@2  @^ @h 8 ? #\  `8` @R-  ,02+L*  ` 2 А L   @~ 0 2 0-3  =@'/@M  L g  o a *`:  u*` : -)$8 :  + - =ڐ`=*` =  ?* : ` uo *` €$ ?" ?"" II -@ &`0 ? ?@ -3 =`@ =` ="  +` -@ ݐ& ? ?@ -3  X@  -@Ғ Ő& ? ?@ -L3 @{=`G =` =!``=` ="  -@̭ & ? ?@ -=`3 @V`" -@̔  &`# @q ? ?@ -3  X@6AL  ,**` .@vTTTTTTTTTTTTTTTTTTTTTTTT`g"*`o`= -`X`+`-0?0<`u07*2 -2   +* )2  &2 *2 <c* 2  * 2 +-  =  *   - +  X2`2 `: J@+-X2@   `J@-+`8  X`8  `( 2 **   2 **  "J@2 ** ʐ $< C`4@$ C`4@$S C`4@%s: 㿘P`<!oc@ڐ`@o@Вc@Ő㿘@@ @~ @offonsecurelocalrtsctssoftcarmdmbufwindow㿘 a  @o 1  a@Le Ȁ N@r aa`? "`@А @  "@ ဢ0#\ @ ` " L   `2 L "Π Ȁ #"ˠ   `"`  @*$`L $`$`@ɐ$`L $` @ "` "`L M! 'p@   p \ p` ?|$` `@   p \ p`  j$` `@y   p \ p`  X$` `@g   p \ p`  F$` `@U   p \ p`  4$` `@C   p \ p`  "$` `@1   p \ p`  $` `Ȑ@  M!L  =2 M!@n$`@%L pM! #" L #2   L "  "  & L "& @q 2,J A 造"62 J\2 J ""  *@'`# *&*  2 ** J "   "   J "  "  " 0 Jŀ"*㿘@qa =   /etc/ttysr㿘1 !  qq"@Lb&!@ @Lݰ 㿘1 !  @8&!@ $OpenBSD: rindex.c,v 1.2 1996/08/19 08:34:08 tholo Exp $*`:` J " 㿘 @  @$@ 㿘  <a!@`?  !  "" /dev//var/run/dev.db@ʒh  @̠  P"< @ H rD " @@.@ r.`  H.`  .`  .` .` @ '  ?PP 'T'X'\7P X` 2 d` @ "@˗` @  @@8r@w @ & +"@x' "@x# `@ @k@P  @@`@@yG 2@xА BLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocks㿐r@"r_"L [@MH Qr" J``MJ  1r`M*r`k`Gr`K`(r#"r"r`m`gr"r"r"Ȥ !r"% $r"ؤ$!"@o"% @r"@f @ ! r#@Zb""! r8"@˒  &&  &&@"$8 C`4@?ch?# @  @ Ժ ?@ ?# @!?4#a/?#?  ?# !?$#?#?  ?# ! ?# ?#? ?#  ̀??#`  ?`?``?# ! ?#?  ?#  ?Q#M??#?   ?# ! 2 ?7@! 2?#?  ?c@  ̀@2 ?"@ ̀@?#?  ?c@ ! @" @! @2 #? G #?   ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"  ` @! @2` @   ?#?    ?# ! ?#?  ?#  ?Q#M??#?   ?# ! 2 ?7@! 2?#?  ?c@  ̀@2 ?"@ ̀@?#?  ?c@ ! @" @! @2 #? G #?   ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"   @! @2    ?#Ԑ#  @̘ ?`?D '#\   @@2@   z? ""@ d? M J J`, , 4 $   @ J 2, ;`@ :E4&@ @? ?`)` ` % _ J _"@yB 2 `?$  ` , `4  ` ,  "J 2L Т`  8 & @F `?@ʐ0#@ܐSF ӄF @   "  ?b!?#Ȣ@ 4 @  4    n ΐ i#h ?@͐ &?`0@5`.`    #\   @m??@I J `  @ה 0:*` *   ?#Ȓ 0   @ `( ( @= @P  @    @@%?#\  @??@ ,`4`$`` @  `J 2,``e0P %L@?`C@ "?L "; @x2 " L _2  @x( 2!` $` ``"   ``  ,` ,` 2  ? ,`4`  ,`` @ "L ̐  8 "   @" @ě0@ǯ㿘 ̐?  , @€? 㿘 @Ӕ ?@g㿘`? "`@  "@@ %u㿘 ?*`  * bN  2! # c @  $c@ 2$` 1 #w`@̒ 0 @nF  㿘 ?*`  * cN  2! # `Ѐ @  $`@ 2$` 1  w`@ 0 @n  㿘 `   @Z! `'  @Z!@Z!  `@     @  @Za㿘@Z!@    @ `@@Z~!  㿘 `   @Zr! `'  @Zj!Β㿘  "7 ⨒'  b&⨁㿘@ZG!@J    @ `@j@Z4!  㿘 `   @Z(! `'  @Z !Β㿘  "7 ⨒'  b&⨁/etc/groupr㿘1   "x@FM1  $ `" @+ & $  x @Fa& @ 㿘@ 㿘!@Yِ!   "  @YА!㿘!    @# `$ $ `" @ $`$㿘!!@Y@Ygroup.byname%ugroup.bygid: `  # )  p  (`  (@C֐ `% @Ȑ   4V'# `$``$И#`% #\  (x,b@@[Hؠ@©`$ $`$$`$$,, (x b@,@ Ѐ @%  `  (#xb@@Ž@ZrР@|%  @w Ԓ@@o% ',  @C$ 2' @iݒ 2L { `? "`@ @  "@ k0 +xL :h  d@C x !  S%  (  (@C, K  #x (b@@QxbP@Y! (!x@A"X@YР 2* Ԓ@Ȧ@!x̠"h,'̒@ L&@ H&@ D " @HĔ ȔJ@  @ P&N&@B xbh@ %̀  " @u    % @l x̠ @ bh  &""h@t 2 "h@ &@  " @H} Ȁ@J@ 2 8 &̀ ̀  c@%& J ,  *"@`    ""@*"@ `" ̀@  '"@ 㿘N  @'  " @l $" ""$ @> 㿘" " @tx 2   2 㿘"` @@`@ 2@$㿘%  `D"!D `(L ` ?@7 @Ǧ"@/D @"  L ` ?@ @ǎ" @  @"  za" "  ""  L ` ?@ @l" @  @"   L ` ?@ @T" @  @"  L ` ?@͐ @<" @  "  `x  $# $": 㿐N@ ' +zJ@` :'J@ 2`c'@ &@ & @  ] @G;UJ 2 N& @  H @G'AJ 2} : :& @ & @  . @Dې'J 2c #@4^ ' @$Z & @ p  @D J 2H @4E @4 & $@ z!& & & $c@ Q& @ M& @ Ia (& !`"  2&     &   &   2&   2&  `2&  master.passwd.bynamepasswd.byname`  l`@ 1b? @2%""  `| æ   `  @@q |$|| y   ! "G! ` , @- "{{"#ؘ#`% #\  `@X@c`  $` $|@Y'! $`h$@ {"{# `@ ˚؀ TJ$|@̀ @ $| ""J "@ {{"#@U@W ؀ #*! b  @ "{{"#"@9ܚ@V"@$|  &"܀ "Q"@M"! @ő @' ذ`D *@` ;"0a p 2`/p"p@x  ''@Ȑ N" I1  DJ + -J  @ D    "`|  "`|@0 "|@i} "b"2) DJ  @@԰ ̀` J@ 7 @Ҕ @["*" D __YP!+X}`  1''}/ @ 1  l ''    l ؟   㿈@% @" ? ) 0` 4)`2#$0  `  @?   $0% 4 {b@耢 2 $0@  $0% 4$ % 4$  `  l`@ A    " p?7 9 DJ`+`-"J `D# `` @>Ő p DJ   @" _ !  @$ ` {"{#@!  @U _  `@ % 2`D@ ̒@Ĭ @|?p " J  M {{"## @Đ @Uy` "2!  "% @~% `@w % `D %'Ȁ {{"## @ @UQ`  !  "O% @VK%   @``,̐`D < `D $05` `@@H ̢ Ā` J@ ؐ @s @`Dː `D@pc `Dt l @&lJ'!S p %pp p 2/А В@æ  ''@ ! t l @&lư %'! 1/@`  В@Å`''@Ր  t` l @&l   D %umaster.passwd.byuidpasswd.byuid`  l`@ B 7 ~b@S  "`p? 7 9 DJ`+`-`D # `` @=d po DJ   @" _ !  @q$ "` ~"~#@!  @TO _  `@S % 2`D@Z ̒@Ĭ @?p " J   {{"## @c @T` "2!  "% @% `@ % `D 'Ȁ {{"## @; @S`  !  "N% @J%   @—``,k`D ;`D %04J ` `@@ ̢ Ā` J@ v @ @`D i `D t `l @&`lD'!T p %pp p 2/ @F  ''@ ! t `l @&`lf  '! 3/'@*  ''@z  t` `l @&`l   D 㿘!     "`t" p"|@\ 5$ "! 㿘 㿘!  l " p@ $ l!   `" |@> $ "!/etc/pwd.db/etc/spwd.db%s: %m㿘 ?"b@a"| !!    @p  "`l !  8  a0@BX  $ 8 㿐 `l  v  ! <@a @@ "< 2 $ @ @ "$ @@$ @_  @ " D' @* .`` D"  @* .`` !  L@p ` @k ` @f $ ` @* .`` D"  @* .`` D"  @* .`` D" @* .``  `h@= `$@@x@3   $x $OpenBSD: getnetgrent.c,v 1.12 2002/02/17 19:42:22 millert Exp $㿘@H 2 b @! & & @= P &b @ 㿘  @2 *@j&  2 & @F&b @  * "  & 㿘`  @ .`@ @+` @*@%@#㿘  @: ,`@@m\ 2 `@* 㿘L@ @#\@ L@ @ `2` "`#\L@ @K   ` 2  L#\ L    `2  " *: #&   `&@ b @n @5@* & 㿘@  2b @X `$ ,  ,   )    "@ @~@| netgroup: db getnetgroupnetgroup.byusernetgroup.byhost㿀)  / @ @4 ,@ؐ ''  ?0@C@d耢 &b @ & @ @4 2" 310 0  0 @@U@Q 䀢   netgroup: Syntax error `%s'㿘J`"V #%J`#N  `&J` ` #\ `2 "(2< &@a.?, &J  c\@ `  # @ &@ @v @=@  *L 2 netgroup: Cycle in group `%s'㿈  @#8@03<+ 1 *'5|  ? @r0 4"` &4Ē㿘  ` `@k  `  @k     @k   㿈  @2#8@EY ђ 1 M ' " ?:( @ 01 "@  "@  @@  Ð@ٰ 0@հ %s.%s㿘@ b @  "N "`N@ "@E(%s,%s,%s)㿘#0#@ #@`#@@(㿐` @Ð" @ @y   ,㿘ؖ   і  ǖ    $ @7"NN? ,2 N`@^  @7  @N( 逦@- 㿘"0!`$"4% "4 $b0@ "4  ""4@"4  @ @ "4b0 $"4  @$/etc/netgroup.db+㿐"0`'!   "   @l $   b n 1 @7Ր0@@a b @{ "4$0 4  4"@4"4 "4 㿐!  '  '"   @lt $  @7 b " 1 @7 `@|`  `  3`  2  2 @a+  㿘'L'P'T'X@L%s: : %s 㿘 "Pa <`@` @C`@!!@Sn@@w㿘'H'L'P'T'X@ H%s: : %s 㿘 "Pa <a@d  @a@Z!!@S>@R㿘'H'L'P'T'X@H%s: 㿘P`<!bp@8 @@.bx$ C`4@$ C`4@$OpenBSD: strsep.c,v 1.3 1997/08/20 04:28:14 millert Exp $  J H 2* #2HJ$OpenBSD: yp_first.c,v 1.5 1996/12/03 08:20:03 deraadt Exp $yp_first: clnt_callX  N "q @ @ `"j N@ "f @ @('_ &'@&Đ@N S !T  ?''?'?'' ` #\  4 ؟#P    `@PcĐ?"`h@cఒ !P`@& & @*@`@'@ ' @@@*@P@`@Oā$OpenBSD: xdr_ypreq_nokey.c,v 1.3 1996/08/19 08:35:03 tholo Exp $㿘@` @`&` $OpenBSD: radixsort.c,v 1.5 2002/02/17 19:42:24 millert Exp $㾘    +@  ( 4 * $*        "b?@H  㾘2  `* @ `* ``4  * ``$*      "b?` @  @F.`  ?@Ӗ @` ?"@@ & &   8#?c#"?#") ? `   @?  +` /!  $     *    "@&$   *`*` *   f?    *  $?c@@"c ` `* ` !  ` "  & &&  "*  $ %$$@ ` ` #@#`#` " *@  #@ * *  ?# V??"@@ & &  ͦ ?8c#?#"?c) @"@?    @?  ! `1* ? $ ࠞ  *`    "@ऀ@&$ ` #`?:*` *   r?`   ?* $  % ?c@@ "c"  * ࠀ`" ! ?# `ࠞ "` @& & &  *`""# $ @%$$@ ` ` #@#` #`?#@? ??c   *@ #@ ?"? I?㿘`.  %? @ @ @`@@"`@  &&?? 8 `ք 㿘 b @@7 b b @/etc/protocolsr㿘! P  @@5I`P$ P@5s b"b㿘! P " @xA$ P "" 㿐`P    @@5&`P % P P@4Β y J?` 2'# P!  @, L@ #@Y # 2,   "@6`ؠ Ҥ, LL "  " @6آ  ,@`@6" PJ  P# P   "`"``!L  *`:    $@6Oؠ " $,  "$L  $ $OpenBSD: killpg.c,v 1.4 2002/02/19 19:39:36 millert Exp $㿘 @'   "b?" ( $OpenBSD: creat.c,v 1.4 2002/02/19 19:39:36 millert Exp $㿘.`2@ђ&$ C`4@*********p*h*X*@*0* **)))))))p)`)H)0))((((User defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0$OpenBSD: clnt_udp.c,v 1.17 2001/09/15 13:51:00 deraadt Exp $clntudp_create: out of memory X\@v   `` ? `d@l@ ``cH@~! b  "h"`$ X @ɐ `2@S= *` V 6 !,$$$   $  ?$  $ $  8$ $ \$ T$ $ (@I$ $ ''''' X@Q @Q +  <`€$ P 6$  '  @S   ' "  c"c"@RE  b~@$ @P$ $ @ @ 㿈`'' #\b'D ('H? \'L'P'T'X'D`@'T'P$'P('T`!ؐ` 2 * @ U@ƒ  '$$$ $$$$H'|'x8'@$8`€PX@3€ D € PL€ 2  @ $, `€'<'HH X@8<H   "$0@ $, P  T F ""X'7 ' T''' @p?/b@!b?'8 2`* `*  $ 8  @R ?% X`x '` | 'd?``d'xP '|TH @3 $, ⨀ Mh@s hp"@l'`t"`'d@?`x`@|'Xd@'\@?XX\'xP '|T& @ $,r ȠL )  \'L@ " "⨀ #"$0@ܐ$,Q (uX`@ 2o @P# @Og .@Oْ,, DD `€   $,$0  %@N D@  @  D'D @O2''$,",@, ,"@0"`4"`㿘  " 8 8@% ȇ("$"($"(""" "  "" """   4@4T44h4|㿘   " <@+ < `@ 8@3@1PhH`6X6P6X6P6X6Ptcpudp㿐N '@4   J   8  ????' $ $ $ $ $ $ $ `?"V  2y? 2u? 2q? 2m??g? "   "\?$$  $ $ $ $ $ $$ !!`! 2`"    ".? ꀢ    2/' ' ' ' ' ' ' '   $ @ $$ $ $ $ $ $ $ '  ' ' ' ' ' ' ᄀ`n'$$ $ $ $ $ $ $  U"   O2N @ "   D`2A @ "   7`24  2 $   2  2$   2$ @`@` `" `` `   m 2l?g? V$$ $ $ $ $ $ $  =  5 22  @ "   (`2$   2 2$   2$ @.`` `` `     2 `?&   "&@*&fbf㿐@  q   `@&? a0@,  "H@ O a8@,x `+ J@ &`J@ f" y b  2 @  @N@b  `J@ ဢ f`@B `  &  "` #$*` €???`@*{?>>?>x& ' @N   "`1 @@ 2) @J  "$  " ``@  $  @ $  ?@  & @*3h&'ؐ@̒ 2= @  6 @*ܔ & @`2"?@ $?@   ` `  & @)㿘@ 2B @  2 ; @R %  ,@Uؐ $%?@!?,@   2 @?&`2@ܐ㿘  @ @  &`?@A 㿘`@ &  $  $ $  $  $   $ `$  @$ `  *`@$  $ *  ` `@ 0 㿘@ 㿘`"E    2?         3?1?/?  "(?@(?c ?    "X"P@+ ߀ 2     2  2    0 0    㿐N ?`@? ?@?@  ?@/Y "@0 J@ ?gethostby*.getanswer: asked for "%s %s %s", got type "%s"?cH'D  'L????؀  D0M2L D? c  ?D# 5`   8"bD@( €   %"b@@   "b&'L ?#" ?@?D@ B`@ "=@@ * 2 `@ * `4 @ * 2 ` @ ?2&D@Ę$ € " @@ 4?@@+&? _@耢 (Z@@ @@L@0 %H@]@)  ax %@0m6@20@?2*@?# 2  @< & ' ' ' ' ' ' ''  ' @(? %@ ?     2 @ ??"  @D?#  L Δ "b  " 8`  ????'???'???耢 L H $ ''''' '?' $''̢ ' 'Ȑ  $?'̢ 'Ȑ@g ! TĀ   $ `    > 2$ /etc/hostsr㿘!! !@+a($!@+=㿘!! @n$!# ?cp!`!@*a( %a| c@& ?#@a@)% "o L #?a@,u  ,@,ma ?,  L  *`:    "@,S! , @(]  ? ?L  ?#` `` '`'`'`'`''''ؐ Җ ? #@$@` ?  2@?#x  ????M  $ ` ` \  IP  ? ???+ @Nڐ `*@ a@+ؐ 2*@_] `J@*:    "  @+a " `*@``"`J@  @` `'` '`'`'`'` '''E 2' @&@`+  2@   $` `  hosts.bynameipnodes.bynameP !L  !L?`??? @'  _  !H`!H@Đ ` %!H 1%L!"H@@> !%` @'` '`'`'`'`!H?8'   $` ` L@X@>u!H 2!H   $`` 㻈   `   @ ` ""\?`=?#`$ $`` ` ` #d#\@ #`    $@ 3@v   2   2   &`@`2` `!-` €         "b?  "bUUUUUUН㿘    ``   @ h  ""   ""bN    J .Jd?`2J J .`?  `@  `Rgad2  ? @c 4[  ` `   87` b1 `Ԡ ,`Ԭ@@C 4;⨀ =4 "   "  2     2 `"" `@  "@ @   $ `? $?%s.%s㻐  ` @` ""2?`@q$  ?N .2@O? @]@Z $  "b ?@$㻈  ? &``  @~ ""H?$#d#` #\  @  `  $@<   ("b@ 6  "b ` `#,*` €         "b?[[ZZ[[㿘    `   @  ""   ""bN    J .Jd?`2J J .`? `@ dq`ad2  ? @j 4a  ` `   ;:` b4 `Ԡ /`Ԭ@@G 4>b =7 "   "  2     2 `"" `@  "@ @   $ `? $?%.*s.%.*s㷐  ` @m` ""'?`@?"N .2h@} ,@ b$@:ژ$HOSTALIASESr㻐   2x @"@ 2p l@&c "g @d YJ?` '#N@, O #\@ ` 2 L@`L@  @@ `"`L@ 4 ,@@$  )#\` @ `2`!`L` `  1 #\J  @ `"!P*$@M[@i>0 @%ޒ @i5 H   `` d@` ""?`  @!@E`  2@4@@ *` * $@ >*` a ?$@?'D'?Z?2X?? Ժ@ ˑ. $ 2 @.2  @  ;4` 8?@  @  @ @  @ 4`  ` .` ,` @Ց2 .`@ё2 `@Ґ /`2 @ʒ```@T4`&㿘& @%?.@ @ ). @2  . .      @ @ `   &6`  㿘.`  .2 .   ,,`6 @2 @6 , 4 @@6` ,`6 㿘@E%?' )!$h@F #c4    2Z@42aXh$h  @-2a\$h  2 ! 4!`!  2a^ 5 3- 7 14!`!` @*  `@ #$h@c4 $h`   ,,`2   , @4*  2` , 2  @+` ,2`x 6b 6b0@3l"2 @l ` ? &d6"2㿘!  @!!lb0!/  !l!d ! t! !h @$!h!hb0 2 @/@ $!ha -   !^a`)`!X@Y@ג!?4!X` b0 !\Xb@ 5b0 aZ2 . 6    *@ @ *#㿘  8 Q   L ?# ߐ @ @2  @2      ) @}  "$   0 # ` ?c 2 `"  @2  㻐 )@e$ @?@ * `4 @* 2  ` @!   ܤ 㻐  & $?  @.$ @@ؐ* `4 @Ӑ* 2  ` `   'H'Ԁ`'D@,?"I?  `'H" 'Ĕ  <''̀  !'Ȑ  @  ' @  `   @? ` *"`"  DH` x*` €   )4?`Ā "x`'Ȥ  !"`" @ "%bx @   @C{$" $bx  *b! $"@BԔ  *" "bJ@0D H''''bx@J H`   *b 7ްbx@ޠ  ް"@*` 7ހ  @"6(̀ % @'j @* 2 ' 77"7ހbx@ ހ  "@nB "b* &7ޑ* 2 ""bx@蠒 ޒ"@*` 7 @ "x` !   " @    @2   @B$" $bx  *Bb""| `$ !`  Ȁ"|` !"|  Dbx@B䀢 # $"|D bx@(HH"|   /'7bx@A  $"|"bD bxH@(H Ȑ *t  * '@~` '耢 4' ''bx  @r2  \bx 2 * +  &   @BS @  "`bx0B! >'' "bbx @؀ 0'Ԑ '@bx  $ (u bx (2 DH bx       *@r !``"D  `  " @c'< Ā   ` `  a@P"`  DbH`/ d*` €   )4%?`D  `@  Ȑ  '@Ā  Ѐ   ="b <"b""?snsstXltnl|stX㿘!"x  @??$"x""|""℁$ C`4@㿘 @? @$㿐 U?@_`0`  `@@"$`0@ $`0T` $` $`@` 3\@ `@ܐ  ?@Զ`2  `C  $`4` $`$`$@2(" $`4` $@  $`  $`$`$`4 @ "brjeechodiscardsystatdaytimenetstatqotdchargenftp-dataftptelnetsmtptimerlpnamewhoisdomainaptsapfsbootpsbootpctftpfingerlinksupdupnewaccthostnamesiso-tsapx400x400-sndcsnet-nspop-2sunrpcauthsftpuucp-pathnntperpcntpstatsrvprofileNeWSsnmpsnmp-trapprint-srv%d㿘`"*` €1"1"1"1"1"1~"1{"1x"1u"1r"1o#1l#1i#1f#1c# 1`#(1]#01Z#81W#@1T#H1Q#P1N"1K#X1H#`1E#h1B#p1?#x1<#19#16#13#10#1-#1*#1'#1$#1!#1#1 1 1 1 1 1  (1  81 !x`H @3ytzxxzxzxzxzxzxzxxxzxzxzzzzzzzzzzzxzyzzyy zzzzzzzzzy,zzzy8zyDzzzzzzzyPy\yhzzzzzzzytzyzzzzzzzyzzzzzzzyzzzzyyyyyyzzzyzyzzzzzzzz(zz4zz@zzzzzzzzzzLzzzXzzzzzzzzdzzzzzzzzzzzzzzzzzpz|zzzzzzzzicmpigmpggpsttcpuclegpigpnvp-IIpupchaosudp㿘`+"*` €1*!P1'!X1$!`1!!h1!p1!x1!1!1!1!1 !1 !1 !`H @2}}}~h}~~~ ~,~h~8~D~h~h~h~P~\%s㿘  !` G   !\b@j   `  @ @  @* 2  &<``!`  !`?` '`@ * '@ @* 㿘@a`;; res options: %s㿘`8@iȐ    # " @ V@i`H2 `?`&`@ * &@@ ;; ->>HEADER<<- opcode: %s, status: %s, id: %d; flags: qr aa tc rd ra UNUSED-BIT-ON ad cd; Ques: %d, Ans: %d, Auth: %d, Addit: %d;; QUESTIONS: ;; , type = %s, class = %s ;; ANSWERS: ;; AUTHORITY RECORDS: ;; ADDITIONAL RECORDS: ;; ...truncated ;; ...malformed 㻈   `@Y?k!`  ( ``"  `2`  ̒ `<! +`  `@i!`& * & @a!` (?`&@ ; ;* &@I!` "@a @h2``a0@h$a8@h"a@@hڐ!aH@hӐ aP@h̐ @aX@hŐ ah@h ap@h!` ! ax@h !?#a @h a@h  a@h!` +" ?`& * & @ђ  t!`  "?a@hu? g  -+)`  @@heȀ@8`   @ @D$ @ `s@m`  " `@* @2 @h8aТ`@8Z`   @ϐ* @2 @h%!` ` "? ?`&* & @^?<`@/ !?c#\  ՚ %@ "#\ @ǚ @ "#\    0 @gْb00@gԒbH㿘"㻐@$ O ?`&@ .* &@ .@t㿘Ԕ".㿘@ & @^ J?`."  !!.  *`㻐 ؘ$ @80  %lu %s %s ; proto %d, port %d " "\"?" ;; *** Warning *** OS-type missing ( %lu ; serial %lu ; refresh (%s) %lu ; retry (%s) %lu ; expire (%s) %lu ) ; minimum (%s) %d %u %u "%.*s" %u %u %u %u %s %s ( 0x%04x %u %u ( ) ; BAD BASE64 %d ; LABELS WRONG (%d should be %d) ( %s %u ?%d?;; packet size error (found %ld, dlen was %d) ?c   ` @ ""   =$ @@p*  2 @k*  2 @k @b a`*  2 `d a@f !`   !@!!@f@!@f`eC"*` €``2?%?@˔   T"@ @q@ !2,T"@ @f@   @* 2 a ` @fd?`&@  "@9 6:5%@?a  \?`&@ \* &@~?` &@  * & @i`*?`&@ " "* &@RM H b@Ȓ6:5%@?  \?`&@ \* &@,?` &@  * & @`*?`&@ "| " 2g@~" b(@e]?`&@  * &@  "[ ?`&@  * &@ϒ @E"P@ @enbX@! @|"p@eb@! @p"@eV@ ! @d"@eJ@ !"@X @e>!@ ۠"Б* 2 @e3x !@ Р"Б* 2 @e(  " ?`Z&@6WZ "@ߒ9 6:5%@>"  \?`&@ \* &@??` &@  * & @*`*?`&@ " "?`&@  * &@g "?`&@ "* &@ 9 6:5%@=  \?`&@ \* &@ Ӓ?` &@  * & @ `* "?`&@ "* &@  ?`&@ * &@  ? @l!?   .@6 ޒ!?`  @Ւ!@ ǐ * @ ¡4 * 2  @db! "@d @d @cC@  * @ 4` * @ 4 * 2  b@c,?`&@  * &@ "[ " ?`&@  * &@ C 2h| ?`&@  * &@ @ mO 2M!@ >"@cB  ?!? @̔ !T#"@ @@rc @cv  * ' ``@ 4 @ / ?`&@ * &@ ,`*?`&@ ) )* &@ ?`&@&  * &@ r@ Ő* 2  @cc c @cc( @c?aX ✒$@Ô @+1`?2@b#0L?`&@  * & @ 1`@倌`?}c8@ ~*  `H@92 @bђ cP@bː@D cX@b@ dc @b !@ W#@R @b@ O@J @b!@ @#* 2 @b ?aX ✒$@G @"+1`?2@b{#0L?`&@  * & @ `@倌`?c8@b`c@@bZ@c@bQ?`& * & @ &c@b: 8(((@(X((|( (((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((  ANYHESIODHSCHAOSIN`X80     x` X@8 xp`P`H80( xP H(! "phPdH(e f#"any"URN Naming AuthorityNAPTRgroup ID (nonstandard)GIDuser ID (nonstandard)UIDuser information (nonstandard)UINFOmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressA㿘    @" 2 2 &   2 2&㿘   2 2&   2 !`H@(m2&㿘   2 2&   2 !`H@(O2&㿘  㿘 < initdebugaaonly(unimpl)usevcprimry(unimpl)igntcrecursdefnamstyopndnsrchinsecure1insecure2inet6edns0?0x%lx?㿘@"K1"?1671O1 8121F1 11A1 61.1(141 '1/1 '1!1%1 "11 1!!H!P!X!h!p!!!!! ! ! !!а!a@'0 secs%d day%ss%d hour%s%d min%s%d sec%s㿘  #x#x  b"b6 . @s <@y <@l <@r <@e @k  `"`###@'d L 2 ` , ###@'L L 2 ` ", ###@'1 L 2   `2 "2"2"` 2,",  ###@' "%ld.%.2ld㿘  @2   @ P* @1 !"("@ d d@Ӑ@&㿘#\    `1 +   +` *  `?Е: L .+`  \ `*  :`Д *` * + Б: @ +` *  #P*   ```@:`#P,`@ 4 * $ 㿘\    .(`(б> `c\2c\i.) (б> `c\2c\K.+(б> `.2*c\!. 8(( `(/ 8а( (`/ ?Ѕ8c\"c\2(82)((` (( (( (1 ((` (( (( (1 &(& (82 ( " ""c\"c\2"`llllllllTllllTlll`lllllllllllll`llllllllTllllTlll`$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$㿀''@U'@@  / /    /逢`  2 쀢 2   J@ - +`'?J@ +`'#\4' 4' 4`5 5 5  K ' , @ *  `?Ѐ K .,  ' c\ ` '* :`Д@ *` * +`Б:  ', @*`@*`@@L&%c\  @ `   ' @ `  4  4 c\4 ' @ `  :X.`/c\  `' @ `  c\  `' @ `  :/.`r/c\  `' @ `  c\  `' @ `  :.`I/.`.@.` .`.`.`.`.`.`.`.` .` .` .` .` .`?; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %smH '&%b@#0 ` ``*`  `* `*`     `*``+ @ +`**@ *  @`   / /ސ†"??ڐ!  N S/ /@u͒#'@#@uƒ <@ܒ <@u <@Ւ <` W/  E/@u#@Œ#@u <@ <@u <@ < d@u d@@l @7.+ "cxe@7' "cx^@7  "cx#\b #p#`#d#h#l#t#x#|##@#Ecx cx@.cxcx@(cx@"㿘@R   L ." `@ &L L * 2?J?`.2 %04d%02d%02d%02d%02d%02d㿈'@ 1  l  "  " #\"8#`a@"=㿈`B #   `2`*3  *2  `? /// ///ꀢ`?/@??@@`?@T` . . . .Ğ`? ///@ * `@    2`*  2+ 2  //逢`?/@ ?@?@@# `. . = . =..?㿘N  ^ c\   Q`# @2 _ "`   `9N +`3N@L"@* .@*  `C"@@: .@@**`  ` `3"@@: .@@**`   @%"@@ .@` N  \ @ `2N==@ N    #9 64?#\ @ `  =N   `2N=2?N  #\  `"?N ` @ ?0?㿘?   @`G  .&`)?0C@ @??(@`@.` , \ . \2 (@@:)?(@`(@`<   !`?( `@ &  ? ` (@!㿘@    @ 2`  `B ?@n  ;:,*`" 7*  ?@$@`$@ .񀦠\  ,  $ ??"? >*@*,2$? $     ? " ?  \ @H*`P㿘D`4 ` "' 8?, ., \" Ґ  < ` "&`."  `?*  @ `Ц &*?J .( J.  .`.`Ѐ   Ѐ -2 `2J 㿘N * N  .   㿘N  % ߀ ] `.`\ " N`  ߀ ] `.`. J߀](J    ( ( (*`  2 *`*@2 2 2 *`*@*`*`  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~2H(P㿘`` &`` 2 @@   "b&?@``"  @U ? `@?&`*@``&@`  @> ?ZONEREFZONEINITUPDATEMAUPDATEMUPDATEDAUPDATEDUPDATEA8765NOTIFYCQUERYUCQUERYMIQUERYQUERYNOCHANGE14131211109REFUSEDNOTIMPNXDOMAINSERVFAILFORMERRNOERROR㿀@' ?''@~%?Ѐ 8?Ʌ(8㿘 B :@'.3+1// #4 c\ `*   ` D "$ Ӑ   *  c\ ` D "  ,  .@`   ǀ.  H 4  6%* . @ 0 07( @ ` 07(*& @*   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~2(P%d.%d.%d.%d㿈'1 !H#\8@e. 㿘    @  @" /"b 㿈 b @ @J  "b %x8  ???? Ț 4`@ :`*`$@*`#@ * * ``# ?''  ?,`` ?'' ' ?Ā@$''''``,` ?Ā@''?Ā ??'?#  : .+@  Đ@@ `@ 2,`,( ``, ,` ,`Ā  ,`,`$%  ] ( @  `H@`` Đ@ 2, :, , $@  "b fLOCALDOMAIN/etc/resolv.confrbf;#domain lookupsearchnameserver%dsortlistoptionsconfRES_OPTIONSenv    '`''   "` 2 $  "$ 5 ,4  ,$@#d<*@  $dc($  $`@Ɛ@) =-@#0 7`!@/UL` '$DH \  .  $@` ' N" N@ 2NNN    2 .$@#@@X '! c`"H@z /e'#a@~, ch@  .O Pcp@:  )O  $c 2@N "  " N 2 0!  !@.ڐ@ Ncx 2."'c@:  2AO  ; "H@@   N   `L@ y @ b f,  ,``L@ y @ b f , "Ӱ c@:=  UO  Pc`2N "  " N  !  !@.f@+Ԓ 2.&?L ?耢  ?@N  . " $@`  N @   N   2 .$@ 'c@9 2O  2 N "  " N d a #\ `  .J  #\@ `"*  ??  ??''c  5@bg' 6` 1`  #+  `@>  #*  @!    +  @)    *@" " "" ' "@Yc@9T  O  ֐`   c lcc-7N "  " N π ̀ ;@ `2N N`"N@*ܐ耢 2 NN ; \N.@= B  ah-`$@@* %`. N   ; \ `" *: @. %h@{'%@@u'%`h*`c"  ' S'@  @ N` -`@*` '@ @@"#"#"#"# . `N   ; \ `" *: & ./ @Q @U  ?    4,, *,`` ` =.c@8t   O  c@@7 ` "   d `**` "d@H  L`` @U  @) . `` @,!`-  Ԓ`" Ԣ` $@N   ! *:   .Nd` ?@$$@@)В . $@`@$@@   @  " @#Ȱ @c  ` "` ndots:debuginet6insecure1insecure2edns0㿐N s  c+-)'%*:  N "  " aH@7Ô    @ C@c\  2` ``7* ad+  < -$adaP@7  'X@7  `!`@7 2`$p@7 2` (@7~  2N` $`N   2 N  0 ???$OpenBSD: atoi.c,v 1.2 1996/08/19 08:33:24 tholo Exp $㿘 @0 $OpenBSD: bzero.S,v 1.2 1996/08/19 08:17:56 tholo Exp $ `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*㿘  ` @2@0 㿈  ?'  @{y ?? 㿐@ ?㿈)#\ `y 0   N x X   #\*:   `  @ ?;   D` +`ɚ@ ;  . = $" $5#\ `0$:  `2#*` €?#@!耢 * #@?#@耢 쀢`* *` ` 耢 쀢`*   *` * @`2&@ (P눝㿘    @  @G /"b?㿐N  / ( #@'ْ " @* @*`@ $2,@  ,@ .2 `,@ N ް   .@.`.`.` 㿈 @  N :   N :"Nt K N  `D ?##Ȑ@' #@'|  ",R (N`:`.`GNN A >4, ,   6  @2l  0+N`°   !4, , `$   ? % **   @&   $OpenBSD: strncpy.c,v 1.2 1996/08/19 08:34:22 tholo Exp $ @(*`  *02 @$OpenBSD: strcasecmp.c,v 1.3 1997/08/20 04:13:57 millert Exp $        @ ` " @ @ @`  @ # 2 @ $OpenBSD: _yp_check.c,v 1.3 1996/08/19 08:34:57 tholo Exp $㿐 J#` @#    #&@ܐ#`?$OpenBSD: yp_get_default_domain.c,v 1.3 1996/08/19 08:35:09 tholo Exp $㿘 &J#` # @ ! # #& 㿈  ?'  @y3 ?? 㿘`6 "@"&&@G+, @? `"&&@-&@`", 値@Hi ހ" ,㿘#@Ua! @M" @1А `  @1Ő   20 `b @1 b@N 2b @5@&܁㿘 !a`@  / /etc/servicesr㿘!"0  @'`$"0@Q b"b㿘!"0 " @D$"0 "" ,/㿐b0    @`؀ $00@  J?` 2'#0! !`@|, L@ #@%s # 2,  "d @oa` ,@`L@L@ "` "`ah@^ ,@}  J 0?#0* !dt2"` "`"` @;` "&$@,  "!$@L  `*`:    @$@`@!` " $@,  "$@L  $@!d$OpenBSD: fgetln.c,v 1.2 1996/08/19 08:32:29 tholo Exp $㿘 H* D  @} "?& H& D 㿘 4@G) 2F&@ @  $&@ @ "$4 4$  @  $@Ò D@$"@$@`P $@D@@F ئ&@D&@ 㿐@K & @uQ  @[X! 46  444 x`̔6 6 & $& ,& (& &    @u 㿘 @R    6 ""8  `@un(` K  ? B ; > @u @2P  @ ? 2 ?  : @ 0d < :@  d  " : @ DE      "b2 @t' h €d4!@2 T & @ 2  <   (4 ؐ$$L4 2T @ Ȫ@B 2#0 @" P  @ ? : @ 0d "< :@ d0 " :@ D8<" @d  "@@d   @2'L4$L@@@D 4%@2L@%@&0$  $@"$0@{ $0  ?T4 L  :  @ @?2"$0` $@@"$0@{ɐ $0 @ ?04 @E  @ "@$"$@t ?@?20?0`@@"$0@{ $0 $ ?4 $ 㿘 ;   $OpenBSD: strpbrk.c,v 1.2 1996/08/19 08:34:23 tholo Exp $J H ? 2H  J  $OpenBSD: strtol.c,v 1.4 1996/08/19 08:33:51 tholo Exp $㿘7\ @ `` - +L@  L@` 0 L@ x XL` ` 0  ) #@dQ@pg$ $    - ) "6"&? ? %@"  #?% @  @`\    Ҡ? ??ˠ`2&@ 㿐@$    "  2 @- 2  @z   "bx   ?''D'''   @t      @zbܮ   @tښ ܚq  h   2c  ^ T`  T ` ?@` ` L`D/ 2 ` @{v>  : `   * @"   ?     + "    ? 2@`2@@+ * @ ,`D "@y0ɐ"* @yҐ @y? @|ܐܢ @    2  1 2  ) T %` %` @|R \ . %`  T@|H T   ?@`` ?%` @|8 D`%@ h`Df / 2 ` @z"Y  T`` %`` %`%`  *  @"   ?    .  @"'   ? "%` "%`" %`  @|F@@{Ք@Ց.%@ܨ *a @yA䀥@ D%@""@y7 㿘@y1$OpenBSD: strtoul.c,v 1.4 1996/08/19 08:33:52 tholo Exp $㿘%\ @ `` - +L@  L@` 0 L@ x XL` ` 0  @}?@~?\  /  "#@8? ??%@~  @`    ? ??ޠ 4 `&@ 㿘'L'P'T'X@L㿘cL@[㿘@m#L㿘@w#L㿘@L㿘@#L㿘@cL㿘'P'T'X@.Psyslog: unknown facility/priority: %xsyslog_r: unknown facility/priority: %x<%d>%h %e %T %s[%d]Error %d /dev/console p<#L@ Ò`( ##P ##` :  #"`#L@@#ԢÔx@V((  (6'$@@!à @ Ԗ@ & 6$@` 2` 2`P <&``Ô@V| & 6$@` !@yZ @Vi & 6$@`   :,@` ,@`*`0$#L-+Ñ:` % N m @ @@V5`@V.6?&$, ?*`ّ:`,@ & 6@` $@'Ð$` '''' @z `  `` @@D@@ *@*@8@@ ` Ð  @U  >@Đ $@Ð$`Ȕ ''''ؐ@zq@p!㿘?"& @p?&& /dev/log(?   @a ?3& @S ?,  (  ? j ?/???????????Ġ/a`7@! h@ j? @o&& 㿘 2&& "&   &㿘@o?&&  `"`㿘 @ $ C`4@$OpenBSD: strftime.c,v 1.8 2002/04/04 19:12:09 millert Exp $xh`XPH@0(p`PH@(%a %b %e %H:%M:%S %Z %YPMAM%a %b %e %T %Y%m/%d/%y%H:%M:%SSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJan%c㿐@'Ő!@2"`2*? *?%02d%2d%Y-%m-%d%03d %H:%M%I:%M:%S %p%ld%lu %d%04d%e-%b-%Y-+PLF`%<L`z6Ȑ *` €/``Đ#x*` | Ő"H@``Đ#x*` ` Ő"H@ `` Đ#x*` 0 Ő"H@`` Đ#x*` Ő"H@` d@j'lŔbP@o` @ ޠ'Ŕː `` bP@TȰ` bX@LŔ"``bP@@` @^g@^c " ŔbP@-`Ŕ bp@$`bX@` @^C@^? " ŔbX@ }`bP@u`Ŕ bP@lŒ"x@e`   @XŔO"ŔK"@bP@ԖH`@'`'` '`'`'`'`'` '`$'`('@ 'Œb@ @$Ŕ pŒ"@` `?@i"ŔbP@ ` " Ŕb@@iВ > ``'l` $2m@] d 2 n@]! 2mn!m@] d  !n@]! !m!n? @]$?@] $@?& Ζ 4` -`` -` 5-`:  V g ŔbP2 Ő ' d@]YŔbPb@#Ŕ"``` " @i\ Ő @iW ŔbP@ `b@wn`` ',` '@hf' '` d@]'lŔbP@ݖQ`Ŕ'lb@ԖH`( @ؔ@` D` `, @ @ɔ9` 5`$`6Ő" "ؒ@@h <@h <* , ,  <@\ɐŔb@ `$Ę  . L  $,(P|lT\ 0L`h㿈@ @@ `@  (*@  J ? * ``  , ,`"  L'L  ( " b  @  ,L'L% (( ` (@  @../etc/localtime/usr/share/zoneinfo/?` #@t  N : /@ / 2 Ȓcp@ o 2  N /@ .   2NȰ#x " ?N :" N /`?"Ȣ#`"?@u@u #@ Ȓc@n@k@ . 2 @  2?@P ?? @ @k5@k 2ذ?;`8`5`&@2` &`/`$&`,`(@`, 2&` ` 4?` !r4?``24? 2? 2?* + * @ @` ?@@  *@ $@@$@ r 6``, & ` `` 6`e @*` Y`` & @` 6` gLΐ`& @` E&  @``@& ` @4Y?`  `   #L@ @*`   `#L@*@ 6`!L@&`& @ ` ` gL" "` L@` "` ?` `  gL" "`L@` "`?` ` mnJJ Ѐ ,-+2  " JЀ   ((+ Ї8   JЀ  & "@ 㿐 ۖ $* "@*`@*`&@N :  ʖ ; *@" * @&@N :   < 2@  &@㿘N -   +    @ &@㿘N J M &@`* !?В &@ `   "0 N .  ` v  "$ N . `      &@` !m` 2N  / u` &`㿘 ` @Y d 2  @Y! 2  "  ""   * * "@*`" *{ ;xT!u* * "@*`" *k ?- @ʐ ܓ*`@ ?* @*`" *" *  @Y>    &@ d@eO d@Y1,`@*`@*`@eB  ``:```: .`" @Y  & @,` +`- @* *`ʒ ܀  `& +` * "*"@ *` posixrules,M4.1.0,M10.5.0X '@r!'{$>?L :ԒĠ 5?ː# 2&@L '_$ (!?L  , ;  2L?Đ1'L 2L`ˠ#L , ;j  ࠒ "?L , Ȑ "?L 2?Đ     &`&`&gL&gP&g` &gT&gd&gh`eب '9ʮ Ĕ̐Ɣ$ $@$@,`$@ ,,`$@ ,` !< @XF d 2  @X@! . .*@ *`" *" * Ȩ&` 2?  `@e gP* *  ``gL   eؔgP@gL * @*` ` @6  * * ``  @1 eĄgPg\gXgL` * *  `(  `2*" %% #* * ` ``@ۘ Ė   &gL&g`&gd&`&gP&gT &gh  &`&gL &`&gP&gT&` &` ` "8?#L@@| @@u  㿘 ʒ  㿘   ?""  o㿘! $@@TZ㿘@p!( # מ`  #@!f 4@qQ!@ $` #@L   " "T!L` """P@"L0"l L :A 㿘! $@@㿐 "``'`  %gP@ *`` eؘ%``   *@ 6* , 'L@ @@m &  #L@@ ,*" &(㿘! $@Vc @P㿘 ` 4 ,@H " 㿘 (@7 ` !  "`  @. ܒ@,`   (&(㿘 ޔ㿘 ` D ,@ " 㿘!  Ŕ㿘  ? D+!L!P +  2.   4  ?*      ?+    @2   @     @??ɑ+ %T@b:@V&@ T T!  ?"  `@b.&@V.@b <& <@U&`@U  & &0'@b!m`&* @*`@*`@ <  d@a$@a! <  d@a$@aޒ!$$@`Ѧa< @U d 2  @U! ,  , @ , @ʐ ܔ*`@&&&@`*``*`&$@ @ 6`&$& & 㿘ː@h@͒ "  2`㿘@ &8@a@a8@q@"&@`` ` ` `@ ('D'P&@`'H'L'Ȑ  '̒`'Д 'Ԗ 'ؐ  ' ' $'('' ' < K?В < C?  <?ܨ 4?z'l .?Ԁ )!n'ʐo? "ؤ  ܤ  < @Tג d 2  @Tђ! ,  , @@ `'Ԁ!n(+ؤ  ܤ  a< @T d 2  @T! ,  , $@ 'Ԑ*  Ԁ!nݢ'ʒ"@ 'Ԁ  ''ؐ  ̰?ؤܣ*   @T d 2  @T}! ,  , * @Ԁ@ؒȶ 8 ?Ȁ`;8''l'4'?ŀ ?Ȑ ;''w''Ƞ 'IH"t@  " ? |,* 'P@P@耢@2-?? (/ * 'L@L耢@@ " L'H 2耢@츇???줄ϪC?LH  4? `?' *"@' *@'耢`   @' 2?'LHD P"@?㿘  w 㿐  &  `" K && ͐"t@  " ? :- * P@P@ @2-? (,* @  L`?"@  && `2 "@  " `?&& ޢ쨅?Ϫ?㿘! $@ِ͐ bt@ѐ㿘?" 㿘ΐ& ` 㿘ΐ& `}  L*` 㿘'DDD&㿐'DސDD@ 'א D"@@ `'D&@ &􀢀 ?0'D&@ 4􀢀  $! C`4@SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%.3s %.3s%3d %02d:%02d:%02d %d 㿈 #Г*ђ@ #@  *#ђ@ #@  'l #h #\ #`#d@G  㿘 `  @ " Ȑ $OpenBSD: strcpy.c,v 1.4 1996/08/19 08:34:14 tholo Exp $ @( *` @ (* $OpenBSD: strstr.c,v 1.2 1996/08/19 08:34:27 tholo Exp $㿘N@ `@l;N    2N@ 2N?@#?"77'''''L'P'T'X@GL*@8`#`? "77''''@Gݐ*@$OpenBSD: ypmatch_cache.c,v 1.7 1998/01/20 18:40:27 deraadt Exp $㿐@ a        6 2 @hm  Da$$ $ $ $ $  $ $$a  " @h$  @hy$ @hO &$ @hJ $  @hk $$  $ @j$  @j    @  @hT @& $  !L  $ 㿐! !  (  & #'@! "  2 @q 2 @D~ 2 @$  2  yp_match: clnt_callX  L " @k< @`" N@ " @k1 @$' '@Đ@@  z #@(  쀢 `@g'@ '@ 0_ @jK@@*@@0U!T Ė ?''''''''' ` #\   П D    `@YaĐ?"`h@ 谒 !D`@gf'@ ' @j@#@@*  D@ʔ " D@S@.āyp_next: clnt_callP\ `N "w @j @`"p N@ "l @j @$$a '$@'@@ U !T  ?''?'?'''' ` #\   П#P    `@Ғ`@?"`h@ఒ !#P`@f'@ ' @i@@*@`@f$@ $ @ir@@*@#P@̒@$OpenBSD: yp_bind.c,v 1.12 2002/01/02 20:18:32 deraadt Exp $/var/run/ypbind.lock%s/%s.%d/var/yp/bindingclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFDH'D"@D  ? ^ @ " ? b # @_P @_@h !X? #x  ` " @@fv 2 `%cx`$X&@D ( @i # #x D@  2 2 h@f/ l   @i< l?& \& h  h 2> hDԔ$ @Dϐ@D ?"- h@   #  '''̒ '@z̒@ @_& h@_l@_"̰ @f Ȱ     ?А   ?؄?//'a'bД  @_ 2 @"Ѐ" @e #   @" @eא !T'''' #\@# D耢  "  D!@4b `€ ?f& h @ `* @7 `/# 2 & H"W @eS   & L. H. I& P& T ` . J ` . K A. L `. M `. N ` J. O6 X& h@D!T'2`@:`' ` ? @& \a''Ēb H Q \ & `@#& h \ @A̔ ?@ ݐ#(cx&%cx`2&@ 㿘 ` @?& \& `㿘 㿘 #x  @m  2 ` @`$@$x@e0 $OpenBSD: clnt_perror.c,v 1.13 2001/09/15 13:51:00 deraadt Exp $㿘1 ! 2!@dϐ!&!!%s: %s; errno = %s ; low version = %u, high version = %u ; why = %s (unknown authentication error - %d) ; s1 = %u, s2 = %u ... 㿈Ƞ !j  `€!@ "(!@CC" ! @L$@ 耢`;א *` €!@"0@C'3֒h@C " @ @+$@ @얒 ֐@Cx@C@B@ @B֒b. @0֔Ȑ @B \d\d\d\d\$[\d\$\d\d\d\d\d\d\d\d㿘!#֠!bxv@2_`_@_ _^^^^^x^X^8^]]]]]x]`RPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code) #p* 㿘!#֠!bx@1%s: %s - %s %s: %s 㿘z  / #` #`!!נ#А  !נ#ǐ @@A!    @Aے! ,,%s㿘!#ؠ!`@1baaaaaxa`a@Failed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OK   * $OpenBSD: strcat.c,v 1.4 1996/08/19 08:34:10 tholo Exp $J" @ J2  @(*`  $OpenBSD: strerror.c,v 1.3 2002/02/16 21:27:24 millert Exp $㿘 @a $OpenBSD: clnt_tcp.c,v 1.18 2001/09/15 13:51:00 deraadt Exp $clnttcp_create: out of memory `@bk  @bf d 2 ؒcx@0! b  ""` 2@= *` 26 @bn@bly  6#$   @ &@z  @    "  "cc"?O @[7K $ $$ $  $   L$  $  @@$ @@&' ''''Đ 0 @ @ 2  P  # @[  `€ P$ H``ڟ@ې"L`@o!|$@$$  @a @a h 'H'P\ L 0'L'T  @$ `$ T   @ 2 `   0&@$ $%`  H ``€H " $ € PL€   $  $ $@ q $@  $ $h 2@d   ` %  $ $Y % !&@'`'`''@'耢 F@  $ "'0<Ȁ2' @ $ $ 2&  T  $ $$ (€   $ ؐ $ $؀  &@@ $"  $  @ 2g&@ $ $"@("`,"`㿘  " L L@` `"  `"  " " "  "  "" " " "  㿘   " P@Y P `@ L@`@`P2 `!ؐ` 2 * @` ?@c  '$ $ $ $ $ $ $  @?  Ȩb@''+  2`* `*  $   @ b@> Ȗ"@'̒"`'Đ@? "@ '"`'@?' '`  ` & $@`v)?b " & (& $@`i?"@`b@Yq 2  6 & $& (?b & $& (㿘#  @Y[?&b?$ $$ ( @$OpenBSD: auth_none.c,v 1.7 2001/09/15 13:51:00 deraadt Exp $㿀! " 2  < @3 @ 2$" +  < ' ""&  a&  && &  &  & @T (@< @9 @& <  `@㿘 "   ` (<   $OpenBSD: rpc_prot.c,v 1.7 2001/09/15 13:51:01 deraadt Exp $㿘@ *  ``@ b!㿘@  㿘 @ ` " `    ``€ @ `  @ `㿘@  " @   @ `  @ `@ ֒` 㿘@ ڒ @ Ȓ` " ` 2  ` ᴒ`@ =  㿘 &`&` 2 @  @ ` @ `  @ ` @ `  ܄*  "@ "@ "@  "@ "@"@ "`"@"`qqqqqq     "@ "@"`"@"`㿘    &@  "&@ @ ڒ@ &`@ "  " 0 " 0 &` &`&` &`$OpenBSD: xdr_mem.c,v 1.8 2001/09/17 18:34:51 jason Exp $`"" " " "  "  "@ "   "@   "   " ? @dd(*#d ` * `* `*d# "  #"@d 0#d*@  *` *` *` "  #㿘 "  $  @`  @$  㿘 "  $  @`  @$    "    @4 " "       " "   $OpenBSD: bindresvport.c,v 1.13 2000/01/26 03:43:21 deraadt Exp $㿘@㾈`!'@l?2`\?@`  `   '`  '  ."bE? '` ' ) .` *`.@ '@A찒 +@A  #@" !   "@-   $"@ @ &$" $h C`4@$  C`4@$v C`4@$i C`4@$b C`4@$OpenBSD: pmap_getport.c,v 1.7 2001/09/15 13:51:01 deraadt Exp $p o6 b$?b$!'''#\ab7ڐ ! /",'",`''''' #\  ڀ    "c c`  ڀ 2   "c @܀?"6 @U6 ځ$OpenBSD: pmap_prot.c,v 1.4 2002/02/13 22:36:52 deraadt Exp $㿘@  @ `  @ ` @ `  $] C`4@$a C`4@$OpenBSD: xdr_rec.c,v 1.9 2002/02/16 21:27:24 millert Exp $xdrrec_create: out of memory 㿘@\o D ސ!@*ch05@ @$ <@ @\\$ @  $ ސ!@*ch@\y0 $   2 $   $ 8bD& & $$ $ $ $ ,$ ($ $ $ $ $$ 0$ 4㿐 4 ,0"  @&@4, ", "4@%   &@ 㿘    &  & & @- 2  & @ "㿘   4   8 2 @a 󀦠 8@9 & 4"$ 4@㿘!    " 8 @^m & @@$  @$ @  2  㿘`   @T–  ?@  "  , ?  "  0" &㿘 ?&"   0  "    $  , 4 "  0   ( "@ $ 4$ ,    " 40 @  @  ,0 # , 4㿘 @[c @[a㿘 @ "  8  & 4@ 2 4   4 4 4 8 " 4& 8 㿘 @ "  8  & 4@ 2 4  4 4 4 8 " 4 0 , `?㿘`       * "@   # ? " `""㿘 ` "@ @?* "   "     `$ $ 㿘 0 (  $ "  ?" & ,& 0 㿘$  0 ,     4@]: ,&@& ,@㿐    2 & 8& 4  㿘`$  0 ,  @ ` 4 & ,&@  c(/  ?$ C`4@: x؀ N "  @]'$ ` '' b@Dؒ@]$$    $:$$ @] $OpenBSD: __strerror.c,v 1.8 2001/12/08 20:37:32 deraadt Exp $㿘 ",@Ce  0?,@Oy  @CX  0,libcUnknown error: 㿘 @!p#| .  \  @<@ # ?x @/@ @]' "@,  "b# b@$b㿘?   "b ?" @\ @Yѐ 㿘?   =  @ @7   @.@08/`(@ @ @?@4@08/`(@р 6`6`@؆@NLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGC㻘 "?N @ / @w@[ 2 @[#ؠ 2#@[   J B  ?* : `(3"<*` € J@  4 @ 1 *`J@ ) @ **% J@   @  *`J@  @ **    * * L  :`%*@9?2 L 2 L ?P؝0@7 ?,@[ @Q$?#\   @[ @Q?2???#@ @Xt  && ̐@[?$OpenBSD: index.c,v 1.2 1996/08/19 08:34:02 tholo Exp $*`:`J   $OpenBSD: errlist.c,v 1.3 1996/09/15 09:30:59 tholo Exp $x`H0p`P8p`H8 xX8xX(xX8X@0hP8 Inappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisc quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0$OpenBSD: strlcpy.c,v 1.5 2001/05/13 15:40:16 deraadt Exp $   (+  2 2 " 2+J " ?$OpenBSD: strncat.c,v 1.2 1996/08/19 08:34:21 tholo Exp $JJ2 @(*`*$x C`4@$OpenBSD: xdr_ypbind_resp.c,v 1.3 1996/08/19 08:35:01 tholo Exp $㿘@K " @  2  @`@`$OpenBSD: xdr_ypbind_binding.c,v 1.3 1996/08/19 08:35:00 tholo Exp $㿘@Ք  `@ϔ  $OpenBSD: xdr_ypbind_resptype.c,v 1.3 1996/08/19 08:35:01 tholo Exp $㿘@$OpenBSD: strdup.c,v 1.3 1997/08/20 04:18:52 millert Exp $㿘@X` @U @W0 㿐@3d  ?&$OpenBSD: xdr_ypreq_key.c,v 1.3 1996/08/19 08:35:03 tholo Exp $㿘@#  @5` @n` $OpenBSD: xdr_domainname.c,v 1.3 1996/08/19 08:34:58 tholo Exp $㿘@ @$OpenBSD: xdr_mapname.c,v 1.3 1996/08/19 08:34:59 tholo Exp $㿘@ؔ @$OpenBSD: xdr_ypresp_key_val.c,v 1.3 1996/08/19 08:35:04 tholo Exp $㿘@r  @U` @` $OpenBSD: xdr_keydat.c,v 1.4 1996/08/19 08:34:58 tholo Exp $㿘`@-$$OpenBSD: xdr_ypresp_val.c,v 1.3 1996/08/19 08:35:06 tholo Exp $㿘@5 @` $OpenBSD: xdr_valdat.c,v 1.4 1996/08/19 08:35:00 tholo Exp $㿘`@$$OpenBSD: xdr_ypstat.c,v 1.4 1996/12/14 06:49:45 tholo Exp $㿘@$OpenBSD: xdr.c,v 1.6 2001/09/15 13:51:01 deraadt Exp $㿀 ' 㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 @ €'@€  &@  㿘`"   `  0  `@€ 㿘`"   `  0  `@€ 㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 @ €'@€  &@  㿐 "    0 V@ €'€   6@  㿐 "    0 @ €'€   6@  㿐 "    0 V@ €'€   6@  㿐 "    0 @ €'€   6@  㿐N@'   .@ 㿐@'В   .@ 㿐 "    0@  @ '€@€    @ &@  㿘㿘$ "         b82      2    `0`?xdr_bytes: out of memory 㿘@[ "2  2+ "   0"   @R &@  !@ `    @R&@㿘`–$㿘{ "   @ "  2    €xdr_string: out of memory 㿐 @   "7 @U' -8+ `  ` 0!  2@Q&@  !@ b8 ,#@Q&@  㿘?$OpenBSD: ypprot_err.c,v 1.4 1996/12/14 06:49:47 tholo Exp $  0(             $ $㿘@ union㽐@/  @T   <    "b @- ?@Q @$#"`@ `x4@           c@Q( @@Q0%@Ӗ  $@䀤c``@Iސ@/?  @P@Pr $@&  5"   ` , %   `$@@$ '@> , %   @ @ "$  2``2$`@ 퀤@P   @Pg*  2 & $& @P\&  & @P~@Ik  & && & @& 8  F@S @Ȕ   @P6, 7 0:" ƀ 4   ?@P&  ' $@ `,`  4`  @V,` . @S| Ȕ   @PH, 2 ?@P%?. "?@ Ā@ @ &@㿘@ @M`㿘@ @S` `@@?` $@@O$`@O@Hސ@SP 㿘@㿘@O   H  L*`    H#" # # #?㿘` *`"L@@  2 "  @  " : @H  & &   @6@  2 @O$@㿘  @&   22 &   2   2    @R  &   @ 2   "   & @ `"   2   2  㿘  % @R # $b  b  @R b  @Q@R  "&& $Ą C`4@$OpenBSD: qsort.c,v 1.7 2002/02/17 19:42:24 millert Exp $㿘  `@ `= @T3%``@$@#6 $"    ,*  @$@ ֘ Т06`@T|`@Tu`(q@Tn6`-    4  $  &  4  -% %    4      4  ``&$6? "" ? **@S-`)@` @$$@`6? ""  ? ** @3 π@0,)$` $$$`6"? "" " ? ** @ @ @-` `@@$$@ $6"? """ ? ** =@S%``@$@#6 $"    ,*  @$@ ֘ Т0a@Rߐ$@$ @  $`%`$@ 2`? ""#@  ? **#@@8``% 2`? ""  ? **@  @QĖ@Qג%$OpenBSD: strcmp.c,v 1.3 1996/08/19 08:34:12 tholo Exp $J@   J@J`  % C`4@㿈 "а`"Д   '?   @F ?"?"Ё$OpenBSD: merge.c,v 1.5 2002/02/17 19:42:24 millert Exp $㿀'D'H 'P  "bB? 'D ``?'H@R@L6  D0?H'P@,H@R` @@'耢' H@Q'` ?' @  ?&@  ?&@P€ ?  2" MP€F'€464'- P%@€$@($@P%@@Q2 P€4@P€4=" "  $@ `$@`/  ,@ ` ,@`!`" $@ `$@ ` ,@ ` ,@ ` VP ` $@ `   ,@ `䀤` " $@ `  ,@ `"  ''` ?@ @ 'D H@P@F@K+ 㿐.@` ?@P̒@$ &@PÐ@@@P@  ?@P@$   @P'     "``"@ "@   @,*@`$ P*$   $@ "@   @,*@`"@ * *ܢ$$  @,*@`"@ * $ $@ " "`?  㿘  ,*  @ `$@ `$OpenBSD: strncmp.c,v 1.3 1996/08/19 08:34:21 tholo Exp $2J@ "J`  2J@ 㿘 I@8   @ @o@ @o @ @o  "b ?" " " " " " r @(: а  ? ' ' ''''''!  ! @   "  "& `& . ``& i& &`D9 '"  @B ?#` `" 2``o   & b0@ f&  @"& #!X&  S   & @Lx 2K5 @ !&  a bx& & & & & & &  @F "'5 `  2   "` @̔ @Ȕ !  )€??5 0  "b5  @`"&@B& 㿘  `"" @ & " ( " "b?@C: '|'d 'h'`'l't'x'p ?"@   t  'lt  |x#؀`'t @'x| "'||#ؒ`@ 't'l'x'd'`'|'p| ဢ@d[ @H"$ \ @K"$?$a| $$a$at$ax$b@Hr$a J$`&& & & & & & & & ab  $b #c `!b& & & & & & & && ` "       b  $b @& $aaА`  @i?$ab  $b aВ @$ ?`a@K `̀@wa@AD  •  L!b@b ?F$b \ $b X'\ T/ P/ L/\'X/ H/ / /X'T/ `/ `/ `T//'P///P'L////L'H/ / / H//L!b@   O?"@~ _2z 'pb  $b $a$bp `؀!'p"'pp@ 8'p` b  $b b $aԐ $b $bp$ad p?*  'dpd* @ *'ddaؐ@L?l@L??* 2``4aܐ 4aaЖa@ې +$@b  `@D@@3?b  $b  b  $b @b  $b     O"b` ` "a@GEaЀ?@@.@G= 㿐 @1    2 2   @  "b, b 2,?"b@  "@  `2? $4 $ $ !ڒ 4 $ !ؒ @I@  @ 0?TMPDIR%s/bt.XXXXXX/tmp㻐@IG @I:"8"@"P$@%c?'@H @#T?@N> @H  㿘  `"" @? & "  !А "b?㿈  `@* $   "b'?@  ?  @@ 0#\  @ 2!Ȱ" @ @@0@$ P" `2@0' ` ` `.' .. . .' . .  .. '... . .. 7...7  `?2 .O.* 2   ܄ؚԘБ.`2 7 **  '. ***'**** ' `* `* `**' * * **`*`2  ² 0ki* 2  e ΰȞĆ.`2 @7 **@  '  . * **' * * ** 1'****'****' `* `* `**' * * **`*`2   P" `2@0 ? ``U2 * 2  Ģ+ 2 @  '``. +``+`+``@' +@ +` +`+`` @ `@' +@ +` +`+``@'+@+`+`+`@ 7 + 2`*@ *t`Ģk* 2  f ܰ؞ԆЄ̪ʑ+ 2   '``. +``+`+``@'`+@`+``+`+`` @1`@' +@ +` +`+``@' +@ +` +`+``@'+@+`+`+``@'+@+`+`+`2  7 `+ ʒ@2*` *`' . . .'. `. `. `.'. . .  . . ' . . .7. .7. ..t#tp * d * #p* l t`*  * (` (` ph(`  #l  * (` (` l(`  #h * (` (` h(`  #d  * (` (` d(`  #` ` `* (` `(` `(`#h ``"b @@ $`b   "`(    `    "b?`aܐ < (`Ԑ@2? '' @> `@> `aܐ Ԑ@?Ӑ '' @> @> `aܐ ̠Ԁ2 a@ @` "?)`  Ж@ 2 @ ?  Ѐ @@  Ѐ "`b "`@m?2 `@@ ?`    ?  "@ @ #\@J c0m,* 2 2`   , "*@>.  ,  6 "@6  2  ` &  $ ,@ `@>`@>`(@ @@ 2 a`@2a`  4`a䀢 2@  2  5`?2 ?@2@ $a 4a쀢 2 @`2@ $a4a$a@@  2b @ b   $b 㿘 @!袒 2!I&!& 6 ` ` ` ?"@  @*7!䀢 2`` 2/*2 2`?@2' @ &  6!6 6!쀢 2* 2 @ 46!쀠 `?&&!@*  㿐  `"" @ $ "  I   B @L@   6 " =  @k /'`?2  2  @/ 2*?  @N`?2     @  ?`?@   "b? "  $" 㿐@ @ @ " @@`"g@ ,@   @ "ް ` ?2 ? =@ !?&! 2"- 2 `@@  ! "!2! @t&!@ܔ  @f @Δ 2 @! "!2`! &!@@`2@ y@C @ "y @ i`e ,@.   @ "c   A@ !?&! 2""- 2 `@@  @ @m `!"!2`2!  &!@ @T 2@  ?@ !"!2`! &!@"`2@̔  @4&@`?㿐 @ 2z x? 2  @n`?  @Q 2&` @ 2M" `?2  2 @S <?0L@ H ? 2 @ ئ ` ?2  @" ?#@Ӕ?"%    4 @  " `?2  @S  @K  ?@F ?@ ?㿘?r# @  ` - @  @  ?"u`?2  2@@   4`!ڐ 4`H$` @ 2q?@ 1 "D!i?`` @$ @;T`?@4`*2  ?#  2*`2  `?2 "?* `+ 2  *2*` `?4`@ ʔ @! ,@&! 2@  @   @  ?@6  @ ʒ  㿘 (@   @  .@r 2m?.@  `` @ n` ?"^?` " @@` @ b@ ?2@P?`@ ` &@ @:@6*?#2@   3*`2   ?2 "?* `+`2   *3*`  @?6 ( @ @2    2  ?6  㿈  ` ,`" `  `  #\'7 @) 2 7'@ 2 ` W,`?2 ?7'@  ` C,`2`"@ : %' 2`7@o 2 `" @  ?2 ?2('`"$'@  /?'7@N 2 ` ,`@   $@4`@  '7 `#\  @  `  ,`㿘``"`@ ۔  `"@ g ``" @ ̔ 2`? "@ V  㿈 ``"@@ J $``#*` € `( @@/  "b? @t#\a@Cab  @ @ 0$`TtTttT,t,㿐`]!*` €     "bL?@F    @ @ F "7??2  "  "&@)6` @ ǔ %   * @  @  @ " "??2 `" &@?2 ?6` H㿐  `  @WS @   D "" `D6` ` ` *?2`2 @5  @ k  @ є " &6`   `,`&@` 6`` ? @ M 2 @  2??2 ?6`&@ 㿐@ 2~ "[" 2s' '@   @  ' ' 7  2&  +@ @   @ i 2$@2D? @  >??2 4  4 @ @ @ ה  !& ?2 @2 @ Ŕ `2 @ ) 2$?4  & &㿘  " (@=& &  (&   . (6 㿘 ,&! @  2& l  2`*`    , 2 @6 @-   "@!&P, `?, 2   +" 2$&-`    @Y 20 4 ?2 @2&  @# 2 &6  , 2!,2"!2`! &!   @ *㿐 @ ` ' 7@Ĕ  @  0 @   & & & 㿐 @ i` '  ?2 ?7@  @  0 @   & & & 㿘@`* @\7    @A 2n?$`2" @@ @;  @<7 "T?&& @6&& && "B  `   @` 4?0@`2 " @"$  `  (@ @;  @; 2'@?  '`@`  @6  ' @'  ' 㿐    2    * @  2   * @    ' '   !@!̀ "!?'!€ `8 @  " ` `` @ @    ``@㿘` `@Ք $ @& ?2" ?$ "@>M" 2?" ( @@"! @4" 2?@?"?p `` @ $` 2 @ |  t 2 €??"k?  @3 @2c?$ '' "آ   24$$@3䀢 G   "$$  ? ''@= ` '   $$?  @3  ? @Ȕ  ? *@$  ?㿘 ``@@ $`@0 ?"+?@@?2`$? "a@:s$` $`a "a@:k$a$aaȀ "a@:c$a$aa@:^@:\@3I  ?㿘  ``@۔ $ `  "b?" `  `@? ?@ " ?$" 㿀 @# L" !ؐ!b!Ԕ " ?'''' @4@  ?㿘T    "b+?` @34 `" @  &? " 0@9  0` @@"$ 0@9 $ 0 D "$ @9$ D$ 4 $ 㿘 @=1   ? ɚ @<ʖ @=$ 㿘  `@D $  @`2"  "b)?@ " )" !€ @t  ? @4 "   @@0@$ 㿐̀ Ȁ @9J @9`2B?$$'3'Ƞ `? "`@@  "@?2,?2,` @<)@ ̀?*   !$ 㿐bK ba#a̐@ 9?D?2.a̤!!a$à &@8ߐ  @9 $a. a`? "`@aa@  "@?׀aȀ?&''`Ő?*aȀ b  !$b 㿐bà aȀ @8 @8`2 b6?b  !1$b $a$aab'b'b$b b a* 2" b@; @ Ѡ  ဦ$b 㿐bb  b%b*'b  !$b   2 &'@Ж  ? ߰ $b 㿈  `"" @ڔ $ " "-" "*8T !̀ :!Ȁ @8 @8L`?"$!$!@3 !!" "@; " !'"''' (#|. € (    $!"@"  @ "@  " R   "bM? 5" )2 "!€???" %" "" '@7" '"'@: " "'@3 #?"`" "@7@   "$ $"  $"  @H   44  444 xa @֔䀢?/ ?' ' b@  @M  "b@@?2 @@ J?     ?`"@ @. 2 #\@>ڔ 3b /$b. * 2`2   .  "*@2  .   4 "@4  2    $  * @1b b$b @$b@ 㿘  `@ $  $ @`" "@@% (  " 2 $ @  $?$ $ "b ? "  @$" 㿘@ 2@?`@ @G  @B 㿘`. @   " @( ?2I?`` @& @1{. ``@ " @: ?6`?* c2  @ 3@*`2  ``? ? @" : ?* `+ 2 ` *3@*` `` 6`b?$b㿘@  ? ?$  @`$㿘  @/t㿘  `@.  $ 2 0   ""@4 G?"  @/T @? $  ?4 $   4 ` @@" <@6  <$ 0 $  8 &$  2 @- @/Q   $  $  ?Ȑ*@$  4 2 @ 4 4 $  㿘  `"@^ $ `. `*` €@% (" ( #  $    ( " "  $?2"G " )2"!€??<?"  "b5?" " )2 "!€ $" ـ8 @\   ( , ($ $@"   @@0@$ xxxDx㿘'L!Ā ! @5% @5c `; &!&!!L@0#  &!& "@ @`* @   !@3!̀ 2.?&!" @"#!̲ @ !Ȁ @4@5*`2&!? &!!Ȓ@/' !'''  㿐@/ה ` @/Ӑ& :! @4 @4`$?&'!?@' @ 8@/@K "@`' 㿐` !@?@@k %? $$ $ $ 4 @4  @/x $@ &ۦ@  㿐@/] `@/Y  @l 2` ? "!@   ? @Z "'`'@ @ 㿘&`!Ԓ&`"  @&!@&" 㿘!Ԁ`@2   !&@" `$" $!@ 㿘 ,&!  @ J  $@& 6 m   ?2  !*`2 @`*+@   @( !2 !&! В*2 ?@    ?*2 ?@    # @e @` "' ,` *`  ? *`   #  @F !?&! ` @@ ߀$ 8@6 # <    "b  @ $(  &&   ""  &$ &$&$&$"$$"$"$ mpool_new: page allocation overflow. 㿘$?` @Ő!@4@. , $ &$@"&@" &$   *   * "" 2 "" "" " @2 &" & 㿘  *  䀢@ ""`@ "@@ & "`  @"@"`@3  㿘@O ?`  *  @ `"`"` ,@"@$`$@` 2@"`" "@`@` & "` ` @`"`$` $` @2 &" &  ` `T,`&"@@ 2$I @8k $`@#$  ?  `@5   "b$` ,`` `  `*  ,`  $@$`` 2 "`" "@$` $` @2 &" & $"`$$``` `*` *` 㿘 @ & "`  @ &"`@2T 2@2N 㿘   @f?2  ? 2 @$  ?㿘dd @*;d@"7d  2/  @A?<    *  @@  ""` @ "@ @ $`"`  @ "`, $@"2 d@1ǐ    d@4֔ $ , d $d 㿘$ "$$$``$`@7 `$@K$ "$ ?"`$$``` .``("   2 2  㿘'L'P'T'X@L$_ C`4@㿐@6  @   ``  @  "b @) " 3  `4!3 4444 x`̔3 # $# ,# (#  # Jr  wa           &  "  J+b  J +    "@ %$sniglet^&8`    "b@!ܢ  ?$a$a@[?$a " @ w a@4@   ̀@`@  ` @ N  "$a !$a a@)!?! "p! 2 O@!a@2 O`?   a  €!h`@ "` OX! `(@& $a@ 2V ` `D* a8` `*@ :@ *`$a@3   `@=`$a0@=\@$a0  a @ ?$a$$a4@0Z $  ! "@֐"$"       bĖ"Pa & & & & & & & &  &`@)Ja@0Y$" 㿘 ?@ @0L " ? ?   ⨐?8!` ! @$ $ $ $ $ $ 4$! $ 8$  D @3  Ē @3 @` @ :  @ $ $ - " @ w *@@@ $ $  2$ 4 2$!  2  ဢ@ d"$   "b  $ @  㿘 4@%'  & @ @  *  D# *#  * ,& $& `@ږ " ?!.`2 ? & ,& < & 0@%& (@  , @4& @㿘!4@<|    "!؀ !!ؐ?* &! @/!??&!@/!@W 2! "! 6!!8, @ "!@/q! , ! "!@/f! "!@/`!?@(I@/X  ""?㿘`  "b? "? !4  @<  2 ?@  2?&!0 㿘!4 1aa!  & &  !h& @!! @  ?!? O ""&!, !8 đ, ` , @ @  2?  ,  㿘  @=   ""#!,?㿘  !   ""#!,?  @ 㿘      @    """,?㿐 @ @:w ?P ` ` -` G`   % 2  `@ @  G`   @:J "s ``݀@ +2 `'@* 2 `@:, "W ``  T?` ` @ F?F ` `C `! ``+00 `6 `,@  @͘  & "@&@ђ 2 `@k  `?@  ?0 @/0?? ` ?-`㿘     ""$!,?!$   $!($!$$!  ! 2!$ $!( ( @9 "m?$! @ "  ($!$?$!$_ !(*  `2@ *@ @9 $! $!(`  @ `!$$!  $!$"! @ "! !**`     @   *?0)! ` @ @ &@@ ? " &`! ( 2  @& *@ 2" &@  !$ $!($!$$! $!( 㿘 (  4  0& (!@   @  *`*`!@0 "+?&  @Ȓ !ؓ,` "  ?!! `&!&! (@     D*` + "&  ,  & ,& 0@+㿘@,  @'&@0 @-$㿘! € , (  0㿘 @z   &!  @s.@   ! "J$"?6  + +* !ؐ@" ! `&! `7 ``20|(* * * * * * * * ؔ :;X;D;0;;::$OpenBSD: calloc.c,v 1.5 1999/11/10 20:12:31 millert Exp $㿘@23@,W @/g 㿘,` ``$, @2 `@'N,`2`6 $, 2 @'C`,`2`,``2 6**`@6$ 2`2`㿘`. `@C"?. "  ,"* *`@`2 `" @ @' @4.`22@22*   @4 248?$8``.`㿈  @7Ė   @7 2 j?- .`3 3`@c Y  - `  -`@<`` , @ '2$'2%* "@ , 2 $ @ @&@ "@44 @ '" ('`@ʴ@ "* 2``**`4@@% 2`@* 2   - ` ?-`p?*2`@   ?* 2   #\@; 2?܀؀*,`2 ` 2%`# + 2**4' 2*`* 2 2`@7 c  @e   l  i,`,`2  ' %@ '`' `# '`2#  * @  `@  @Ӑ "w #. * @  `@ c@ 2"?U .`* 2`@  *` `8,`,`2  *F @ 㿘`- *2  "3  * @ *2  `%*2   @ ` N @ ?@6P "\?``"    ϖ*``ˑ*  *  @  `@ `@= 7 `  *  @  `@  Ҕ`@M "`?@`  .` 8` & 8 (@{` 4 $ Ő?㿘 4@@ `2  & 4 & 4``@h.`,`2 `@5֖  &` ` *`*2*  2224`㿐!  6@  ?6` {6`  <@A ?*  D@  3 *  <  '@0 ?*  D @ @> @"? J?  O"bB?6@`2  @ 2  6@ ?6` 26` ဢ@-`"@ :  &@?'  .@ .`.`.`` 7.@.`@  `@?7 .@.`` 㿐!? @ϐ 2i?  ဢ@,! "@ :  $'++ + +   `@`7 **  <@ ?*  D@  4 *  <  '@y ?*  D @ @> @{?   O"b?㿘@( !!<   , &! @+ʐ " @+Đ?* $ ĕ.2 !8.`" $      (HASH: Out of overflow pages. Increase page size 㿘 D, `$* : ?: 1 8. @ @c À2 * ?  $* ? @  :  ? ?e` *` Ց. ,D@  %$@   "@ * $@ g$ % *` ,$   ?$   * ?2%``m, L  2l ` g $Z% * ,$  , ?$  :** %  * @% , ;I  :**$   * @%  @-*` $ ?%$  D D .  4  ?* D@$@ g. .  6 c @  1  "b 㿘`2 ` '*  D@  $&& $ !8 : +`*`   @{  :**$   * *# @4TMPDIR%s/_hash.XXXXXX/tmp㻐@) @)###$@ ?'@)< @?&!@.! @ݔ  @)- ! ?㿘,``$4, @2 `@".`$ 6, 2 @"%64`4`` *`$ @2`* 2 㿘!@6 @& .`!8$ .`     *  2@'  ?*@    2@* *@ 㿘`*  m* 2 *`*  4`$ , 2 @!  +  +  42*`4$ 2+ * 2 4 `|%0+   &@2 @ ,$@,`4 2 @!4 5?%@*"@2* 2  2` `.`*`@`?`*  H* 2 @ @"**  4 $@ ,`2 @!@ +  +  42*`4$@ 2@*  2 +  4 ! 2`?+  4 `` .`*`@`? 㿘`  * 2  ( `*  ` * ?`*` .`2`@1ٖ ?`   +  ?  `22`$`%?$`?2  + *`2 "  2 ` *`@ 2` ` ,`   8 ?$ 8㿘`,  " * 2`@( `$*, 2 @ & @1u $@``" *2   **2  ?,  @ ??㿘 @+  ? @1H "    +  @  `+ &@  㿘`.  `2.*  ? @1 "s?`  .  `*  ? @1 ]` ?* @   2  "?@0 -,`D?  &" !&  * !$  &!(&!$&!  ?@0Ӗ (&!  &!(`@ 2" !$&!  &!$ ,`2 @?&   !@ƒ ! & "b?㿘`   "@(`! @$@$ @&!, &!( * ?@0 /&!  `,!$&!  &!$* @0p Ĕ $?,` 2 @  ! `@n@ 0 "b?㿘@  ?&! &?㿘```? * 2 "@ ` ! @$^@$5 /$!  ,%?@* @0 ΐ ,` 2 @  !``@@ 0 "b?㿈\'P 2d? @ P* 2`` 4 P@/ؖ $ L?$  `"`` *``/`` *` 2`6 *2 *62`6@2`* 2 P$$  `` *` *  *` 262*`@2`P  ?6P"$ $ $OpenBSD: memcmp.c,v 1.2 1996/08/19 08:34:05 tholo Exp $" @ ` ?  2    (  $\ C`4@㿐@3 ?㿐 @' ?㿘  @  㿘  @   㿘8`  "bL 2 $?  "b@$ L@ a  0,@v ?L`XL X`?#@  @) 4GA,?L X` ``%<'+  L/2?,@a X, `Q%b8L`*@6!  &@D , A, a, "`5 " @-!  "`' @  b `? aL Z2c\" ,  @ `ʀzŀ  /dev/arandomx @ۨ#@ߒ ?@ x@s   %?p    , 'l p l @ʚ ?2 ?. ` `.   @  @.  ` , , . 㿘  `  ؐ *@? # **؁㿘  `  bؤbؐ? *b ` `,  @ R@, ` - - ,㿘  `  ؞ؐ (ؖ   ` + *  *ؔ  (؄ ,   ` + *  *ؔ  (آ +` +  *  *ؘ (ؔ ( + *  * $t C`4@$ C`4@$ C`4@$ C`4@$ C`4@㿐#\#`  @$  㿐#\#`  @$z  @'P'T`'X#?"77'P`''''@o`*$OpenBSD: vfprintf.c,v 1.17 2002/02/19 19:39:37 millert Exp $㿘` @&`&`&` @   ? ,$ 7''7'''''@1 @5 2? @  @4 InfNaN0123456789abcdef(null)0123456789ABCDEFbug in vfprintf: bad base0.㼐@'H'` ` 2 ` @I   "b*?`   HW` HH<'$'8 ''''' '$ @'$  $< %'$'$$ $$@ '耢 '[ ޤ ' $  '$''?/+$J@`'$?`X #P*` €O+ $ /+ $ L ?Ѐ 8, L** ?Г:`  L $ 8  '8H8@8 .' '$.' $ '  +/+$J  *>'$L ? 8, L** ?Г:`  L $ 8  '8H8@8 .'$.?&i?h$?Ѐ  , * $?РJ@`?Ѐ '$ $?&U?T?M  , * $?РJ?Ѐ '$ $2A'8 9'8H8@k2$/ - @$J l2( '$$ 8`@.@/@   ''8 @ `.@*  : `.@:  6q  -/+`k ? g   G  "  8`.@''ȴ?`".@''ȴ?@&L #ȁ  -/+! @&K ! ,#`!#\7@ƚ0 g G00?@$ g g E e e f'0@' , @ ,`  O7 @  O7`  " O7 C  -@/+  8`.@ :`:  `.@ " @ 8`.@ 2`.@ "   '' 8 @ `.@  `.@  8`.@a '  q x8`.@"   @! "$/+@!   'x'|x 8 @ `.@  `.@ / "!耏  ''X'\X  8 @ `.@  `.@   2 /+ '?`S "  7F"   4`,  `4 0 , 806 03,  @!o `0, %  ` `0, , 4`  ` 4  ,'@  ' ? @/@ /+ ''O+ `' '`4O+" . 3c $$` '耢 ': ? c$$@ '耢 '$ O+  + $$`  0/8/98 $$` '耢 ' `4" . +c $$` '耢 ' e? 4$c$$@ '耢 '̒ O" - +c $$` '耢 ' 5? 4$c$$@ '耢 ' ! e$$@ Fȁ BV0"@ $$` '耢 'u 0,@  $$` '耢 '\ ߤ,?  +c $$` '耢 'B Ť? 4$c$$@^ ``,"@ $$` '耢 ' $$` '耢 '  0  - +c $$` '耢 ' u? 4$c$$@ '耢 'ܒ _$,$,@R$,$, @ '耢 ' B0,"@ - +c $$` '耢 ' '? 4$c$$@ '耢 '  "H $$` 0$0 @ '耢 'o 0 "H $$` '耢 'Y ܤ$0," $,0" @ t , 4 R   ./8/98 $$` '耢 ', ȁ B,$,?$, .@ ? 4 +c $$` '耢 ' ? 4$c$$@$$` '耢 ' f$ $  @ '耢 'ϒ R 1" , 3c $$` '耢 ' 5? 4$c$$`'耢`' !8 &  ' 耢  8' 耢  8'8`@"` @ ` @? lwHwHl$wHwHwHwHwHwHl,m,wHm$m8wHnnnnnnnnnnwHwHwHwHwHwHwHwHwHwHoxp$wHp$wHwHwHwHowHwHs4wHwHwHwHwHtwHwHuwHwHwHwHwHwHwHwHwHwHoLo|p$p$p$o o|wHwHo(wHrps8soDwHtwHtwHwHu ?`/*`d * d *`d * d*`d*d* N%2   N `X#"*` €N ?` %L* @ L*`ДЀ @LN*6 N ?`  L* @ L*`ДЀ @L $@  @ d@r`d *@`@4 d@d`d *@`@4NЀ NЀ   +  * ?И NЀ  $ @ `@d@2`d *@`@4qpN `@d@ `d *@`@4_^N@d@`d *@`@4ONN@`@d@`d *@`@4>=N@d@`d *@`@40/N`@d@`d *@`@4N@d@Ғ`d *@`@4N `@d@`d *@`@4N@d@`d *@`@4N@`@d@`d *@`@4ߦN@d@`d *@`@4ѦN `@d@`d *@`@4N@d@p`d *@`@4N@`@d@_`d *@`@4N@d@Q`d *@`@4N`@d@B`d *@`@4N`@d@3`d *@`@4rqN `@d@!`d *@`@4`_N@d@`d *@`@4PON@`@d@`d *@`@4?>N@d@`d *@`@410N `@d@`d *@`@4 N@d@ђ`d *@`@4N@`@d@`d *@`@4N@d@`d *@`@4N2N@* & )d+ " d `#"H*` €`@?``@? ``@?``@?x`` $d @             0TT0TTTTTT\0T0T0TTTTTTTTTTTXTXTTTTTTTTTTTPTTTTTTTTTTTTTXXXXXTTTTTTTTT㿘@  * @P&@@@& @  @S$ &@㿀?"\ f#   e E  #Ё 9/ -/?#\  ?@W耤 g G f# fJ 02 @cЁ B  '@@#Ё B3'@   0`*@@ '`" "@ ``, -,   +,  ` @-  0.@ A ` `0..   & 0. `0. &@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  $OpenBSD: strtod.c,v 1.15 2002/02/19 19:39:37 millert Exp $㿘 #.  ` @ " ,, @ސ "`"`"`"`   `("@ 㿘? #  @ @@4`4  *  $ 2  ,   * @L ː, " & 㿘 @   *`   "`"``   N      &N    ?  * ?<* 0*  *   @, 0"@& 0"@" ?  0 0 0 02 "@0  "@㿘&  " " 㿀 `@6  `  ` . ' , `,`% *%@  ''@ L@ @`'?c '? c@ @  @4`4 444 4  $@? #@ 4 4@4 @   4 $@  $'  "' 㿘` #ܕ*  >``#!  (```"q$ ( $@ 2^$@"`" >`U>``2@㿘>` @ *@  Z `  " * ` " * " 2@ ` "`" & C`(` " ?8 㿘     H     ` * `@ (? # @  "  22: "  33 ` :`@  ?# @  : 2`@ 33  :`  ? 2 ?   ?0  8 4?8      ( ;``"##㿐  * ? " &@ " 4  ? "@ ,2   ? " 3 ,  . ..groupB0 master.passwdpasswd0pwd.db0spwd.db protocolsoservices#oSdisktab.shadow8T disktabU fstab*BV resolv.confW hosts ...wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: guest:*:31:root utmp:*:45: www:*:67: network:*:69: named:*:70: proxy:*:71: dialer:*:117: nogroup:*:32766: nobody:*:32767: root::0:0:daemon:0:0:Charlie &:/root:/bin/csh daemon:*:1:1::0:0:The devil himself:/root:/sbin/nologin operator:*:2:5::0:0:System &:/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source,,,:/:/sbin/nologin smmsp:*:25:25::0:0:Sendmail Message Submission Program:/nonexistent:/sbin/nologin popa3d:*:26:26::0:0:POP3 server:/var/empty:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico www:*:67:67::0:0:HTTP server:/var/www:/sbin/nologin named:*:70:70::0:0:BIND Name Service Daemon:/var/named:/sbin/nologin proxy:*:71:71::0:0:Proxy Services:/nonexistent:/sbin/nologin nobody:*:32767:32767::0:0:Unprivileged user:/nonexistent:/sbin/nologin root:*:0:0:Charlie &:/root:/bin/csh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source,,,:/:/sbin/nologin smmsp:*:25:25:Sendmail Message Submission Program:/nonexistent:/sbin/nologin popa3d:*:26:26:POP3 server:/var/empty:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico www:*:67:67:HTTP server:/var/www:/sbin/nologin named:*:70:70:BIND Name Service Daemon:/var/named:/sbin/nologin proxy:*:71:71:Proxy Services:/nonexistent:/sbin/nologin nobody:*:32767:32767:Unprivileged user:/nonexistent:/sbin/nologin ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs  . .. 0@ 1@ 2@ 3@ 4@ 5@ 6@ 7@ 8@ 9@ 10@ 11@ 12@ 13@ 14@ 15@ 16@ 17@ 18@ 19@ 20@ 21@ 22@ 23@ 24@ 25@ 26@ 27@ 28@ 29@ 30@ 31@ 32@ 33@ 34@ 35@ 36@ 37@ 38@39@ 40@ 41@ 42@ 43@ 44@ 45@ 46@ 47@ 48@ 49@ 50@ 51@ 52@ 53@ 54@ 55@ 56@ 57@ 58@ 59@ 60@ 61@ 62@63@ @ <|8ـ<|8ـ<|8ـ 69<}<}<} nx<}<},<}, G<}'<} X<} XPXs d<}I<}v<}v   PC)<}f<}f<}f $a<}W<}W<}W_Am<,<< [!<f<f<9{-a< < <1- +zR!<ׄ<ׄ<1-{ >ja<G<G<1-!fɓ!<<<1-{!a<e<e<1-"*r!<(<(<1-{"U&a<><1-{/q]a<G<G<,0yky!<k <k <,{0ha<4΀<4΀<,1"!<(<(<,{1Ua!< < <,{>=Fa<沀<沀<,?0[!<v<v<,{?X!<z9<z9< W!<f<f< ݘ!<u*<u*< zD75!<W<W< oM!<p<p<  $!<G<G<GoV!<k <k <k o7a !<4΀<4΀<4΀o\@|!<e<e<eoN!< /< /< /itA!!<) <) <) y'R!<*T<*T<*Tag!<,<,<,ap!<-D<-D<-D?^!<><>bdO!<<<!<t<t<t!<<< !<e<e<e:*!<<<Sc!< U< U< UW!<"<"<" r!<#F<#F<#F Zu!<% <% <% !v1!<&6<&6<&6!ұ!<(<(<("Z!<)'<)'<)'"*1!<+<+<+#۞!<-L<-L<-L#-J4!<.}<.}<.}$;!<0G<0G<0G$LCs!<1xˀ<1xˀ<1xˀ%h!<3B<3B<3B%Ei!<5 R<5 R<5 R&D!<6=<6=<6=&>b!<8C<8C<8C'HO!<98p<98p<98p'e6!<;3<;3<;3(RJB!<1-<1-<1-(9d !<bZ<bZ<bZ)OD=!<,<,<,)g!<]J<]J<]J* E!<'<'<'*?0J!<р<р<р+tO(!< !< !< !+v!< < < ,.+{!< < < ,K^%!<沀<沀<沀-b? !<v<v<v-n!<<<.R&!<f<f<f.!<u*<u*<u*/ $wc!<><><>/U!!<<<m[!<t<t<tchFU!<<<@Ѵ,!<e<e<eCP]V!<<<'^v!< U< U< U7m1-K! !<e<e<e !<(<(<(E]E7!'@ 2:%`"_H%`  #.` ?$%% B"@ $%c*@?$&@ .`% B@?$% B #*` ?$% ?*%@P #* ?$% B?4$ :"  ""b䀢 H   + @?$% B?: + ?,$ ?%( B?  $(#a?_]  #* ?$% ?K:4 `Ȁ + ?$% B?: + `@?"# D(?)F!?()BD F?   ""b䀢`|H 2?@?r  2'''m  0[5 # @  I ?   ? ?2@ :?8 ? ? ! B0& !!+' a&1'? "!!a!a!B'aB &'??@n?Ѐ B- %?,??? @'cD?   #"D?! aB B?d?? @D?   F#' €?!  a( 0!0 ``` *@s` ܒ `       $@  ?3 6" @   4`% & $@    2`&  u & V  ?H 2"?"쀢 #㿘 t -    `@a `1?#  @ @@4`4    "@ @2 @:`"44 3`: ('  "'  0?#`  - @4   4` " 2 @:`"44 3`:  ('  "' InfinityNaN0h #'L'P'T ? # *@  "" "#Ȁ`6'@ '@ * '  T#"@̀ ,?,,"0"@\ N    \"8 B T "\,ְbH "  +ȓ2g Ⱥ| ?* &' $2`   @Ȓ"@̐$* 2@ ̐"*@' !@B?{͔ ? '?!H!P' Fa`X8JHBH ' B# '#, $ȇ%)'#?    '% 'L 8'LL` 'L L "'0"ܓ* €?'? 'P'P`P 'PP' 'P '쀧`   ` "#  ,  `" "# ` Ⱥ  '  c* @<"  #Ƞ    ?Ȁ  /`@ &' B<  `ȅ!?Ȳ`c* @>`$Ȁ %B?  /`@ $ȇ%B?ȡ<  `耢 ah 9' 쀢 ap B ?'ȀF!x?0D'@'&!  '$% ?ȅ)  P?䀢 Ic* @`$%! ȑȍB'`0-@ȍ…&' Z?ȉ"!h#ā) 0 @6T?!pȑ DDB?ȅ'`0.Ȱ …&' 8?ȅƁ)} 0`@4?Ȑ* c@ $% B!pȀ@B'`0.Ȱ ?!D-Y 0ȉ&' 9?Ȱ?N 0"? Ⱥ`D??Ȥ  ZX#, "P #    a Bȁ  1-@ Ȁ@ȍB'`0 H.Ȱ  ?ȉ"#B  ?ȅ$%H` 0?N 92?-@ . !p B?!8D`'Ԁ ! L ؀d3 6" &$' %  ` @4%%&@䀢`` 4 y p L̀ 2'?@2 '   ''  *`p  "@ `  ` "```@h b耢`  ݒ  Ԕ 쀥L  Ɣ x  1Pɤ8 1-@`Ĥ``'܀'  Ը* @     Ԁ   ' 'Ԑ  `Ԣ 01G  %a` L` ̀ `9+ 4`f.& ``L`̀ `  4`2N.`"K.``:  9E. `9` 9., ;..@   # ` 0.@  ɒ 4 ??`N  1?N 9  .-@`N 0"?   Ԁ`@ސ ܐڐ2. 0-@` .T"\2"@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  +dd10ȅ(#$OpenBSD: localeconv.c,v 1.3 1997/07/23 21:14:40 kstailey Exp $d$ #0       $((()(*(+ (,!(-"(.#(/"dh 0"0 "` "`"h0HHHHHHHh``.㿘` ` ` 2 @@   "b?@`  ` `, $$ ڤ`" $&`ְ `s "` `@  @2` :` ``#. ` *. @ a` ``&@$`$`$@$`` "`*@@ `@"@$`$@.@` @ @@@<$@ 2` `` `,` $u` ` @ `@"@$`$@`" $&`b   `  ` @ j "@  `@ ` `@ @ @ K@@@$@ +0@ `,` 0   @ 1`@"@$`$@2`@Ɛ   `" $&` ` ? @4` 㿘  `2 @& 2   +?"  0` @@"& 0@u & 0 &   ?6 &  6   2 @   &  &   &  㿐  C & & (&@&@  4  C  & 6 & & @ "b& &  &@ xV  2  6 8T  &&@ `  &<  ؐ`?`&$&@( "&@$ L ( (4!@"$㿀. * "* @Đ  * ?  ? #   ` `? P? ?    ( 0 8 @ H?88888 8(80888@8H8PX㿘  `@Q"   R X 2 &  ?2 2 """""""0"4"D"H㿘@ " `  ` "@` 2`} $㿘4@Ɛ"ȁ4@   """`㿘T @j  P > B< P ?Đ*@4 㿘 ! V  @6  ?Ē* 6 V @R㿘T   @#?  2  ?Đ*@4   4 < P㿘@V $ C`4@㿐 @ f  ??#\  ǔ@   @ V $ C`4@$ C`4@㿘 2 4@7"    @  "b?㿘T` `  ` `@" $@`$`` ? @4`  $`` &  4`, 㿘" ? T` "??`X2$OpenBSD: getdtablesize.c,v 1.2 1996/08/19 08:19:20 tholo Exp $㿘@ x? `}'5"t*` € G  @耢 ~?|z d W  7  @耢 n?l ,  )  C  #     : !              '9'    '1'                    $? ܖؘ @R ? ܀ ?  "b ? ܖؘ @> ??܁XdԄԘԤԌ $0<HTdpՄՐ՜ըմ$„ C`4@/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin㿘 @lU  N `2J    < ; <"5c@f <9    1 ",  ?`#6 ԓ*` €#?###    (",&  &  "b?LXdp|؄،ذؔؠؠؠؠؠؠؠؠبذ$ʄ C`4@$OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $Y V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @* error: xP >8 x*` €#* <%##2 8%# 5""  1"b .""  *"b '""  #"b  ""  "b ""  "b ""  "b %А  %! "7!h$"$"L  Ѐ   "b#\   @y? ?"b7!@ c 2 "? #"b( "" &" %## *` @z%# "b&bޔ`ބ``ް`````````` ````````<`T``````ޤ``````````````````0`L㿘# ?b   * `""` "@""" 6  4  b"  * "   "@  ""  ` "Ԁ`. @ƒ Ѐ`  b܀ "b@㿘? (    ) ?:   :  ",    2 2 *   *,`  @    6 6   : 6 * 2 2@6 6 & @ 6 @@M 2@*6 6 6 6 &  4 `   ?2 * #@ `" 6   2*  (   #  `  +@ 2*` +@*#  $@ ?6 6 ` b " * "@"&""7 " `  "   `* @ " *` 6 ""@& bԐ#: *   ,    @ allocation failed. 㿘 "` "`@   "` 2 9"0 "Ѐ` @ malloc() has never been called. junk pointer, too low to make sense. junk pointer, too high to make sense. modified (page-) pointer. modified (chunk-) pointer. chunk is already free. pointer to wrong page. 㿘 "`@ "`2 9a#"4` "@ 9Y#@ " 9R#h "*  ?@9E#`@ !`@   "Ā`8@6?@20D )  * ?@9##?,@2 2 *`  29#  bđ* 2 @2 @ 09#p 0   ` @0@z@page is already free. freelist is destroyed. 㿘  "` 9B#0"` "6 "@ 94#@0 " 9,#h0 "*  @0  *@ ?. 2 9#0t2 *  2@  ` 9#0e "Ԁ` , @ Е,@  *@$@    `4  "* @" 2  @"@ "@   :@ @" @ "@  * @$'"@$@@@2@"@  b2 " "* " `2  @P  VT in malloc():recursive call. out of memory. 㿘! "; a "  $";! " ?$"," b̐?$"䀦 ;K!8 in free():㿘! "; a " $";Z! " "?$" in realloc():㿘 ;"@ "b  ";<! " ?$"䀢  O" b̐?$"䀦 ;!8㿘 :" 0Ȁ9#0?9 #0 ✛.` " `✑* @ # 3 `   b" b@   "Ԁ`+  @n "Ȁ`@ bܴ  $bb" " " b`b" "A&b ` :`@ 2@`@ b"`" &` "@0$b` @`&` @`%&``2"@  &` &` &@" 2@`&`&`  :b" "&@$bd"8@ 0#`c䀢@)! ` "؀@%@ "؀@c`&`@&` @ `  "2 "@  $"؀ #b ✓+ " b  ✀$OpenBSD: abort.c,v 1.7 2001/08/12 12:03:01 heko Exp $㿐?ߒ'  @ 쀢   "` @"@A@G  @L  @ @6@< @ $OpenBSD: exit.c,v 1.4 2000/01/06 08:45:50 d Exp $㿘 "` `?, @`, @?, @`2` " @$ $ C`4@$% C`4@x  ??''쀢'  "b ? " *@ @  '@؀ ?؁$. C`4@$OpenBSD: sigprocmask.S,v 1.3 1999/01/22 06:07:56 marc Exp $@2@  0 C`4@2"$OpenBSD: brk.S,v 1.2 1996/08/19 08:18:02 tholo Exp $`8@4   :C`4@ `@$OpenBSD: sbrk.S,v 1.2 1996/08/19 08:18:10 tholo Exp $@   : C`4@"@$OpenBSD: getenv.c,v 1.4 1998/07/16 18:02:33 deraadt Exp $ 4 ⠀ / "#8*"@ J=2""  J JJ 2 J=ې    㿐ƒ$ C`4@$K C`4@$OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $Y V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @*$OpenBSD: memset.c,v 1.2 1996/08/19 08:34:07 tholo Exp $(㿈'XX#d#h#\#` @ Ł$Ƅ C`4@$J C`4@$I C`4@$: C`4@$OpenBSD: strlen.S,v 1.2 1996/08/19 08:17:59 tholo Exp $ J " $y C`4@$ C`4@h @   @8@ @   㿘 `@$6 C`4@$OpenBSD: memchr.c,v 1.4 2001/09/07 08:09:31 espie Exp $"  `  ?2  㿐@H 'T!@] T 31?T2 7耦(7耢 2: % 4`44`44`4`ؤ45 5 ȕ4'5 5  B'? 8' `@%`@`*  @@ `*  @@`*  @T  -`@T :-`-2 ,`- ͓2`   ` `" `` 8   đ. ?2@ Đ" * c'Ā@ '.` @ '  @ @ @?   '/ @   7@', @@ '@H. 2, @ ( ?#   ?#*`/@.  ?@+'$$66`% @"6``4@  * . ?  @26`@4@Ā2T`#@  " . @?* :@ @2. 4@*  *`T@ :̑* Τ Г*`@  +    ?( 8 2 + ( 2@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" $OpenBSD: umul.S,v 1.2 1996/08/19 08:17:46 tholo Exp $ /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  $OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $X@V+  2     " *@ `2 "@ `2 *@ `0* @  "2 2  "? *@2 ?"@? *@;`` (` `?#;```0  ?2 `2 #$OpenBSD: multibyte.c,v 1.3 2002/02/19 19:39:37 millert Exp $ "  J` ? `   ?J@"J@@  " *   J@"`   `(*`  $  C`4@$OpenBSD: cerror.S,v 1.2 1996/08/19 08:18:02 tholo Exp $  b??x@\ 7ޤޠ@+ ޠ@ ?  ޒ"@6 * 2     & , @ & $ ,  @ Y,  @ ?Ş V@:?`,Bἔ  W  7  "  "  0= 9 ; 07   5 ?   `( ?  *   2`*`2  (" ` ? ? @ @ ` '' '@'` ?:      "   @q @   * ޓ2   * "@ *h    6   "  "  0 @ e0 ޔ"6 *`3 ޒ*  F}$  ޔ"6 *`2 ހ`*  & &  $   ,  $ `[` @ݐ?`0Sހ ? * @      @` @ؐ$@$  ޔ"6 *6 ޓ*`@ &,$  ? * @      @` `?2 $@$  ޔ"6 *`6  * 2`&  $  `"@ 2 @Ӓ?@?X T ἀ?$ἠ  D  @0; 7  2? .㿐Y a  4`$@4``$`@$`` $` ```?2 @  &`4`7&&CIؠ 2 8  R` @`$` @ ``$ $ 4 4 $  L 2@K & Ԕ @Ɩؐ"3&&㿐    $@$@$`$ $ $`4 4`!ڒ4 4``  $ $` @&&㿘!ڐ?6`6`*  2 `@?2 @$$ `6`6`*` 2` @ ?2 @$ $ ` 6` `&` b  㿘!ڐ?* 6`6`2`&@ @ &.`  ' 6  ` " 6`6` * 2 &@@&.   `"`  @C?2`  ? ` ?" *2 @ 6`6`p&`   ? 6`&`    x`!ڐ?2 7'T*`* 2`'X2`     -'7  ''`'-`2 2` X6  "-  -0*  -0$2 @ @ `  2 @ @ ` `  ? `-2  @   2  @ @   ?G-`2 7   /`2   :/*`2 -2`@ $* "6 2  'ܐݔܒ`@*`2     -`-2  `-` 2  @6    - @@-`-2 @ `22@:# # "2-`- <#T@"2@ *H`--@2 <``  "*  *0  *0@ @ `  @ @ `   ?*  @ @ @ ` -`"2`64 T*` `-`2 -@6 6㿘 T     " ߔ  ?` (0 `*`0`@*`0  㿘   "   "     6@ !ؐ?*@ ,  ?!0    2@$   `?  ,$ ! " "@!&& $! "㿘! ! ` "`      $`ʐ   ! |?z&!@"``@"` 2` ` "n$` `@ *  ? ` F 2m ` "``  !ؑ2*  !0  * * " *"` "=$` $`  27$`  23$`  @ *  ?       21 $  , "` "!`$ !$!"  "@ `" $` $  `  `" $` $`&,` ,`!Ē!$`$@&!`" @ :@`! "!""!㿘! 4 !/   `   ɬ 2?`"  "     " "!2  @"``"` *` @`"!"`!"@! ` $OpenBSD: crt0.c,v 1.4 2002/02/16 21:27:20 millert Exp $...U.U.Z.r0. .,.,.,...p.hv8.`v8.Xv8.P.HԐ.8H.0 E0.( k8. `. `. . . - - - - $- $- $- 3- 6- B- N0- S0- Y0-x nX-p @-` -Ph-Hh-@ -8 -0-(@- ----X,X,X,X,,,,V,X,˜,˜,),*,Ƙ,0,p,h ,`,X,PL,HL,@L,8,0,(, ,#x**$OpenBSD: args.c,v 1.12 2002/02/16 21:27:06 millert Exp $$OpenBSD: conv.c,v 1.8 2001/08/07 14:39:27 hugh Exp $$OpenBSD: conv_tab.c,v 1.3 1996/06/23 14:19:46 deraadt Exp $    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: dd.c,v 1.12 2002/02/16 21:27:06 millert Exp $$OpenBSD: misc.c,v 1.10 2001/08/07 14:39:27 hugh Exp $A.$OpenBSD: position.c,v 1.4 2001/08/07 14:39:27 hugh Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_cd9660.c,v 1.12 2002/02/16 21:27:36 millert Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: df.c,v 1.31 2002/02/16 21:27:06 millert Exp $@A0?PA>Bp>C=p<@$AA@Y@Y@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. rP`XH8(`XP8(x`@(xph`XPH@80( xph`XPH@0xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( Pxph`XPH@80( ߸߰ߨߠߘߐ߈߀xph`XPH@80( xp`XPH@8x( ph`XPph`XPHH@8(ph`XPH@80( ( xph`XPH@80(       h P @ (  xph`XPH@80( xph`XPH@80( Pxph`XPH@80( ߸߰ߨߠߘߐ߈߀xph`XPH@80( 9:H:@:8:0:(V@jjjjA0123456789abcdef@(#) Copyright (c) 1983, 1988, 1993 Regents of the University of California. All rights reserved. ~( p`P@0 p`P@8(p`XH80h xhph`PX$DP%8H&\@)850xp*+\.3 !;T ";D  ]eT]\ ZW('\@Y8YZHZxZ[` 0xphxH00xxXUGHRBD M@dmCXLS1@2 3 xhXH8(p`H0p$OpenBSD: atalk.c,v 1.7 2002/02/16 21:27:50 millert Exp $@(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount.c,v 1.26 2002/02/17 19:42:28 millert Exp $@     p X P H 8 0 (   @    $OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sync.c,v 1.3 2001/05/18 07:32:36 mickey Exp $@(#)cl_bsd.c 8.29 (Berkeley) 7/1/96@(#)cl_funcs.c 10.50 (Berkeley) 9/24/96@(#)cl_main.c 10.36 (Berkeley) 10/14/96@(#)cl_read.c 10.15 (Berkeley) 9/24/96@(#)cl_screen.c 10.49 (Berkeley) 9/24/96@(#)cl_term.c 10.22 (Berkeley) 9/15/96@(#)cut.c 10.10 (Berkeley) 9/15/96@(#)delete.c 10.12 (Berkeley) 10/23/96@(#)ex.c 10.57 (Berkeley) 10/10/96@(#)ex_abbrev.c 10.7 (Berkeley) 3/6/96@(#)ex_append.c 10.30 (Berkeley) 10/23/96@(#)ex_args.c 10.16 (Berkeley) 7/13/96@(#)ex_argv.c 10.26 (Berkeley) 9/20/96@(#)ex_at.c 10.12 (Berkeley) 9/15/96@(#)ex_bang.c 10.33 (Berkeley) 9/23/96@(#)ex_cd.c 10.10 (Berkeley) 8/12/96@(#)ex_cmd.c 10.20 (Berkeley) 10/10/96@(#)ex_cscope.c 10.13 (Berkeley) 9/15/96@(#)ex_delete.c 10.9 (Berkeley) 10/23/96@(#)ex_display.c 10.12 (Berkeley) 4/10/96@(#)ex_edit.c 10.10 (Berkeley) 4/27/96@(#)ex_equal.c 10.10 (Berkeley) 3/6/96@(#)ex_file.c 10.12 (Berkeley) 7/12/96@(#)ex_filter.c 10.34 (Berkeley) 10/23/96@(#)ex_global.c 10.22 (Berkeley) 10/10/96@(#)ex_init.c 10.26 (Berkeley) 8/12/96@(#)ex_join.c 10.10 (Berkeley) 9/15/96@(#)ex_map.c 10.9 (Berkeley) 3/6/96@(#)ex_mark.c 10.8 (Berkeley) 3/6/96@(#)ex_mkexrc.c 10.11 (Berkeley) 3/6/96@(#)ex_move.c 10.10 (Berkeley) 9/15/96@(#)ex_open.c 10.7 (Berkeley) 3/6/96@(#)ex_perl.c 8.10 (Berkeley) 9/15/96@(#)ex_preserve.c 10.12 (Berkeley) 4/27/96@(#)ex_print.c 10.18 (Berkeley) 5/12/96@(#)ex_put.c 10.7 (Berkeley) 3/6/96@(#)ex_quit.c 10.7 (Berkeley) 4/27/96@(#)ex_read.c 10.38 (Berkeley) 8/12/96@(#)ex_screen.c 10.11 (Berkeley) 6/29/96@(#)ex_script.c 10.30 (Berkeley) 9/24/96/dev/ptyXX@(#)ex_set.c 10.7 (Berkeley) 3/6/96@(#)ex_shell.c 10.38 (Berkeley) 8/19/96@(#)ex_shift.c 10.11 (Berkeley) 9/15/96@(#)ex_source.c 10.12 (Berkeley) 8/10/96@(#)ex_stop.c 10.10 (Berkeley) 3/6/96@(#)ex_subst.c 10.37 (Berkeley) 9/15/96@(#)ex_tag.c 10.36 (Berkeley) 9/15/96@(#)ex_tcl.c 8.10 (Berkeley) 9/15/96@(#)ex_txt.c 10.17 (Berkeley) 10/10/96@(#)ex_undo.c 10.6 (Berkeley) 3/6/96@(#)ex_usage.c 10.13 (Berkeley) 5/3/96@(#)ex_util.c 10.23 (Berkeley) 6/19/96@(#)ex_version.c 10.31 (Berkeley) 8/22/96@(#)ex_visual.c 10.13 (Berkeley) 6/28/96@(#)ex_write.c 10.30 (Berkeley) 7/12/96@(#)ex_yank.c 10.7 (Berkeley) 3/6/96@(#)ex_z.c 10.10 (Berkeley) 3/6/96@(#)exf.c 10.49 (Berkeley) 10/10/96@(#)getc.c 10.10 (Berkeley) 3/6/96@(#)key.c 10.33 (Berkeley) 9/24/96\^:   }) 00123456789abcdef01234567@(#)line.c 10.21 (Berkeley) 9/15/96@(#)log.c 10.8 (Berkeley) 3/6/96@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1992, 1993, 1994, 1995, 1996 Keith Bostic. All rights reserved. @(#)main.c 10.48 (Berkeley) 10/11/96@(#)mark.c 10.13 (Berkeley) 7/19/96@(#)msg.c 10.48 (Berkeley) 9/15/96@(#)options.c 10.51 (Berkeley) 10/14/96@(#)options_f.c 10.25 (Berkeley) 7/12/96@(#)put.c 10.11 (Berkeley) 9/23/96@(#)recover.c 10.21 (Berkeley) 9/15/96@(#)screen.c 10.15 (Berkeley) 9/15/96@(#)search.c 10.25 (Berkeley) 6/30/96@(#)seq.c 10.10 (Berkeley) 3/30/96@(#)util.c 10.11 (Berkeley) 9/15/96@(#)v_at.c 10.8 (Berkeley) 4/27/96@(#)v_ch.c 10.8 (Berkeley) 3/6/96@(#)v_cmd.c 10.9 (Berkeley) 3/28/96@(#)v_delete.c 10.9 (Berkeley) 10/23/96@(#)v_ex.c 10.42 (Berkeley) 6/28/96@(#)v_increment.c 10.12 (Berkeley) 3/19/96@(#)v_init.c 10.8 (Berkeley) 3/30/96@(#)v_itxt.c 10.16 (Berkeley) 10/23/96@(#)v_left.c 10.7 (Berkeley) 3/6/96@(#)v_mark.c 10.8 (Berkeley) 9/20/96@(#)v_match.c 10.8 (Berkeley) 3/6/96@(#)v_paragraph.c 10.7 (Berkeley) 3/6/96@(#)v_put.c 10.5 (Berkeley) 3/6/96@(#)v_redraw.c 10.6 (Berkeley) 3/6/96@(#)v_replace.c 10.17 (Berkeley) 6/30/96@(#)v_right.c 10.7 (Berkeley) 3/6/96@(#)v_screen.c 10.10 (Berkeley) 4/27/96@(#)v_scroll.c 10.9 (Berkeley) 4/27/96@(#)v_search.c 10.18 (Berkeley) 9/19/96q@(#)v_section.c 10.7 (Berkeley) 3/6/96@(#)v_sentence.c 10.7 (Berkeley) 3/6/96@(#)v_status.c 10.9 (Berkeley) 5/15/96@(#)v_txt.c 10.87 (Berkeley) 10/13/96@(#)v_ulcase.c 10.7 (Berkeley) 3/6/96@(#)v_undo.c 10.5 (Berkeley) 3/6/96@(#)v_util.c 10.11 (Berkeley) 6/30/96@(#)v_word.c 10.5 (Berkeley) 3/6/96@(#)v_xchar.c 10.9 (Berkeley) 10/23/96@(#)v_yank.c 10.9 (Berkeley) 5/19/96@(#)v_z.c 10.10 (Berkeley) 5/16/96@(#)v_zexit.c 10.6 (Berkeley) 4/27/96@(#)vi.c 10.57 (Berkeley) 10/13/96@(#)vs_line.c 10.19 (Berkeley) 9/26/96@(#)vs_msg.c 10.77 (Berkeley) 10/13/96|/-\@(#)vs_refresh.c 10.44 (Berkeley) 10/13/96@(#)vs_relative.c 10.11 (Berkeley) 5/13/96@(#)vs_smap.c 10.25 (Berkeley) 7/12/96@(#)vs_split.c 10.31 (Berkeley) 10/13/96$OpenBSD: cchar.c,v 1.8 1998/11/18 23:26:13 deraadt Exp $$OpenBSD: gfmt.c,v 1.4 1997/09/01 18:30:33 deraadt Exp $$OpenBSD: key.c,v 1.10 2002/02/16 21:27:08 millert Exp $0x( hTp$$lHhx$$OpenBSD: modes.c,v 1.5 1999/10/26 22:53:52 deraadt Exp $$OpenBSD: print.c,v 1.9 2002/02/16 21:27:08 millert Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: stty.c,v 1.9 2001/09/06 13:29:08 mpech Exp $@(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.7 2002/02/16 21:27:07 millert Exp $@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.73 2002/03/24 22:51:54 millert Exp $ xph` XPH@80((/tmp/EdDk.aXXXXXXXXXX :A$OpenBSD: dkcksum.c,v 1.3 2001/11/05 07:39:16 mpech Exp $$OpenBSD: editor.c,v 1.79 2002/02/16 21:27:33 millert Exp $ xph` XPH@80((AA?DISKLABEL(8) OpenBSD System Manager's Manual DISKLABEL(8) NNAAMMEE ddiisskkllaabbeell - read and write disk pack label SSYYNNOOPPSSIISS ddiisskkllaabbeell [--nn] [--ccdd | --rr] [--tt] [--vv] _d_i_s_k ddiisskkllaabbeell --ww [--nn] [--ccdd | --rr] [--vv] _d_i_s_k _d_i_s_k_t_y_p_e [_p_a_c_k_i_d] ddiisskkllaabbeell --ee [--nn] [--ccdd | --rr] [--vv] _d_i_s_k ddiisskkllaabbeell --EE [--ff _t_e_m_p_f_i_l_e] [--nn] [--ccdd | --rr] [--vv] _d_i_s_k ddiisskkllaabbeell --RR [--rr] [--nn] [--vv] _d_i_s_k _p_r_o_t_o_f_i_l_e ddiisskkllaabbeell [--NNWW] [--nn] [--vv] _d_i_s_k ddiisskkllaabbeell --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k [_d_i_s_k_t_y_p_e] ddiisskkllaabbeell --ww --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k _d_i_s_k_t_y_p_e [_p_a_c_k_i_d] ddiisskkllaabbeell --RR --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k _p_r_o_t_o_f_i_l_e [_d_i_s_k_t_y_p_e] DDEESSCCRRIIPPTTIIOONN The ddiisskkllaabbeell utility can be used to install, examine, or modify the la- bel on a disk drive or pack. The disk label contains information about disk characteristics (size, type, etc.) and the partition layout, stored on the disk itself. It is used by the operating system to optimize disk I/O and locate the filesystems resident on the disk. The options are as follows: --nn Make no permanent changes to the disklabel (useful for debugging purposes). --vv Print additional information during operation (verbose mode). --rr Causes the label to be read from or written to the disk directly, rather than going through the system's in-core copy of the label. This option may allow a label to be installed on a disk without kernel support for a label, such as when labels are first in- stalled on a system. This flag does not work on a number of ar- chitectures, thus it is not considered the right way to put a new label on a disk. Its use is discouraged. --BB Install bootstrap code. The --rr flag is implied by --BB and never needs to be specified. --bb Specify the single level boot program, or the primary boot pro- gram, depending on the system boot architecture (single or two- level). --ss On machines with a two-level bootstrap (such as i386-based sys- tems), specify the secondary boot program. --dd Use the _d_e_f_a_u_l_t label. This ignores any existing OpenBSD parti- tions on the disk. Note that this option will only work for disks that are capable of reporting their geometry, such as SCSI, IDE, and ESDI. May not be used in conjunction with the --rr flag. --cc Clear the system's in-core copy of the label and update it based on the on-disk label. May not be used in conjunction with the --rr flag. --ff _t_e_m_p_f_i_l_e Write entries to _t_e_m_p_f_i_l_e in fstab(5) format for any partitions for which mount point information has been specified. The --ff flag is only valid when used in conjunction with the --EE flag. If _t_e_m_p_f_i_l_e already exists, it will be overwritten. --tt Format the label as a disktab(5) entry. --ww Write a standard label on the designated drive. --ee Edit an existing disk label using the editor specified in the EDITOR environment variable, or vi(1) if none is specified. --EE Use a simple initial label editor, using the command-driven built-in editor described below. --RR Restore a disk label that was formatted in a prior operation and saved in an ASCII file. --NN Disallow writing of the pack label area on the selected disk. --WW Allow writing of the pack label area on the selected disk. The first form of the command (read) is used to examine the label on the named disk drive (e.g., sd0 or _/_d_e_v_/_r_s_d_0_c). It will display all of the parameters associated with the drive and its partition layout. Unless the --rr flag is given, the kernel's in-core copy of the label is dis- played; if the disk has no label, or the partition types on the disk are incorrect, the kernel may have constructed or modified the label. The second form of the command (write) is used to write a standard label on the designated drive. The drive parameters and partitions are taken from that file. If different disks of the same physical type are to have different partitions, it will be necessary to have separate disktab en- tries describing each, or to edit the label after installation as de- scribed below. The optional argument is a pack identification string, up to 16 characters long. The pack ID must be quoted if it contains blanks. If the --rr flag is given, the disk sectors containing the label and boot- strap will be written directly. A side-effect of this is that any exist- ing bootstrap code will be overwritten and the disk rendered unbootable. If --rr is not specified, the existing label will be updated via the in- core copy and any bootstrap code will be unaffected. If the disk does not already have a label, the --rr flag must be used. In either case, the kernel's in-core label is replaced. In the third form of the command (edit), the label is read from the in- core kernel copy, or directly from the disk if the --rr flag is also given. The label is formatted and then supplied to an editor for changes. If no editor is specified in an EDITOR environment variable, vi(1) is used. When the editor terminates, the formatted label is reread and used to rewrite the disk label. Existing bootstrap code is unchanged regardless of whether --rr was specified. The initial label editor mode is only intended for new disks as it will move partitions around as necessary to maintain a contiguous pool of free blocks. Some commands or prompts take an optional unit. Available units are `b' for bytes, `c' for cylinders, `k' for kilobytes, `m' for megabytes, and `g' for gigabytes. Quantities will be rounded to the nearest cylinder when units are specified for sizes (or offsets). Com- mands may be aborted by entering `^D' (Control-D). Entering `^D' at the main `>' prompt will exit the editor. At prompts that request a size, `*' may be entered to indicate the rest of the available space. The edi- tor commands are as follows: ? [command] Display help message with all available commands. You may specify a _c_o_m_m_a_n_d for which to get more detailed help. There is also (simple) context-sensitive help available at most prompts. M Display this manual page. u Undo (or redo) last change. Entering _u once will undo your last change. Entering it again will restore the change. p [unit] Print the current disk label. If a _u_n_i_t is given, the size and offsets are displayed in terms of the specified unit. e Edit drive parameters. This option is used to set the follow- ing parameters: sectors/track, tracks/cylinder, sectors/cylin- der, number of cylinders on the disk, total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. b Set OpenBSD disk boundaries. This option tells ddiisskkllaabbeell which parts of the disk it is allowed to modify. This option is probably only useful for ports with fdisk partition tables where the ending sector in the MBR is incorrect. The user may enter `*' at the ``Size'' prompt to indicate the entire size of the disk (minus the starting sector). This is useful for disks larger than 8 gigabytes where the fdisk partition table is incapable of storing the real size. r Recalculate free space. This option should really not be nec- essary under normal circumstances. a [part] Add new partition. This option adds a new BSD partition. If no partition letter is specified (a-p), the user will be prompted for one. c [part] Change the size of an existing partition. If no partition is specified, the user will be prompted for one. The new size may be in terms of the aforementioned units and may also be prefixed with `+' or `-' to change the size by a relative amount. d [part] Delete an existing partition (or `*' to delete all parti- tions). If no partition is specified, the user will be prompted for one. You may not delete the `c' partition. g [d|b|u] Set disk geometry based on what the _d_i_s_k, _B_I_O_S, or _u_s_e_r thinks (the _u_s_e_r geometry is simply what the label said before ddiisskkllaabbeell made any changes). D Sets the disk label to the default values as reported by the kernel. This similates the case where there is no disk label. m [part] Modify parameters for an existing partition. If no partition is specified, the user will be prompted for one. This option allows the user to change the filesystem type, starting off- set, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all pa- rameters are configurable for non-BSD partitions). n [part] Name the mount point for an existing partition. If no parti- tion is specified, the user will be prompted for one. This option is only valid if ddiisskkllaabbeell was invoked with the --ff flag. s [path] Save the label to a file in ASCII format (suitable for loading via the --RR option). If no path is specified, the user will be prompted for one. w Write the label to disk. This option will commit any changes to the on-disk label. q Quit the editor. If any changes have been made, the user will be asked whether or not to save the changes to the on-disk la- bel. x Exit the editor without saving any changes to the label. X Toggle ``expert mode''. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). z Zeroes out the existing partition table, leaving only the ``c'' partition. The drive parameters are not changed. In the restore form of the command, the prototype file used to create the label should be in the same format as that produced when reading or edit- ing a label. Comments are delimited by _# and newline. As with --ww, any existing bootstrap code will be clobbered if --rr is specified and will be unaffected otherwise. The final three forms of ddiisskkllaabbeell are used to install bootstrap code on machines where the bootstrap is part of the label. The bootstrap code is comprised of one or two boot programs depending on the machine. When installing bootstrap code with the --BB flag, if the names are not ex- plicitly given, standard boot programs will be used. The boot programs are located in _/_u_s_r_/_m_d_e_c. The names of the programs are taken from the ``b0'' and ``b1'' parameters of the disktab(5) entry for the disk if _d_i_s_k_t_y_p_e was given and its disktab entry exists and includes those param- eters. Otherwise, boot program names are derived from the name of the disk. These names are of the form _b_a_s_e_n_a_m_eboot for the primary (or only) bootstrap, and boot_b_a_s_e_n_a_m_e for the secondary bootstrap; for example, _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d if the disk device is _s_d_0. The first of the three boot-installation forms is used to install boot- strap code without changing the existing label. It is essentially a read command with respect to the disk label itself and all options are related to the specification of the boot program as described previously. The final two forms are analogous to the basic write and restore versions ex- cept that they will install bootstrap code in addition to a new label. Note that when a disk has no real BSD disklabel the kernel creates a de- fault label so that the disk can be used. This default label will in- clude other partitions found on the disk if they are supported on your architechture. For example, on systems that support fdisk(8) partitions the default label will also include DOS and Linux partitions. However, these entries are not dynamic, they are fixed at the time ddiisskkllaabbeell is run. That means that subsequent changes that affect non-OpenBSD parti- tions will not be present in the default label, though you may update them by hand. To see the default label, run ddiisskkllaabbeell with the --dd flag. You can then run ddiisskkllaabbeell with the --ee flag and paste any entries you want from the default label into the real one. EEXXAAMMPPLLEESS disklabel sd0 Display the in-core label for sd0 as obtained via _/_d_e_v_/_r_s_d_0_c. disklabel -w -r /dev/rsd0c sd2212 foo Create a label for sd0 based on information for ``sd2212'' found in _/_e_t_c_/_d_i_s_k_t_a_b. Any existing bootstrap code will be clobbered. (Normally you do not want to use the --rr flag though.) disklabel -e -r sd0 Read the on-disk label for sd0, edit it and reinstall in-core as well as on-disk. (Normally you do not want to use the --rr flag though.) Existing bootstrap code is unaffected. disklabel -R sd0 mylabel Restore the on-disk and in-core label for sd0 from information in _m_y_l_a_b_e_l. Existing bootstrap code is unaffected. disklabel -B sd0 Install a new bootstrap on sd0. The boot code comes from _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and possibly _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d. On-disk and in-core la- bels are unchanged, but on some systems other information may be de- stroyed. Use with care. disklabel -w -B /dev/rsd0c -b newboot sd2212 Install a new label and bootstrap. The label is derived from disktab in- formation for ``sd2212'' and installed both in-core and on-disk. The bootstrap code comes from the file _/_u_s_r_/_m_d_e_c_/_n_e_w_b_o_o_t. FFIILLEESS /etc/disktab /usr/mdec/_x_xboot /usr/mdec/boot_x_x SSEEEE AALLSSOO disklabel(5), disktab(5), scan_ffs(5) DDIIAAGGNNOOSSTTIICCSS The kernel device drivers will not allow the size of a disk partition to be decreased or the offset of a partition to be changed while it is open. Some device drivers create a label containing only a single large parti- tion if a disk is unlabeled; thus, the label must be written to the `a' partition of the disk while it is open. This sometimes requires the de- sired label to be set in two steps, the first one creating at least one other partition, and the second setting the label on the new partition while shrinking the `a' partition. On some machines the bootstrap code may not fit entirely in the area al- located for it by some filesystems. As a result, it may not be possible to have filesystems on some partitions of a ``bootable'' disk. When in- stalling bootstrap code, ddiisskkllaabbeell checks for these cases. If the in- stalled boot code would overlap a partition of type FS_UNUSED it is marked as type FS_BOOT. The newfs(8) utility will disallow creation of filesystems on FS_BOOT partitions. Conversely, if a partition has a type other than FS_UNUSED or FS_BOOT, ddiisskkllaabbeell will not install bootstrap code that overlaps it. NNOOTTEESS On i386 machines, installboot(8) is normally used to install boot code. The --BB option to ddiisskkllaabbeell can still be used to install old style boot code, but this usage is deprecated. On some machines, such as the sparc and amiga, partition tables may not exhibit the full functionality that is described above. BBUUGGSS When a disk name is given without a full pathname, the constructed device name uses the `a' partition on the tahoe, the `c' partition on all oth- ers. In --EE mode, ddiisskkllaabbeell is far too quick to shuffle partitions around; it should keep a free block list and only move partitions around with the user's permission. Also, in --EE mode, partitions outside the OpenBSD portion of the disk should be changeable. OpenBSD 3.1 October 27, 1997 5 $OpenBSD: ar_io.c,v 1.26 2002/02/19 19:39:35 millert Exp $$OpenBSD: ar_subs.c,v 1.18 2002/02/19 19:39:35 millert Exp $$OpenBSD: buf_subs.c,v 1.11 2002/02/19 19:39:35 millert Exp $ $OpenBSD: cache.c,v 1.10 2002/02/19 19:39:35 millert Exp $$OpenBSD: cpio.c,v 1.9 2002/02/19 19:39:35 millert Exp $$OpenBSD: file_subs.c,v 1.17 2002/02/19 19:39:35 millert Exp $$OpenBSD: ftree.c,v 1.18 2002/02/19 19:39:35 millert Exp $$OpenBSD: gen_subs.c,v 1.13 2002/02/19 19:39:35 millert Exp $$OpenBSD: getoldopt.c,v 1.4 2000/01/22 20:24:51 deraadt Exp $$OpenBSD: options.c,v 1.50 2002/02/19 19:39:35 millert Exp $abcdfiklnoprstuvwxBDEGHLPTUXYZ(DPޤƔĔ= Lܠޘޤ`ƔĔ=nD8ޤƔĔ=n(D8DƔĔ=(HA(AƔĔ`(xdƔĔ=$OpenBSD: pat_rep.c,v 1.17 2002/02/19 19:39:35 millert Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.20 2002/02/19 19:39:35 millert Exp $Ÿ$OpenBSD: sel_subs.c,v 1.10 2002/02/19 19:39:35 millert Exp $$OpenBSD: tables.c,v 1.15 2002/02/19 19:39:35 millert Exp $$OpenBSD: tar.c,v 1.25 2002/02/19 19:39:35 millert Exp $$OpenBSD: tty_subs.c,v 1.8 2002/02/19 19:39:35 millert Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.50 2002/02/17 02:04:38 deraadt Exp $8!l.? ;A??zG{A.@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cat.c,v 1.13 2002/03/14 21:17:50 millert Exp $@(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ifconfig.c,v 1.61 2002/04/10 18:52:27 millert Exp $7"P"`""p"""""P"`""p"P"`""p""x""$OpenBSD: cmp.c,v 1.3 1997/01/03 22:36:07 millert Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ls.c,v 1.17 2002/03/12 01:05:15 millert Exp $P.͈$OpenBSD: print.c,v 1.16 2002/02/16 21:27:07 millert Exp $$OpenBSD: util.c,v 1.7 2001/09/06 13:29:08 mpech Exp $@(#) Copyright (c) 1993 The Regents of the University of California. All rights reserved. kX k k k k k k k k k k np n` nP nH n8 n0 n  n n m m m m m m m m m m m mp m` mP m@ m8 m0 m  m m l l l l l l l l l l l l lp l` lX lP lH l@ l8 l0 l  l l k n n n n n n n n n n nx n p o o o o o o o o o o o o o o ox op o` oX oP oH o@ o8 o0 o( o  o o o o px pp ph pX pP pH p8 p( p p q q q q q qp q` qP q@ q0 q  q p p p p p p p p q q q q r` rX rP r@ r0 r  r r r r r r r rx rp rh r r r r s s s` sP s@ s0 s( s t 6|   < 0 ( p ` P @ 0        x h P @   , p ` PD h ` X P H @ 8 o 0 (      8 (           h X @ 0           p  x h X H  @ 0            H    p p   X  pdmټlڔڤڴ T Ӝ       8 (       p ` P @ 0       X H h X H 8 (  h    ޔh, o8  H 8   @(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cksum.c,v 1.8 2002/02/16 21:27:44 millert Exp $$OpenBSD: crc.c,v 1.3 2001/11/19 19:02:13 mpech Exp $$OpenBSD: print.c,v 1.2 1996/06/26 05:32:03 deraadt Exp $$OpenBSD: sum1.c,v 1.3 2001/11/19 19:02:13 mpech Exp $$OpenBSD: sum2.c,v 1.3 2001/11/19 19:02:13 mpech Exp $ <$OpenBSD: termcap.c,v 1.3 2001/07/16 06:14:31 pvalchev Exp $ Lx Lh L` LH L@ L( L L L KDDDDXXXXllll e j   ky JKYdu f   bvz!w"F2R r u'g<<p%{{}}{}(())()[[]][]#$G>>P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:p:x&-/:ttso_|%v !+ HhVq:q:QZZ  lhbwixX  0 $ k j  is a directory is not a regular filehha"H b " ˀ B"( ݘ hc"| 8  d" ܸe" ܘ ܀ `f"p H (g"<  ۠h"t ۀ XHA" @ i"D ˴ j"\ ڰ ڈkH lH \m" x h Xn"" @ ( o 0 O  pH lP ʤ q"x ٰ ـ hr!"X @ s!" S!" t $ ظT بu"" x X @V w!"P  x$" ׸XA" א py" X 0z"l  ? 4" (press RETURN)... (interrupt to abort)?n?f%f .?m(file %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(file %i of %m) .?e(END) ?x- Next\: %x.:(?pB%pB\%:byte %bB?s/%s..).%t?f%f .?n?m(file %i of %m) ..?ltline %lt?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(file %i of %m) .?ltline %lt?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tX 290@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ @(#)getmntopts.c 8.3 (Berkeley) 3/29/95$OpenBSD: grep.c,v 1.1 2001/09/21 23:12:00 deraadt Exp $@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: basename.c,v 1.4 2002/02/16 21:27:44 millert Exp $@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.13 2002/02/16 21:27:38 millert Exp $@(#) Copyright (c) 1983, 1990 The Regents of the University of California. All rights reserved. $OpenBSD: rsh.c,v 1.25 2002/02/19 19:39:39 millert Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.10 2002/02/16 21:27:35 millert Exp $@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: slattach.c,v 1.12 2002/02/16 21:27:38 millert Exp $% Yp Y` YP@(#) Copyright (c) 1983, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: route.c,v 1.44 2002/02/16 21:27:37 millert Exp $0123456789abcdef ` p @  ` 0 pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATICPROTO2PROTO1UPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD          x p h X P @ 8 0 (              ! " # x$ p% h& `' X( H) @* 0+ (, - . /$OpenBSD: cmds.c,v 1.40 2002/01/04 16:18:59 art Exp $ `    x p h#7 $OpenBSD: cmdtab.c,v 1.15 2001/10/04 22:49:55 pjanzen Exp $send account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote ftp servertoggle carriage return stripping on ascii getstoggle/set debugging modedelete remote filelist contents of remote directoryterminate ftp sessionexecute macrotoggle use of EPSV/EPRT on IPv4 ftpset file transfer formattoggle gate-ftp; specify host[:port] to change proxytoggle metacharacter expansion of local file namestoggle printing `#' marks; specify number to set sizeprint local help informationget (set) idle timer on remote sidechange local working directoryprint local working directorylist contents of remote directorydefine a macrodelete multiple fileslist contents of multiple remote directoriesget multiple filesmake directory on the remote machinelist contents of multiple remote directoriesset file transfer modeshow last modification time of remote filesend multiple filesget file if remote file is newer than local file nlist contents of remote directoryset templates for default file name mappingset translation table for default file name mappingview a remote file through your pagertoggle passive transfer modetoggle use of PORT/LPRT cmd for each data connectiontoggle preservation of modification time of retrieved filestoggle transfer progress metertoggle interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandreceive fileget file restarting at end of local fileget help from remote serverrename fileclear queued command repliesrestart file transfer at bytecountremove directory on the remote machineshow status of remote machinetoggle store unique for local filessend one fileescape to the shellsend site specific command to remote server Try "rhelp site" or "site help" for more informationshow size of remote fileshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle packet tracingset file transfer typeget (set) umask on remote sidesend new user informationtoggle verbose mode    P     8 ( P  p      x p < h p `X  X P @ H 8 p 0 d (   8 8 8 P ϔ X P    \  ,   p H    h       X   H x Ŝ   x  p 0 h 0 `  X P8  Hh  @8 8 8  0   d ` p   D x  p   0 P ϔ ` l      0  P p x  0 x p  h( `@ P X` 0 P  H P @ ߰ 8 8 0  (  p   0  ,S$OpenBSD: domacro.c,v 1.7 1997/07/25 21:56:19 millert Exp $$OpenBSD: fetch.c,v 1.38 2002/02/16 21:27:46 millert Exp $ $OpenBSD: ftp.c,v 1.43 2002/02/19 19:39:38 millert Exp $@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.48 2001/06/23 22:48:45 millert Exp $$OpenBSD: ruserpass.c,v 1.13 2002/02/16 21:27:46 millert Exp $     x p h$OpenBSD: util.c,v 1.29 2002/03/30 17:45:44 deraadt Exp $ KMGTPA.A.>?PQ Copyright 1995, 1996, 1997, 1998, 1999 The Internet Software Consortium.All rights reserved.Internet Software Consortium DHCP ClientPlease contribute if you find this software useful.For info, please visit http://www.isc.org/dhcp-contrib.htmlPATH=/usr/bin:/usr/sbin:/bin:/sbin/sbin/dhclient-script( 0(EHC  p h$b@ X P$b@ @ 8$b@ 0 ($b@  ($b@ ($b@ ($b@ ($b@ ($b@ ($b@ ($b@ ($b@ x p$b@ ` X$b@ H @$b@ 0 @$b@ P$b@  @$b@ @$b@ $b@ $b@ $b@ X$b@ $b@ h `$b@ H @$b@ 0 X$b@  $b@ P$b@ $b@ $b@ $b@ P$b@ $b@! x $b@" ` `$b@# H $b@$ 8 $b@% `$b@&  $b@' @$b@( ($b@) ($b@* ߸ p$b@+ ߠ ($b@, ߈ ($b@- p $b@. ` @$b@/ P ($b@0 8 ($b@1 P$b@2  `$b@3 $b@4 $b@5 P$b@6 ި ޠ$b@7 ސ @$b@8 x X$b@9 ` `$b@: H `$b@; 0 @$b@<  p$b@=  p$b@> p$b@? @$b@@ ($b@A @$b@B ݰ @$b@C ݘ ($b@D ݈ ($b@E x ($b@F h ($b@G X ($b@H H ($b@I 8 ($b@J ($b@K ($b@L @$b@M p$b@N p$b@O ܸ p$b@P ܨ p$b@Q ܘ p$b@R ܈ p$b@S x p$b@T h ($b@U X p$b@V H p$b@W 8 p$b@X ( p$b@Y  p$b@Z  p$b@[ p$b@\ p$b@] p$b@^ p$b@_ ۸ p$b@` ۨ p$b@a ۘ p$b@b ۈ p$b@c x p$b@d h p$b@e X p$b@f H p$b@g 8 p$b@h ( p$b@i  p$b@j  p$b@k p$b@l p$b@m p$b@n p$b@o ڸ p$b@p ڨ p$b@q ژ p$b@r ڈ p$b@s x p$b@t h p$b@u X p$b@v H p$b@w 8 p$b@x ( p$b@y  p$b@z  p$b@{ p$b@| p$b@} p$b@~ p$b@ ٸ p$b@ ٨ p$b@ ٘ p$b@ و p$b@ x p$b@ h p$b@ X p$b@ H p$b@ 8 p$b@ ( p$b@  p$b@  p$b@ p$b@ p$b@ p$b@ p$b@ ظ p$b@ ب p$b@ ؘ p$b@ ؈ p$b@ x p$b@ h p$b@ X p$b@ H p$b@ 8 p$b@ ( p$b@  p$b@  p$b@ p$b@ p$b@ p$b@ p$b@ ׸ p$b@ ר p$b@ ט p$b@ ׈ p$b@ x p$b@ h p$b@ X p$b@ H p$b@ 8 p$b@ ( p$b@  p$b@  p$b@ p$b@ p$b@ p$b@ p$b@ ָ p$b@ ֨ p$b@ ֘ p$b@ ֈ p$b@ x p$b@ h p$b@ X p$b@ H p$b@ 8 p$b@ ( p$b@  p$b@  p$b@ p$b@ p$b@ p$b@ p$b@ ո p$b@ ը p$b@ ՘ p$b@ Ո p$b@ x p$b@ h p$b@ X p$b@ H p$b@ 8 p$b@ ( p$b@  p$b@  p$b@ p$b@ p$b@ p$b@ p$b@ Ը p$b@ Ԩ p$b@ Ԙ p$b@ Ԉ p$b@ x p$b@ h p$b@ X p$b@ H p$b@ 8 p$b@ ( p$b@  p$b@  p$b@ p$b@ p$b@ p$b@ p$b@ Ӹ p$b@ Ө p$b@ Ә p$b@ ӈ p$b@ x p$b@ h p$b@ X p$b@ H p$b@ 8 p$b@ ( p$b@  p$b@  p$b@ p$b@ p$b@ p$b@ p$b@ Ҹ p$b@ Ҩ p$b@ Ҙ p$b@ ҈ p$b@ x p$b@ h p$b@ X p$b@ H p$b@ 8 p$b@ ( p$b@  p$b@  p$b@ p$b@ p$b@ p$b@ $b@249:;<=   !"#$%&'()*+,-./017>?@ABCDEFGHIJKLNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ` P @ 0  x h X H 8 (   x h X H 8 (   x h X H 8 (   x h X H 8 (   x h X H 8 (   x h X H 8 (   x h X H 8 (   x h X H 8 (   x h X H 8 (   x h X H 8 (   x h X H 8 (   x h X H 8 (   x h X H 8 (   x h X H 8 (   x h X H 8 (   x;Zx0N@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.12 2002/02/16 21:27:36 millert Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.23 2002/02/16 21:27:37 millert Exp $$OpenBSD: buf.c,v 1.12 2002/03/24 22:17:04 millert Exp $$j`$OpenBSD: cbc.c,v 1.7 2002/01/16 18:44:21 mpech Exp $@ $OpenBSD: glbl.c,v 1.9 2002/03/24 22:17:04 millert Exp $$OpenBSD: io.c,v 1.10 2002/03/24 22:17:04 millert Exp $D$OpenBSD: main.c,v 1.26 2002/03/24 22:17:04 millert Exp $DDH$OpenBSD: re.c,v 1.8 2001/01/16 03:04:46 deraadt Exp $$OpenBSD: sub.c,v 1.8 2002/03/24 22:17:04 millert Exp $$OpenBSD: undo.c,v 1.6 2002/03/24 22:17:04 millert Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.18 2002/02/16 21:27:06 millert Exp $/`$OpenBSD: utils.c,v 1.18 2001/11/05 07:39:16 mpech Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cut.c,v 1.9 2002/02/16 21:27:45 millert Exp $Ҁ8ш@Ѐ@aӸcӰcӠdӐdӈfӀhxlpLhn`NXqPq@r8S0t(T vV19Zbpטx0֨Xհp8ԘH%h@%h@      %r%|7%{%X8<%8           #+3;CScscc !1Aa  0@` ?? w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.13 2002/02/16 21:27:06 millert Exp $@(#) Copyright (c) 1988 The Regents of the University of California. All rights reserved. $OpenBSD: chroot.c,v 1.3 2000/08/17 15:28:36 mickey Exp $$OpenBSD: dir.c,v 1.11 2002/02/16 21:27:34 millert Exp $ ... ...$OpenBSD: inode.c,v 1.19 2002/02/16 21:27:34 millert Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.20 2002/02/16 21:27:34 millert Exp $$OpenBSD: pass1.c,v 1.11 2002/02/16 21:27:34 millert Exp $$OpenBSD: pass1b.c,v 1.6 2002/02/16 21:27:34 millert Exp $$OpenBSD: pass2.c,v 1.12 2002/02/16 21:27:34 millert Exp $$OpenBSD: pass3.c,v 1.6 2001/11/05 07:39:16 mpech Exp $$OpenBSD: pass4.c,v 1.5 2001/11/05 07:39:16 mpech Exp $$OpenBSD: pass5.c,v 1.14 2001/12/01 19:04:41 deraadt Exp $$NetBSD: fsutil.c,v 1.2 1996/10/03 20:06:31 christos Exp $$OpenBSD: setup.c,v 1.15 2002/02/16 21:27:34 millert Exp $xph`XPH@8H@0 P8xxxxxxxph`xxXxPxxxx$OpenBSD: utilities.c,v 1.15 2002/02/23 21:23:46 deraadt Exp $M?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@EXEXEXFX$OpenBSD: append.c,v 1.7 2001/03/20 19:36:27 millert Exp $$OpenBSD: fields.c,v 1.6 2002/02/16 21:27:52 millert Exp $$OpenBSD: files.c,v 1.8 2002/02/16 21:27:52 millert Exp $$OpenBSD: fsort.c,v 1.8 2001/02/04 21:27:00 ericj Exp $$OpenBSD: init.c,v 1.3 1999/05/24 17:57:18 millert Exp $$OpenBSD: msort.c,v 1.11 2002/02/16 21:27:52 millert Exp $@(#) Copyright (c) 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sort.c,v 1.18 2002/02/16 21:27:52 millert Exp $ /dev/stdin0$OpenBSD: tmp.c,v 1.3 2000/06/30 16:00:23 millert Exp $@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.25 2002/02/19 19:39:38 millert Exp $ $OpenBSD: dkcksum.c,v 1.3 2001/11/05 07:39:16 mpech Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: newfs.c,v 1.32 2002/02/19 19:39:38 millert Exp $ĨĘĐĈĀph`XPH@ 8@0@@ @%s: can't read disk label; disk type must be specified`P8pP0߰ߐxX@($OpenBSD: mkfs.c,v 1.20 2001/11/05 07:39:17 mpech Exp $>......$OpenBSD: getopt.c,v 1.4 2001/07/12 05:17:09 deraadt Exp $$OpenBSD: acu.c,v 1.7 2001/10/24 18:38:58 millert Exp $$OpenBSD: acutab.c,v 1.2 1996/06/26 05:40:41 deraadt Exp $11Hh11x|1pt1ht$OpenBSD: cmds.c,v 1.13 2001/10/24 18:38:58 millert Exp $<<111$OpenBSD: cmdtab.c,v 1.3 2001/09/09 17:58:41 millert Exp $!SpE\<SP2>S094tS3\pR>|R7$R@CRCcRG<.RpH,RpH,RPNR0NsR JvRL0?Qv#QNt$OpenBSD: cu.c,v 1.11 2002/02/10 23:22:10 miod Exp $$OpenBSD: hunt.c,v 1.8 2001/10/24 18:38:58 millert Exp $$OpenBSD: log.c,v 1.5 2001/09/09 19:30:49 millert Exp $$OpenBSD: partab.c,v 1.3 1997/04/02 01:47:02 millert Exp $ !"$'(+-.03569: } ${PS3=#? } ${PS4=+ }KSH_VERSIONhlet||&&!()]]<>tttttttttxt`tXtHt@t8t0t ts ss ss ss ss sssspshsXsPs8s0ssssrrrrrrrrrrxr`rXr8r0rrqqqqqqqqqx qpq`@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QB&- _@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: sleep.c,v 1.12 2002/02/16 21:27:07 millert Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mv.c,v 1.23 2002/02/16 21:27:07 millert Exp $@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: dmesg.c,v 1.15 2002/02/16 21:27:33 millert Exp $@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: hostname.c,v 1.5 2002/02/16 21:27:07 millert Exp $%&&&&&&x&p&h&`&X&P&H&@&8&0'@'8'('''&&&&&&&&&&&&&H&0'p'p'p'p'p'p'p'h'`'X'p'p'P'p'H'p'p&'p'p*8$NetBSD: getrawpartition.c,v 1.1 1996/05/16 07:03:33 thorpej Exp $0$NetBSD: getmaxpartitions.c,v 1.1 1996/05/16 07:03:31 thorpej Exp $m%%p%c%%{10}%%/%%{16}%%*%%p%c%%{10}%%m%%+&G@$\]^7ba_`c8V9Mdefg:U;J<H=>LhW?O@NiAB CD  !"#$%E &'()*+,-./F 0123456789G :;<=>?@ABCH D E F GIJKjkLMKNIOP[lmcnoQRpqRSrZstuvwxSyz{|}~TPUQVTWp$OpenBSD: read_bsd_terminfo.c,v 1.10 2002/02/16 21:27:26 millert Exp $VX  @%&*!#yz=A@A$OpenBSD: getloadavg.c,v 1.3 2001/11/05 22:20:18 art Exp $A$OpenBSD: confstr.c,v 1.4 2001/06/27 00:58:54 lebel Exp $$OpenBSD: cfsetispeed.c,v 1.2 1996/08/19 08:34:36 tholo Exp $$OpenBSD: fscanf.c,v 1.5 2002/02/19 19:39:36 millert Exp $$OpenBSD: fstab.c,v 1.10 2002/02/16 21:27:22 millert Exp $$OpenBSD: tcflush.c,v 1.2 1996/08/19 08:34:39 tholo Exp $ $OpenBSD: ethers.c,v 1.13 2002/02/16 21:27:23 millert Exp $xx:xx:xx:xx:xx:xx$OpenBSD: ipx_addr.c,v 1.5 2001/06/27 00:58:55 lebel Exp $$OpenBSD: _vwarnx.c,v 1.3 1996/08/19 08:21:35 tholo Exp $$OpenBSD: fwrite.c,v 1.2 1996/08/19 08:32:50 tholo Exp $t|X`$OpenBSD: cfgetospeed.c,v 1.2 1996/08/19 08:34:35 tholo Exp $$OpenBSD: nice.c,v 1.3 1998/05/06 23:11:43 deraadt Exp $$OpenBSD: devname.c,v 1.2 1996/08/19 08:22:18 tholo Exp $$OpenBSD: linkaddr.c,v 1.2 1996/08/19 08:29:27 tholo Exp $0123456789abcdef$OpenBSD: getprotoname.c,v 1.3 1997/07/09 01:08:32 millert Exp $$OpenBSD: vis.c,v 1.8 2002/02/19 19:39:36 millert Exp $$OpenBSD: _warn.c,v 1.3 1996/08/19 08:21:36 tholo Exp $*$OpenBSD: sethostname.c,v 1.5 2002/02/19 19:39:36 millert Exp $$OpenBSD: readpassphrase.c,v 1.12 2001/12/15 05:41:00 millert Exp $$OpenBSD: tcsetattr.c,v 1.2 1996/08/19 08:34:42 tholo Exp $$OpenBSD: basename.c,v 1.6 2001/06/28 04:27:19 pjanzen Exp $1$OpenBSD: setjmperr.c,v 1.2 1996/08/19 08:25:52 tholo Exp $$OpenBSD: getnetnamadr.c,v 1.15 2002/02/16 21:27:23 millert Exp $$OpenBSD: getnetbyaddr.c,v 1.5 1997/07/09 01:08:28 millert Exp $$OpenBSD: getnetbyname.c,v 1.5 1997/07/09 01:08:29 millert Exp $$OpenBSD: getnetent.c,v 1.8 1998/03/16 05:06:57 millert Exp $$OpenBSD: inet_network.c,v 1.7 1997/07/09 01:08:37 millert Exp $$OpenBSD: alarm.c,v 1.3 1996/09/15 09:30:54 tholo Exp $$OpenBSD: inet_makeaddr.c,v 1.3 1997/04/05 21:13:12 millert Exp $$OpenBSD: getmntinfo.c,v 1.4 1999/06/01 15:31:13 millert Exp $C$OpenBSD: asprintf.c,v 1.8 2002/02/19 19:39:36 millert Exp $$OpenBSD: strtofflags.c,v 1.1 2000/07/19 19:26:04 mickey Exp $H$OpenBSD: iso_addr.c,v 1.2 1996/08/19 08:29:23 tholo Exp $0123456789abcdefL`M8$OpenBSD: cfgetispeed.c,v 1.2 1996/08/19 08:34:34 tholo Exp $P$OpenBSD: inet_netof.c,v 1.3 1997/04/05 21:13:13 millert Exp $RpU@$OpenBSD: cfsetspeed.c,v 1.2 1996/08/19 08:34:37 tholo Exp $$OpenBSD: times.c,v 1.2 1996/08/19 08:26:43 tholo Exp $$OpenBSD: morecrypt.c,v 1.9 1998/03/22 19:01:20 niklas Exp $:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ i$OpenBSD: getservbyport.c,v 1.3 1997/07/09 01:08:35 millert Exp $$OpenBSD: herror.c,v 1.4 1997/03/13 19:07:28 downsj Exp $$OpenBSD: wait.c,v 1.2 1996/08/19 08:27:41 tholo Exp $X$OpenBSD: sleep.c,v 1.7 1997/04/25 04:20:41 tholo Exp $$OpenBSD: getlogin.c,v 1.7 2002/02/16 21:27:22 millert Exp $$OpenBSD: puts.c,v 1.3 1999/08/07 17:35:58 millert Exp $$OpenBSD: regerror.c,v 1.7 2002/02/16 21:27:24 millert Exp $`P8( pX H(   pH8P0$OpenBSD: _warnx.c,v 1.3 1996/08/19 08:21:38 tholo Exp $$OpenBSD: sethostent.c,v 1.4 1997/03/15 21:53:50 pefo Exp $$OpenBSD: getcwd.c,v 1.6 2000/07/19 15:25:13 deraadt Exp $$OpenBSD: regexec.c,v 1.7 1997/04/30 05:51:10 tholo Exp $$OpenBSD: engine.c,v 1.5 2002/02/16 21:27:24 millert Exp $$OpenBSD: fts.c,v 1.30 2002/02/16 21:27:22 millert Exp $$OpenBSD: vprintf.c,v 1.3 2001/07/09 06:57:45 deraadt Exp $$OpenBSD: raise.c,v 1.2 1996/08/19 08:25:33 tholo Exp $P$OpenBSD: tcsetpgrp.c,v 1.4 2002/02/19 19:39:37 millert Exp $$OpenBSD: setbuffer.c,v 1.2 1996/08/19 08:33:05 tholo Exp $$OpenBSD: fputc.c,v 1.4 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: _errx.c,v 1.4 1996/08/19 08:21:21 tholo Exp $$OpenBSD: errx.c,v 1.4 2002/02/19 19:39:36 millert Exp $$OpenBSD: regcomp.c,v 1.8 2002/02/16 21:27:24 millert Exp $h`XP( xPH@80(           xph`XPH@80(  !"#$%x&h'P(8)(*+,--..//0123456789x:h;X<H=0> ?@[\\]^^_x_h`X{@{0| }}~$OpenBSD: regfree.c,v 1.3 1997/04/28 20:45:01 millert Exp $$OpenBSD: ns_ntoa.c,v 1.8 2002/02/16 21:27:23 millert Exp $$OpenBSD: ipx_ntoa.c,v 1.2 1996/08/19 08:29:20 tholo Exp $xxxx.xx:xx:xx:xx:xx:xx.uuuuu$OpenBSD: glob.c,v 1.18 2002/02/17 19:42:22 millert Exp $$OpenBSD: freopen.c,v 1.4 1998/11/10 22:10:21 deraadt Exp $9 </etc/rpc$OpenBSD: tcgetpgrp.c,v 1.2 1996/08/19 08:34:40 tholo Exp $$OpenBSD: cfmakeraw.c,v 1.3 1998/08/20 19:45:57 deraadt Exp $$OpenBSD: ns_addr.c,v 1.7 2002/02/16 21:27:23 millert Exp $$OpenBSD: sscanf.c,v 1.5 2002/02/19 19:39:37 millert Exp $$OpenBSD: vfscanf.c,v 1.8 2002/02/19 19:39:37 millert Exp $  $OpenBSD: fread.c,v 1.3 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: strtoq.c,v 1.4 1996/08/19 08:33:52 tholo Exp $$OpenBSD: strtouq.c,v 1.4 1996/08/19 08:33:53 tholo Exp $$OpenBSD: ungetc.c,v 1.4 2002/02/16 21:27:24 millert Exp $$OpenBSD: disklabel.c,v 1.6 2002/02/16 21:27:22 millert Exp $```x`p`h```X`P`H`@`8`0`(` `a(a aa```````````````0`aXaXaXaXaXaXaXaPaHa@aXaXa8aXa0aXaX`aXaX$OpenBSD: getcap.c,v 1.20 2002/02/16 21:27:22 millert Exp ${$OpenBSD: truncate.c,v 1.6 1997/04/26 08:50:13 tholo Exp $|?9gt>QNPaPkqj,jH6T7YqϑI 7RǤq)>Oq9NNL(Kɲ@KCS[kA|pp$OpenBSD: popen.c,v 1.12 2002/01/16 01:28:54 millert Exp $$OpenBSD: exec.c,v 1.12 2002/02/19 19:39:36 millert Exp $$OpenBSD: waitpid.c,v 1.4 2002/02/19 19:39:36 millert Exp $p$OpenBSD: printf.c,v 1.4 2002/02/19 19:39:37 millert Exp $$OpenBSD: utime.c,v 1.2 1996/08/19 08:27:24 tholo Exp $$OpenBSD: setlocale.c,v 1.8 2002/02/16 21:27:23 millert Exp $(CCCCCCC$OpenBSD: gethostnamadr.c,v 1.45 2002/02/17 19:42:23 millert Exp $gethostby*.getanswer: asked for "%s", got "%s"$OpenBSD: ftell.c,v 1.3 2000/02/21 22:11:22 millert Exp $p$OpenBSD: inet_lnaof.c,v 1.3 1997/04/05 21:13:11 millert Exp $$OpenBSD: tcdrain.c,v 1.2 1996/08/19 08:34:38 tholo Exp $$OpenBSD: setmode.c,v 1.11 2002/02/19 19:39:36 millert Exp $$OpenBSD: _err.c,v 1.4 1996/08/19 08:21:19 tholo Exp $$OpenBSD: verrx.c,v 1.3 2002/02/19 19:39:36 millert Exp $$OpenBSD: getttyent.c,v 1.5 2002/02/16 21:27:22 millert Exp $0$OpenBSD: ttyname.c,v 1.8 2002/02/16 21:27:23 millert Exp $$OpenBSD: getbsize.c,v 1.7 2001/08/18 22:56:22 deraadt Exp $$OpenBSD: nlist.c,v 1.41 2002/02/16 21:27:23 millert Exp $`P$OpenBSD: fgetc.c,v 1.2 1996/08/19 08:32:27 tholo Exp $$OpenBSD: pwcache.c,v 1.5 2001/06/27 00:58:54 lebel Exp $$OpenBSD: getgrent.c,v 1.15 2002/02/16 21:27:22 millert Exp $$OpenBSD: getpwent.c,v 1.24 2002/02/19 19:39:36 millert Exp $*netgroup: %m$OpenBSD: err.c,v 1.5 2002/02/19 19:39:36 millert Exp $$OpenBSD: verr.c,v 1.3 2002/02/19 19:39:36 millert Exp $$OpenBSD: warn.c,v 1.4 2002/02/19 19:39:36 millert Exp $$OpenBSD: vwarn.c,v 1.3 2002/02/19 19:39:36 millert Exp $$OpenBSD: warnx.c,v 1.3 2002/02/19 19:39:36 millert Exp $$OpenBSD: vwarnx.c,v 1.3 2002/02/19 19:39:36 millert Exp $p$OpenBSD: getproto.c,v 1.3 1997/07/09 01:08:31 millert Exp $$OpenBSD: getprotoent.c,v 1.4 1999/09/03 16:23:18 millert Exp $'$OpenBSD: cfsetospeed.c,v 1.2 1996/08/19 08:34:37 tholo Exp $'$OpenBSD: _sys_siglist.c,v 1.2 1996/08/19 08:21:27 tholo Exp $$OpenBSD: siglist.c,v 1.2 1996/08/19 08:26:05 tholo Exp $+-43344gethostby*.getanswer: asked for "%s", got "%s"$OpenBSD: res_query.c,v 1.17 2002/02/16 21:27:23 millert Exp $$OpenBSD: res_mkquery.c,v 1.10 2001/07/31 22:02:18 jakob Exp $$OpenBSD: res_send.c,v 1.11 2002/02/16 21:27:23 millert Exp $$OpenBSD: setbuf.c,v 1.2 1996/08/19 08:33:04 tholo Exp $$OpenBSD: setvbuf.c,v 1.3 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: res_debug.c,v 1.11 2001/06/11 10:05:59 itojun Exp $ d'B@;ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/$OpenBSD: res_comp.c,v 1.10 2002/02/19 19:39:36 millert Exp $$OpenBSD: tolower_.c,v 1.3 2001/06/27 07:17:08 pjanzen Exp $x$OpenBSD: wbuf.c,v 1.5 2001/07/09 06:57:45 deraadt Exp $$OpenBSD: res_data.c,v 1.1 1997/03/13 19:07:36 downsj Exp $( Ͱ͘͠ΨΠΐ΀xph`XPH@0$OpenBSD: fputs.c,v 1.3 1999/08/07 17:35:58 millert Exp $$OpenBSD: nsap_addr.c,v 1.4 1997/07/09 01:08:45 millert Exp $$OpenBSD: toupper_.c,v 1.3 2001/06/27 07:17:09 pjanzen Exp $$OpenBSD: inet_ntoa.c,v 1.2 1996/08/19 08:29:16 tholo Exp $$OpenBSD: inet_ntop.c,v 1.2 2002/02/16 21:27:23 millert Exp $%u.%u.%u.%u$OpenBSD: res_init.c,v 1.25 2002/02/16 21:27:23 millert Exp $/&$OpenBSD: gethostname.c,v 1.3 1998/05/13 08:50:58 deraadt Exp $$OpenBSD: inet_addr.c,v 1.6 1999/05/03 22:31:14 yanick Exp $$OpenBSD: inet_pton.c,v 1.4 2002/02/16 21:27:23 millert Exp $01234567890123456789abcdef0123456789ABCDEFx  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ $OpenBSD: getdomainname.c,v 1.3 1998/05/13 08:50:55 deraadt Exp $$OpenBSD: fgets.c,v 1.3 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: getservbyname.c,v 1.5 2000/01/06 08:24:17 d Exp $$OpenBSD: getservent.c,v 1.5 1999/09/03 16:23:19 millert Exp $$OpenBSD: fopen.c,v 1.2 1996/08/19 08:32:41 tholo Exp $$OpenBSD: rewind.c,v 1.2 1996/08/19 08:33:02 tholo Exp $$OpenBSD: fseek.c,v 1.4 2002/02/16 21:27:24 millert Exp $h 0$OpenBSD: syslog.c,v 1.16 2002/02/19 19:39:36 millert Exp $$OpenBSD: send.c,v 1.2 1996/08/19 08:29:52 tholo Exp $@(#)strftime.c 7.648@(#)localtime.c 7.75$OpenBSD: localtime.c,v 1.21 2002/04/04 19:12:09 millert Exp $WILDABBRGMT@(#)asctime.c 7.9$OpenBSD: asctime.c,v 1.7 2000/01/06 08:24:17 d Exp $II$OpenBSD: sprintf.c,v 1.5 2002/02/19 19:39:37 millert Exp $$OpenBSD: vsnprintf.c,v 1.5 1998/07/27 02:28:28 millert Exp $JRX YbPbc8f(ihi$iDiipm(nnLnnnnoLossstuDuuusxtttuDuuvsxvx<zH{(|}}x~~P$OpenBSD: perror.c,v 1.4 2002/02/16 21:27:24 millert Exp $$OpenBSD: catclose.c,v 1.4 1997/07/09 01:08:57 millert Exp $$OpenBSD: catgets.c,v 1.5 1996/09/15 09:31:22 tholo Exp $$OpenBSD: catopen.c,v 1.10 2002/02/16 21:27:23 millert Exp $ Ph$OpenBSD: time.c,v 1.2 1996/08/19 08:26:39 tholo Exp $H8x$OpenBSD: opendir.c,v 1.6 1998/08/15 08:10:14 deraadt Exp $$OpenBSD: scandir.c,v 1.5 2002/02/16 21:27:23 millert Exp $$OpenBSD: closedir.c,v 1.3 1998/11/20 11:18:37 d Exp $$OpenBSD: seekdir.c,v 1.4 2002/02/16 21:27:23 millert Exp $$OpenBSD: telldir.c,v 1.2 1996/08/19 08:26:35 tholo Exp $$OpenBSD: readdir.c,v 1.5 2001/05/17 20:20:36 rees Exp $`$OpenBSD: getpagesize.c,v 1.2 1996/08/19 08:23:54 tholo Exp $$OpenBSD: db.c,v 1.5 2002/02/25 23:45:15 millert Exp $$OpenBSD: rec_open.c,v 1.7 2002/01/31 17:19:11 millert Exp $$OpenBSD: bt_open.c,v 1.9 2002/02/25 23:45:14 millert Exp $$OpenBSD: bt_get.c,v 1.4 1999/02/15 05:11:22 millert Exp $$OpenBSD: bt_conv.c,v 1.5 2002/02/16 21:27:22 millert Exp $$OpenBSD: bt_put.c,v 1.7 2002/02/16 21:27:22 millert Exp $$OpenBSD: bt_delete.c,v 1.6 2002/02/16 21:27:22 millert Exp $$OpenBSD: bt_seq.c,v 1.6 2002/02/16 21:27:22 millert Exp $$OpenBSD: bt_search.c,v 1.5 2002/02/16 21:27:22 millert Exp $$OpenBSD: bt_utils.c,v 1.4 1999/02/15 05:11:23 millert Exp $$OpenBSD: rec_close.c,v 1.7 2002/02/25 23:45:15 millert Exp $$OpenBSD: bt_close.c,v 1.5 2002/02/16 21:27:22 millert Exp $$OpenBSD: fclose.c,v 1.2 1996/08/19 08:32:19 tholo Exp $$OpenBSD: ftruncate.c,v 1.7 1998/11/20 11:18:52 d Exp $$OpenBSD: rec_get.c,v 1.6 2000/11/21 02:11:02 deraadt Exp $$OpenBSD: rec_put.c,v 1.5 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_delete.c,v 1.5 2002/02/16 21:27:22 millert Exp $$OpenBSD: rget.c,v 1.3 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: refill.c,v 1.5 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: rec_seq.c,v 1.4 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_utils.c,v 1.3 1996/08/19 08:21:12 tholo Exp $$OpenBSD: bt_overflow.c,v 1.5 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_page.c,v 1.5 1999/02/15 05:11:23 millert Exp $$OpenBSD: rec_search.c,v 1.5 1999/02/15 05:11:25 millert Exp $$OpenBSD: mpool.c,v 1.10 2002/02/25 23:45:15 millert Exp $$OpenBSD: fprintf.c,v 1.4 2002/02/19 19:39:36 millert Exp $$OpenBSD: fdopen.c,v 1.2 1996/08/19 08:32:20 tholo Exp $$OpenBSD: flags.c,v 1.3 1996/08/19 08:32:37 tholo Exp $$OpenBSD: hash.c,v 1.14 2002/03/25 19:08:48 millert Exp $$OpenBSD: hash_func.c,v 1.6 2002/02/16 21:27:22 millert Exp $:;$OpenBSD: hash_page.c,v 1.12 2002/02/25 23:45:15 millert Exp $$OpenBSD: ashldi3.c,v 1.2 1996/08/19 08:30:16 tholo Exp $$OpenBSD: hash_bigkey.c,v 1.10 2002/02/25 23:45:15 millert Exp $_$OpenBSD: hash_log2.c,v 1.4 1999/02/15 05:11:24 millert Exp $$OpenBSD: mktemp.c,v 1.15 2002/02/16 21:27:24 millert Exp $$OpenBSD: pread.c,v 1.2 2001/05/05 22:58:29 millert Exp $$OpenBSD: pwrite.c,v 1.2 2001/05/05 22:58:30 millert Exp $$OpenBSD: snprintf.c,v 1.7 2002/02/19 19:39:37 millert Exp $h 0000000000000000`}?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒCAy7FnM8O?ZwH02uOs<<Ҳ؉9I#ը32D=%[ό (doCA@???5?55?5A??҇coCa?Ɗ(`ȳ?DPy?@$@@?$OpenBSD: flt_rounds.c,v 1.3 1997/08/01 21:36:33 deraadt Exp $$OpenBSD: infinity.c,v 1.2 1996/08/19 08:17:37 tholo Exp $$OpenBSD: ctype_.c,v 1.5 2001/01/06 20:34:48 naddy Exp $ ((((( AAAAAABBBBBB ((((( X$OpenBSD: _def_monetary.c,v 1.3 1997/07/23 21:14:38 kstailey Exp $ $OpenBSD: _def_numeric.c,v 1.3 1997/07/23 21:14:39 kstailey Exp $P$OpenBSD: fvwrite.c,v 1.11 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: wsetup.c,v 1.3 2001/07/09 06:57:45 deraadt Exp $$OpenBSD: makebuf.c,v 1.3 1998/11/25 05:18:49 millert Exp $$OpenBSD: findfp.c,v 1.2 1996/08/19 08:32:36 tholo Exp $(4шx`шx Ÿшx$OpenBSD: stdio.c,v 1.4 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: lseek.c,v 1.6 1998/11/20 11:18:53 d Exp $$OpenBSD: fflush.c,v 1.2 1996/08/19 08:32:26 tholo Exp $$OpenBSD: fwalk.c,v 1.3 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: sysconf.c,v 1.4 1998/06/02 06:10:26 deraadt Exp $$OpenBSD: sysctl.c,v 1.4 2002/02/16 21:27:23 millert Exp $@$OpenBSD: malloc.c,v 1.47 2002/02/16 21:27:24 millert Exp $P $OpenBSD: signal.c,v 1.4 1998/06/26 02:12:49 deraadt Exp $(B(B@`$OpenBSD: mmap.c,v 1.8 1998/01/02 05:32:50 deraadt Exp $$OpenBSD: isatty.c,v 1.3 1998/11/20 11:18:39 d Exp $$OpenBSD: tcgetattr.c,v 1.2 1996/08/19 08:34:39 tholo Exp $$OpenBSD: umoddi3.c,v 1.2 1996/08/19 08:30:48 tholo Exp $$OpenBSD: qdivrem.c,v 1.3 2002/02/16 21:27:23 millert Exp $P$OpenBSD: isinf.c,v 1.4 2001/09/10 22:38:11 millert Exp $$OpenBSD: isnan.c,v 1.4 2001/09/10 22:38:11 millert Exp $ $OpenBSD: bt_split.c,v 1.9 2002/02/25 23:45:14 millert Exp $$OpenBSD: hash_buf.c,v 1.10 2002/02/25 23:45:15 millert Exp $a  !n}n`npopa3d*POP3 server/var/empty/sbin/nologin2popa3d*POP3 server/var/empty/sbin/nologin1popa3dJEuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2nobody*Unprivileged user/nonexistent/sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin3Fsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmspe`""www*CCHTTP server/var/www/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin3Gbin*Binaries Commands and Source,,,//sbin/nologin1binsn3.named*FFBIND Name Service Daemon/var/named/sbin/nologin2 rootdaemonCharlie &/root/bin/csh/2rootdaemonCharlie &/root/bin/csh/3proxy*GGProxy Services/nonexistent/sbin/nologin1proxy e`oUoproxy*GGProxy Services/nonexistent/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobodyul+&;6  nobody*Unprivileged user/nonexistent/sbin/nologin2 operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/csh1root \Vto$$bin*Binaries Commands and Source,,,//sbin/nologin2www*CCHTTP server/var/www/sbin/nologin3Cbin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2a  !n}n`npopa3d*POP3 server/var/empty/sbin/nologin2popa3d*POP3 server/var/empty/sbin/nologin1popa3dJEuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2nobody*Unprivileged user/nonexistent/sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin3Fsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmspe`""www*CCHTTP server/var/www/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin3Gbin*Binaries Commands and Source,,,//sbin/nologin1binto50named*FFBIND Name Service Daemon/var/named/sbin/nologin2 rootdaemonCharlie &/root/bin/csh2rootdaemonCharlie &/root/bin/csh3proxy*GGProxy Services/nonexistent/sbin/nologin1proxy e`oUoproxy*GGProxy Services/nonexistent/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobodyvm,'<7 nobody*Unprivileged user/nonexistent/sbin/nologin2 operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/csh1root \Vto$$bin*Binaries Commands and Source,,,//sbin/nologin2www*CCHTTP server/var/www/sbin/nologin3Cbin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2 ... . .. binmdecsbinshare . ..ObootB0Pbootxx0Qbinstall#oR installboot . .. chrootT installboot sysctlr4X}4X4X4`4`4`44444 4 |4"4.4 =4 I4LW4i4v44 4 4 X54p4484@$4_4_dvma_mapin_block_count.urem_devopen_obp_close.udiv_pgofset__udiv_sprintf_netif_debug_freelist__urem_printf_putchar_obp_strategystart_prom0_iclose_io_twiddle_prom_ioctl_promvec_prom0_close_closeall_vprintf_block_size_prom0_strategy__rtt_dvma_init_dvma_free_prom_boothow_prom_si_prom_bootdevice_memset_memcpy_cputyp_pgshift_prom0_iopen_panic_progname_prom_open_etext_donottwiddle_bzero_prom_init_block_table_ndevs_dvma_mapout_loadboot_nbpg_exit_main_free_debug_alloc_edata_end_dvma_alloc___main_prom_bootfile_devswsrt0.obootxx.ogcc2_compiled.___gnu_compiled_ccloseall.ogcc2_compiled.___gnu_compiled_cdvma.ogcc2_compiled.___gnu_compiled_cpromdev.ogcc2_compiled.___gnu_compiled_c_filestore.9_bootstore.10_prom0_fake_saveecho_pv_putchar_promdev_inuse_prom_mapin_prom_mapinfo_prom_mapinfo_cnt_prom_devmap_promvecstore.47/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/alloc.o/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/exit.o/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/printf.o/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/memcpy.o/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/memset.o/usr/src/sys/arch/sparc/stand/bootxx/../libkern/obj/__main.o/usr/src/sys/arch/sparc/stand/bootxx/../libkern/obj/bzero.o/usr/src/sys/arch/sparc/stand/bootxx/../libkern/obj/urem.o/usr/src/sys/arch/sparc/stand/bootxx/../libkern/obj/udiv.oN:\ :ty#winchester:ns#83:nt#15:nc#2619:\ :pb#498000:ob#0:\ :pc#3260655:oc#0:\ :ph#2761410:oh#498000: Seagate ST1239N SWIFT:\ :ty#winchester:ns#35:nt#9:nc#1264: Seagate ST12400N 2.4GB:\ :ty#winchester:ns#82:nt#19:nc#2668:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#4156744:oc#0:\ :pg#4058590:og#98154: Seagate ST12550N:\ :ty#winchester:ns#80:nt#19:nc#2747: Seagate ST1480N:\ :ty#winchester:ns#64:nt#9:nc#1456: Seagate ST15150N:\ :ty#winchester:ns#78:nt#21:nc#5119:\ :pc#8384922:oc#0: Seagate ST410800N Elite 9:\ :ty#winchester:ns#108:nt#27:nc#6087:\ :pc#17749692:oc#0: Seagate ST42100N - Wren 9:\ :ty#winchester:ns#96:nt#15:nc#2574:\ :pc#3706560:oc#0: Seagate ST42400N Elite 2:\ :ty#winchester:ns#84:nt#19:nc#2604:\ :pc#4155984:oc#0: Seagate Sabre-5 ST81236J:\ :ty#XD7053:ns#82:nt#15:nc#1633:\ :pa#99630:oa#0:ba#8192:\ :pb#261990:ob#99630:\ :pc#2008590:oc#0:\ :pd#548580:od#361620:\ :pe#1098390:oe#910200:\ :pf#361620:of#0:\ :pg#1646970:og#361620:\ :ph#1908960:oh#99630: SeagateST3283N:\ :ty#winchester:ns#57:nt#5:nc#1689: Sun1.0G:\ :ty#winchester:ns#80:nt#15:nc#1703: SyQuest SQ555:\ :ty#winchester:ns#34:nt#2:nc#1273:\ :pc#86564:oc#0: Toshiba MK 156F:\ :ty#winchester:ns#34:nt#10:nc#815: Vertex V185:\ :ty#ACB4000:ns#17:nt#7:nc#1163: \4 `@# ` "" $@` `T@   b@w"@H*/+  "bH  0  "  "  * " !` " @ %s: can't open device㿐@K#@  b("b( @ "   @`@)  @   "H@@%s: alloc failed%s: block table corrupt%s: read failure%s: short read㿐 `@    !@`  @ D ? c' / - + ,`2 @      @@ @`a@@?@2 @a aa @` @Ȳ@  ? Ċ`Ī@` Ē`IJ@` @ dvma_mapin㿘? #@(1? @@#1?dvma_mapout㿘 #@(1 @. 1㿘@ " ْ㿘 @  promprom0㿘  ` @ "H `  "  ` ""J  *@J` )*@Can't open device `%s' 㿘@   ` @ "H `  €b  $€b 2$   " @!X0   $   $`$` 㿘# bH`   ``*  `bH   '@`2`0`,6 * '@ 㿘  2& `& $& (   €5 " '@ 㿘 "H  @@ 0(@  㿘  @ $ ? `$ *㿐 "H/  0T@㿘  㿘 "H`t€Invalid controller number prom_iopen: "%s" error=%d 㿘) " ?N  @  "bPbP$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $`  @ `+  " * @F $`0 "$`4 " @$` @ 2" &  %"   @  㿘# b  @ 4 "$b  & 4$b prom_mapin: length=%dprom_mapin: invalid maptype %d㿘  *`@   "H@ Ę    L         "`@{` `  @   8 <?*  Ș آ&@  `   Ȱ@㿘?( ,1 \&"H H L` T ` X P d l$ p  t @  .@ ДЖ ? * `:```?  `Ԕ "`"     А?"  㿘 b'H'L'P'T 'X "b@0H @  exit㿘 !@ ( 㿘!  !X'L'P'T'X$"@L"*㿘 'H'L'P'T'X @ H㿘  @8N@`N@`%` N@`|`  `*` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @L N@ @C N@ @: N@ 0 x  @, N@ % w ls4l404x444444444444444d44444444444@444444440123456789abcdef㿈  @ @,@"  ?L?|/-\㿘  ؀`  "  a8J@ #" @ @   @ *0   @ *`( `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" bootxx4444444H44\4   4444#4p,4\74=4F4M4 pV 4 c4m4t4 |4 4H44 4(4@4 4H44X4 444H 4`4t! 4L/ 4P8 4I4Q4Y4a4 j4w4 ~44444@44 4H4 444 H44  44  4 44H#48+ 4:4 A4H4Q4`4dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: unknown|unknown terminal type:\ :gn:tc=dumb: pcvtXX|pcvt vt200 emulator (DEC VT220):\ :am:km:mi:ms:xn:\ :it#8:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:SF=\E[%dS:\ :SR=\E[%dT:UP=\E[%dA:\ :ac=++,,--..00``aaffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:im=\E[4h:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:\ :k8=\E[20~:k9=\E[21~:k;=\E[29~:kD=\E[3~:kH=\E[4~:kI=\E[2~:\ :kN=\E[6~:kP=\E[5~:kb=\177:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=\EE:\ :r1=\Ec\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/share/tabset/vt100:sc=\E7:se=\E[27m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m:\ :ve=\E[?25h:vi=\E[?25l: pcvt25|dec vt220 emulation with 25 lines:\ :co#80:li#25:\ :is=\E[1;25r\E[25;1H:tc=pcvtXX:tc=ecma+color: pcvt28|dec vt220 emulation with 28 lines:\ :co#80:li#28:\ :is=\E[1;28r\E[28;1H:tc=pcvtXX: pcvt35|dec vt220 emulation with 35 lines:\ :co#80:li#35:\ :is=\E[1;35r\E[35;1H:tc=pcvtXX: pcvt40|dec vt220 emulation with 40 lines:\ :co#80:li#40:\ :is=\E[1;40r\E[40;1H:tc=pcvtXX: pcvt43|dec vt220 emulation with 43 lines:\ :co#80:li#43:\ :is=\E[1;43r\E[43;1H:tc=pcvtXX: pcvt50|dec vt220 emulation with 50 lines:\ :co#80:li#50:\ :is=\E[1;50r\E[50;1H:tc=pcvtXX: pcvt25w|dec vt220 emulation with 25 lines and 132 cols:\ :co#132:li#25:\ :is=\E[1;25r\E[25;1H:tc=pcvtXX: pcvt28w|dec vt220 emulation with 28 lines and 132 cols:\ :co#132:li#28:\ :is=\E[1;28r\E[28;1H:tc=pcvtXX: pcvt35w|dec vt220 emulation with 35 lines and 132 cols:\ :co#132:li#35:\ :is=\E[1;35r\E[35;1H:tc=pcvtXX: pcvt40w|dec vt220 emulation with 40 lines and 132 cols:\ :co#132:li#40:\ :is=\E[1;40r\E[40;1H:tc=pcvtXX: pcvt43w|dec vt220 emulation with 43 lines and 132 cols:\ :co#132:li#43:\ :is=\E[1;43r\E[43;1H:tc=pcvtXX: pcvt50w|dec vt220 emulation with 50 lines and 132 cols:\ :co#132:li#50:\ :is=\E[1;50r\E[50;1H:tc=pcvtXX: pc3|BSD/OS on the PC Console:\ :tc=bsdos-pc-nobold: vt52|dec vt52:\ :bs:\ :co#80:it#8:li#24:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\EG:as=\EF:bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :\ :cr=^M:do=\EB:ho=\EH:kb=^H:kd=\EB:kl=\ED:kr=\EC:ku=\EA:\ :le=\ED:nd=\EC:nw=^M^J:sf=^J:sr=\EI:ta=^I:up=\EA: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt100nam|vt100-nam|vt100 no automargins:\ :am@:xn@:tc=vt100-am: vt100-vb|dec vt100 (w/advanced video) & no beep:\ :bl@:vb=\E[?5h\E[?5l:tc=vt100: vt100-w|vt100-w-am|dec vt100 132 cols (w/advanced video):\ :co#132:li#24:\ :rs=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=vt100-am: vt100-w-nam|vt100-nam-w|dec vt100 132 cols (w/advanced video no automargin):\ :co#132:li#14:vt@:\ :rs=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=vt100-nam: vt100-nav|vt100 without advanced video option:\ :sg#1:\ :mb@:md@:me@:mr@:sa@:se=\E[m:so=\E[7m:ue@:us@:tc=vt100: vt100-nav-w|vt100-w-nav|dec vt100 132 cols 14 lines (no advanced video option):\ :co#132:li#14:tc=vt100-nav: vt100-s|vt100-s-top|vt100-top-s|vt100 for use with top sysline:\ :es:hs:\ :li#23:\ :cl=\E[2;1H\E[J:cm=\E[%i%+^A;%dH:cs=\E[%i%i%d;%dr:\ :ds=\E7\E[1;24r\E8:fs=\E8:ho=\E[2;1H:is=\E7\E[2;24r\E8:\ :ts=\E7\E[1;%p1%dH\E[1K:tc=vt100-am: vt100-s-bot|vt100-bot-s|vt100 for use with bottom sysline:\ :es:hs:\ :li#23:\ :ds=\E7\E[1;24r\E8:fs=\E8:is=\E[1;23r\E[23;1H:\ :ts=\E7\E[24;%p1%dH\E[1K:tc=vt100-am: vt102|dec vt102:\ :mi:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4l:im=\E[4h:tc=vt100: vt102-w|dec vt102 in wide mode:\ :co#132:\ :r3=\E[?3h:tc=vt102: vt102-nsgr|vt102 no sgr (use if you see snowflakes after highlight changes):\ :me=\E[m:sa@:tc=vt102: vt125|vt125 graphics terminal:\ :cl=\E[H\E[2J\EPpS(E)\E\\:tc=vt100: vt131|dec vt131:\ :am:bs:xn:\ :co#80:it#8:li#24:vt#3:\ :RA=\E[?7h:SA=\E[?7h:bl=^G:cd=50\E[J:ce=3\E[K:\ :cl=50\E[;H\E[2J:cm=5\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :do=^J:ho=\E[H:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=2\E[5m:md=2\E[1m:\ :me=2\E[m:mr=2\E[7m:nd=2\E[C:nw=^M^J:\ :r1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:sc=\E7:\ :se=2\E[m:so=2\E[7m:sr=5\EM:ta=^I:ue=2\E[m:up=2\E[A:\ :us=2\E[4m: vt132|DEC vt132:\ :xn:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4h:im=\E[4l:ip=:sf=\n:\ :tc=vt100: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: vt220-new|vt200-new|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:\ :cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :eA=\E)0:ec=\E[%dX:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:kd=\E[B:\ :kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:\ :l4=pf4:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :nw=\EE:pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l: vt220-w|vt200-w|DEC vt220 in wide mode:\ :co#132:\ :r3=\E[?3h:tc=vt220: vt220-8bit|vt220-8|vt200-8bit|vt200-8|dec vt220/200 in 8-bit mode:\ :am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\233%dL:DC=\233%dP:DL=\233%dM:DO=\233%dB:IC=\233%d@:\ :LE=\233%dD:RI=\233%dC:UP=\233%dA:ae=^O:al=\233L:as=^N:\ :bl=^G:cd=\233J:ce=\233K:cl=\233H\233J:cm=\233%i%d;%dH:\ :cr=^M:cs=\233%i%d;%dr:ct=\2333g:dc=\233P:dl=\233M:do=^J:\ :ec=\233%dX:ei=\2334l:ho=\233H:\ :if=/usr/share/tabset/vt100:im=\2334h:\ :is=\233?7h\233>\233?1h\E F\233?4l:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:k6=\23317~:k7=\23318~:k8=\23319~:\ :k9=\23320~:kI=\2332~:kN=\2336~:kP=\2335~:kb=\177:\ :kd=\233B:kh=\233H:kl=\233D:kr=\233C:ku=\233A:le=^H:\ :mb=\2335m:md=\2331m:me=\233m:mr=\2337m:nd=\233C:nw=\EE:\ :rc=\E8:sc=\E7:se=\23327m:sf=\ED:so=\2337m:sr=\EM:st=\EH:\ :ta=^I:ue=\23324m:up=\233A:us=\2334m:vb=\233?5h\233?5l: vt220d|DEC VT220 in vt100 mode with DEC function key labeling:\ :F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:\ :F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:k5@:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:\ :tc=vt220: vt220-nam|v200-nam|VT220 in vt100 mode with no auto margins:\ :am@:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7l\E[?8h:tc=vt220: vt200-js|vt220-js|dec vt200 series with jump scroll:\ :am:\ :co#80:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:dm=:do=^J:ed=:\ :ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E[61"p\E[H\E[?3l\E[?4l\E[?1l\E[?5l\E[?6l\E[?7h\E[?8h\E[?25h\E>\E[m:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kb=\177:kd=\EOB:\ :ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:\ :nw=^M\ED:r1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/share/tabset/vt100:sc=\E7:se=5\E[27m:sf=\ED:\ :so=5\E[7m:sr=\EM:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m: vt320nam|v320n|DEC VT320 in vt100 emul. mode with NO AUTO WRAP mode:\ :am@:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7l\E[?8h:tc=vt220: vt320|vt300|dec vt320 7 bit terminal:\ :am:es:hs:mi:ms:xn:\ :co#80:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOu:K3=\EOy:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ec=\E[%dX:\ :ei=\E[4l:fs=\E[0$}:ho=\E[H:im=\E[4h:\ :is=\E>\E[?3l\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:kl=\EOD:kr=\EOC:\ :ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:nw=\EE:rc=\E8:\ :rs=\E>\E[?3l\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[1$}\E[H\E[K:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[?25h:\ :vi=\E[?25l: vt320-nam|vt300-nam|dec vt320 7 bit terminal with no am to make SAS happy:\ :am@:\ :is=\E>\E[?3l\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :rs=\E>\E[?3l\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320: vt320-w|vt300-w|dec vt320 wide 7 bit terminal:\ :co#132:ws#132:\ :is=\E>\E[?3h\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :rs=\E>\E[?3h\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320: vt320-w-nam|vt300-w-nam|dec vt320 wide 7 bit terminal with no am:\ :am@:\ :is=\E>\E[?3h\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :rs=\E>\E[?3h\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320-w: vt340|dec-vt340|vt330|dec-vt330|dec vt340 graphics terminal with 24 line page:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:al=\E[L:as=^N:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:\ :fs=\E[$}:ho=\E[H:im=\E[4h:\ :is=\E<\E F\E>\E[?1h\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=\177:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:\ :r1=\E[?3l:rc=\E8:rf=/usr/share/tabset/vt300:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[2$~\E[1$}\E[1;%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=200\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: vt400|vt400-24|dec-vt400|dec vt400 24x80 column autowrap:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:ae=^O:\ :al=\E[L:as=^N:cd=10\E[J:ce=4\E[K:cl=10\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:\ :fs=\E[$}:ho=\E[H:ic=\E[@:im=\E[4h:\ :is=\E<\E F\E>\E[?1h\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=\177:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:\ :r1=\E<\E[?3l\E[!p\E[?7h:rc=\E8:\ :rf=/usr/share/tabset/vt300:sc=\E7:se=\E[27m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ts=\E[2$~\E[1$}\E[1;%dH:\ :ue=\E[24m:up=\E[A:us=\E[4m:vb=200\E[?5h\E[?5l:\ :ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: vt420|DEC VT420:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\E[B:ke=\E>:kl=\E[D:kr=\E[C:ks=\E=:ku=\E[A:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :r3=\E[?67h\E[64;1"p:rc=\E8:rf=/usr/share/tabset/vt300:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt420pc|DEC VT420 w/PC keyboard:\ :@7=\E[4~:F1=\E[23~:F2=\E[24~:F3=\E[11;2~:F4=\E[12;2~:\ :F5=\E[13;2~:F6=\E[14;2~:F7=\E[15;2~:F8=\E[17;2~:\ :F9=\E[18;2~:FA=\E[19;2~:FB=\E[20;2~:FC=\E[21;2~:\ :FD=\E[23;2~:FE=\E[24;2~:FF=\E[23~:FG=\E[24~:FH=\E[25~:\ :FI=\E[26~:FJ=\E[28~:FK=\E[29~:FL=\E[31~:FM=\E[32~:\ :FN=\E[33~:FO=\E[34~:FP=\E[35~:FQ=\E[36~:FR=\E[23;2~:\ :FS=\E[24;2~:FT=\E[25;2~:FU=\E[26;2~:FV=\E[28;2~:\ :FW=\E[29;2~:FX=\E[31;2~:FY=\E[32;2~:FZ=\E[33;2~:\ :Fa=\E[34;2~:Fb=\E[35;2~:Fc=\E[36;2~:\ :S6=USR_TERM\:vt420pcdos\::k1=\E[11~:k2=\E[12~:\ :k3=\E[13~:k4=\E[14~:k5=\E[15~:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:k;=\E[21~:kD=\177:kh=\E[H:\ :..px=\EP1;1|%?%{16}%p1%>%t%{0}%e%{21}%p1%>%t%{1}%e%{25}%p1%>%t%{2}%e%{27}%p1%>%t%{3}%e%{30}%p1%>%t%{4}%e%{5}%;%p1%+%d/%p2%s\E\\:\ :tc=vt420: vt420pcdos|DEC VT420 w/PC for DOS Merge:\ :li#25:\ :S1=%?%p1%{19}%=%t\E\023\021%e%p1%{32}%<%t\E%p1%c%e%p1%{127}%=%t\E\177%e%p1%c%;:\ :S4=\E[?1;2r\E[34h:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:S6@:\ :me=\E[m:sa@:tc=vt420pc: vt420f|DEC VT420 with VT kbd; VT400 mode; F1-F5 used as Fkeys:\ :F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:\ :F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:\ :k1=\E[11~:k2=\E[12~:k3=\E[13~:k4=\E[14~:k5=\E[15~:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:\ :kD=\177:kh=\E[H:l1=\EOP:l2=\EOQ:l3=\EOR:l4=\EOS:tc=vt420: vt510|DEC VT510:\ :tc=vt420: vt510pc|DEC VT510 w/PC keyboard:\ :tc=vt420pc: vt510pcdos|DEC VT510 w/PC for DOS Merge:\ :tc=vt420pcdos: vt520|DEC VT520:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :..px=\EP1;1|%?%{16}%p1%>%t%{0}%e%{21}%p1%>%t%{1}%e%{25}%p1%>%t%{2}%e%{27}%p1%>%t%{3}%e%{30}%p1%>%t%{4}%e%{5}%;%p1%+%d/%p2%s\E\\:\ :r3=\E[?67h\E[64;1"p:rc=\E8:rf=/usr/share/tabset/vt300:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt525|DEC VT525:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :..px=\EP1;1|%?%{16}%p1%>%t%{0}%e%{21}%p1%>%t%{1}%e%{25}%p1%>%t%{2}%e%{27}%p1%>%t%{3}%e%{30}%p1%>%t%{4}%e%{5}%;%p1%+%d/%p2%s\E\\:\ :r3=\E[?67h\E[64;1"p:rc=\E8:rf=/usr/share/tabset/vt300:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: sun-il|Sun Microsystems console with working insert-line:\ :am:km:ms:\ :co#80:li#34:\ :%7=\E[194z:&5=\E[193z:&8=\E[195z:@7=\E[220z:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:F1=\E[234z:F2=\E[235z:IC=\E[%d@:\ :K2=\E[218z:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=^L:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=:ic=\E[@:im=:\ :k1=\E[224z:k2=\E[225z:k3=\E[226z:k4=\E[227z:k5=\E[228z:\ :k6=\E[229z:k7=\E[230z:k8=\E[231z:k9=\E[232z:k;=\E[233z:\ :kD=\177:kN=\E[222z:kP=\E[216z:kb=^H:kd=\E[B:kh=\E[214z:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:md@:me=\E[m:mr=\E[7m:nd=\E[C:\ :rs=\E[s:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;m:\ :se=\E[m:sf=^J:so=\E[7m:ta=^I:u8=\E[1t:u9=\E[11t:ue@:\ :up=\E[A:us@: sun-cgsix|sun-ss5|Sun SparcStation 5 console:\ :AL@:al@:tc=sun-il: sun|sun1|sun2|Sun Microsystems Inc. workstation console:\ :tc=sun-il: sun-s|Sun Microsystems Workstation window with status line:\ :hs:\ :ds=\E]l\E\\:fs=\E\\:ts=\E]l:tc=sun: sun-e-s|sun-s-e|Sun Microsystems Workstation with status hacked for emacs:\ :hs:\ :ds=\E]l\E\\:fs=\E\\:ts=\E]l:tc=sun-e: sun-48|Sun 48-line window:\ :co#80:li#48:tc=sun: sun-34|Sun 34-line window:\ :co#80:li#34:tc=sun: sun-24|Sun 24-line window:\ :co#80:li#24:tc=sun: sun-17|Sun 17-line window:\ :co#80:li#17:tc=sun: sun-12|Sun 12-line window:\ :co#80:li#12:tc=sun: sun-1|Sun 1-line window for sysline:\ :es:hs:\ :co#80:li#1:\ :ds=^L:fs=\E[K:ts=^M:tc=sun: sun-e|sun-nic|sune|Sun Microsystems Workstation without insert character:\ :ei@:ic@:im@:tc=sun: sun-c|sun-cmd|Sun Microsystems Workstation console with scrollable history:\ :li#35:\ :te=\E[>4h:ti=\E[>4l:tc=sun: vt320-k3|MS-Kermit 3.00's vt320 emulation:\ :am:es:hs:km:mi:ms:xn:\ :co#80:it#8:li#49:pb#9600:vt#3:\ :AL=\E[%dL:CC=\E:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SR=\E[%dL:UP=\E[%dA:ae=\E(B:al=\E[L:\ :as=\E(0:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ds=\E[0$~:ec=\E[%dX:ei=\E[4l:fs=\E[0$}:ho=\E[H:im=\E[4h:\ :is=\E>\E F\E[?1l\E[?7h\E[r\E[2$~:k0=\E[21~:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:\ :k9=\E[20~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\EOB:\ :ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M^J:rc=\E8:\ :sc=\E7:se=\E[27m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[1$}\r\E[K:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l\E[?5h\E[?5l\E[?5h\E[?5l:ve=\E[?25h:\ :vi=\E[?25l: vt320-k311|dec vt320 series as defined by kermit 3.11:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:al=3\E[L:as=^N:bl=^G:cd=\E[J:ce=\E[K:cl=\E[;H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:\ :fs=\E[$}:ho=\E[H:im=\E[4h:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:\ :r1=\E[?3l:rc=\E8:rf=/usr/share/tabset/vt100:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[2$~\E[1$}\E[1;%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: vt50|dec vt50:\ :bs:\ :co#80:li#12:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cr=^M:do=^J:le=^H:nd=\EC:\ :sf=^J:ta=^I:up=\EA: vt50h|dec vt50h:\ :bs:\ :co#80:li#12:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=^M:do=^J:\ :le=^H:nd=\EC:sf=^J:sr=\EI:ta=^I:up=\EA: vt61|vt-61|vt61.5|dec vt61:\ :co#80:li#24:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=\r:do=^J:\ :kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:sf=\n:sr=\EI:ta=^I:\ :up=\EA:  @ w|!<<<?m!<]J<]J< !!<w<w< }8Bu!<X;<X;<e 5UɩBu!< !< !<( QlMBu!< < ypBu!<v<v<'V  Bu!<<<) I϶Bua<f<f< ! ʶ!<u*<u*< !+@a<W<W< ! woT!<p<p< !Ja<9<9< ! 6!<k <k < !)a<4΀<4΀< ! bk!<<< !+a< /< /< ! }I!B!< < < } lM !<N<N<N} p!<߀<߀<߀} -T!<<<F5w<v<v<vss0wC<z9<z9<z9ss1"a<C<C<Caudio0%dX<u*<u*<u*mixer07 <><><>sound0 <p<<audioctl0m<<5<3B r#m&<<5<8C  Rk<z9<f<f  (*>'m<8<]J<]J    @ H P X ВsE < < < ( 0 $<I <I <I /tmp/disktab.shadow1Z<ܓ<ܓ<ܓ/tmp/fstab.shadow t\<p<</tmp/resolv.conf.shadow <8<8<8/tmp/hostsO0 < /< U< U eY<(<-L<-L m<0G<8<8 rh/4uh1>ın(/5 CiJ:$&aʌ_j}a=ҋ*JUG|8+#cX "$_b" ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi shift done echo -n $_a # Prevent a trailing blank on the output, and thus a bad value # for cutlast or cutword, by outputting blanks only when $_l # has values to sort. if [[ -n "$_l" ]] ; then echo -n " " bsort $_l fi } # return true when the list $1 contains a set also in one of $2 ... $n list_has_sets() { local _list=$1 _f shift for _f in $* do if isin ${_f}${VERSION}.tar.gz $_list; then return 0 fi # Try for stupid msdos convention if isin ${_f}${VERSION}.tgz $_list; then return 0 fi # Special check for kernel if [ "$_f" = "kernel" ] && isin bsd $_list; then return 0 fi done return 1 } # log in via ftp to host $1 as user $2 with password $3 # and return a list of all files in the directory $4 on stdout ftp_list_files() { ftp ${_ftp_active} -V -n "$1" << __EOT user "$2" "$3" cd "$4" ls quit __EOT } # $1 is relative mountpoint get_localdir() { local _mp=$1 _dir= while : ; do echo -n "Enter the pathname where the sets are stored: [$_dir] " getresp "$_dir" _dir=$resp # Allow break-out with empty response if [ -z "$_dir" ]; then echo -n "Are you sure you don't want to set the pathname? [n] " getresp n case $resp in y*|Y*) break ;; *) continue ;; esac fi if list_has_sets "`ls -l ${_mp}/${_dir}`" $THESETS then local_sets_dir=$_mp/$_dir break fi cat << __EOT The directory "${_mp}/${_dir}" does not exist, or does not hold any OpenBSD ${VERSION_MAJOR}.${VERSION_MINOR} ${MODE} sets. __EOT echo -n "Re-enter pathname? [y] " getresp y case $resp in y*|Y*) ;; *) local_sets_dir= break ;; esac done } makedev() { local _d=$1 if [ ! -c /dev/r${_d}c ]; then if [ -r /dev/MAKEDEV ]; then (cd /dev; sh MAKEDEV $_d) else echo "Device nodes for $_d are missing, and MAKEDEV" echo "does not exist to create them with. Sorry." false fi fi } getanotherdisk() { cat << __EOT Now you can select another disk to initialize. (Do not re-select a disk you have already entered information for). Available disks are: $_DKDEVS __EOT echo -n "Which one? [done] " getresp done if [ "X${resp}" = "Xdone" ]; then DISK=done elif isin $resp $_DKDEVS ; then DISK=$resp makedev $resp || DISK= else echo "\nThe disk $resp does not exist." DISK= fi } getrootdisk() { local _defdsk _defdsk=`echo $_DKDEVS | cutlast` if [ "${_defdsk}" != "${_DKDEVS}" ]; then _defdsk= fi cat << __EOT The installation program needs to know which disk to consider the root disk. Note the unit number may be different than the unit number you used in the boot program (especially on a PC with multiple disk controllers). Available disks are: $_DKDEVS __EOT echo -n "Which disk is the root disk? [${_defdsk}] " getresp "$_defdsk" if isin $resp $_DKDEVS ; then ROOTDISK=$resp makedev $resp || ROOTDISK= else echo "\nThe disk '$resp' does not exist." ROOTDISK= fi } # Create an entry in the hosts file. If an entry with the # same symbolic name already exists, delete it. # $1 - IP address # $2 - symbolic name addhostent() { sed "/ $2\$/d" < /tmp/hosts > /tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$1 $2" >> /tmp/hosts } # Create a hostname.* file for the interface. # $1 - interface name # $2 - interface symbolic name # $3 - interface IP address # $4 - interface netmask # $5 - (optional) interface media directives addifconfig() { if [ "$3" = "dhcp" ]; then echo "dhcp NONE NONE NONE $5" > /tmp/hostname.$1 addhostent 127.0.0.1 $2 else echo "inet $3 $4 NONE $5" > /tmp/hostname.$1 addhostent $3 $2 fi } configure_all_interfaces() { local _ifsdone= _ifs _ouranswer= _reprompt=1 _IFS=`get_ifdevs` resp= while [ "X${resp}" != X"done" ]; do if [ $_reprompt = 1 ]; then cat << __EOT You may configure the following network interfaces (the interfaces marked with [X] have been successfully configured): __EOT for _ifs in $_IFS; do if [ -z "$_ouranswer" ]; then _ouranswer=$_ifs fi if isin $_ifs $_ifsdone ; then echo -n " [X] " else echo -n " [ ] " fi echo $_ifs done echo fi echo -n "Configure which interface? (or 'done') [$_ouranswer] " getresp "$_ouranswer" case $resp in "done") ;; "") _reprompt=0 ;; *) _ifs=$resp _ouranswer=done if isin $_ifs $_IFS ; then if configure_ifs $_ifs ; then _ifsdone="$_ifs $_ifsdone" else _ouranswer= fi else echo "Invalid response: '$resp' is not in list" fi _reprompt=1 ;; esac done } configure_ifs() { local _up _if_name=$1 _if_ip _if_mask local _if_symname _if_extra _hostname local _dhcp_prompt set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` _up=$1 _if_ip=$2 _if_mask=$3 if [ $_up = "UP" ]; then ifconfig $_if_name delete down fi if [ ! -x /sbin/dhclient ]; then echo "DHCP install not supported\n" else _dhcp_prompt=" (or 'dhcp')" fi # Get IP address resp= while [ -z "$resp" ] ; do echo -n "IP address${_dhcp_prompt}? [$_if_ip] " getresp "$_if_ip" if [ ! -x /sbin/dhclient -a "X$resp" == "Xdhcp" ]; then resp= fi _if_ip=$resp done # Get symbolic name _hostname=`hostname` resp= while [ -z "$resp" ] ; do echo -n "Symbolic (host) name? [$_hostname] " getresp "$_hostname" _if_symname=$resp done # Get netmask if [ "$_if_ip" != "dhcp" ]; then resp= if [ -z "$_if_mask" ]; then _if_mask=255.255.255.0 fi while [ -z "$resp" ]; do echo -n "Netmask? [$_if_mask] " getresp "$_if_mask" _if_mask=$resp done fi if [ -n "`ifconfig -m ${_if_name} | sed -n '/media/p'`" ]; then cat << __EOT Your use of the network interface may require non-default media directives. The default media is: __EOT ifconfig -m ${_if_name} | sed -n ' /supported/D /media:/p' echo "This is a list of supported media:" ifconfig -m ${_if_name} | sed -n ' /media:/D s/^ // /media/p' cat << __EOT If the default is not satisfactory, and you wish to use another media, copy that line from above (e.g. "media 100baseTX") __EOT echo -n "Media directives? [$_if_extra] " getresp "$_if_extra" if [ -n "$resp" ]; then _if_extra=$resp fi fi # Configure the interface. If it # succeeds, add it to the permanent # network configuration info. if [ "$_if_ip" = "dhcp" ]; then ifconfig ${_if_name} down ${_if_extra} cat > /etc/dhclient.conf << __EOT initial-interval 1; send host-name "$_hostname"; request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT dhclient -1 ${_if_name} set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` if [ $1 = "UP" -a $2 = "0.0.0.0" ]; then echo "hostname-associated DHCP attempt for $_if_name failed..." ifconfig $_if_name delete down cat > /etc/dhclient.conf << __EOT initial-interval 1; request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT dhclient -1 ${_if_name} set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` if [ $1 = "UP" -a $2 = "0.0.0.0" ]; then echo "free-roaming DHCP attempt for $_if_name failed." ifconfig $_if_name delete down return 1 else echo "DHCP attempt for $_if_name successful." addifconfig ${_if_name} ${_if_symname} ${_if_ip} return 0 fi else echo "DHCP configuration of $_if_name successful." addifconfig ${_if_name} ${_if_symname} ${_if_ip} return 0 fi else ifconfig ${_if_name} down if ifconfig ${_if_name} inet \ ${_if_ip} \ netmask ${_if_mask} ${_if_extra} up then addifconfig ${_if_name} ${_if_symname} ${_if_ip} ${_if_mask} "${_if_extra}" return 0 fi fi return 1 } # Returns true if $1 contains only alphanumerics isalphanumeric() { local _n _n=$1 while [ ${#_n} != 0 ]; do case $_n in [A-Za-z0-9]*) ;; *) return 1;; esac _n=${_n#?} done return 0 } # Much of this is gratuitously stolen from /etc/netstart. enable_network() { # Check for required network related files for _netfile in hosts myname; do if [ ! -f /mnt/etc/${_netfile} ]; then echo "ERROR: no /mnt/etc/${_netfile}!" return 1 fi done # Copy any required or optional files found for _netfile in hosts myname dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done hostname=`cat /etc/myname` hostname $hostname _didnet=1 # set the address for the loopback interface ifconfig lo0 inet localhost # use loopback, not the wire route -n add -host $hostname localhost > /dev/null route -n add -net 127 127.0.0.1 -reject > /dev/null # configure all of the non-loopback interfaces which we know about. # refer to hostname.if(5) for hn in /mnt/etc/hostname.*; do # Strip off /mnt/etc/hostname. prefix if=${hn#/mnt/etc/hostname.} # Interface names must be alphanumeric only. We check to avoid # configuring backup or temp files, and to catch the "*" case. if ! isalphanumeric "$if"; then continue fi ifconfig $if > /dev/null 2>&1 if [ $? -ne 0 ]; then continue fi # Now parse the hostname.* file while :; do if [ "$cmd2" ]; then # we are carrying over from the 'read dt dtaddr' last time set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= # make sure and get any remaining args in ext2, like the read below i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else # read the next line or exit the while loop read af name mask bcaddr ext1 ext2 || break fi # $af can be "dhcp", "up", "rtsol", an address family, commands, or # a comment. case $af in "#"*|"!"*|"bridge"|""|"rtsol") # skip comments, user commands, bridges, # IPv6 rtsol and empty lines continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= ifconfig $if $name $mask $bcaddr $ext1 $ext2 down cmd="dhclient $if" ;; "up") # The only one of these guaranteed to be set is $if # the remaining ones exist so that media controls work cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then # perform a 'shift' of sorts alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "X$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -n add -host $name 127.0.0.1" ;; inet6) # Ignore IPv6 setup continue ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done < /mnt/etc/hostname.$if done # /mnt/etc/mygate, if it exists, contains the name of my gateway host # that name must be in /etc/hosts. if [ -f /mnt/etc/mygate ]; then route delete default > /dev/null 2>&1 route -n add -host default `cat /mnt/etc/mygate` fi # Get FQDN after any DHCP manipulation of resolv.conf is done get_fqdn /etc/resolv.conf # Display results... echo "Network interface configuration:" ifconfig -am # enable the resolver if resolv.conf is available if [ -f /etc/resolv.conf ]; then route show echo "\nResolver enabled." else route -n show echo "\nResolver not enabled." fi return 0 } # Print the selector and get a response # The list of sets is passed in as $1, sets $resp get_selection() { local _next=done _f _sets=$1 for _f in $_sets ; do if isin $_f $_setsdone ; then echo -n " [X] " else echo -n " [ ] " if [ "X$_next" = "Xdone" ]; then _next=$_f fi fi echo $_f done # Get the name of the file. echo -n "File name? [$_next] " getresp "$_next" # Ignore a bare '-' or '+' case $resp in +|-) resp= esac } # Do globbing on the selection and parse +/-, sets the global # _get_files and _setsdone appropriately. glob_selection() { local _selection=$1 _src=$2 _sets=$3 local _action _matched _tfile _f if [ -z "$_selection" ]; then return fi # Change +/- into add/remove _action=add case $_selection in +*) _selection=${_selection#?} ;; -*) _selection=${_selection#?} _action=remove ;; esac # Major hack to allow the user to select globbing patterns set -o noglob if [ X"$_selection" = X"all" ]; then _selection=* fi # This is safe in single user mode. _tfile=/tmp/install_case.$$ cat >$_tfile << __EOT case \$_f in $_selection) # Add/remove file to extraction list if [ "\$_action" = "add" ]; then _get_files=\`addel \${_f} \${_get_files}\` _setsdone=\`addel \${_f} \${_setsdone}\` elif [ "\$_action" = "remove" ]; then _get_files=\`rmel \${_f} \${_get_files}\` _setsdone=\`rmel \${_f} \${_setsdone}\` else echo "Unknown action: \$_action" fi _matched=\$(( \$_matched + 1 )) ;; esac __EOT set +o noglob # Eww. _matched=0 for _f in $_sets; do . $_tfile done rm -f $_tfile if [ $_matched -eq 0 ]; then cat << __EOT The file '${_src}/${_selection}' does not exist. Check to make sure you entered the name properly. __EOT fi } display_failure_msg() { cat << __EOT The following files failed to extract correctly. Choose which one(s) to retry or 'done' to exit selector. You may de-select a file by prepending a '-' to its name. __EOT } display_selection_msg() { cat << __EOT The following sets are available. Enter a filename, 'all' to select all the sets, or 'done'. You may de-select a set by prepending a '-' to its name. __EOT } display_extract_msg() { cat << __EOT You will now be asked which sets to ${MODE}. Some of these sets are required for your ${MODE} and some are optional. You will want at least the base and bsd sets. Consult the installation notes if you are not sure which sets are required! __EOT } # Set global _sets to either # 1) a list of sets found in both $1 and $THESETS, where # $2 is the location that generated the list of files in $1. # or # 2) a list of .tgz or .tar.gz files found in $2 get_sets_list () { local _f _file_list=$1 _src=$2 _sets= for _f in $THESETS ; do if [ "X${_f}" = "Xkernel" ]; then if isin bsd $_file_list; then _sets="$_sets bsd" fi elif isin ${_f}${VERSION}.tar.gz $_file_list; then _sets="$_sets ${_f}${VERSION}.tar.gz" elif isin ${_f}${VERSION}.tgz $_file_list; then _sets="$_sets ${_f}${VERSION}.tgz" fi done if [ -z "$_sets" ]; then cat << __EOT The directory '${_src}' contains no OpenBSD ${VERSION_MAJOR}.${VERSION_MINOR} ${MODE} sets. __EOT echo -n "Search for other *.tar.gz and *.tgz files? [y] " getresp y case $resp in n*|N*) return ;; esac # *.tar.gz and *.tgz are possible sets for _f in $_file_list ; do case $_f in *.tar.gz|*.tgz) _sets="$_sets ${_f}" esac done fi if [ -z "$_sets" ]; then eval echo "There are no *.tar.gz or *.tgz files in ${_src}." echo -n "See a directory listing? [y] " getresp y case $resp in n*|N*) return ;; esac echo "\n${_file_list}\n" return fi } # Set global _get_files to the list of sets requested by the user # from $1. Add this list to _setsdone after saving current value # of _setsdone. get_get_files_list () { local _src=$1 _get_files= _osetsdone=$_setsdone # Set the default list of files for _f in $_sets ; do # $_sets contains only .tgz and .tar.gz file names and 'bsd'. case $_f in base*|bsd|comp*|etc*|game*|man*|misc*) if ! isin ${_f} ${_setsdone}; then _get_files=`addel ${_f} ${_get_files}` _setsdone=`addel ${_f} ${_setsdone}` fi ;; esac done # Allow the user to select/de-select additional sets while : ; do display_selection_msg get_selection "$_sets" if [ "X${resp}" = "Xdone" ]; then break fi glob_selection "$resp" "$_src" "$_sets" done } # Install the list of files in the global _get_files from the source # in $1, aka $2. For mounted file system installs $1==file:$2. For URL # installs $1 == $_url_base and $2 == $1 w/o passwords, etc. # # Return 0 if install was attempted, 1 if user aborted before install # was tried. install_get_files_list () { local _f _failed_files _src=$1 _public_src=$2 echo -n "Ready to ${MODE} sets? [y] " getresp y case $resp in y*|Y*) ;; *) _setsdone=$_osetsdone return 1 ;; esac # Install/Upgrade the sets one at a time. Keep track of which # ones fail. while [ -n "${_get_files}" ] ; do _failed_files= echo for _f in $_get_files ; do echo "Getting ${_f} ..." case $_f in *.tar.gz|*.tgz) ftp ${_ftp_active} -o - -V -m "${_src}/${_f}" | tar zxpf - -C /mnt ;; *) ftp ${_ftp_active} -o "/mnt/${_f}" -V -m "${_src}/${_f}" ;; esac if [ $? -ne 0 ]; then # Mark xfer as having failed,. _setsdone=`rmel $_f $_setsdone` _failed_files="${_failed_files} ${_f}" fi done # Offer the option of re-fetching failed files. _get_files= while [ -n "${_failed_files}" ] ; do display_failure_msg get_selection "$_failed_files" if [ "X${resp}" = X"done" ]; then break fi glob_selection "$resp" "$_public_src" "$_failed_files" done done } # Encode $1 as specified for usercodes and passwords in RFC 1738 # section 3.1, and now supported by our in-tree ftp: # # ':' -> '%3a' # '@' -> '%40' # '/' -> '%2f' # # *NOTE* quotes around $1 are required to preserve trailing or # embeddded blanks in usercodes and passwords! encode_for_url() { echo "$1" | sed -e 's/:/%3a/g' -e 's/@/%40/g' -e 's/\//%2f/g' } # Get several parameters from the user, and xfer # files from the server. # Note: _ftp_server_ip, _ftp_server_dir, _ftp_server_login, # _ftp_server_password, and _ftp_active must be global. install_url() { local _f _file_list _url_type _url_base _url_login _url_pass _oifs # Parse arguments, shell style case $1 in -ftp) _url_type=ftp ;; -http) _url_type=http ;; esac cat << __EOT This is an automated ${_url_type}-based installation process. You will be asked questions and then the files will be retrieved iteratively via ${_url_type}. __EOT # Proxy the connections? if [ -z "$_proxy_host" ]; then _proxy_host=none fi echo -n "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none') [${_proxy_host}] " getresp "$_proxy_host" if [ "X${resp}" = X"none" ]; then unset _proxy_host ftp_proxy http_proxy else _proxy_host=$resp export ftp_proxy=${_proxy_host} export http_proxy=${_proxy_host} fi if [ "${_url_type}" = "ftp" -a -z "$ftp_proxy" ]; then # Use active mode ftp? (irrelevant if using a proxy) case $_ftp_active in -A) resp=y ;; *) resp=n ;; esac cat << __EOT By default, ftp will attempt a passive connection and fall back to a normal (active) connection if that does not work. However, there are some very old ftp servers that claim to support passive mode, but really do not. In this case, you should explicitly request an active session. __EOT echo -n "Do you want to use active ftp? [${resp}] " getresp "$resp" case $resp in y*|Y*) _ftp_active=-A ;; *) unset _ftp_active ;; esac fi # Provide a list of possible servers [ -z "$_ftp_getlist" ] && _ftp_getlist=y echo -n "Do you want a list of potential ${_url_type} servers? [${_ftp_getlist}] " getresp "$_ftp_getlist" case $resp in n*|N*) _ftp_getlist=n ;; *) _ftp_getlist=y ftphost=129.128.5.191 if [ "X${_resolver_enabled}" = X"TRUE" ]; then ftphost=ftp.openbsd.org fi ftp ${_ftp_active} -V -a -o /tmp/ftplist ftp://${ftphost}/pub/OpenBSD/${VERSION_MAJOR}.${VERSION_MINOR}/ftplist > /dev/null cat /tmp/ftplist | grep "^${_url_type}:" | cat -n | less -XE ;; esac # Get server IP address resp= while [ -z "$resp" ] ; do if [ -f /tmp/ftplist ]; then eval echo -n "Server IP address, hostname, or list#? [\$_${_url_type}_server_ip]\ " else eval echo -n "Server IP address, or hostname? [\$_${_url_type}_server_ip]\ " fi eval getresp "\$_${_url_type}_server_ip" if [ "X$resp" = "X?" -a -f /tmp/ftplist ]; then cat /tmp/ftplist | grep "^${_url_type}:" | cat -n | less -XE resp= elif [ -n "$resp" \ -a `isnumeric $resp` -eq 1 \ -a ${resp:-0} -ge 1 \ -a -f /tmp/ftplist ] then maxlines=`grep "^${_url_type}:" /tmp/ftplist | cat -n | sed -n -e '$p' | cutword 1` if [ $maxlines -lt $resp ]; then echo "There is no ${resp}th line in the list." resp= continue fi tline=`grep "^${_url_type}:" /tmp/ftplist | sed -n -e "${resp}p"` url=`echo $tline | sed -e "s/^${_url_type}:\/\///" | cutword -t' ' 1 | cutword -t' ' 1` host=`echo $url | cutword -t/ 1` path=`echo $url | sed -e "s/^${host}\///"` path=${path}/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH} eval _${_url_type}_server_ip=$host eval _${_url_type}_server_dir=$path # do it again, just to double check resp= echo "Using $tline" else eval _${_url_type}_server_ip=$resp fi done # Get server directory if [ "${_url_type}" = "ftp" -a -z "$_ftp_server_dir" ] ; then # Default ftp dir _ftp_server_dir=pub/OpenBSD/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH} fi resp= while [ -z "$resp" ] ; do eval echo -n "Server directory? [\$_${_url_type}_server_dir]\ " eval getresp "\$_${_url_type}_server_dir" eval _${_url_type}_server_dir=$resp done if [ "${_url_type}" = "ftp" ]; then # Need default values even if we proxy ftp... if [ -z "$_ftp_server_login" ] ; then _ftp_server_login=anonymous fi if [ -z "$_ftp_server_password" ] ; then _ftp_server_password=root@`hostname`.${FQDN} fi # Get login name, setting IFS to nothing so trailing or # embedded blanks are preserved! _oifs=$IFS IFS= resp= while [ -z "$resp" ] ; do echo -n "Login? [${_ftp_server_login}] " getresp "$_ftp_server_login" _ftp_server_login=$resp done # Get password unless anonymous if [ "${_ftp_server_login}" != "anonymous" ]; then resp= while [ -z "$resp" ] ; do echo -n "Password (will not echo): " stty -echo getresp -n "$_ftp_server_password" stty echo echo _ftp_server_password=$resp done else # only used by ftp_list_files() _ftp_server_password=root@`hostname`.${FQDN} fi IFS=$_oifs fi # Build up the base url since it is so nasty... if [ "${_url_type}" = "ftp" -a "${_ftp_server_login}" != "anonymous" ]; then _url_login=`encode_for_url "${_ftp_server_login}"` _url_pass=`encode_for_url "${_ftp_server_password}"` _url_base=ftp://${_url_login}:${_url_pass}@${_ftp_server_ip}/${_ftp_server_dir} else eval _url_base=${_url_type}://\$_${_url_type}_server_ip/\$_${_url_type}_server_dir fi # Get list of files from the server. # XXX - check for nil $_file_list and deal if [ "${_url_type}" = "ftp" -a -z "$ftp_proxy" ] ; then _file_list=`ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_ftp_server_password" "$_ftp_server_dir"` else # Assumes index file is "index.txt" for http (or proxy) # We can't use index.html since the format is server-dependent _file_list=`ftp -o - -V "${_url_base}/index.txt" | sed 's/ //'` fi get_sets_list "$_file_list" "`eval echo \\$_${_url_type}_server_dir`" [ -z "$_sets" ] && return display_extract_msg get_get_files_list "`eval echo \\$_${_url_type}_server_dir`" # User may have selected no files [ -z "$_get_files" ] && return cat << __EOT Fetching files via ${_url_type} may take a long time, especially over a slow network connection. __EOT install_get_files_list "$_url_base" "`eval echo \$_${_url_type}_server_dir`" if [ $? -eq 0 ] ; then # Stash the fact that we configured and downloaded via this url method eval _installed_via_${_url_type}=1 fi } # $1 - directory containing installation sets install_from_mounted_fs() { local _f _get_files _file_list if [ ! -d "$1" ]; then echo "No such directory: '$1'" return fi _file_list=`ls -l ${1}` get_sets_list "$_file_list" "$1" [ -z "$_sets" ] && return display_extract_msg get_get_files_list "$1" # User may have selected no files [ -z "$_get_files" ] && return install_get_files_list "file:$1" "$1" } install_cdrom() { local _drive _range _part _fstype _directory _n # Get the cdrom device info if [ -z "$_CDDEVS" ]; then echo "No CD-ROM devices were found. Aborting." return fi cat << __EOT The following CD-ROM devices are installed on your system. Please make sure the CD is in the CD-ROM drive and select the device containing the CD with the installation sets: $_CDDEVS __EOT _drive=`echo $_CDDEVS | cutword 1` echo -n "Which CD-ROM contains the installation media? [$_drive] " getresp "$_drive" case $resp in abort) echo "Aborting." return ;; *) if isin $resp $_CDDEVS ; then _drive=$resp else echo "\nThe CD-ROM $resp does not exist.\nAborting." return fi ;; esac # If it is an ISO9660 CD-ROM, we don't need to ask any other questions _n=0 until disklabel $_drive >/tmp/label.$_drive 2>&1; do # Try up to 6 times to access the CD if egrep -q '(Input/output error)|(sector size 0)' /tmp/label.$_drive; then _n=$(( $_n + 1 )) if [ _n -le 5 ]; then echo "I/O error accessing $_drive; retrying" sleep 10 else echo "Cannot access $_drive. Aborting." return fi else break fi done echo if grep -q '^ *c: .*ISO9660' /tmp/label.$_drive; then _fstype=cd9660 _part=c else # Get partition from user _range=`md_get_partition_range` resp= while [ -z "$resp" ] ; do echo -n 'CD-ROM partition to mount? (normally "c") [c] ' getresp c case $resp in $_range) _part=$resp ;; *) echo "Invalid response: $resp" # force loop to repeat resp= ;; esac done # Ask for filesystem type cat << __EOT There are two CD-ROM filesystem types currently supported by this program: cd9660 ISO-9660 ffs Berkeley Fast Filesystem __EOT resp= while [ -z "$resp" ] ; do echo -n "Which filesystem type? [cd9660] " getresp cd9660 case $resp in cd9660|ffs) _fstype=$resp ;; *) echo "Invalid response: '$resp'" # force loop to repeat resp= ;; esac done fi rm -f /tmp/label.$_drive # Mount the CD-ROM if ! mount -t ${_fstype} -o ro /dev/${_drive}${_part} /mnt2 ; then echo "Cannot mount CD-ROM drive. Aborting." return fi # Get the directory where the file lives resp= _directory=${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH} echo "Enter the directory relative to the mount point that contains" echo -n "the file: [${_directory}] " getresp "$_directory" install_from_mounted_fs "/mnt2/${resp}" umount -f /mnt2 > /dev/null 2>&1 } mount_a_disk() { # Mount a disk on /mnt2. The set of disk devices to choose from # is $_DKDEVS. # returns 0 on failure. local _drive _def_partition _partition_range _partition _fstype local _fsopts _md_fstype _md_fsopts cat << __EOT The following disk devices are installed on your system; please select the disk device containing the partition with the installation sets: $_DKDEVS __EOT echo -n "Which is the disk with the installation sets? [abort] " getresp abort case $resp in abort) echo "Aborting." return 0 ;; *) if isin $resp $_DKDEVS ; then _drive=$resp else echo "\nThe disk $resp does not exist.\nAborting." return 0 fi ;; esac # Get partition cat << __EOT The following partitions have been found on $_drive: __EOT disklabel $_drive 2>/dev/null | grep '^ .:' echo _likely_partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/swap/s/.*//' -e '/unused/s/.*//' \ -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _def_partition=`echo $_likely_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then _def_partition=`echo $_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then echo "There are no usable partitions on that disk" return 0 fi fi resp= while [ -z "$resp" ]; do echo -n "Partition? [$_def_partition] " getresp "$_def_partition" case $resp in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" # force loop to repeat resp= ;; esac done # Ask for filesystem type cat << __EOT The following filesystem types are supported: default (deduced from the disklabel) ffs __EOT _md_fstype=`md_native_fstype` _md_fsopts=`md_native_fsopts` if [ -n "$_md_fstype" ]; then echo " $_md_fstype" else _md_fstype=_undefined_ fi resp= while [ -z "$resp" ]; do echo -n "Which filesystem type? [default] " getresp default case $resp in default) _fstype= _fsopts=ro ;; ffs) _fstype="-t $resp" _fsopts=async,ro ;; $_md_fstype) _fstype="-t $resp" _fsopts=$_md_fsopts ;; *) echo "Invalid response: $resp" # force loop to repeat resp= ;; esac done # Mount the disk if ! mount $_fstype -o $_fsopts /dev/${_drive}${_partition} /mnt2; then echo "Cannot mount disk. Aborting." return 0 fi return 1 } install_disk() { if mount_a_disk ; then return fi # Get the directory where the file lives echo "Enter the directory relative to the mount point that" echo -n "contains the file: [.] " getresp "." install_from_mounted_fs "/mnt2/${resp}" umount -f /mnt2 > /dev/null 2>&1 } install_nfs() { # Get the IP address of the server resp= while [ -z "$resp" ] ; do echo -n "Server IP address or hostname? [${_nfs_server_ip}] " getresp "$_nfs_server_ip" done _nfs_server_ip=$resp # Get server path to mount resp= while [ -z "$resp" ]; do echo -n "Filesystem on server to mount? [${_nfs_server_path}] " getresp "$_nfs_server_path" done _nfs_server_path=$resp # Determine use of TCP echo -n "Use TCP transport? (only works with capable NFS server) [n] " getresp n case $resp in y*|Y*) _nfs_tcp=-T ;; *) _nfs_tcp= ;; esac # Mount the server mkdir /mnt2 > /dev/null 2>&1 if ! mount_nfs $_nfs_tcp ${_nfs_server_ip}:${_nfs_server_path} /mnt2 ; then echo "Cannot mount NFS server. Aborting." return fi # Get the directory where the file lives resp= while [ -z "$resp" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file: [.] " getresp done install_from_mounted_fs "/mnt2/${resp}" umount -f /mnt2 > /dev/null 2>&1 } install_tape() { local _xcmd # Get the name of the tape from the user. cat << __EOT The installation program needs to know which tape device to use. Make sure you use a "no rewind on close" device. __EOT _tape=`basename $TAPE` resp= while [ -z "$resp" ]; do echo -n "Name of tape device? [${_tape}]" getresp "$_tape" done _tape=`basename $resp` TAPE=/dev/${_tape} if [ ! -c $TAPE ]; then echo "$TAPE does not exist or is not a character special file." echo "Aborting." return fi export TAPE # Rewind the tape device echo -n "Rewinding tape..." if ! mt rewind ; then echo "$TAPE may not be attached to the system or may not be" echo "a tape device. Aborting." return fi echo "done." # Get the file number resp= while [ -z "$resp" ]; do echo -n "File number? " getresp case $resp in [1-9]*) _nskip=$(( $resp - 1 )) ;; *) echo "Invalid file number ${resp}." # force loop to repeat resp= ;; esac done # Skip to correct file. echo -n "Skipping to source file..." if [ "X${_nskip}" != X"0" ]; then if ! mt fsf $_nskip ; then echo "Could not skip $_nskip files. Aborting." return fi fi echo "done." cat << __EOT There are 2 different ways the file can be stored on tape: 1) an image of a gzipped tar file 2) a standard tar image __EOT resp= while [ -z "$resp" ]; do echo -n "Which way is it? [1] " getresp 1 case $resp in 1) _xcmd="tar -zxvpf -" ;; 2) _xcmd="tar -xvpf -" ;; *) echo "Invalid response: $resp." # force loop to repeat resp= ;; esac ( cd /mnt; dd if=$TAPE | $_xcmd ) done echo "Extraction complete." } get_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath # If the timezone directory structure is not # available, return immediately. [ ! -d $_zoneroot ] && return cat << __EOT Select a time zone for your location. Timezones are represented on the system by a directory structure rooted in "/usr/share/timezone". Most timezones can be selected by entering a token like "CET" or "GMT-6". Other zones are grouped by continent or country, with detailed zone information separated by a slash ("/"), e.g. "US/Pacific" or "Canada/Mountain". __EOT if [ -L /mnt/etc/localtime ]; then TZ=`ls -l /mnt/etc/localtime 2>/dev/null | cutlast` TZ=${TZ#${_zoneroot#/mnt}} fi [ -z "$TZ" ] && TZ=GMT while : ; do _zonepath=$_zoneroot echo -n "What timezone are you in? ('?' for list) [$TZ] " getresp "$TZ" if [ "$resp" = "?" ]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [ -d "$_zonepath" ]; do echo -n "Select a sub-timezone of " echo -n "'${_zonepath#$_zoneroot}' ('?' for list): " getresp if [ "$resp" = "?" ]; then ls -F ${_zonepath} else _zonepath=${_zonepath}/${resp} fi done if [ -f "$_zonepath" ]; then TZ=${_zonepath#$_zoneroot} echo "You have selected timezone '$TZ'". ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { if [ ! -s /mnt/bsd ]; then cat << __EOT Warning, no kernel (/mnt/bsd) installed! You did not unpack a file set containing a kernel -- this is needed to boot. Please note that the install kernel is *not* suitable for general use. __EOT elif [ ! -f /mnt/bin/cat ]; then cat << __EOT You still do not have a /bin/cat in your filesystem (i.e. a sample random file which you probably want). This seems to indicate that you are still missing important distribution files. __EOT elif [ ! -x /mnt/dev/MAKEDEV ]; then cat << __EOT No /dev/MAKEDEV has been installed yet. __EOT elif [ ! -d /mnt/etc -o ! -d /mnt/usr/share/zoneinfo -o ! -d /mnt/dev ]; then cat << __EOT One or more of /etc, /usr/share/zoneinfo or /dev is missing. Did you forget to extract a required set? __EOT else return 0 fi cat << __EOT You will now be given the chance to install the missing set(s). You can enter '!' at the prompt to escape to a shell and fix things by hand if you wish. __EOT return 1 } install_sets() { local _yup=FALSE _have_nfs # Can we do an NFS install? [ -f /sbin/mount_nfs ] && _have_nfs=true # Ask the user which media to load the distribution from. cat << __EOT You must now specify where the ${MODE} sets you want to use are. They must either be on a local device (disk, tape, or CD-ROM), an accessible NFS filesystem or an accessible ftp or http network server. You will have the chance to repeat this step or to extract sets from several places, so you do not have to try to load all the sets in one try and can recover from some errors. __EOT if [ -n "$local_sets_dir" ]; then install_from_mounted_fs "${local_sets_dir}" [ -n "$_setsdone" ] && _yup=TRUE fi # Go on prodding for alternate locations resp= while [ -z "$resp" ]; do # If _yup is not FALSE, it means that we extracted sets above. # If that's the case, bypass the menu the first time. if [ X"$_yup" = X"FALSE" ]; then echo -n "Install from (f)tp, (h)ttp, (t)ape, (C)D-ROM" [ -n "$_have_nfs" ] && echo -n ", (N)FS" echo -n " or local (d)isk? " getresp case $resp in d*|D*) install_disk resp=d ;; f*|F*) [ -n "$_didnet" ] || donetconfig install_url -ftp resp=f ;; h*|H*) [ -n "$_didnet" ] || donetconfig install_url -http resp=h ;; t*|T*) install_tape resp=t ;; c*|C*) install_cdrom resp=c ;; n*|N*) [ -n "$_didnet" ] || donetconfig if [ -n "$_have_nfs" ]; then install_nfs resp=n else echo "Invalid response: $resp" resp= fi ;; *) echo "Invalid response: $resp" resp= ;; esac else # So we'll ask next time _yup=FALSE fi # Perform sanity checks... if sane_install; then # Give the user the opportunity to extract more sets. They # don't necessarily have to come from the same media. echo -n "\nExtract more sets? [n] " getresp n case $resp in y*|Y*) # Force loop to repeat resp= ;; esac else # Not sane, don't exit loop. resp= fi done } # Create a fstab to use for fsck'ing, mounting and unmounting all # of the target filesystems relative to /mnt. munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do # Skip comment lines, non-ffs filesystems and # 'noauto' filesystems. case $_dev in \#*) continue ;; esac case $_fstype in ffs) ;; *) continue ;; esac case $_opt in *noauto*) continue ;; esac # Don't use soft updates _opt="$(echo ${_opt} | sed 's/,softdep,/,/; s/,softdep//; s/softdep,//')" if [ "$_mp" = "/" ]; then _mp= fi echo $_dev /mnt$_mp $_fstype $_opt $_rest done > /etc/fstab } # Must mount filesystems manually, one at a time, so we can make # sure the mount points exist. mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do # If not the root filesystem, make sure the mount # point is present. if [ "X{$_mp}" != X"/mnt" ]; then mkdir -p $_mp fi # Mount the filesystem. If the mount fails, exit. if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then # In addition to the error message displayed by mount ... cat << __EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the ${MODE}. __EOT exit fi done < /etc/fstab } # Script is exiting. Clean up as much as possible. cleanup_on_exit() { local _bad_devs echo "\nCleaning up..." # Kill any running dhclient, so a restart will not # find /dev/bpf0 busy. Do this first so a user who # interrupts out of any fsck'ing will not be stuck # with an active dhclient. if [ -f /var/run/dhclient.pid ]; then echo "Stopping dhclient" kill -HUP `sed -ne "1p" /var/run/dhclient.pid` > /dev/null 2>&1 rm -f /var/run/dhclient.pid fi if [ -f /etc/fstab ]; then umount -av elif [ ! "`df /`" = "`df /mnt`" ]; then umount -v /mnt fi echo "Done." } # Remount all filesystems in /etc/fstab with the options from # /etc/fstab, i.e. without any options such as async which # may have been used in the first mount. remount_fs() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do if ! mount -u -o $_opt $_dev $_mp ; then # error message displayed by mount exit 1 fi done < /etc/fstab } # Preen all filesystems in /etc/fstab, showing individual results, # but skipping the root filesystem device given in $1. This was # already fsck'ed successfully. check_fs() { local _dev _rest _badfsck=0 _root=$1 while read _dev _rest; do [ "$_dev" = "$_root" ] && continue echo -n "fsck -p ${_dev}..." if ! fsck -fp ${_dev} > /dev/null 2>&1; then echo "FAILED. You must fsck this device manually." _badfsck=1 else echo "OK." fi done < /etc/fstab return $_badfsck } # Find LAST instance of DOMAIN or SEARCH and extract first domain name # on that line as FQDN. Then ask user, just to be sure. # $1 = resolv.conf file to search for FQDN # $2 = hosts file to add FQDN information to get_fqdn() { if [ -f "$1" ]; then FQDN=`sed -n \ -e '/^domain[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '/^search[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '${g;p;}' $1` fi if [ -f "$2" -a -n "$FQDN" ]; then # Add FQDN to hosts file entries created by addhostent, changing # lines like # 1.2.3.4 hostname # to # 1.2.3.4 hostname.$FQDN hostname sed "s/\\(.*\\)[[:space:]]\\(.*\\)\$/\\1 \\2.$FQDN \\2/" < $2 > $2.new mv $2.new $2 else echo -n "Enter DNS domain name (e.g. 'bar.com'): [$FQDN] " getresp "$FQDN" FQDN=$resp fi } donetconfig() { _didnet=1 _nam= if [ -f /tmp/myname ]; then _nam=`cat /tmp/myname` fi resp= while [ -z "$resp" ] ; do echo -n "Enter system hostname (short form, e.g. 'foo'): [$_nam] " getresp "$_nam" done hostname $resp echo $resp > /tmp/myname # Always create new hosts file. If install.sh has been # restarted, an existing one may contain information which # will conflict with the information about to be entered. # Also ensures logic to put FQDN in hosts file will create # hosts file lines in correct format. echo "::1 localhost\n127.0.0.1 localhost" > /tmp/hosts # Remove any existing hostname.* files. If install.sh has # been restarted, this ensures a correct list of configured # interfaces is displayed, and gives the user a chance to # change which interfaces are to be configured. rm -f /tmp/hostname.* # Revoke any previous decision on whether or not to use # a nameserver during installation. rm -f /tmp/resolv.conf.shadow cat << __EOT If any interfaces will be configured using a DHCP server it is recommended that you do not enter a DNS domain name, a default route, or any name servers. __EOT FQDN= get_fqdn /tmp/resolv.conf configure_all_interfaces # As dhclient will populate /etc/resolv.conf, a symbolic link to # /tmp/resolv.conf.shadow, mv any such file to /tmp/resolv.conf # so it will eventually be copied to /mnt/etc/resolv.conf and will # not in the meantime remove the user's ability to choose to use it # or not, during the rest of the install. if [ -f /tmp/resolv.conf.shadow ]; then mv /tmp/resolv.conf.shadow /tmp/resolv.conf fi # Get any DHCP supplied FQDN, and in any case apply FQDN to # the host names in /tmp/hosts, all without asking for any more # user confirmation. This means DHCP supplied information will # override a user supplied (or previous DHCP supplied) FQDN. get_fqdn /tmp/resolv.conf /tmp/hosts resp=`route -n show | grep '^default' | sed -e 's/^default *//' -e 's/ .*//'` if [ -z "$resp" ] ; then resp=none if [ -f /tmp/mygate ]; then resp=`cat /etc/mygate` if [ -z "$resp" ]; then resp=none fi fi fi echo -n "Enter IP address of default route: [$resp] " getresp "$resp" if [ "X${resp}" != X"none" ]; then route delete default > /dev/null 2>&1 if route add default $resp > /dev/null ; then echo $resp > /tmp/mygate fi fi resp=none if [ -f /tmp/resolv.conf ]; then resp= for n in `grep '^nameserver ' /tmp/resolv.conf | \ sed -e 's/^nameserver //'` do if [ -z "$resp" ] ; then resp=$n else resp="$resp $n" fi done fi echo -n "Enter IP address of primary nameserver: [$resp] " getresp "$resp" if [ "X${resp}" != X"none" ]; then echo "search $FQDN" > /tmp/resolv.conf for n in `echo ${resp}`; do echo "nameserver $n" >> /tmp/resolv.conf done echo "lookup file bind" >> /tmp/resolv.conf echo -n "Would you like to use the nameserver now? [y] " getresp y case $resp in y*|Y*) cp /tmp/resolv.conf /tmp/resolv.conf.shadow ;; esac fi if [ ! -f /tmp/resolv.conf.shadow ]; then echo "\nThe host table is as follows:\n" cat /tmp/hosts cat << __EOT You may want to edit the host table in the event that you are doing an NFS installation or an FTP installation without a name server and want to refer to the server by name rather than by its numeric ip address. __EOT echo -n "Would you like to edit the host table with ${EDITOR}? [n] " getresp n case $resp in y*|Y*) ${EDITOR} /tmp/hosts ;; esac fi cat << __EOT You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. __EOT echo -n "Escape to shell? [n] " getresp n case $resp in y*|Y*) echo "Type 'exit' to return to install." sh ;; esac } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } finish_up() { # Get timezone info get_timezone echo -n "Making all device nodes (by running /dev/MAKEDEV all) ..." cd /mnt/dev sh MAKEDEV all echo "... done." cd / md_installboot ${ROOTDISK} populateusrlocal # XXXXX - what is this for? [ -x /mnt/${MODE}.site ] && /mnt/usr/sbin/chroot /mnt /${MODE}.site # Unmount filesystems, etc. Disable trap that would do same on exit. # Do this manually rather than through the trap so md_congrats is # the last message printed. trap - HUP INT QUIT TERM EXIT cleanup_on_exit # Pat on the back. md_congrats exit 0 } ######################################################################## # # Initial actions common to both installs and upgrades. # # Some may require machine dependent routines, which may # call functions defined above, so it's safest to put this # code here rather than at the top of the file. # ######################################################################## ROOTDISK= VERSION=31 VERSION_MAJOR=$(( $VERSION / 10 )) VERSION_MINOR=$(( $VERSION % 10 )) export VERSION VERSION_MAJOR VERSION_MINOR # Use install.md routines to get lists of devices on system _DKDEVS=`md_get_diskdevs` _CDDEVS=`md_get_cddevs` # extra "site" set can be provided by person doing install or # upgrade. THESETS="base etc misc comp man game xbase xshare xfont xserv site $MDSETS" # Global variable using during sets installation local_sets_dir= _sets= _setsdone= _osetsdone= _get_files= # decide upon an editor if [ -z "$EDITOR" ] ; then EDITOR=ed if [ -x /usr/bin/vi ]; then EDITOR=vi fi export EDITOR fi # Cleanup when the script exits. trap 'cleanup_on_exit' EXIT trap 'exit 2' HUP INT QUIT TERM # Good {morning,afternoon,evening,night}. echo md_welcome_banner if [ -f /etc/fstab -a "${MODE}" = "install" ]; then cat << __EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT echo -n "Skip disk initialization and p" else echo -n "P" fi echo -n "roceed with ${MODE}? [n] " getresp n case $resp in y*|Y*) echo "\nCool! Let's get to it...\n" ;; *) md_not_going_to_install exit ;; esac # Deal with terminal issues md_set_term cat << __EOT At any prompt except password prompts you can run a shell command by typing '!foo', or escape to a shell by typing '!'. __EOT c2_compiled.___gnu_compiled_c_open_countnetif_sun.ogcc2_compiled.___gnu_compiled_c_netif_prompromdev.ogcc2_compiled.___gnu_compiled_c_filestore.9_bootstore.10_prom0_fake_saveecho_pv_putchar_sun4_idprom.65_dtab_stringbuf.75_promdev_inuse_prom_mapin_prom_mapinfo_prom_mapinfo_cnt_prom_devmap_promvecstore.88version.ogcc2_compiled.___gnu_compiled_cufs.ostrncpy.obootparam.ocd9660.ogets.onfs.orpc.ostrerror.orarp.onet.oin_cksum.oether.oglobals.omemcmp.oexit.ocloseall.ocread.oalloc.omemcpy.omemset.oclose.olseek.oopen.oread.oprintf.oarp.osdiv.oashrdi3.ostrcmp.o__main.ostrlen.oudiv.oumul.ourem.obzero.orem.oinflate.oadler32.oinfblock.oinfcodes.oinffast.oinfutil.oinftrees.ocrc32.o ` h p x  (08@HPX`hpx (08@HPX`hpxhpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxhpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx@h 8`@#`3#P" $@``T@1#3cP@"@H*/+,3"`  0  "#,"# *,"#!`,"#@>> OpenBSD BOOT %s bsddevice[%s]: boot: open: %s: %s Booting %s @ 0x%x 㿘@T@-!@ 3"@`L@ 3!313%3/+3)3-'3 5@a(@ $ aH@{"H@ M"H 2%aH@r @ L 2@b !h8@a@@gBad format %d+%d+[%d+%d]=0x%x boot: short read x@ ;%?@ ?# @!2?3܀a"0?@ ?# @!2?%܀a""?@ ?# @! 2?܀a "?@ ?# @ 2 ܀`@"0@"?@ ?# @!  a ܤ` ܐ@;܀?@@ ?# @! a "?@ a?# @!"  @ .@`@ 2.@"@@ k@@ 䀤 .@?`耣 C.@ .`".`.`@`@耢@F#2@ c|@ٔ  < c|.@ .` .` .`c|  ?`@Ĕ2'@"@m`? ? @3"@a"@,c 3 3! b1  Ā 0@K",? Ċ`Ī@` Ē`IJ@` @ dvma_mapin㿘? #@(1?@,#(1?dvma_mapout㿘 #@(1@#p1㿘@ " ْ㿘 @㿘1#` @- "`3 !h@/ # $#㿘1c耢 ? "c-@}`boot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s 㿐'-@j?73"Ȣ!' @@@ )32 @b0-!X12`#@ 23#!' @n@#'@  3 3!h 2 3!p㿘3p` 231"p#"`"`"`"` "`"`" @`  "ah? 3 h ?3p 㿘  ; < 㿘 - D@@H   @="&  ?  promprom0㿘,#`3@3`  $  32 `"H3""@JJ`  -2*@3"@@ (*`J@ @ *`  2`3"!HJ  *@J` )*@` 3`""@``*J@ -& @33 *:  c` d a !J@ s !J@  !$!#a @ #!J@  @Can't open device `%s' Can't open network device `%s' 㿘@ ,#`  @aܔP$` $`%33  `( $ 3aH€  !a\$` $`$@ H@Z!02H@ $`&` 2!22,c @ "P H@@!0",c @,cԐ @ - "` #-`  $$ 㿘#3``   ``*  ``   '@`2`0`,6 * '@ 㿘  ʒ& `& $& (   €͒ " '@ 㿘 ` @ 3  `( ( @0@ 㿘   2  @! $ ?2`$ *㿘3 ` `0`4 㿘3 ` `?`8 ? xmit: not a network device 㿘  ,`@|!?K@ S`?㿘 ,5`€>㿐3 `` (`P      O/O O /O㿘㿐3  `      O ? X/O O /O㿐3 /  0T@㿘  㿘3 `t€㿘@-@D㿐3`     X  p@%x mac-address drop swap 6 cmoveX,#` #32  ` 2   Њ@+`  "".@ .` .` .` .` .``` `€0 `@`|@ielefdxyxdstsddevice_typeblocknetworkbyte㿘3 ` !-`@@Xa@a ' b@  @b    H` HN@J@2J`N` " 2 node %x property %s length %d > %d 㿘3 ` € 0#@ 㿘2 @ޖ ??" ,Invalid controller number prom_iopen: "%s" error=%d 㿘)2! ?N  @ 3"aa$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $` @ΐ#+  " * @F $`0 "$`4 " @D$` @ 2!&  %! @# 㿘#2a  @ 4 "$a & 4$aprom_mapin: length=%dprom_mapin: invalid maptype %d㿘,#*`@ -!@|! --         !@e` `,#@ ,#8 <?*   آ&@  ` ,#@㿘?(2,13\& H L` T ` X P d l$ p  t @2 .@2.1㿐``@ 0@ `@`@[ @ * @S   @@ x ` *  d,  0 2 0 0@" x @s*  @`?``"? 6"?%` 0@㿘 `  .` 8@ ^&  @   @`&@``@@6``,`G D& h`?  ,` @@!  @!0$@r     d ,  0 2 0 2 %@` ,`@L@Ԑ,`& 㿐   e<`P @@ܔ 4`0*:  8  2`0 @8e<`0e<eD `L  Ȁ)n 2; @`0$  " @   `d  *  0 @$ $  $&@&    b 8   @   " & 㿐`@  <@`@-5 2& :@ "   2  @l  " *@B<@@` ڐ2 ``@Ӑ 㻀@@ Ц @ &`@9@$`   `  @2 %\F!T@  0@@eg0   @ t,   $@  '` L@  @5<`/2L@`L@ /"`L@"y   נ  / ``4k `L@  /`,@P谒 \,@+ W(  2LL@@ $H  E;@%( 8@"@ 0 K䰒 *@`  d*  0` @O / ' 'ܒ L@  @   0@ @@ Ё㿘 &     . @ "  @0  .  "  @z0 @w@t а 㿐 @j@&B<@@`@@ ``@0 2&     ":?"   ? @ : ` :?  2`"` "`:`0㿐`  8 `@@2.@``@.@+?) @ " " ""@@C <@  @ @ @ B <@   @(*`  bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d p k3"1a"'А $  $ $ ''X@ג 2W?-a0??"a04` $@!#`"#@ #\ @  !2 @Ő#<?#3"$bD@"$*`4bD' @2 6` @##?2'ܢ ܔ"""2b0@ ?3"2b@w  ?2@b ? ?  P2"2b0''@H 2C?@!@? 2:?-a02?"a06 $"&#`a#@b#\ @'   3 H"ah''@( 2?@J 2?#'@ ? ?㿘`&"@  &@  㿘`&@   ? & @ Ԕ.@&  @""#d d " e" f" g"#" ?  +d +e +f +gd"@# @ ` J@(8(8    `J/`? `2A ` `!J@(8(8  . ` J J#   J@;..2J`;2 , `J@; @Є 8 <` CD001㿐@ ( ( @V`  -``( (  !@ R     2` * @h * *` * +  *+`  h  @ (g 8@ @`-`  ` ΀ǰ    *` *   *  M `N JL *  2D     !*  *` * @*@  @  @ L  *  "M  !   L  *  2 M  : L  *    g2 @ ``  `-`( U(  gh 8  *   *` * ƒ  @ @@ ˀg@+ @    >>>&`>  * *`   * & +` * +   :>@ 0  @  @ 㿘  @ &  㷐 R@ N`@4 @H``@C@2 *@ `  @ ,  ( )􀢨$ 2@` ' 8'" w@ '@@ @ B <@&hhB <@2&     ":?"   ? @ : ` :?  $2`"`"`  :`0 㿘c  ,  ". /.".+."&  "!".. 0  ? 0 @͠L *L0} 0z 0pؒ  @ S@ 8 'pt@ ( ,  $ #`a#\b` @' ? 3 H "ah؀`3@   "!h?㽠P  x@   'P $` $` $`  $$` ($` ,$`@ $` 8 t@  $`   h #`ab`$#\ @ ? 3!h x 0  &,& &&& D& &(&$@ 㺈 ` ($a b ????#\#`  @ ? 3!h `  dh@ d .@  ?nfsread: short packet, %d < %ld 0  '  $  $  (  ,     $$L#`a $b (#\  @b ,? L `" H3"!h?@T@ B0  @ y3 H"ah?㿘@ -3 "ah!02"!06 & 2 ?  " $?!$ "  ?nfs_open: must mount first. 㷈2##` @ :" N  m `/2N N /" N a  0 ] @ x  <$N O  N  /  .ɔ A.0 0〢 2;@ @  $+  (@;@O`/  @ x@ x  @ x N  &`  @x x@s x㿘  "& @i x&  nfs_read: hit EOF unexpectantly㿘' #3!3%@ {   ݖ? ah2  !䀢 @ P  ; B& > @ 2&     D  "; ?  ?  @ ;   `; ?  -0( 4 2`:2` <"` @"`D :`0 callrpc: error = %d 㿐\@?<6   '?'?@?2x '?` '?`@"x"?'?Đ #`#` #`#`#\ #`a $  p@X? 3` @``2"@#3 H"ah?recvrpc: reject, astat=%d, errno=%d 㿘!3$!h@ 2#x@ 2?`2 ?`` $!h H@’ ??"@?23P3( 2  2 2 *?3!P #!P!P3("#!P" " " getport: %s㾐a"@3 o'?(' "p #\#` ""   6   p'0 #3!ah@f!Ȓ@Q H$ah?bad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentUnknown error: code %d㿘`W1!(*` €10"1-"1*"1'#1$#1!#01#@1#X1#p1#1#1#1 #1  12!` @8D8D8E8E8D8D8E8D8E8E8E8E8E8E8E8E8E8E8E8E8E8D8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8D8E8E8E8E8E8E8E8E8D8E8E8E8D\8Dh8Dt8D8D8Drarp: bad socket. %d No response for RARP request Ӑ @B"J?  .@  7Ɛ(   , 4 , 4 ` 44 `~4 `4 `4 ``4 `4 #\ D .@q @"? 32b b2  b @ 0- ? @ -??"aȰ $`㿘- P@ 5㿐@3!"!h  5@2?@ 2?`(2?`&2?` 2 ? `@  ??sendudp: bad write (%d != %d)x&$`$` $`$`$`$`<* @ *@@ &  ,`,` 4` $`  $`@4`  6 4 4 `'`'` '`'&$`,` '@4` 4 쀣?&$`$`$`  $` -!؀    2`'" 'ܐ@_ܖ@( @?!@Qreadudp: huge packet, udp len %ld x@ް zހ( (  t?@͒o?2m?<@ 2f? 2b?6` <`\@u 2X? &T?``  2L?` &@  "@4  ` 2=?` 5` %@"0? ,  $ $ ' '`'''4 @8  ?$$ $ $ $ $$ $ $ $ ` ??sendrecv: short write! (%d < %d)㿘\   )3 <+`%!h(?@ @a @,`4 2 !h   $$@Ӧ` l J` Є * (Ж  (8. 53 ".?" 8" ?#  0 `(?`d((  `d(h(*  ?#㿘@㿘2!,@  .  @ 0,@@ "@  0,@@  0,@,@6 ` "@(* 8("@ Є (@ 㿐 "= N -N`$* `.! גN*`? @ . Ȓ?N*`# @ .   J `   `&     ,` ` `   ( `߀` ܗ(2 ?# : :* 㿘 3` 3` 3`  .+`+`+`+`3`  +` ??㿘   @,   -aP@%  "` ?` ?72-8 :  0 *@ `  *@`*@`2*!耢" @ ` ?  2   㿘2b'H'L'P'T 'X @"b@H@ exit㿘 `㿘3"Р , @` @ , 㿘@@V㿘@~ 㿘 < " ? 2  @13 D&!h@[  $ !h `$ <?$ 8 D$ ?$  @`$㿘אԐ* А* ̐?. ?$`8㿘-!  , @     & &"   & L`?& & S`?   2?  ?B& 8     `* ??w?2? o  e  "  < Z   <  ?& 81.1.4㿘@\?.`,@ P2". `"  P @ՐȐ?@/ 8 `@v &`D&@a&`@0 @`@ P@Ő?㿘 3 "ah?3"Г. @ 2. " @ D@y@v P@㿘2".  8?? ?2$  ?$8$ L "88 @P  "@"$ $$$$ @' 43!h`$<" $& @$$$<S < D!3$!h@ $!h $<D$@ #$8 H@є" $H H ?$88 @=$$  @ $H8 2  < 2  2L H@" $H&㾘 3 3"Г- @2@9"-  `L @?2+$`)'$`" ` 3f c3b @F ` 42$`@   @ ?L @`D P @Ȑ?@ 8$@$`D$`@.` 4@ 1@ /@ f )`' a !ڒ: @3  Yd 4 `0 Y"ah??- ? * `:```? -a "a"    -?"  耢@ @   @ *0   @ *`(㿘3. "Ѐ @  @  3 $"ah2  " @      @ $3"!h`3 "!h?㿘3. "Д@ @  3 "  3  Y :@B: Y"ah? ?   ` 㿐3"а @  `  ` 3 D"ah$@$`$` ' 83@`` / "`J -`)$@&$`  @  2" € ` `  `" ` @3"!h$@?㿐3. "Ѐ @@  3 ,"ah" @% * 2`      3 "ah B< ' 3 "ah&?2( 㿘!2#'L'P'T'X$"@L"*㿘'H'L'P'T'X#@ H㿘#@8N@`N@`%` N@`|`"*` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @L N@ @C N@ @: N@ 0 x  @, N@ % w ls8d8eh8e8fl8fl8fl8fl8fl8fl8fl8d8fl8fl8e8f48fl8fl8ex8fl8f8fl8fl8fH0123456789abcdef㿈"@ǒ @,@  ?L?|/-\㿘-!` 2" cpJ@ #" arpwhohas: overflowed arp_list! arp: no response for %s-"X@ -!@  'h@@C`@ ` X  $X#ƒ  . 7Ɛ(  , 4 , 4  ~4   44  4  4  4 hax4 j4 h!$@#\ .? h!'l#l ` `4` X4`  $X4`㿘-P2(㿐H3-"!h(2*?@ 2&?`(2"?`&2?`  @??-"X-*@ *`@ `V  ??㿘@ /`(+`&'` # `:   `6`6`` ` 6``6``6`6` 6` 6`   .6`  `6` (6`@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&   ?: :  *2@ : J@   J@J`   J " @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &   `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  㿘 ?`2"`0"`"`   "` @ߔ 㿘 ? ` $ 2`0 " $@ $  (€ $ 㿘"M?N 12I?8 D?2 @? &  & & ( $ 2  & $   (  )& "  `"   "`  ( ?"  `   "( *@  "` ?㿘 unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check㿘 "@?  "<? 7` ?? ` .#*` € %  $ $  @  " `$  "b` 2    "b " `  $ $    $`*   &@ݒb`   &@&@  ސ? `$ $    * "` $" `˒  $ $    *` " $" `  $ $    *` " $"    $ $  @ ` " $ $ 0" "b $ " @?   " F"" s @u `  5"@ "@  a? `$ $    * "` $" `N  $ $   *` " $" `9  $ $   *` " $" `$   $ $   " $@  "b $  " " ??8{D8{8|`8|8}8}T8}8}8~T8~8~8H88ԝ㿘    "#? ? @s 0  ? & 06 * ?$@ @  "@ 㿘 A?`2@0;  "@"` 20?  -"`  @`#@  ?( "$$$ "` $$ "@?㿘 " ?   ?  @m㿘?6  ` W R !6& @`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ @β` @`@##񀦠,`     㿘" <&? 8`$`(€  2 ( @G (& 8& 0& & & 4   & <&`0㿘`  `( @ 2` *  `(% $ $`(`$€ 0`  `(  $ ($ ,$ 8$  `( `$€ $`(`$€invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeath 0 4@`  "? ,"` +$#*` €Ш?  *`` 4  `&  `-`0  `4 $@&إ4@ Ð@9耢 & & & @&``$  &`&@& 4?  &4!&!p&`4& & @&``$  &`&@& 4ڔ??  *`` ?#4* @! &!&`& & @&``$  &`&@& 4?`&  m p  `& & @&``$  &`&@& 42D  , ` 0 ( @ "?"`22 & 4@E 0 4 "@ ,? ," ` 0 ( @ "?"`2 & & @&``$  &`&@& 4Y 8I "@`%%@ &     &?  *``  ?, & 4   ! !&!&`& & @&``$  &`&@& 4? `  `( & & & @&``$  &`&@& 4? &4&   2  @  #?  *``   *@ *`"  & 2  4     #* *`"  &  &   $ @ ?2 & `(`$€  && & @&``$  &`&@& 4 &&  4   ! @  -!"ha @,  a?  *`@ ,   *`    $@ * "  & T4    @  E?  *`@ + 4$@  4 @ ! @$@ 4 2!  `$€`( &&`& & @&``$  &`&@& 4+?  ( ? + "@ &  4   ! @     $4  `#\#`&    !`''#d@Sܠ ?2& `$`(€ && & @&``$  &`&@& 4@؀ 2& & & @&``$  &`&@& 4Δ?`$`(€ && & @&``$  &`&@& 4@   @G 0 4@`  "? ,"   c&&& 4@X 4 0 0 4@& & @&``$  &`&@& 4 && & @&``$  &`&@& 4q & & @&``$  &`&@& 4c?& & @&``$  &`&@& 4U& & @&``$  &`&@& 4G& & @&``$  &`&@& 49& & @&``$  &`&@& 4+& & @&``$  &`&@& 4& & @&``$  &`&@& 4& & @&``$  &`&@& 4?@8h88\8<8,88888P㿘* `( `$€ (`(`$€ $`(`$€㿘 (Ք (@& 0& 4`?㿘 (    * * " " "invalid literal/length codeinvalid distance code㿘 0 4 @`  "? ,"@` '!@*` €)` '& & @&``%@&@&`& 4 ` ``@0` 0 4@ `  "@? ,": $@ ` `$` $`$@` -`  *   -bh+`@ ` * @  @$ 4  $`$@  @ $` $`$@_   $@%$@ &`& & @&``%  &`&@& 4?` -`b  *   -"h+`  ` ` `$`$ $` $`$@4 ` -`Q  *   -bh+`@ ` * @  @$  4 $` $` A$@ @ $` * 8$`%$@ 8&`& & @&``%  &`&@& 4O?` -`   *   -"h+`  `  $` $ $@4 `  (  ` ,"  *"$@27  ,  0 ( @ "?"2% & 4@C 0 4 "@ ,? ,"  0 ( @ "?""&  ( ,  (`? $`$@2D `  ,  0 ( @ "?"22 ` & 4@ 0 4 "@ ,? ,"  0 ( @ "?"2 ` & & @&``%  &`&@& 4 (i$@ & 4?`?@ 4 0 0 4@& & @&``%  &`&@& 4r $@& & @&``%  &`&@& 4b & & @&``%  &`&@& 4T?& & @&``%  &`&@& 4F& & @&``%  &`&@& 48& & @&``%  &`&@& 4*& & @&``%  &`&@& 4& @&``%  &`&@& 4& & @&``%  &`&@& 4?@888p8888h888x8㿘`(`$€invalid distance codeinvalid literal/length code㿘04@`  , -h. ((```(@( @ @'"h` &@6 . &@`` 6@(``` (' @@"h` &@V6` (@ &@(`@ `. &@'.6, * @(!?/ (?/ y?/ / ?/ i?/ / ?/ X @2 `. `(. @@@6` 3"` @ . `. @(@@ 2l```&@/6/ 6`` 8) &@" "@'@`'@"@"`"`"42 ` "`8) &@" "@'@`'@"@"`"`"4? &``6` 8) &@" "@'@`'@"@"`"`"4 㿘 4 0@`  ,"` " `"&`&` 8 <& <&`0 ,@@ ' 4  (& 4 4`"   " `"&`&` 8 <& <&`0@&` & 0 #+3;CScspp !1Aa  0@` 'H'X\H'L'P'T''''''''''''''''@(@`&@H X&#/ @  .@"@ * 􀠠  (`@"@8 # (.@@  ,`(`@?&@0 '48' - @ `  @ `.@(&@h H`@*@ @ h'H'0?'p  '(+ '$??Hh((+`', M+`$   % ` d#,@   @&@ .`@8, . ``dp&@&#//! $0@8 '.@&@&X& 4#/,@  /@L   `/@`'LT (P/@ P(@`'0@ (?  ?..`& &   (@" @6@2@ .@@? '  .@+`@?2[  H+ ` 2?oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths tree㿀   ( ' #?#d#`#\#h   | ??*" ' *@ 2 (*"' ? ( $€oversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengths㿀d !  ( `' R?((X#Ԛ#\#`#d#h! ?  ,??*#-$ +*'#))\#`#dP #\#h  ? 2 (??+  $ ?+ + @$ ? ( $€0 ( $€ --""-"@1"" w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-+" `Y G8+ @0(` @(` @0(` @0(` @0(` @0(` @0(` @0(0` + @0(`88! 8$8%$8%8%8&X8-828284L84T848:8=(8=p8>,8>48>8 88 88 8 8X8 8l8 8888888   8@` 0123456789abcdef/8P?? inflate 1.1.4 Copyright 1995-2002 Mark Adler `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`8, 8@8W!84- 8 58u:8(C8r@I8I R8,[8 f86u8kXz8 8 8l8)8 8$ 8(8h8q@8n 8088+08+8? 88QB8K 8ʰX8n_8hj8nXr8|}8d8N08n88ST8J8 8:8Ot8z 8c 8ʴ!8+8 88B8=(M8r@T8c\8RXg 8ʸt828 88A|8n89 88+l8&888j8T&8'/8<86J 8xS88@a8=pk 8|v8P|8X8>48 8ˀ8:$84L88l8>8gx8F8D8" 8*8 9 8H8 T8Pc8Tl80v88%$ 8̀8%8\8D08888X8Tx 8̈8d8&X88-8, @8DU8kX[8! e8u8x88x088?0888u88 8 88 8H'8_x/8>,:8XD8-Q8`Y8+l8^t8  8L8_8h8( 8848 8P8S888T 828 ,8 &84T38(=8D8R 8XZ8aHa8th8Lr8R}8 8x88@88|8Y$888A8%8P 8h 8p" 8(8O/858 <8ThB8LH8^N8MDX8[_ 8f8Xm8 88,8^(88 8 8P88P858n8 88b 8@ 8 8z< $8 0 8D @ 8H F8$ Q8 a84 q 8 w 8 ~8 8 8 8 8 8 8 8 8 8 8 8 8 8 +8 78  C8  R8  d8 p8 z8 8 8 8 8 8Ɉ 8 8 8H 8@ 8Ɍ 8 8 %8 78 D8Ȁ U8 _8 n8 8 8' 8' 8,` 85 86 8? 8B 8F 8I 8Q 8RX 8S 8S 8T 8Tx 8T 8^( 8^ !8_x *8_ 28` :8aH A8b H8c Q8g W8kX ^8n h8nX q8n z8n 8n 8q@ 8r@ 8t 8u 8x0 8( 8 8 8 8 8X 8 _getsecs_rpc_fromaddr_open_dvma_mapin_gateip.rem_adler32.urem_sendudp_getprop_netif_put_nfs_getrootfh.div_devopen_socktodesc_obp_close_bp_getfile_inflate_codes_new_bp_server_addr_strtab_inflate_codes_free.umul.udiv_hostname_getchar_xdr_string_encode_inflate_trees_bits_nfs_readdir_in_cksum_pgofset_hostnamelen__udiv_arpwhohas_strcmp_net_close_inflate_trees_dynamic_inet_addr_strlen_inflate_set_dictionary_ether_sprintf_readudp_inflateSetDictionary_nfs_open_inet_ntoa_inflate_sprintf_netif_debug_freelist_netif_close_net_open_nfs_close__urem_printf_sendether_file_system_cd9660_close_inflate_trees_fixed_swapip_rpc_pmap_putcache___ashrdi3_nfs_readdata_domainname_xdr_string_decode_ufs_readdir_putchar_inflate_copyright_arp_reply_zcfree_strncpy_netdev_sock_nfs_lookupfh_rpc_xid_nfs_readlink_nfs_read_strtablen_ip_convertaddr_obp_strategy_nfs_seekstart_nfs_root_node_nfs_mount_cd9660_write_inflateSyncPoint_prom0_iclose_nfs_stat_twiddle_rarp_getipaddress_hz_getdevtype_rootip_net_mountroot_rpc_pmap_list_prom_ioctl_inflate_codes_zcalloc_rpc_port_obp_xmit_ufs_read_promvec_ufs_seek_obp_recv_strerror_prom0_close_file_system_nfs_inflate_flush_arp_num_closeall_bootfile_vprintf_ufs_stat_prom0_strategy_prom_getether_xdr_inaddr_decode_inflate_blocks_free__div_ufs_open_nfs_stat_types_inflateEnd_netmask_inflateReset__rtt_rpc_call_inflate_blocks_sync_point_file_system_ufs__rem_dvma_init_dvma_free_prom_boothow_prom_si_getpropstring_prom_bootdevice_memset_nfs_write_rootpath_cd9660_open_olseek_xdr_inaddr_encode_memcpy_get_crc_table_nameip_oclose_inflate_mask_bp_whoami_cputyp_cd9660_stat_pgshift_rpc_pmap_num_memcmp_prom0_iopen_inflate_fast_panic_cd9660_read_netif_open_prom_open_cd9660_seek_peekchar_etext_donottwiddle_ifname_oopen_bzero_getticks_readether_prom_init_inflateInit2__inflateSync_ndevs_loadfile_dvma_mapout_read_inflate_blocks_reset_arp_list_rpc_pmap_getcache_ufs_write_prom0_recv_errno_sockets_esym_intoa_nbpg_nfsys_exit_main_free_sendrecv_lseek_debug_close_inflate_blocks_new_domainnamelen_crc32_alloc_edata_cngetc_fbuf_end_dvma_alloc_bcea_gets___main_netif_get_version_oread_prom_bootfile_file_system_cd9660_inflateInit__prom0_xmit_bp_server_port_dbuf_ufs_close_inflate_blocks_cd9660_readdir_myip_files_devswsrt0.oboot.ogcc2_compiled.___gnu_compiled_cconf.ogcc2_compiled.___gnu_compiled_cdvma.ogcc2_compiled.___gnu_compiled_cnet.ogc# $OpenBSD: dot.profile,v 1.22 2002/04/13 17:36:56 deraadt Exp $ # $NetBSD: dot.profile,v 1.1 1995/12/18 22:54:43 pk Exp $ # # Copyright (c) 1995 Jason R. Thorpe # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Christopher G. Demetriou. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs # emacs-style command line editing # XXX # the TERM/EDITOR stuff is really well enough parameterized to be moved # into install.sub where it could use the routines there and be invoked # from the various (semi) MI install and upgrade scripts # terminals believed to be in termcap, default TERM TERMS="sun vt* pcvt* dumb" TERM=sun rootdisk=`dmesg|sed -n -e '/OpenBSD /h' -e '//!H' -e '${ g p }'|sed -n -e '/^root on \([0-9a-z]*\).*/{ s//\/dev\/\1/ p }'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T 9600 # get the terminal type _forceloop="" while [ "X$_forceloop" = X"" ]; do echo "Supported terminals are: $TERMS" eval `tset -s -m ":?$TERM"` if [ "X$TERM" != X"unknown" ]; then _forceloop="done" fi done export TERM # Installing or upgrading? _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall, (U)pgrade, or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi # # # # # # # # MDSETS=kernel ARCH=sparc md_set_term() { test -n "$TERM" && return echo -n "Specify terminal type [sun]: " getresp sun TERM=$resp export TERM } md_get_msgbuf() { # Only want to see one boot's worth of info dmesg > /tmp/msgbuf sed -n -f /dev/stdin /tmp/msgbuf <<- OOF /^OpenBSD /h /^OpenBSD /!H \${ g p } OOF } md_get_diskdevs() { # return available disk devices md_get_msgbuf | sed -n -e '/^sd[0-9] /{s/ .*//;p;}' \ -e '/^x[dy][0-9] /{s/ .*//;p;}' } md_get_cddevs() { # return available CDROM devices md_get_msgbuf | sed -n -e '/^cd[0-9] /{s/ .*//;p;}' } md_get_partition_range() { # return range of valid partition letters echo [a-p] } md_questions() { : } md_installboot() { local _rawdev _prefix if [ -z "$1" ]; then echo No disk device specified, you must run installboot manually. return fi _rawdev=/dev/r${1}c # use extracted mdec if it exists (may be newer) if [ -e /mnt/usr/mdec/boot ]; then _prefix=/mnt/usr/mdec elif [ -e /usr/mdec/boot ]; then _prefix=/usr/mdec else echo No boot block prototypes found, you must run installboot manually. return fi echo Installing boot block... cp ${_prefix}/boot /mnt/boot sync; sync; sync installboot -v /mnt/boot ${_prefix}/bootxx ${_rawdev} } md_native_fstype() { : } md_native_fsopts() { : } md_checkfordisklabel() { # $1 is the disk to check local rval disklabel $1 > /dev/null 2> /tmp/checkfordisklabel if grep "no disk label" /tmp/checkfordisklabel; then rval=1 elif grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 else rval=0 fi rm -f /tmp/checkfordisklabel return $rval } md_prep_disklabel() { local _disk=$1 md_checkfordisklabel $_disk case $? in 0) ;; 1) echo WARNING: Label on disk $_disk has no label. You will be creating a new one. echo ;; 2) echo WARNING: Label on disk $_disk is corrupted. You will be repairing. echo ;; esac # display example cat << __EOT If you are unsure of how to use multiple partitions properly (ie. separating /, /usr, /tmp, /var, /usr/local, and other things) just split the space into a root and swap partition for now. __EOT disklabel -W ${_disk} disklabel -f /tmp/fstab.${_disk} -E ${_disk} } md_welcome_banner() { { if [ "$MODE" = install ]; then cat << __EOT Welcome to the OpenBSD/sparc ${VERSION_MAJOR}.${VERSION_MINOR} installation program. This program is designed to help you put OpenBSD on your disk in a simple and rational way. __EOT else cat << __EOT Welcome to the OpenBSD/sparc ${VERSION_MAJOR}.${VERSION_MINOR} upgrade program. This program is designed to help you upgrade your OpenBSD system in a simple and rational way. As a reminder, installing the 'etc' binary set is NOT recommended. Once the rest of your system has been upgraded, you should manually merge any changes to files in the 'etc' set into those files which already exist on your system. __EOT fi cat << __EOT As with anything which modifies your disk's contents, this program can cause SIGNIFICANT data loss, and you are advised to make sure your data is backed up before beginning the installation process. Default answers are displayed in brackets after the questions. You can hit Control-C at any time to quit, but if you do so at a prompt, you may have to hit return. Also, quitting in the middle of installation may leave your system in an inconsistent state. __EOT } | more } md_not_going_to_install() { cat << __EOT OK, then. Enter 'halt' at the prompt to halt the machine. Once the machine has halted, power-cycle the system to load new boot code. __EOT } md_congrats() { local what; if [ "$MODE" = install ]; then what=installed else what=upgraded fi cat << __EOT CONGRATULATIONS! You have successfully $what OpenBSD! To boot the installed system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT } "`xȨ/@+P zHP tHP pHP lHWHqHP `HP THP ZHP THP PHP LHP HHP DHP @HP HP ?HP @|HP AxHP BtHP CpHP DlHP EhHP FdHP G`HP H\HP IXHP JTHP KPHP LLHP MHHP NDHP O@HP P HP ? HP @ |HP A xHP B tHP C pHP D lHP E hHP F dHP G `HP H \HP I XHP J THP K PHP L LHP M HHP N DHP O @HP P HP ?HP @|HP AxHP BtHP CpHP DlHP EhHP FdHP G`HP H\HP IXHP JTHP KPHP LLHP MHHP NDHP O@HP P;8;;;;; ;(;0H )@`  >!  >;8!7 >,0+0;"+,+0΁`#@ 0΁1 !>&;8>0)@09`")@)@0΁`# 0΁1"; > 9`9`9`9`9` 9`(9`09`86`@!`xH )@` !!! P -@ @ @"P/> P-> %)>Ȩ t %"+/> ->+cP> #`"##t@>  ;x ;"`;" @˗@Ҋ@@2 @ 0P -@ @ @"P/> P-> %)>Ȩ t %"+/> ->+cP> #`"##t@;x҂@ ;Ԃ@`;"k  ւ@ ؂@ " +?P `* -` @Lt x ``-`Ё @@ tx ǁ )>!4@! P-> %)>Ȩ t %"+/> ->+cP> #`"##t@;x;;>!<!@ ;`#h#l;;;;@``htx ;`#h#l;;;;@A``htxf )>)#؀@)>* T P -@ @ @"P/> P-> %)>Ȩ t %"+/> ->+cP ;`@;h#t;x;;;;;`@;`htx />->+cPۜP -@ @ @"P/> P-> %)>Ȩ t %"+/> ->+cP ;`@;h#t;x;;;`;;@(;`htxف -?P -@-P -@ @ @"/>/> />6PP-> %)>Ȩ t %"/>/> />P;x> #`"#@;,/,;@ ;`,)>Ȩ!;h %)> 7# #p "`@ x  +?P`-@-?P- %0P -@ @ @"/>/> />6PP-> %)>Ȩ t %"/>/> />P;x> #`"#@;,/,;@ ;`,)>Ȩ!;h %)> 7# #p "`@   @@w`x' P -@ @ @"/>/> />6PP-> %)>Ȩ t %"/>/> />P> #`"#?P * * ;`@;h09P -@ @ @"/>/> />6PP-> %)>Ȩ t %"/>/> />P> #`"#?P * * ;`@҂@ Ԃ@;h ւ@ ؂@@.`h ?P `*  P -@ @ @"/>/> />6PP-> %)>Ȩ t %"/>/> />P> #`"#?p " ?P "  ;`@;h@e`h ?p " q @/>  @̀-> $)>Ȩ t %->+cP->Ȭ ZP @ H ,@`#>`$` (08 @̀=)> ,0+0;"+2+0 `# @ 05-" % >&u 8 >0-@0=`"-@-@0 `# @ 05-"Y  ->%- +cP ;`@;h #t;x;`;;;;@c;`htx ->& 0Ȧ! H,@` !`hpxX (08@HP @̀H,@`%> $!> `8 (0 @̀@ @̀  H ,@`#>`$` (08@̀,2G?@ @̀='>,0/0?"/2/0 `# @ 05-"$>& 8>0-@0=`"-@-@0 `# @ 05-" ?  H,@`#>` $`!> `8 (0@̀ ->Ȭ  @uP->"/> 94Ր  ! H,@` !X (08@HP @̀>Ȗt `?* `"" * `@">Ȗ  * `@&* *  ֊@* "``'1@'0@ )>+>%@#'$(  Ȓ`Ȕ Ȕ  c  mt@ >   >  @@   >  @@ #>%> 8`@%  '`@`@ 7  '`@`@ 0, *H Ѐ(H+ `!Ђ* ր  Ԡ҂2`*`D4`@ D֠ 0 !Ђ* ҂2`*`D4`@ D>%b@>"  *>" (!`>" ,H(  /  > ==>ǜPH >" 0> F > 8a@d"@!> $!H``> "aD  !>%#!>'"$ $ >%# 2> " > " > "!> "!@>#"">#"">#"#$>#"#L>$"">$"",>$"">$"">*" >*" 0>+""@@Yd#@+`;h;p;x;;;;;;;;;;;;;@L@P@ `hpx gP   d#@+`;h;p;x;;;;;;;;;;;;;@H@@ `hpx d P    "%>> >"  ">>@ >  >&cx#  >&c# J@*@ ` `*@ ?"@ 2"# @ "`*@ @ "`*@  "  ?J*@`8  ?"@ 2"> * >ȁ >@ *>ȁ >' X@" >" >"   >4``6 >` >Ȏ  !!`> @1>  <`" <> #`"# >  >> !@`h2$j0>'@!P>'@!Z>'@!gswitch rqswitch wchanswitch SRUN> >: H> @" (o!@`j> %"> : h>*"2J "2 J    "2 J  J " > c+  @ #@"   *@ * hlH1 > " D `!@"I"j >  `" j ` *@  ( !> !x` (08 2㿠@ע>`` Ъ@@>`€"Т@: H"  h`>   >>(d" " " ?" ?> >>(p" " > >>(d" " > >>(d" " > ؀ >>(d" "" > >>(p" 2" > >>(d" 2" > >>(d" *" >>(`d" `2 `2`2" >>(`d" `2*`22`2"" @>(`p" Њ@" " @""@" "`""@ 6 :@ 6 `6:   6  J?*@``";" " J `*"J*@ `"" "R2@ `4"R2@ `"" ""@ `""@ `":@ `""@ `R2@J *`2J*@   6 " J"`*@`"(" " " J"`*@"" J"`*@"" "" R"` 2@"" R"`2@"" "`"@"" R"`2@2J?*>`>)` #` 6 J *@`#`  `"<" " J *@`#`  "J *@"`" "R 2@`8"R 2@"`" " "@`" "@"`  :@ ` " "@` R 2@J *`#`  2J#`  *@#`  #`  H@ `*  @ : " : : : : : (: 0: 8: @: H: P: X: `: h: p: x 2@ *  @ 2* H@ `      ( 0 8 @ H P X ` h p x 0000H ?P *H ?P +*?p` "@?p`"@@* ?P` <@ "@$@% #@%"$@% #@%&؃%"@ւ"%ւ"&؃"@  >* "2 J "2 J   "2 J  J  @ @: `  : `z Z@  r R@  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@a>` """"""""""""""""@2?# * 2  `c  @ `> %? @ 3 >!T c@  Њb@&""""  >c@ @> aD ``44: " longjmp botch@" `&"`㿠>+@X#6 0diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapdrivevectoffsetslotluntargetphyleveladdrkbdgifksymsccdvndtbptygrevlanbridgeenctunsppppppslbpfilterlooppflogpfdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKPolled Mailbox Command (0x%x) Timeoutisp_mboxcmdInterrupting Mailbox Command (0x%x) Timeout%s index %d=> %s %02x%s:0x%08x:%s????21002200230012401280108012160LVDDifferentialSingle-Endedunknown mode on bus %d (0x%x)Unknown Chip Type 0x%x10201020A10401040A1040B1040CDifferential ModeUltra Mode Capablechip reset timed outMBOX_BUSY never cleared on resetRegister Test Failed (0x%x 0x%x 0x%x 0x%x 0x%x)F/W download failed at word %dRam Checksum Failureskipping f/w downloadBoard Type %s, Chip Revision 0x%x, %s F/W Revision %d.%d.%dloadedresidentFirmware Attributes = 0x%xInstalled in 64-Bit PCI slotLast F/W revision was %d.%d.%d%d max I/O commands supportedCannot setup DMAx!>, b`.!`B  !  €* 2 aS 2  ؐ`€ * 2 ` 2  ؐ`€ * 2  "   `@  7@)k @2  6 6 6  @ &  ؐ`    /     6 6 6! 6!  6 6!6 6!  `@ ` 5 ` ">, 0 >,  >, "h"p"x ؐ`   ؐ`!  ؐ`   ؐ`(  ؐ`  1 ` ܒ <.   ">, "b  d ܀ . >,"  >,"2>,>,""  `v€a id+ &>,@2"+ @>>,$"@>>,$ " @>>,$"Ȑ @>   >,ؙ3  @=     ’   av€a  ̀id+ '>,@#+ @>>,$" @>>,$"  @>>,$"Ȑ >,ؙ3  @=   ؐ` ܟ€  ?`*`>1"T €>,@= >,  (#>,  (#>,  <# >,  < #(>,  <#0>,  <#8. .   `v€! >, @=m@@ @*@$@  ` € * 2``2  >, @=OX@  $@ < . @=C  @ *@$@ *`"   @ +.    >!>!`" @   `   d !   "  ؒ B    `   d !     ؒ @   ؐ`  ` ##>,k d?<    1€cp0-    `€  "  0 `€      ؐ`   ؐ`   % @4 d ؐ`    5  `( `€ * 2 `  !  `€  * 2 `  ؒ @`€ * 2 ` @  .   0   /(    @  `@   `" @  / ϐ #ɐ d? >, ؐ`€* 2   7@&ݔ   @7/b <)!777777@& 耢d7" @/"?#@! )!@"  >,#`#\@; 0= `$   "    /'(1 $     ) ؑ, 77$@7@&p 耢2>, ` 77@&a @>-   &  * >-& @; @ 77@&E    ?` &  & H 0 ! 2  2 H /d * %    & & H 0     ` ` 477@%  7@% @ 2  ` ꀦ  %6 6 6 6 6 6 >-  0>- p>- x  #\  #`#d@;) ` &`2  D? * *`      2 >-2 @;   ؐ`€  >-@;  怢>- 耢     @:  7@% @3>-6 *` @:ߗ2@&ΐ  @ >-!`  .!      ` @ & @: 0 & $㿘@'     2 @'  @0@#failed to set active negation state (%d,%d), (%d,%d)failed to set tag age limit (%d,%d)Enabled FW features (0x%x)㿀  ܀   2   2 @2     `. 27 ` 7 `  7 7  @$7 67@2` `72 7@$ڔ 耤 57@2`2` `@ 722   7@$Ô 耢 3>1@3`2 23`#\ؖ   `@:   37 `7 7@$ 耤 >1 ` @9 0j 17`7 7@$ 耢]@v     2!J@k !J !H @777777@$q = !D6! !F!77777@$^ 耤@+ J6! !?6! 7耢 7 7 ?  7ꀤ @$> 耢>18@9 !  .!Initiator ID is %d on Channel %dInitial Settings bus%d tgt%d flags 0x%x off 0x%x per 0x%x㿀.`*  ܐ *  07.`  7 @$ @>2  71@9P 9>2,*  2``c  2   `.`,  8@77ꀌ 77  2 * @7 `2`#\#` # @9@# ' 8@7777@# 耢$*  72    977 7 7@# @2  , *  @2  !2 ! *  `@.!!!  `@.!0` bad frame length (%d) from NVRAM- using %dbad maximum allocation (%d)- using 16bad execution throttle of %d- using 16Setting ICB Node 0x%08x%08x Port 0x%08x%08xNot using any WWNsisp_fibre_init: fwoptions 0x%x㾰'D ܈'@'$@D 0"@2` `$@V `D  $` /  ?# @3DD?``* *``   3D!7`2 `7?# @2@1 * 2 '@1 >3 (D'$ @8*$$$1 `*`  1 `>3D'$X@8 $ 1    1  >3D'$@8  $ 1  ) D k`  ) 1 /9DD   1   @   D @ 0 @  1 @D  /D  ? # @1 D`  D  D D  1 DD  @* *`    8 /'( 8 77D'$77@"G $'(D ``/) `ؔ ``D'$`ؔ `D``ؔ `Da`ؔ `Da$D` ?p  }?x zxx+`|'d|/ p7`p'Tt'P3*'`',  / 7``+ d 'lPTx|* t2`'\2 '3`'L'D'@,@  x'<    37  3 7 x7`x'43 'h7 'X7`x 7`  'H'8'0 1 o>3) _) O) ) ) 7) ) ) ) ) ) ) t|#\<) ? ) w) ) D@7'$ $D>3 '$@6$? *@1 D!aJ @aFaD1 $aH1 &1 21 (1 *1 01 ,1 .1 41 6>3 D'$@6ڔ  $@ ) )( (`2    0?# @2 *`@0D2    0?# @2 *`@0D2    0?# @2 *`@0D 2    0?# @2 *`@0   ) ) (  ((  0 * D 2    0?# @2 *`@0   ) ) ( ( * D`2    0 ?# @2 *`@0 D`2   " 0"?# @2 *`@0"D2   $ 0$?# @2 *`@0$D2   & ??# @2 *`@?#0&(  D 2   3 @2 *`@3 ?#0  D`2   3 @2 *`@3 D`2   8 08?# @2 *`@08 : ;) ;) :(: ;(;D2   < 0<?# @2 *`@0<D2   @ 0@?# @2 *`@0@ B C) C) B(B C(CD 2  " D D?# @2 *`@0D ` 7 7@@7 (7D7777@ A @D333   +  `` +㿈 ܒ c7! 7   7` 77@ 7@ ?   @@ *  `@.@?? ܔ  ( " ( 㿈 ܐ d7.`# 7`7 777@ @`?@)ǐ 㿈.` j7耦  7`7 @Ɣ @3   3 3 *`*-5,`4      5`-    -4,  -`,  6    F Port (no FLOGI_ACC response)F PortN-Port to N-PortFL PortPrivate LoopFirmware State <%s->%s>usec%d: 0x%lx->0x%lx enano 0x%x%08x2Gb link speed/s`ܨ 'l`;'p-B9>75>7@'dd@ l 2  @d@  l2`@ `d @4!l `d2 l2   @'d"@'xd"'|А"@'x'|x*" * "@*`@ |*`@ *`" *  * : D+ "@ +`" *`* " "* * ** **#@ # +`@ +  #\p'd+ +`#` @49 dА"?@pb@@ b?'p ` `?` `` `H 0 'dd` e6` 2@ H /d * % `   ` `H 0 e6@ ?D 8`;ʀ@8`'d@Y͒#d`  `  `?` `` `H 0  A'dd` @p` <pH /d * % `   `) `H 0 "p p#;ʀ('dpe6@ ?D 'p;ʀ@p#'d@Ytpd@'ppΐl2   2? 7'd@ @d?l*``  /l 8 l *  @" ?"l@ ?l " * "`   2      'd ~ d` ~`'tl@ ? "@* *`  *`l "- ,`+`(  5`  t@ 5-  @6`.  -`. -.`l/   (  ?`+`(  ,`5- @ 6`.  @-5`- .`-`    ?`l@ 0* * @"* *`  '`l*l@ @ "l "'d@0xtd@vdl@ ?"@l@ ?l* ""l!@?Ϣc l"``/ ]7'd7@ 耢dꀢ l>7 @2al   "dl> 2`  ` >#\@*  #`'d@2D l3 d p *` l*   ("@@6*` *` * l ( `@2@  2@`@2@@2 @  @2@$$ p@@*@'@lp 'p'd@/ dl `/@l'``?`` ?``2 "@" @@ @@*@@* * @ '@ '@@@  '@l 'p@/  Config WaitWaiting for AL_PAWait LoginReadyLoss Of SyncErrorRe-InitNonparticipating????? >:H* >:"8>:"H>:"`>:"p>: "x>: ">:">:">:" ,'D '2     ?2`   2`  @D ?@ 0g` "@ 0("ذ ְ? (( &??#c    2<  '!D '$@/$ @OF$ `*`  !   2     ! ' '*(', @* *` (`( ?'0"@*` *  *  *  : ?'|`f'  @b, '\,2  Ȕ D~'$ $, 'T'd'D'l  ?h'L't?Ht?pT'\?Pd'<l?`6 D--`tL?@  6 @ *h H\+?Xd@0D. 0`@* <(@ ?8l@L..`  @* *`X@<+8*`2 d +D + @ \<@ +2@@\@@@@.  @  @ 0  3@6@* *`   2, 2( 2$   @2` 2` @@ ! >|'$D@0 $*@! /'`Ñ2` 8 D'$ '$ q7  *`D77@70$*`$ *** !*  >D'$ؗ:@/Ւ $* ! /'``?0 * *  *  *  : ' ~)'42 \ ` o7D` *`77 7/(D 7D'$4@>  /'`T$?@` 3>=#|*` €, '0'>ΐ&* +  + +    D'$h; @/n $ !` )>'$D@/^ $!' ~ ``~D)'$  $> @D@/E $@ /'`  > D'$p@/3 $* *`   > 0*@ * ! +`(,`  5-   6`.   @-5`-   .`-`    9 +`(  ,`5- @  6`. @-5`- .`-`      @$9   @0#* *  *  *  @ !: 'D'$@, '$D'$@. $@*@! > D'$@. $ q7 *7D747@)  /'`?$, *  (@ ?  0("p giving up on synchronizing the port databaseRemap Overflow 'D 2        ~U Q pe' ('@LX+ '@͖ * * `( '  D''  ?`2   *`` @ D?`2   ``@  ?`'D'  2   ?2   @ 'v`>=D@-Ւ ? +`(,`  5-   6`.   @-5`-   .`-`    ?`+`(  ,`5-  6`. @  -5`- .`-`    ?` 0* * @' * *`  '`/  7'  (''$) ?#@ **@ *` `( *"`( *  * ( *  ( @ " ( ' '+`8?#+  * `    @' 8>͑*` *  ` {(*  @r% @ n (, ,#\#`'D@, @*` ** @ *` "`,(*`(+  * ( "( *` *  @  <"(,* ? c#>+  *  @2   2D `0'@,* * ( "( ( @$ ( ۨ   @z'6+  *  ,> (hD'@, g 8+ @ *`     @ 8@ @`@@2`@2 '>=D'@,\ @'`0*` * * (* ** @ +` : 0* *  : * * `( `(  #`(`,*` *  @ #`(#`,D' @* '*  (@ :$ؒ"@*` *  *  *   @ 2```@ < 'D @)ؔ@J `@   0&'No LoopFailed to allocate IOCB bufferFailed to allocate XCB buffertimeout or transmit failedno fabric loopremote device not a target%xSNS Failed- %stangled fabric database detectedfabric too big (> 65535)X   0$$s #$ ? ȶ@I  `!07Ȓ `4 !4`  a2` !4`4` 4`4``4`4` 4`2    ?# @2 *`@?#0`   2  @ 2 @2 *`@2?` 2  `  ??# @2 *`@?#0 `  2  2 @ 2 *`@2? n7 ! 7 7 7 7@7 92`  2 p"$@2?`>B x*` €>@!>@!>@!>@!>@ !>@ ">@(@m >@0@* ?2`  2?2`   ? ! + $  +   !!%"$","<"@"`"i  +@    +@  +   +@    !+@  $+!$  !%+@    "$+@    ",+@    "<+@    "@+@    "`+@  h+"h  "i+@   * *`   @(5 2   `>@@@*C  ??#?#>@h@*2  0$$ $0<HRegister FC4 types succeededH ܐ@H> <  7@  a4 @ "!2 4 4 4 4 4 ` !4   ` 2 4 4  @  ?# @2 *`@?#0    2   2 @2 *`@2? 2    ??# @2 *`@?#0    2  2 @ 2 *`@2? n  77 @@7 777@H @>B@) Adapter not at RUNSTATEunsupported cdb length (%d, CDB[0]=0x%x)Target %d does not have target serviceRequest Queue OverflowRequest Queue Overflow+out of xflist pointersSTART cmd for %d.%d.%d cmd 0x%x datalen %ld@ *@ & & , `2   a2   >B@)I   `  ,4 2   >B ؐ@)2 o  ``n `2   `f   } V& , P2`  }K 2`    & ,2 2 h0 e' % # o"2`M 2" h2`  2 h2`  2`  -r 2 h /(`- h*  ( 2`  2` 2 >B@(Ē @ & , e a "`@Đ`ؠ `€4aa4?a4?*a<  4? @  77>B0 a  `       @?# a2  : ݐ@F @   -`,4 , ,`2  " ,,  , ,  ,  ,  ,  , `2  " ?  **` 2 2 $ `2   , , ,  , `2   4 @2 *`@4 `2   4 @2 *`@4 `2  4  @2 *`@4 `2  4  @2 *`@4   $   * ? # '? ?   `2  "@ @ *  *@ 2 @ 2 @ `2   @@ *  *@ 2 @ 2 @#$?ؚ``ؐ`` 4a a*@2   a* *`  `,a `4aa6a6*a<  6 @  77>B`@@E @ , `   ,   ,, ` "    2  J`   d`ܔ̑-*  h"    4   d, ` "`    4  `  4 ,   @C#* `4   4` a"   a8 "   *@`22a8 ?*"@0`쀢" 4a" >B`$`ؖ`@`g" `.`쀢@*a8* &"@H@&  & , f& , >B x 2  $ K g#\#` @@&ې`ؐ``4aa 4aUnknown Control Opcode 0x%xdriver initiated bus reset of bus %dTarget %d on Bus %d Reset Succeededcannot find handle for command to abort㿈 >F"* €>E@& ?  7耊`7 `7 7    7 7 ! 2* ! *  `@.!@ @2˰?>E@&a ð ?# :..`@  777@ @2?>E8 @&B! *2! *  `@.!      !8*@ * +  2 >E`@& x?  2 ` `7  `.`7777.`  7.* @ 7778 @O  I #A "<?08 "3?/ "*?W&   b7 @[@?    @E  ?PhxdMbox Command Async (0x%x) with no waitersAsync Mbox 0x%xinterrupt (ISR=%x SEMA=%x) when not readyoptr %x soft optr %xResponse Queue Out Pointer Unstable (%x, %x)bogus intr- isr %x (%x) iptr %x optr %xQueue Entrycontinuation segmentinternal queues fullbad header flagbad request packetunknown flags (0x%x) in responsebad request handle %d (type 0x%x, flags 0x%x)cannot find handle 0x%x in xflistasked for %ld got resid %ldRequest Queue Entry bounced backunhandled response queue type 0x%x8. P 0.!2  #.!6!$  !$ <  `€4  ` & @B ! .! >F2@$͒  4 @>F@$ @`,`2`@ Ȑ 2# !2   2 !2   $.`- >F23  @$  ؐ! €!* 2    `@ ؐ`  0  / `€!! * 2`  7>F! P@$s  ! 7   /(* آ  ؐ`€! ش`€!* 2 .2 `c$ ؀  `@>Fh@$B 0`€!.2@2 -  2/   /( 㪐 d ؐ`€! ش` ` €.2` + .`>F 23 @$ #\!`B >!  `@ ؐ`  5@?#8 *  !@  ?2` 7`  ` 2   .`.@.` .`.@.`.`.` 2  " ? *` * 2 2  2  &` @2 *`@ 2  6`  @2 *`@ 2  6`   @2 *`@ 2  6`  @2 *`@ 2  6` @2 *`@ 2  6` @2 *`@ 2  6` ?  **` 2 2 &` ` ` *   * `@t Ȑ 2   .`.@.` .`.@.`.`.` 2  " ? *` * 2 2  2  &` @2 *`@ 2  6`  @2 *`@ 2  6`   @2 *`@ 2  6`  @2 *`@ 2  6` @2 *`@ 2  6` @2 *`@ 2  6` ?  **` 2 2 &` ` ` *   * @5>ΐ@#\@"  %>F#>,H@"  /'>,%>, ` @ @@eV  @2` P@" @/@@ @ ` - >F @"mS ؀ >F@"d ` >G@"\ ` >G@"S ` >G(@"I  `  2`@@c @`>G` @P@"4 ؀  (!8 *  ? *@@H @`>G @" ؐ`!02 ` *2 @!8* "@`  $ , !2` `$``!*  .! $ , " ` `"`  6` ` @"@` , X@>G@˔ , 2  X 2  $ ,  >`$ (` "` X 2`"` , 2` $ ,`  4 "` "J>G   d ܔ̑* *  @ "  ! d  !  .!->G`@2 $ (` , "$ (`$ (` @>G X 2 $`"" $ , 2` $ ,`  4 ې`  6` >G $`@!Y @" $`  (, X $ , , 2  $>G@!G  $ , $ $ (@!>  , 2 $ $ , $ "    ` 2` 0 , 2` X (` @" X 6   W 0  . ? ( 8 > 2  $#\ ( #` X #d#h ,#l@ ! "-`!?6!-`x" @? @`` 5@   `! ؐ`€ 6! 6! @ x,` "`@`@,`Request Queue Transfer ErrorResponse Queue Transfer Errortimeout initiated SCSI bus reset of bus %ddevice reset on bus %dextended message underrunSCAM interruptstalled SCSI Bus after DATA OverrunSCSI Bus reset after DATA OverrunTransition to LVD modeTransition to Differential modeTransition to Single Ended modeTransition to Unknown Mode 0x%xfast post completion of %uFast Posting CTIO doneLIP destroyed %d active commandsPoint-to-Point modePoint-to-Point -> Loop modeLoop -> Point-to-Point modePoint-to-Point -> Loop mode (BAD LIP)FATAL CONNECTION ERRORLooped Back in Point-to-Point modeUnknown connection mode (0x%x)Unknown Async Code 0x%x㿐    2 '  ` €* 2 '?ߐ#@`5>N *` €! 2*  ! *  `@.! @,  @ ?>K-(>K)H ؐ`€ , >Kh@ 0x>K@ 0q>K@ , >K8>K>K@ ,   `€* 2 @h!>Kd0>KD@@>K>K0@   *# * "  0"H@p    " * # * ">Kh@[   *@"  " * "@F ! 2* ! *  `@.!,   `€>K, 2@* , >K  `€ 2`  ܐ "  pa"! .! @  @2     쀢  !8*@ " " , &!8>K@ Ʊ, !  ܔ.! "  paw"1 !  ܔ.! "  pf"  !  ܔ.! "  pU" ! `` .! G" @ ,  ܐ pb:" @z t,  @  ?  "@)!   ܔ.!  ?" ܐ @\#>L@s Q,   `€* 2 `$>N *` €>L >L@@V  >L `>L@L @ )?>L@C   >LȖ@;   @! ` ܒ`.! ?" @ 0!"@>L@# , 6 777781x1111220882L2h2x22845566\648888888884D4888888888888886888887`Ignored Continuation ResponseUnhandled Response Type 0x%x㿘`>N"x*` €>N@Ē   @ "  >N2  a@ ?:::::::::::::::::::::::::::::::Selection Timeout for %d.%d.%dcommand incomplete for %d.%d.%d, state 0x%xDMA error for command on %d.%d.%dstates=> GOT_BUS GOT_TGT SENT_CDB XFRD_DATA GOT_STS GOT_SNS XFR_CMPLT status=> Disconnect Sync_xfr Parity Bus_Reset Device_Reset Aborted Timeout Negotiation%stransport error for %d.%d.%d: %sbus reset destroyed command for %d.%d.%dcommand aborted for %d.%d.%dcommand timed out for %d.%d.%ddata overrun for command on %d.%d.%dcommand overrun for command on %d.%d.%dstatus overrun for command on %d.%d.%dmsg not COMMAND COMPLETE after status %d.%d.%dNo MESSAGE OUT phase after selection on %d.%d.%dEXTENDED IDENTIFY failed %d.%d.%dINITIATOR DETECTED ERROR rejected by %d.%d.%dABORT OPERATION rejected by %d.%d.%dMESSAGE REJECT rejected by %d.%d.%dNOP rejected by %d.%d.%dMESSAGE PARITY ERROR rejected by %d.%d.%dBUS DEVICE RESET rejected by %d.%d.%dIDENTIFY rejected by %d.%d.%d%d.%d.%d had an unexpected bus freeInvalid IOCB entry type detectedinternal queues full for %d.%d.%d status 0x%xAuto Request Sense failed for %d.%d.%d# $OpenBSD: disktab,v 1.19 2001/09/21 05:43:42 deraadt Exp $ # # @(#)disktab 5.5 (Berkeley) 2/27/91 # # Disk geometry and partition layout tables. # Key: # ty type of disk # ns #sectors/track # nt #tracks/cylinder # nc #cylinders/disk # rm rpm, 3600 default # se sector size, 512 default # sf supports bad144-style bad sector forwarding # so partition offsets in sectors # p[a-p] partition sizes in sectors # b[a-p] partition block sizes in bytes # f[a-p] partition fragment sizes in bytes # miniroot:\ :ty=winchester:se#512:nt#2:rm#300:ns#64:nc#96:\ :ts=3500:\ :pa#12288:oa#0:ba#8192:fa#1024:ta=4.2BSD:\ :pb#0:ob#0:\ :pc#12288:oc#0: rdroot:\ :ty=ramdisk:se#512:nt#2:rm#300:ns#4:nc#544:\ :pa#4352:oa#0:ta=4.2BSD:ba#4352:fa#1024: \ :pc#4352:oc#0: floppy|floppy3|3in|3.5in High Density Floppy:\ :dt=floppy:ty=floppy:se#512:nt#2:rm#300:ns#18:nc#80:\ :pa#2880:oa#0:ba#4096:fa#512:ta=4.2BSD:\ :pb#2880:ob#0:\ :pc#2880:oc#0: # test if not having an 'a' works? fakecdrom|Fake image for Bootable CDROM:\ :ty=winchester:se#512:nt#1:rm#350:ns#640:nc#2048:\ :pa#1310720:oa#0:ba#8192:fa#1024:ta=4.2BSD:\ :pb#1310720:ob#0:bb#8192:fb#1024:tb=4.2BSD:\ :pc#1310720:oc#0:bc#8192:fc#1024:tc=4.2BSD:\ :pd#1310720:od#0:bd#8192:fd#1024:td=4.2BSD: ASI-1.0GIBM:\ :ty#winchester:ns#80:nt#15:nc#1632: Arte DEC DSP3160S:\ :ty#winchester:ns#112:nt#16:nc#1744: CDC 9720-850:\ :ty#XD7053:ns#66:nt#15:nc#1358: CDC EMD 9720:\ :ty#XD7053:ns#48:nt#10:nc#1147: CDC EMD 9720-1230:\ :ty#XD7053:ns#82:nt#15:nc#1633: CDC IPI 9720:\ :ty#ISP-80:ns#82:nt#15:nc#1631:\ :pa#33210:oa#0:ba#8192:\ :pb#131610:ob#33210:\ :pc#2006130:oc#0:\ :pg#196800:og#164820:\ :ph#1644510:oh#361620: CDC IPI 9722:\ :ty#ISP-80:ns#156:nt#7:nc#1630:\ :pa#33852:oa#0:ba#8192:\ :pb#132132:ob#33852:\ :pc#1779960:oc#0:\ :pg#197652:og#165984:\ :ph#1416324:oh#363636: CDC Wren IV 94171-344:\ :ty#winchester:ns#46:nt#9:nc#1545: CONNER 30170E:\ :ty#winchester:ns#46:nt#8:nc#897:\ :pa#14720:oa#0:ba#8192:\ :pb#40480:ob#14720:\ :pc#330096:oc#0:\ :pg#274896:og#55200: CONNER 30200:\ :ty#winchester:ns#49:nt#4:nc#2121:\ :pc#415716:oc#0: CONNER CFP4207S 4.28GB:\ :ty#winchester:ns#125:nt#20:nc#3353:\ :pc#8382500:oc#0: CONNER CP3500-540MB-3.5:\ :ty#winchester:ns#50:nt#12:nc#1768:\ :pc#1060800:oc#0: CP3100:\ :ty#winchester:ns#49:nt#4:nc#1023:\ :pc#204864:oc#0: Conner CFP1060:\ :ty#winchester:ns#111:nt#8:nc#2329: Conner CP3540:\ :ty#winchester:ns#49:nt#12:nc#1805: DEC DSP3107L:\ :ty#winchester:ns#83:nt#8:nc#3147:\ :pc#2089608:oc#0: DEC DSP3210 2 GB:\ :ty#winchester:ns#86:nt#16:nc#3040:\ :pc#4183040:oc#0: DEC DSP5200:\ :ty#winchester:ns#71:nt#21:nc#2619:\ :pa#32802:oa#0:ba#8192:\ :pb#65604:ob#32802:\ :pc#3904929:oc#0:\ :pg#3806523:og#98406: DEC DSP5350:\ :ty#winchester:ns#91:nt#25:nc#3053: DEC_RZ26:\ :ty#winchester:ns#57:nt#14:nc#2568:\ :pa#66234:oa#0:ba#8192:\ :pb#132468:ob#66234:\ :pc#2049264:oc#0:\ :pg#1850562:og#198702: DEC_RZ28:\ :ty#winchester:ns#84:nt#16:nc#3043:\ :pa#64512:oa#0:ba#8192:\ :pb#196224:ob#64512:\ :pc#4089792:oc#0:\ :pg#3827712:og#260736: DEC_RZ58:\ :ty#winchester:ns#85:nt#15:nc#2112: DEC_RZ58_whole_disk:\ :\ :pc#2692800:oc#0: DEC_RZ74:\ :ty#winchester:ns#91:nt#25:nc#3053:\ :pa#65975:oa#0:ba#8192:\ :pb#193375:ob#65975:\ :pc#4192825:oc#0:\ :pg#3931200:og#259350:\ :ph#2752750:oh#4192825: Fujitsu M2243AS:\ :ty#ACB4000:ns#17:nt#11:nc#752: Fujitsu M2246E:\ :ty#winchester:ns#35:nt#6:nc#1196:\ :pa#16170:oa#0:ba#8192:\ :pb#28140:ob#16170:\ :pc#251160:oc#0:\ :pg#206850:og#44310: Fujitsu M2263SA:\ :ty#winchester:ns#53:nt#15:nc#1652: Fujitsu M2266SA 1.2GB:\ :ty#winchester:ns#85:nt#15:nc#1652: Fujitsu M2266SA 1GB:\ :ty#winchester:ns#85:nt#15:nc#1642: Fujitsu M2344K:\ :ty#XD7053:ns#64:nt#27:nc#622: Fujitsu M2511A:\ :ty#winchester:ns#25:nt#1:nc#9950: Fujitsu M2512A small:\ :ty#winchester:ns#25:nt#1:nc#9950:\ :pc#248750:oc#0: Fujitsu M2512A v2:\ :ty#winchester:ns#25:nt#1:nc#17840:\ :pc#446000:oc#0: Fujitsu M2622SA:\ :ty#winchester:ns#64:nt#7:nc#1429:\ :pc#640192:oc#0: Fujitsu M2624FA:\ :ty#winchester:ns#64:nt#11:nc#1440:\ :pa#22528:oa#0:ba#8192:\ :pb#67584:ob#22528:\ :pc#1013760:oc#0:\ :pg#450560:og#90112:\ :ph#473088:oh#540672: Fujitsu M2652SA:\ :ty#winchester:ns#88:nt#20:nc#1935: Fujitsu M2654SA:\ :ty#winchester:ns#88:nt#21:nc#2174: Fujitsu M2684S:\ :ty#SCSI:ns#74:nt#6:nc#2338: Fujitsu-M2284/M2322:\ :ty#XY450:ns#32:nt#10:nc#821: Fujitsu-M2312K:\ :ty#XY450:ns#32:nt#7:nc#587: Fujitsu-M2333:\ :ty#XD7053:ns#67:nt#10:nc#821: Fujitsu-M2351 Eagle:\ :ty#XD7053:ns#46:nt#20:nc#840: Fujitsu-M2361 Eagle:\ :ty#XD7053:ns#67:nt#20:nc#840: Fujitsu-M2372K:\ :ty#XD7053:ns#67:nt#27:nc#743: Fujitsu-M2382:\ :ty#XD7053:ns#81:nt#27:nc#743:\ :pa#80919:oa#0:ba#8192:\ :pb#129033:ob#80919:\ :pc#1624941:oc#0:\ :pd#470205:od#209952:\ :pe#944784:oe#680157:\ :pf#209952:of#0:\ :pg#1414989:og#209952:\ :ph#1544022:oh#80919: Fujitsu-M2624S-512:\ :ty#winchester:ns#64:nt#11:nc#1429: Fujitsu-M2651SA:\ :ty#winchester:ns#88:nt#16:nc#1934:\ :pc#2723072:oc#0: Fujitsu-M2694ESA:\ :ty#winchester:ns#77:nt#15:nc#1830: HP 97549T:\ :ty#winchester:ns#64:nt#16:nc#1909: HP 97556:\ :ty#winchester:ns#72:nt#11:nc#1668: HP 97558:\ :ty#winchester:ns#72:nt#15:nc#1933: HP 97560:\ :ty#winchester:ns#72:nt#19:nc#1933: HP C2247 1.05GB:\ :ty#winchester:ns#95:nt#13:nc#1661:\ :pc#2051335:oc#0:\ :pg#1640080:og#0:\ :ph#411255:oh#1640080: HP C3010 / Cranel 2.0GB Fast SCSI2 H10:\ :ty#winchester:ns#95:nt#19:nc#2165: HP97548SU 664MB:\ :ty#winchester:ns#56:nt#16:nc#1445:\ :pa#35840:oa#0:ba#8192:\ :pb#71680:ob#35840:\ :pc#1294720:oc#0:\ :pg#197120:og#215040:\ :ph#342720:oh#609280: Hewlett Packard C2490A:\ :ty#winchester:ns#107:nt#18:nc#2159: Hewlett Packard C3323A:\ :ty#winchester:ns#98:nt#7:nc#2995: Hewlett Packard C3725S:\ :ty#winchester:ns#140:nt#9:nc#3362:\ :pc#4236120:oc#0:\ :ph#4193280:oh#1260: Hitachi DK315C-10:\ :ty#winchester:ns#75:nt#11:nc#2467: Hitachi DK315C-11:\ :ty#winchester:ns#58:nt#15:nc#2478: Hitachi DK315C-14:\ :ty#winchester:ns#75:nt#15:nc#2462: Hitachi DK326C-10:\ :ty#winchester:ns#87:nt#7:nc#3200: Hitachi DK326C-6:\ :ty#winchester:ns#87:nt#4:nc#3200: Hitachi DK515C-78:\ :ty#winchester:ns#69:nt#14:nc#1354: Hitachi DK516C-16:\ :ty#winchester:ns#80:nt#15:nc#2170: Hitachi DK517C-37:\ :ty#winchester:ns#81:nt#21:nc#3297: Hitachi DK815-10:\ :ty#XD7053:ns#67:nt#15:nc#1735: IBM 0662-S12:\ :ty#winchester:ns#114:nt#6:nc#3002: IBM 0662S12:\ :ty#winchester:ns#108:nt#5:nc#3803: IBM 0663-E15:\ :ty#winchester:ns#37:nt#20:nc#3182: IBM 0663L12:\ :ty#winchester:ns#66:nt#15:nc#1979:\ :pc#1959210:oc#0: IBM 0664-M1H/N1H:\ :ty#winchester:ns#86:nt#16:nc#2856: IBM 0664CSH:\ :ty#winchester:ns#125:nt#30:nc#2787: IBM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM DFHSS1x:\ :ty#winchester:ns#125:nt#4:nc#4383: IBM DFHSS2x:\ :ty#winchester:ns#125:nt#8:nc#4388: IBM DFHSS4x:\ :ty#winchester:ns#125:nt#16:nc#4390: IBM DPES-31080:\ :ty#winchester:ns#108:nt#4:nc#4901:\ :pc#2117232:oc#0: IBM DSAS-3270:\ :ty#winchester:ns#108:nt#2:nc#2542: IBM DSAS-3360:\ :ty#winchester:ns#108:nt#2:nc#3297: IBM DSAS-3540:\ :ty#winchester:ns#108:nt#3:nc#3259: IBM DSAS-3720:\ :ty#winchester:ns#108:nt#4:nc#3292: IBM OEM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM OEM DFHSS2F:\ :ty#winchester:ns#135:nt#8:nc#4076:\ :pa#4100760:oa#0:ba#8192:\ :pb#301320:ob#4100760: MAXOPTIX (NON-ISO, 1024b) DATA:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 1024b) SYSTEM:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 512b) DATA:\ :ty#winchester:ns#60:nt#1:nc#15081: MAXOPTIX (NON-ISO, 512b) SYSTEM:\ :ty#winchester:ns#60:nt#1:nc#15081: MICROP 4221-09MZ 10204:\ :ty#winchester:ns#139:nt#9:nc#3198:\ :pc#4000698:oc#0: MICROPOLIS 1991-27:\ :ty#winchester:ns#149:nt#27:nc#4400: MICROPOLIS 3243-19:\ :ty#winchester:ns#106:nt#19:nc#4139: MICROPOLIS 4110-09:\ :ty#winchester:ns#95:nt#9:nc#2283: Maxtor 7213SR NB:\ :ty#winchester:ns#65:nt#4:nc#1595:\ :pc#414700:oc#0:\ :pg#414700:og#0: Maxtor DXP3105S:\ :ty#winchester:ns#57:nt#14:nc#2568: Maxtor LXT-200S:\ :ty#winchester:ns#43:nt#7:nc#1117: Maxtor LXT-340SY:\ :ty#winchester:ns#70:nt#7:nc#1355: Maxtor LXT535ST:\ :ty#winchester:ns#61:nt#11:nc#1547:\ :pc#1038037:oc#0: Maxtor MXT1240S:\ :ty#winchester:ns#70:nt#15:nc#2306:\ :pc#2421300:oc#0:\ :pg#2421300:og#0: Maxtor P0-12S (1632):\ :ty#winchester:ns#90:nt#15:nc#1478:\ :pc#1995300:oc#0:\ :pg#1995300:og#0: Maxtor P0-12S (1795):\ :ty#winchester:ns#90:nt#15:nc#1510:\ :pc#2038500:oc#0:\ :pg#2038500:og#0: Maxtor P1-17S:\ :ty#winchester:ns#83:nt#19:nc#1816:\ :pa#78850:oa#0:ba#8192:\ :pb#78850:ob#78850:\ :pc#2863832:oc#0:\ :pd#78850:od#157700:\ :pg#2469582:og#236550:\ :ph#78850:oh#2706132: Maxtor P1-17S NB:\ :ty#winchester:ns#90:nt#19:nc#1711:\ :pc#2925810:oc#0:\ :pg#2925810:og#0: Maxtor XT-1050:\ :ty#ACB4000:ns#17:nt#5:nc#1020: Maxtor XT-3280S:\ :ty#winchester:ns#25:nt#15:nc#1222: Maxtor XT-4380S:\ :ty#winchester:ns#36:nt#15:nc#1202: Maxtor XT-8380S:\ :ty#winchester:ns#53:nt#8:nc#1626: Maxtor XT-8610E:\ :ty#winchester:ns#52:nt#12:nc#1626: Maxtor XT-8760E:\ :ty#winchester:ns#50:nt#15:nc#1616:\ :pa#97500:oa#0:ba#8192:\ :pb#63750:ob#658500:\ :pc#1212000:oc#0:\ :pd#280500:od#97500:\ :pe#280500:oe#378000:\ :pf#489750:of#722250:\ :pg#561000:og#97500:\ :ph#658500:oh#0: Maxtor XT-8760S:\ :ty#winchester:ns#54:nt#15:nc#1614: Micropolis 1304:\ :ty#ACB4000:ns#17:nt#6:nc#825: Micropolis 1325:\ :ty#ACB4000:ns#17:nt#8:nc#1022: Micropolis 1355:\ :ty#winchester:ns#34:nt#8:nc#1018: Micropolis 1528-15:\ :ty#winchester:ns#83:nt#15:nc#2102:\ :pa#32370:oa#0:ba#8192:\ :pb#64740:ob#32370:\ :pc#2616990:oc#0:\ :pg#2519880:og#97110: Micropolis 1548-15:\ :ty#winchester:ns#131:nt#15:nc#1701:\ :pa#33405:oa#0:ba#8192:\ :pb#66810:ob#33405:\ :pc#3342465:oc#0:\ :pg#3242250:og#100215: Micropolis 1558:\ :ty#winchester:ns#35:nt#15:nc#1218: Micropolis 1578-15:\ :ty#winchester:ns#35:nt#15:nc#1231:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#646275:oc#0:\ :pg#548625:og#97650: Micropolis 1588-15:\ :ty#winchester:ns#53:nt#15:nc#1637:\ :pa#32595:oa#0:ba#8192:\ :pb#65190:ob#32595:\ :pc#1301415:oc#0:\ :pg#1203630:og#97785: Micropolis 1598-15:\ :ty#winchester:ns#70:nt#15:nc#1931:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#2027550:oc#0:\ :pg#1929900:og#97650: Micropolis 1624-7:\ :ty#winchester:ns#114:nt#7:nc#1647:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#1314306:oc#0:\ :pg#1216152:og#98154: Micropolis 1674-7:\ :ty#winchester:ns#35:nt#7:nc#1255:\ :pa#16415:oa#0:ba#8192:\ :pb#32830:ob#16415:\ :pc#307475:oc#0:\ :pg#258230:og#49245: Micropolis 1684-7:\ :ty#winchester:ns#53:nt#7:nc#1785:\ :pa#32648:oa#0:ba#8192:\ :pb#65296:ob#32648:\ :pc#662235:oc#0:\ :pg#564291:og#97944: Micropolis 1908-15:\ :ty#winchester:ns#95:nt#15:nc#1890:\ :pa#32775:oa#0:ba#8192:\ :pb#65550:ob#32775:\ :pc#2693250:oc#0:\ :pg#2594925:og#98325: Micropolis 1924-21:\ :ty#winchester:ns#94:nt#21:nc#2072:\ :pa#33558:oa#0:ba#8192:\ :pb#67116:ob#33558:\ :pc#4090128:oc#0:\ :pg#3989454:og#100674: Micropolis 1926-15:\ :ty#winchester:ns#101:nt#15:nc#2769:\ :pa#33330:oa#0:ba#8192:\ :pb#66660:ob#33330:\ :pc#4195035:oc#0:\ :pg#4095045:og#99990: Micropolis 1936-21:\ :ty#winchester:ns#101:nt#21:nc#2772:\ :pa#33936:oa#0:ba#8192:\ :pb#67872:ob#33936:\ :pc#5879412:oc#0:\ :pg#2846382:og#101808:\ :ph#2931222:oh#2948190: Micropolis 2105-8:\ :ty#winchester:ns#94:nt#8:nc#1448:\ :pa#32336:oa#0:ba#8192:\ :pb#64672:ob#32336:\ :pc#1088896:oc#0:\ :pg#991888:og#97008: Micropolis 2108-10:\ :ty#winchester:ns#94:nt#10:nc#1450:\ :pa#31960:oa#0:ba#8192:\ :pb#63920:ob#31960:\ :pc#1363000:oc#0:\ :pg#1267120:og#95880: Micropolis 2112-15:\ :ty#winchester:ns#94:nt#15:nc#1452:\ :pa#33840:oa#0:ba#8192:\ :pb#67680:ob#33840:\ :pc#2047320:oc#0:\ :pg#1945800:og#101520: Micropolis 2205-05:\ :ty#winchester:ns#109:nt#5:nc#2088:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#1137960:oc#0:\ :pg#1039860:og#98100: Micropolis 2210-09:\ :ty#winchester:ns#109:nt#9:nc#2099:\ :pa#33354:oa#0:ba#8192:\ :pb#66708:ob#33354:\ :pc#2059119:oc#0:\ :pg#1959057:og#100062: Micropolis 2217-15:\ :ty#winchester:ns#109:nt#15:nc#2105:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#3441675:oc#0:\ :pg#3343575:og#98100: Micropolis 4110:\ :ty#winchester:ns#114:nt#9:nc#1998: Micropolis 4221:\ :ty#winchester:ns#109:nt#9:nc#4079:\ :pa#4001499:oa#0:ba#8192:\ :pc#4001499:oc#0: NEC D2363:\ :ty#XD7053:ns#67:nt#27:nc#964: NEC-D2352:\ :ty#XD7053:ns#57:nt#19:nc#758: Quantum ELS 127S:\ :ty#winchester:ns#54:nt#3:nc#1541: Quantum ELS 170S:\ :ty#winchester:ns#54:nt#4:nc#1542: Quantum ELS 85S:\ :ty#winchester:ns#54:nt#2:nc#1535: Quantum Empire 540S:\ :ty#winchester:ns#92:nt#8:nc#1431: Quantum Empire 1080S:\ :ty#winchester:ns#92:nt#16:nc#1431: Quantum Empire 2100S:\ :ty#winchester:ns#137:nt#12:nc#2497:\ :pc#4105068:oc#0: Quantum GoDrive 120S:\ :ty#winchester:ns#56:nt#4:nc#1067: Quantum GoDrive 160S:\ :ty#winchester:ns#58:nt#4:nc#1413: Quantum LPS 105S:\ :ty#winchester:ns#42:nt#4:nc#1221: Quantum LPS 120S:\ :ty#winchester:ns#60:nt#2:nc#1987: Quantum LPS 240S:\ :ty#winchester:ns#60:nt#4:nc#1995: Quantum LPS 270S:\ :ty#winchester:ns#76:nt#7:nc#992: Quantum LPS 525S:\ :ty#winchester:ns#70:nt#6:nc#2444: Quantum LPS 540S:\ :ty#winchester:ns#125:nt#4:nc#2113: Quantum Lightning 730S:\ :ty#winchester:ns#63:nt#16:nc#1415:\ :pa#161280:oa#0:ba#8192:\ :pb#96768:ob#161280:\ :pc#1426320:oc#0:\ :pg#1168272:og#258048: Quantum PD 80S:\ :ty#winchester:ns#34:nt#6:nc#832: Quantum PD 120S:\ :ty#winchester:ns#42:nt#5:nc#1114: Quantum PD 170S:\ :ty#winchester:ns#42:nt#7:nc#1117: Quantum PD 210S:\ :ty#winchester:ns#49:nt#7:nc#1189: Quantum PD 425S:\ :ty#winchester:ns#60:nt#9:nc#1540: Quantum PD 700S:\ :ty#winchester:ns#70:nt#8:nc#2441: Quantum PD 1050iS:\ :ty#winchester:ns#92:nt#12:nc#1859:\ :pc#2052336:oc#0: Quantum PD 1050S:\ :ty#winchester:ns#70:nt#12:nc#2444: Quantum PD 1225S:\ :ty#winchester:ns#70:nt#14:nc#2442: Quantum XP32150:\ :ty#winchester:ns#109:nt#10:nc#3850: Quantum XP34301:\ :ty#winchester:ns#118:nt#20:nc#3561: Quantum XP34300W:\ :ty#winchester:ns#107:nt#20:nc#3907: RICOH RO-5031E:\ :ty#winchester:ns#54:nt#15:nc#710:\ :pc#575100:oc#0: RZ24:\ :ty#winchester:ns#38:nt#8:nc#1344:\ :pc#409792:oc#0: RZ55:\ :ty#winchester:ns#35:nt#15:nc#1218:\ :pa#32025:oa#0:ba#8192:\ :pb#59850:ob#32025:\ :pc#639450:oc#0:\ :pg#547575:og#91875: SEAGATE ST11950N:\ :ty#winchester:ns#81:nt#15:nc#2715:\ :pc#3298725:oc#0: SEAGATE ST15230N:\ :ty#winchester:ns#111:nt#19:nc#3974: SEAGATE ST31200N:\ :ty#winchester:ns#85:nt#9:nc#2692: SEAGATE ST31230N:\ :ty#winchester:ns#104:nt#5:nc#3978:\ :pc#2068560:oc#0: SEAGATE ST32550N:\ :ty#winchester:ns#109:nt#11:nc#3495:\ :pc#4190505:oc#0: SEAGATE ST3600N:\ :ty#winchester:ns#79:nt#7:nc#1853:\ :pc#1024709:oc#0: ST83220K:\ :ty#"ISP-80":ns#102:nt#19:nc#2652: SUN0104:\ :ty#winchester:ns#35:nt#6:nc#974: SUN0121:\ :ty#winchester:ns#39:nt#4:nc#1520: SUN0207:\ :ty#winchester:ns#36:nt#9:nc#1254: SUN0327:\ :ty#winchester:ns#46:nt#9:nc#1545: SUN0424:\ :ty#winchester:ns#80:nt#9:nc#1151: SUN0535:\ :ty#winchester:ns#80:nt#7:nc#1866: SUN0669:\ :ty#winchester:ns#54:nt#15:nc#1614: SUN1.3G:\ :ty#winchester:ns#80:nt#17:nc#1965: SUN2.1G:\ :ty#winchester:ns#80:nt#19:nc#2733: Sabre ST82500J:\ :ty#XD7053:ns#82:nt#19:nc#2609: Seagate (CDC) Wren V 94181-702:\ :ty#winchester:ns#48:nt#15:nc#1543: Seagate (CDC) Wren VI 94191-766:\ :ty#winchester:ns#52:nt#15:nc#1659: Seagate (CDC) Wren VII 94601-1.2G SunOS 4.1.1:\ :ty#winchester:ns#70:nt#15:nc#1925: Seagate (CDC) Wren VII 94601-15:\ :ty#winchester:ns#71:nt#15:nc#1905: Seagate (CDC) Wren VIII ST41650N:\ :ty#winchester:ns#89:nt#15:nc#2070: Seagate Elite ST43400N-3.5G:\ :ty#winchester:ns#99:nt#21:nc#2736:\ :pa#2843360:oa#0:ba#8192:\ :pb#2843360:ob#2841993: Seagate IPI ZBR Elite:\ :ty#"ISP-80":ns#78:nt#17:nc#1893:\ :pa#34476:oa#0:ba#8192:\ :pb#132600:ob#34476:\ :pc#2510118:oc#0:\ :pg#663000:og#167076:\ :ph#1680042:oh#830076: Seagate ST11200N:\ :ty#winchester:ns#80:nt#15:nc#1714:\ :pa#2056800:oa#0:ba#8192:\ :pc#2056800:oc#0: Seagate ST11900Wide Negotiation failed for %d.%d.%dSDTR Message failed for target %d.%d.%dBad LVD condition while talking to %d.%d.%dPort Unavailable for target %dport logout for target %dport changed for target %dport busy for target %dUnknown Completion Status 0x%x` `+>T t*` €` b2  >N``2 ` @ ,  &,*` 2` 2  >N#\q  >N``2 `Hg >NH #p/H * *` 2 *` !OH>N#` J 2 * *` 2 *` "OH>N#` J 2 * *` 2 *` $OH>N#` J 2 * *` 2 *` (OH>N#` J 2 * *` 2 *` @OH>N#` J 2 * *` 2 *` @OH>N#Ѐ` J 2 * *` 2 *` @OH>N#` J 2 * *` 2 *OH>N#` J 2 * *` 2 *` OH>O ` J 2 * *` 2 *` OH>O ` J 2 * *` 2 *` OH>O ` J 2 * *` 2 *` OH>O (` J 2 * *` 2 *` OH>O 8` J 2 * *` 2 *` OH>O H` J 2 * *` 2 *` @OH>O X` J 2 * *` 2 *` OH>O h` J 2 * *` 2 *>Ox @ >O``2 ` #\ >O  2   @  !2  d  !*  .!,`ː &, >O  2   @  !2  d  !*  .!,` >O``2 ` @Β ,  &,`>O &(``2 `M  >O``2 `@C  >O``2 `h9  >O``2 `/  >O``2 `%  >O``2 `  >O``2 `   >O``2 `P  >O``2 `x  >O``2 `  >O``2 `  >O``2 ` @M , >O``2 `Җ  >O``2 `8Ȗ `,&(` >``2 `  >``3` ` >``2 `( >O`@ , >O``3` `X `#\@  (.X&, >``2 `h  >O``2 `z  >O  3`   `@ޒ   "(, `$ ܘ `?ȑ*` *  *@ 2  `* *  @ "  ! d  !  .!, "&,0 >P  3`   `@   "q, `$ ܘ `?đ*` *  *@ 2  `* *  @ "  ! d  !  .!J, >P``3` `0 `@o =, >P `@f , 6 4&, >P @Y , ) '&, >P @L ,  &, >P @? ,   &,>P` @3 ,  &,NPA AAHIPIJJ4J\JJJJK$KLKtKKKL LHP@P@L\LLLLM0MXMNdO<P@P@P@P@P@P@OpOOP Command for fast post handle 0x%x not found㿘.`6``9 쀦@ !8.` ?` **>T(2@ْ 0#2  + 2 !8* "@`$&`(  .`X  2! !?6!@vGET NOST DATASET HOST DATAGET DATA OVERRUN RECOVERY MODESET DATA OVERRUN RECOVERY MODEGET TARGET MODE STATEENABLE TARGET MODEEXECUTE IOCB A64INITIALIZE RESPONSE QUEUE A64INITIALIZE REQUEST QUEUE A64DUMP RAM A64LOAD RAM A64GET FIRMWARE FEATURESSET FIRMWARE FEATURESSET SCAM CONFIGURATIONGET SCAM CONFIGURATIONGET SYSTEM PARAMETERSET SYSTEM PARAMETEREXEC BIOS IOCBWRITE FOUR RAM WORDSRETURN BIOS BLOCK ADDRSET RESET DELAY PARAMSSET DEV QUEUE PARAMSSET TARGET PARAMSSET PCI CONTROL PARAMSSET ASYNC DATA SETUP TIMESET ACT NEG STATESET CLOCK RATESET TAG AGE LIMITSET RETRY COUNTSET SELECT TIMEOUTSET INIT SCSI IDGET RESET DELAY PARAMSGET DEV QUEUE PARAMSGET TARGET PARAMSGET PCI PARAMSGET ASYNC DATA SETUP TIMEGET ACT NEG STATEGET CLOCK RATEGET TAG AGE LIMITGET RETRY COUNTGET SELECT TIMEOUTGET INIT SCSI IDGET FIRMWARE STATUSGET DEV QUEUE STATUSABORT QUEUESINGLE STEP QUEUESTART QUEUESTOP QUEUEBUS RESETABORT TARGETABORT DEVICEABORTSTOP FIRMWAREWAKE UPEXECUTE IOCBINIT RESULT QUEUEINIT REQUEST QUEUECHECK FIRMWAREABOUT FIRMWAREVERIFY CHECKSUMMAILBOX REG TESTREAD RAM WORDWRITE RAM WORDDUMP RAMEXEC FIRMWARELOAD RAMNO-OPLun RESETSEND LFAGet ID ListINITIALIZE IP MAILBOXSET VENDOR IDGET PORT/NODE NAME LISTLOGIN LOOP PORTINIT LIP LOGINFABRIC LOGOUTSEND CHANGE REQUESTFABRIC LOGINSEND SNSINIT LIP RESETGET LINK STATUSGET PORT NAMEGET FW STATEABORT TASK SETCLEAR TASK SETTARGET RESETCLEAR ACAGET PORT DATABASEGET FC-AL POSITION MAPINIT LIPINIT FIRMWAREGET/SET DATA RATEGET PORT DATABASE,, ENHANCEDREQUEST NON PARTICIPATING MODEGET RESOURCE COUNTSLOOP PORT ENABLELOOP PORT BYPASSSET PORT QUEUE PARAMSSET FIRMWARE OPTIONSGET PORT QUEUE PARAMSGET FIRMWARE OPTIONSGET LOOP IDUnknown Command 0x%xno parameters for 0x%xopcode %xINVALID COMMANDHOST INTERFACE ERRORTEST FAILEDCOMMAND ERRORCOMMAND PARAMETER ERRORLOOP ID ALREADY IN USEPORT ID ALREADY IN USEALL LOOP IDS IN USETIMEOUTerror 0x%xMailbox Command '%s' failed (%s)p >Ϙ#@ >Ϙ!  ^@  >V6@& ,  ``2  ?  `  ? !$  >V6@@! 0   +- `@@4@5  `6!4.!!  .!`@  3 !2 c? !   ؐ@Ԓ֟Ҁ  ֐!2   Y!!!2  2 !2  (>,!4@Ȓ 0!&  %>,#>aP*`  @0  `"aP`# !>, .!!4& @ !2  ! .!0   *" @ 2@  `}{ > @>ϐ!ȓ, `2 @>V@WC @`@1 4`@ "R ``DE>V@G`@=>V@". ``@`@/>V@` @!'>V)>V'"؀$>V"">V#>V#>V#(>V#@  >V #X>V#px@V  >V@ 㿈  i 7 @ *  @$㿘!    < @ ,`skipping target %d bus %d updatebus %d set tgt %d flags 0x%x off 0x%x period 0x%xx! !* ` *@  .! .`*   ܑ* ??c#   ->X 2` 2` @ >X$  @l`  2` (7 $ 8'䀊 ^ 87 ?!a @4  @7@7@2 7 2 * @7 ? * (@4  2#\#` @e   $ '.`,` 7 䀢  !2 !@ *  `@.!`2,  *@ * .`$ @4 ' @``  *  2` 2`  `!!  `@.!0` Using Node WWN 0x%08x%08x, Port WWN 0x%08x%08xp Z.`* * " ܑ*  B $!    k$, 4 4 , , ,  ! <  4<  !4?* 4 @  @   @& `2  "  >Y  #\ @   & ;   :  :  : .`*   ܑ* @@` @* @ *@*  $@  <*$* $@!   4`,`,` 4`,` ,`   *` `  "` `  @21@@G  @2(@ %7 @@  $@`* @2  *@ * $@ 2  * * @$@@!>ϑ3` #\ ` #` `  #d ` 3`#h@>ϑ2 #l ` @, @>ϑ3` #\@3`2` `#``3`#d`#h ` @ `???ì#c !)>Ϡ 4  $ , 4 4  ` ? )  # `2  2    ` 2 `  ? : @2       * 0 *   , $ , #\ 2  #` #d  @ isp_reinit cannot reset cardisp_reinit cannot restart card㿘Ҧ!2   >Z@@   2 " !2   !  0.!!2   >Z`@  6!5 ,`2   (!8 *  ? 2`"  $ 쀢@!8* "@ $ " $ (  2 $$ ( $ ,@ `*` 2  Ϣ invalid NVRAM header%x %x %xinvalid NVRAM checksumversion %d NVRAM not understood㾘 ` !       @  `!S@2  P=` 2  2j?>[@ >[(@ [?  @T `    @ ` >[8@֒ :?>[P@̒ 0? `   @@ !  @    ` @@   @ @A 㿘 ؒ     ؐ`    ` 2` 8`?`f a `&&6* 2 <    ؠ    ؔ`  ܐ  ؔ  Ԑ <<6 *`6 ؒ  Đ  ؐ`€   6Ϸ  ؐ`  ϯ < ؐ`  Ϥ ?# @ `*`2 @6㿀`  ܑ2 ` @ ` * * $@`2 * * $@`?,` `,` ` ,` ` * $@   3  4 ` $    $@` @2  * * @$@` 2  *@ * $@` 2  * * @$@` 2 *@ * $@` ,`` * ` *` 4``!>`*@ 4`` * @3`$@ `#\ `  #` ` 3`#d ` >#h@2 #l ` @ @3` #\@3`2` `#``3`#d`>#h`  ` @ %>` 2  * * @$ `, ` `*` 0 $ `,    `  ,  2`   p,2   ($ 4 ` !4  $4 ` h4 `   4 `   4 ` @  4 `2     4  4 #\ 2  #` #d @  <2*  *  @$ , 4 ``` 㿀.`*   ܑ* 2` `**` $`  * * $` `,  `,  , `  < * * $`  2  * *  `$ 2  * * @$2  *@ * $2  * * @$` ` `* @4  `! 3`* 4 `#\ !>#` #d  #h3`2 #l>ϐ ` @s>ϑ3` #\3`2` `#`3`#d#h`  `@] ( />Ϡ  `+  2  * * @$ `) *` `+   *  p@" `* `*`4  " !4  `$4  h4 `   4 `   4 ` @  4 ` 2     4  4 #\ 2  #` #d ࠖ@ ֘ <2*  *  @$ , 4 ` ``p 㿀.`*   ܑ* 2` `**` $`  * * $` `,  `,  , `  < * * $`  2  * *  `$ 2  * * @$2  *@ * $2  * * @$` ` `* @4  `! 3`* 4 `#\ !>#` #d  #h3`2 #l>ϐ ` @ ->ϑ3` #\3`2` `#`3`#d#h`  `@  ( />Ϡ  `+  2  * * @$ `) *` `+   *  p@" `* `*`4  " !4  `$4  h4 `   4 `   4 ` @  4 ` 2     4  4 #\ 2  #` #d ࠖ@  <2*  *  @$ , 4 ` ``p NVRAM Port WWN 0x%08x%08xNVRAM Node WWN 0x%08x%08xNVRAM: maxfrmlen %d execthrottle %d fwoptions 0x%x㿐` `+``(`,`` ` `5-   @  6. @-5`- .-``    `ܒ >_ '8@ !6   @ ? ` `+`` (`",``! `# `$ 5-  @ 6`.   @-5`- .`-``%     >_ 'X@ ޘ6   @ ?   @   $@2  ?  @2    $@"  ?   @"/`   $@)     2`2  <?#?  ?    2`   2`2` @  ? ` >_` *` 7 ` ` *` 7 `x/ ` / `/ `/ ` @ r7 0@ 2?0(2 ` * `*  +     +     +    +   0` 2?0(2 0` 2?0(2 ` * `!*! 0`" 2"?0(2" 0`$ 2$?0(2$ 0`& 2&?0(2& 0`( 2(?0(2( 0`* 2*?0(2* 0`, 2,?0(2, 0`. 2.?0(2. 0`0 20?0(20 0`2 22?0(22 `4*4 `5*5 0`6 26?0(26 0`8 28?0(28 0`: 2:?0(2: 0`< 2<?0(2< 0`> 2>?0(2> 0`@ 2@?0(2@ 0`B 2B?0(2B 0`D 2D?0(2D 0`F 2F?0(2F 0`H 2H?0(2H 0`J 2J?0(2J 0`L 2L?0(2L 0`N 2N?0(2N 0`P 2P?0(2P 0`R 2R?0(2R 0`T?0(2Tdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKPolled Mailbox Command (0x%x) Timeoutisp_mboxcmdInterrupting Mailbox Command (0x%x) Timeout%s index %d=> %s %02x%s:0x%08x:%sisp㿐!>А  0>c.!ct &  0& &  @$`$`$`  ! 4 4`  >c# ``& !)4` ܒ 4`  4` *@6  2  X@ """ `  2 2$ `22 ̒  *@6   "B 'H /d * %    & & H 0 b     2    'S ?` &  & H 0 Be!g!>` !H /d * %    & & H 0  &%"`*'  2$ @2`  22`    2  2  2   2`  2 2`  4  ?` &  & H 0 4`!>"@0     `("@0 㿘 <?#@@& <@ ~㿘   > `H>d !\# B# 2 (`*   ܑ*  @`4 : .> `< ?#  a `;# `?Ȗ*`2 (* @ @ " 2  !  !*  `@+!* 3@added to blocked queueActive Hiwater Mark=%dblocking queueretrying later for %d.%d㿐 >f ah@,є `   $,6 H /d * % `  $`$`H 0  a2   4K``ؐ`   a2   & `  ``   ``   `?` $``$`H 0  $, e a `  0,a` ``   ``   ` =  $,`   $``$`H 0  2`@` ` "$``"$`$`?` $``$`H 0 >d@=   !2` /`$`@` `` *` ? $`w$``$`H 0 0mݸ f"0` g e"U T` h"9 N`  h@##>P @+ $a` 67`a>d$`a@ -`>d `  @$`0@ڒ ` "$``"$`$ >d   @@ɐh>hb,@+>!P @+ $`?` $``$`H 0 㿐I f  g e 0 h 0   `, 2  &`,   "`5 "  ` ؐ@  s` 2 #蠄?2 ؀`2 ` 2  ߼ "`,`,   &`,finished command on borrowed timerestarting blocked queue㿘 @  *&    @+h h *@&  @>e ` @&  * & @Ր `  $ >f@ @:watchdog found done cmd (handle 0x%x)recursive watchdog (handle 0x%x)watchdog cleanup for handle 0x%xwatchdog timeout on handle %xpossible command timeout on handle %xwatchdog with no command@  H /d * % `  $`$`H 0   ` 6 a8*@ * * 2  "`  >f @`?`$``$`H 0 0@ >f @`?`y$``$`H 0 0o & `ؐ@ d ` >f 0@] @*@-& @- ޫ $` >f` >fX @> "  `쀢8 a8* "@ *  & ,& `>fx@#  @*  & @!ɒ#>P @* h  & `ؐ`€`4aa4?a4?*a<  4?@ @  77" `?`$``$`H 0 0 & @# @    4 , , $` , `2  " ,, , , , , , ,`2  "  ?# ? ** @2@ 2@ $`2   , ,, , `2    4 ?# @2 *`@4 `2    4 ?# @2 *`@4 `2    4?# @2 *`@4`2    4?# @2 *`@4    $   * ?# ?1?`   `2  "  *  *` 2  2 #`2     *  *` 2  2  $`?؆`ؐ``4a `/>f@ `?` $``$`H 0 㿘H /d * %    & & H 0  ؐ`   ?` &  & H 0 restarted command for %d.%dblocked cmd again%s for %d.%dCMD_EAGAINCMD_RQLATER㿘  H /d * % `  $`$`H 0 C f)>h g e"P ,U` h"2 O` >h   @  B h>fa@(h @ *#>Pr '@s ` ` ?` $``"$`$` &>h >h   @Z h>hb,@(<>!P@(L  &   & ,`?` $``$`H 0 requeued %d commands㿘H /d * %    & & H 0   `'& $  ?& ` &  & H 0  ="@ "` >iP@ 0 ?` &  & H 0 㿘   &  "@ "` >iP@ , 16 bit wide, Tagged Queueing Enabled, 16 bit wide, Tagged Queueing Enabled Bus %d Target %d at %dMHz Max Offset %d%sBus %d Target %d Async Mode%sSCSI bus %d reset detectedLoop DOWNLoop UPTarget %d (Loop 0x%x) Port ID 0x%x role %s %s Port WWN 0x%08x%08x Node WWN 0x%08x%08xTarget/InitiatorInitiatorTargetNoArrivedDepartedName Server Database Changed N_Port NL_PortF/NL_Port Nx_Port F_port FL_Port E_port?%s @ 0x%x, Node 0x%08x%08x Port %08x%08xno more space for fabric devices8'D` >l .` €D ` s `/n?> @ ,  * D ܓ.* @*` ( `&  "# 2  ` ` 4*`` " P` ` ` *`0  (  ! *`@}#   " >i ( >i " >i ""0>i"@>i"``.*  >i `#\D#`k>iDd  >iD@ 0D>iਔ ` ? #UDD ? D@ ` $>iD@&a`h $@&o >iD<D 3 /.>i.@ܓ*``( >Б2   "d #\ >i#>i##`#d#h #l #pD@: 0* >iD@3 0#  * !, !-`  ! /`' -' !' !  ' .' !! 'Ħ ??? '? !"'?ă5 ? 5 @  ȧ+ܟ- ?ğ*`4 @2 , @ ?@̆  * *`؆+*`2  +ܘĘ ܃2@@ + -  @  @+/ D-  @ !#  @    ܤ@   "'>j ">i  >j$ P>j  P">j >j P>j P>i##>j    >j  0>j @#`D>j'X#\#d @a "B N2      * *  ( (`  2` 2` 2` 2` $!  (* *  (  @22>jD@ 0 $< < $  @\h%s: 㿘'P'T`'X /@ >l @Bm!@BP>l@Bg!diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKespFAS366/HMEAM53C974FAS216FAS408ESP406NCR53C96NCR53C94ESP200ESP100AESP100    2     2 out of memory %s: unknown variant %d, devices not attached : %s, %dMHz, SCSI ID %d 㿘 H>b@$i"Ȁ 2"Ԑ  @O &""Ԁ 2"Ȑ  @F &""Ȁ >l"Ԁ 2">l@Aސ"0D >>l"@A֒ 0<"* ">l"@A͐"" @  `.  . "*"@ *`"  *  , @*  . . &  @."" 6 f6 j> `& |& t& @'e >aP*"@ @$*`%s: unknown revision code, assuming ESP100 㿘  @!>"x!>m  @Az!  ."`  "x! >m @Aj!  ."   e!"` W>m>m#*` €     `  "` &"  "` &"   "    &". .     .     `   `   `   `  " @A  `   `   `   `  "  `  4%s: resetting SCSI bus 㿘 @>m#@@Ȓ >bx!>m  @@!g  ."`  [NCR_INIT(%d) %d] ncr53c9x_ecb㿐>"x`>n" 8@@!>"| 2"> F>n `P#\ L  @4  $"|" 2  & & &  @1" ""??06 ."6" "`, @R Ȩ  "$?   $ ,  "`, @@    @ $@" ,@3`,   2 ?ڬ@!&"&"  "   :   : `!`*" *** @` ."x!>m  @@!  ."`  0 ."@hregs[intr=%02x,stat=%02x,step=%02x,stat2=%02x] [ncr53c9x_select(t%d,l%d,cmd:%x,tag%x,%x)] SELATNS 㿐` `,  ` >"x` >n`/#`I`J@?ܔ ."`` 2"`А"@ >Ȑ @#>HP!PC @# @"@`" 2 "x!>m  @?"\  ."`            * " @’ ,`"* "@* &`"  "  2`   `2 "􀌠"?"  "          ` "j`I" Q`/`@&"&"'    `  @2 "  ` "  `  " "x!>m  @?"s  ."`  "x!>m  @? "v  ."`    "`@@`/"x!>m  A@>"{ A ."`  A0ܠ  " "    `  ` `@`I.`,`,*`J *`@  `..`." q 2p &"&"'    `  @2 "  ` "  `  "x!>m  @>"  ."   `!" @6".""xa >m @>{"  ."`   "x!>m  @>i"  ."`   " "@  @0E @ "x >n@>I#8"x!>m  C@>A"Ɛ C ."`  C0)`!" @6".""xa>m  F@>)"ʐ F ."`  F0"x!>m  B@>"̐ B ."`  B㿘H /d * % > F @5&` H 0㿘> "@` `@? `H / * % > F@3 H 0` L@~>`a @ :`  &`  [ncr53c9x_scsi_cmd] [0x%x, %d]->%d 㿘  ` !>"x `>q@= "x >q    @=``*    @,`  c 4$  @  2@.$ > %"<$ H /d * % ` $ ` "` $`` $ ,` " H 0c 2$ N  $  $ @ $  $ D  /@  $ @ $ < $$ D, HH /d * % $`$ `"@%`  $ b`@zH 02  @! " @ @  @ [ncr53c9x_poll] [ncr53c9x_poll: rescheduling] 㿘>"x`>q@<#"" !>q @ "`@ B` ""  bx @<ѐ#@'ѐ#贆2  [ncr53c9x_sched] ncr53c9x_sched: not IDLE (state=%d)ncr53c9x_sched: tag alloc failure %d:%d busy 㿘>"x`>q@<#"`" >r@;" ``` `*     ` @  ` "`  @  !H /d* % ,      ; &> %$  @   H 0@@$  <$  "` $$ , " > %"$   "$  `      `  H 0v@=,`I  2 H 0g@ *`  *`2    *`22 >r@:o 0,  , *# ,`JH 0       , @``& `x @``"`& `@"` $` & 0 "@>r` X@;`@`2`requesting sense 㿘``/  *  >bx  >s@; x@:  .`/  *`,`,``  4   #&`@&`<&`D&` &` $,     ?   2, @ , $  @2 h0 &@ " & &  &`` `&` " [ncr53c9x_done(error:%x)] %s: QFULL -- throttling to %d commands resid=%d sense=0x%02x error=%d 㿘` *  ,      >bx  >s ,@;"@``H (2  , `>s*`4 "(2@:  , 2 `H, X` @  $ , $ ,`H > 2`D`D$ (:0Q$ ( bx `$  (`" ,>s@:ɐ"X ,`2>s>s 4@:"h@:"x@U @2  ," &  ." , 2 ` 2  ` 2 4`, " ``"` ` "` ` `"@@ݒ  `@%ncr53c9x_dequeue: lun %qx for ecb %p does not exist ncr53c9x_dequeue: slot %d for lun %qx has %p instead of ecb %p 㿘`  `*  ` 2,``  ,`  2 " >t>t>t @8Ė2`I*"`I `J*`  "">t!0@8 ?*`  ?&` @``"`& @`"[flushfifo] 㿘!>"x >t@:""x!>m  @9$  ."   "   ncr53c9x_rdfifo: bad flag [rdfifo %s (%d):startcont %02x] 㿘``>t0"&"""@@8L#h @€ "` * ,`  '> @€ , &  % `   @€ , @ € "ܠ  '> @€ , & "ܒ@&"x  >t`#>t#>t#"@9s x """ܲ @ >t!>t"Ԑ#@9e "ܲ`@ *">t@9]#"܁[wrfifo(%d):㿘!>"x >u!@9L"x   >t#>t@@9Ac &@>t@9:#  `@ " 2   `   & %s: reselect with invalid selid %02x; sending DEVICE RESET %s: reselect from target %d lun %d tag %x:%x with no nexus; sending ABORT ncr53c9x_sched_msgout %x %d 㿘b   bb  b* * >u"@8ߒ`!> ? `*   `@*``       `` `    ,bݰ `.@  >u"Д@8`!>,b$` ````+`b`@ǒ . "* b@* & bb  ` 2`` "?b  `  `  `    !>"x >u#  @8O%X"x!>m  @8G%X` ,b`   bbĐ @ ` @"x >u#  @80%Z"x!>m  @8(%Z` ,b`   bbĐ @` ,b4b< $bD>$b"x >u#  @8 %c"x! >m @8%c` ,b`   bbĒ`@ "x >u#  @7%g"x!>m  @7%g` ,b`   bbĒ`@ 4b,b [ncr53c9x_msgin(curmsglen:%ld)] %s: msgin: no msg byte available %s: phase change, dropping message, prev %d, state %d gotmsg(%x) state %dcmdcomplete got %ld extra bytes msg reject (msgout=%x) %s: tagged queuing rejected: target %d (rejected sent tag)%s: sync transfer rejected: target %d %s: wide transfer rejected: target %d noop TAG %x:%xdisconnect save datapointer restore datapointer extended(%x) SDTR period %d, offset %d async mode max sync rate %d.%02dMB/s %s: wide mode %d unrecognized MESSAGE EXTENDED; sending REJECT ident unrecognized MESSAGE; sending REJECT %s: TAG reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: unexpected MESSAGE IN; sending DEVICE RESET 㿘>"x`>v"@6#"܀ 2">v#@6 0"x" >w @6Ր "&"ܒ `.""x >w" @6ɐ @" "x!>m  @6%  ."`  >w"ܐ X"@6 0"܀` >u#  @6%"x!>m  @6%  ."`  ""Đ 6"Ē`A3."" "Ԛ "Ԛ  ` ` `  ( ` ` ` `    `  @`?`"x"x!>m  @6U%Ő  ."`  0!">w  p@6E " &"  ""2 ` " *  @ "N>{"d* €"x">w@6  " 6  @` ">w @6 &" ! " $D" ( .""x">w"@5 "€ @"{ "x"L!2">w`  @5 "xb>w@5 "x! >m @5۔%  ."`  Ր   ,`    *  2    I   J*` ",J" ?*,J,I *W">w` !@5 " `."  ,  "`     `   `  2">w` !0@5|  , `&,"x"">w@5q!X""x">w !`@5g ""x">w@5_!p  $"`." !$ "x">w@5M!"$<"$D"x">w@5B!<&"D&""x">w" @55!" `  " `G"x">w ` `@5$!" ` O"x `,"   `,," "   `|"@|` >w@5!"`2  , `,"x >u#  @4&^"x!Z>m  T&^d @  @!-`@*`@*`" "Z@  ,`"* "@* &`,`"* "@* ,@6` >w!@4"`21  "@6 ",   ,  `,"x >u#  @4&{"x!>m  &{@4  ."`  ""Đ @`."6"Đ ," ."  `+ " @ ,`"* "@* &`""    2  "? "           ">w @4:"" ` 2L,  @, +@ " @Y ,`"* "@Q* &`""    2 `` "? "              ,@X` >w@3"("x"x"">w@3ِ"X@I` >w@3Ӑ"`"x >u#  @3˔&"x!>m  @3Ô&  ."`  ""Đ @c`" 2>w"`2 >w " U"  >w"@3 "x6"  C"@` >w#@3 "x >u#  @3&"x!>m  @3}&  ."`  ""Đ @` >u#  @3i&"x!>m  @3a&  ."`  ""Đ @` ."6""Ā "x!>m  @3H&ϐ  ."`  "x!>m  @38&  ."`  " ."&"܁tx0PPP[ncr53c9x_msgout(priq:%x, prevphase:%x)]%s at line %d: unexpected MESSAGE OUT phase %s at line %d: no nexus 㿐>"x`>{"Đ"@2"" @" "=""x!>m  @2Δ&  ."   6")&"Ѐ ">{"x >u"Ɛ# @2&"x!>m  @2&  ."`  ""Đ @"."@ 6"Đ#  @2&"Ѐ 2""Ą "ƒ    * 6"6"6"€&"@"""є ǀ""""s  "” """    " *"ȓ*`* "Ȓ`* "*  "* "`&"  ,  , " @ t ,`"* "@ l* &`"    2 "  "  `"?`"  `         ]"Ȗ    `"ȑ* *"Ȥ*`"*  "* I&"" >{#P @1'" ` "Ȑ 9*@ >{#P @1۔'+   I"* J"* (&"Д "Ȑ ."*@ ` *    ` , , *@   "Ȑ  *@ *@  "."*@"&"" 2""̐L""x!>m  @1'l  ."`  0V"@8  '"̔"П@  `   `  @2 "  ` "  `  "x!>m  @1U'u  ."`  "x! >m @1E'v  ."`    @[ncr53c9x_intr: state %d] %s: SCSI bus reset %s: nexus in reset state%s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: DMA error; resetting %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: SCSI bus parity error sync nego not completed! %s: unexpected disconnect; resetting sending REQUEST SENSE %s: waiting for SCSI Bus Reset to happen %s: target didn't identify <>%s: target didn't send tag: %d bytes in fifo [%d] backoff selector %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] selid=%2x %s: identify failed, state %d, intr %02x ncr53c9x: no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] %s: stray interrupt %s: ICCS: : [intr %x, stat %x, step %x] %s: can't get status, only %d bytes %s: STATUS_PHASE: msg %d %s: invalid state: %dncr53c9x no nexusMESSAGE_OUT_PHASE MESSAGE_IN_PHASE %s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] COMMAND_PHASE 0x%02x (%d) DATA_OUT_PHASE [%ld] DATA_IN_PHASE STATUS_PHASE %s: unexpected bus phase; resetting x>"x`>}"@/"0 @ 2 z  € . @€ " ` .  @€ .  @€  . `$`" @ 2! &"x >n "  @/Y  <  -& < @€  x! >m @/D'  ."   > " >} @/3"P^   >}"h@-  0@Y  @( @€  x! >m @/'  ."     "  2  "`,ے @"-""  ."ݰ ">}" ""@." @€   x! >m @.ؔ'  ."   Ґ " ` ." € "C  @?2  >} @."Ȑ    @ 2  2* " "& "`2"" >}" " #\ @.  2 >} #0  ?D#\@. B>} @.{#"`x >u#  @.p(@x!>m  @.h(@  ."`  ""Đ @` >u#  @.T(Bx!>m  @.L(B  ."`  ""Đ @`."6" ` ""6"x >} # @.0 ` @€  x!>m  @.!(J  ."`  x!>m  D@.(Q  D."`  D"?`q>"*` € ",`  *  ` 2  2 4 `8*`` " `"  "`  "@ @ `2" ">}@6` >}@-#` "*  `." ` ,`" 2>} @-# `>~@- ѐ>~@- @Y  W"`,Z& "?`h>"ؓ*` €>~ @- 0r "  >~@-} `>~@-x X""   € >~ @-h ?#>~  € @-\`Ȓ ?   "6"ƀ 6"6"."x >~@-E @ے $ " & &  $ `$ & " `.">~ @-( `SQ   $"" "" >~   "#\@- : ."x >~!8@- ` """`."x!>m  @,)  ."`   " " "" 2"" ."" >~  @,֐!H ) 0  2;>~2>~@+O!x`   *  `$>"ē*` €x!>m  @,)>  ."`   ! ` 2 " I 2">~X! >~S! ` x >u#  @@,)Mx!>m  @,)M  ."`  ""Đ @`@."6" ` D ",`,`" ." I`x >u# !@,a)Ux!>m  @,Y)U  ."`  ""Đ @:a >u#  @,E)Wx!>m  @,=)W  ."`  ""Đ @`x >u# !@,()Zx!>m  @, )Z  ."`  ""Đ @a."6"Đ t&"" " " @€  f @€   >~ !  #`#\@+ xa>m  @+)z  ."`  x >u#  @+ٔ){x!>m  @+є){  ."`  ""Ē`@ 6"."x!>m  @+)  ."`  !" !"䀠 >~  "  ` #\#`@+ !&"< &"D."u&" "P @+ xa >m @+)  ."    " W  `.">~ " @+k  "܀>~"@+a ""ܐ ?,H""Ԓ@x @ >~ #@+P >~ ! " $D" ( ."#@+< &"x!>m  @+3)ː  ."`  0>~#8 @+% T " 2>~2">~@)#P x  "2 @z @ >Đ hx! > h> hx @>~@*#h &"x @" >~@*# /" x 2"x!>m  @*֔)  ."`  "` ."x! >m @*Ô)  ."`  $ >~" 2 ">~ # @* """@ ߀ ."В`?   # @*  `&"> / @*@ @€  x!>m  @**  ."`  " X/@ &"&"`'"" @ `   `  @2 "  ` "  `  x!>m  @*<*#  ."`  x! >m @*,*&  ."`    @ @ǒ/x!>m  @***  ."`   &"x @>"@* 0x!>m  @)*0  ."   ""@8  "'" @*&">@)ې H" 2"x!>m  @)ϔ*9 ."   ""@8 ' "" @ &" >$  `   `  @2 "  ` "  `  x!>m  @)*F  ."`  x! >m`   @)u*P   ."   `   @N  @>@)[ X"`."x!>m  @)P*V  ."   &"@)D o+  ."쑐% @]"@e 2В@@@ '"@  ? @ 2 @]@*@$  (p   L4 $ddd㿘` 'А @&`&`  @ ;" !'!>"x >u#  @(*"x!>m  @(*  ."`  ""Ē`@ 6"."А"@@ #@'>GP >!PA'@#`@ >0 DMA active%s: timed out [ecb %p (flags 0x%x, dleft %x, stat %x)], AGAIN sync negotiation disabled p  `` *``@   €  @ > @> P ">#\  X#`#d" #h"#l"#p"#t" #x D#|@(M HH /d4 * % @  >@(< 琒 0!>@(5  $,4   " @>@( `  `*  $ H 0㿘> %"}H /d * %   H*`  `(6 2  2 4 `8*` " `"  "`  "@ @   `ґ*`H 0>!P*"@ @ C*`㿘 @€  . @€ " ` .  @€ .  @€  . `$`" @ 2! &">"x`>n "  @' leam7990_config: weird memory size %d: address %s %s: %d receive buffers, %d transmit buffers am7990_config: can't establish shutdownhook㿘@   DV >>>?#aL,"& & & 6 d& 0 ܐ & ܠ 0@9w@B!p 8&!p!p @!  @ @" !>@ @@@" >@ " >        &!t&!x!p@% !>!@A! @'!t>!x @'!0>>"8 @s &!`>@%|!`!t *&!!x *`&!*  * &!&!&!㿘H o*@ g@ H 0h d! 77! ! +`! *! + ! @ !  77ސ 0@7!l&!|!&!@!t3`7&!&!?* !l@!!x 3`77?* !7! !t 6!x  !, !l!@!3`: /7Ԑ7/7֒П !t f!x  0!, !l!@!3` /ː7/77Βȟ !x f㿘!0  %s: controller failed to initialize 㿘!0  = d!4`"!d@!d!0 a!!l  !0, 2!04    d!0  a" !,€ !"?!,€ !!0 !B d6 b @ ;6 d@ 0!8>!@% !8`@㿘 >  '> +> # 2G! H /f * ' V* 4@zI  ""8@ <"`<<8"`8"($@A $0,@4&0 ?6@-cȑH 0M@H /f * ' V* 4@y  ""8@ <"`<<8"`8"($@ $0,@4&0 ?6@cȑH 02l ; <!(" <㿐H /f * ' > ##@ H 0 #+> # 4 H /f * ' > l 2H p@  $ $ 4 $$ $ $ 2  @o{ 0 0 $ $ $  '􀦠>  l 8ܑH /f * ' c@ H 0  4 H /f * '   5 H p@  $ $$ 4   쀦1H /f * ' >  @o $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    ( ' $ 8 $ !$ $&@㿘%- 2 x |  & | X `& x @2 0@=%s: overflow %s: receive buffer error %s: dropping chained buffer 㿐!|; 2  >!@$5  >!@$.  | & |    >@$#! |` & |, !@*`  ! :/77 !t " !,  !  " @&!|%s: transmit buffer error %s: underflow %s: lost carrier %s: excessive collisions, tdr %d 㿐!X#>`@ ;>6 d @>#8@#ʒ  @>#X@# 0@hڐ0P!<`>@#h@# @  &   @#c `&   & ``  "   &   & !x " !?&!!  , ! ! `" d 0@&!! "6 b%s: memory error %s: receiver disabled %s: transmitter disabled 㿘!,€  ?L !0  !0  @   & ( | & | > @#(!pF'   > @#! |`8& |  $> @#! `+&   "Đ"" ( %s: device timeout 㿘>c @!  T` & Tmissing buffer, no_td = %d, last_td = %d 㿐 4 $@ @ha+>a,@a  ch 4d6 4a@"a ̀  @6    €  "=$a  & & $  ?& "1$a ( ",@0B,@a*`    6 20 /77a a0  Hax " a  $a 4$6 4$a㿘H /f * '  0@9K   H 00\a2@a1@5a @a@"4G 0!5@70 !6@3 0<4 44 ` @ɒ0.@  24А4 ?#44 2 @ڐ0@=@= 4*  !@ !D@^i H 0㿘㿘 4!9<6`6`6`6@ & @  *;n # ?  @?`   @2?26 @22*@  * @6@ 2  ؐ 4 = 6 4 4<"6 46@6`6`6`㿐!h'@㿐!h'㿐!h'@=diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK/dev/ksyms: Symbol table not valid. ELFfailed to allocate memory for /dev/ksyms 㿘> > 8a>@!P!@0N#> F>   @`  ` `(@ 2 > F"$a%!0"aܒah@)   )> F  > 8  " 0> 8!!%! @u #> F $a>@!!p0@!a"! ""> F"@"> F"!#!܁? 0   ` > F܀   㿘#`a `  > F@  !> F!a@ " !a"  " @8 @i ` > F> F   ` ј ` a  $ `$[ % `%V"G @K  I?`D 06@?  =?`8  6?`1  /? ` *  (?`#  !?`  ?`  ?`  ? ` "`""  "@0 @ ""`" `" ` " 㿘 `@2,  `@2'  `@2"  `@2 !?a @ 2  H`H@ ( 2  p`p@ ( 2 @4@ 㿘 l`l@2  p?`p @ 2  l  `@2 2  `@2  ` @2  $`$@2  (`(@2   ,`,@2   ,`,@2w  0`0@2r  4`4@2m  8`8@2h   <`<@2_   <`<@2W  @`@@2R  D`D@2M  H`H@2H   L`L@2?   L`L@27  P`P@22  T`T@2-  X`X@2(   \`\@2  \`\@2  ```@2  d`d@2   h`h@ @}@ 㿘 \`\@2  \  `@2 2  `@2w  ` @2r  $`$@2m  (`(@2h   ,`,@2_   ,`,@2W  0`0@2R  4`4@2M  8`8@2H   <`<@2?   <`<@27  @`@@22  D`D@2-  H`H@2(   L`L@2  L`L@2  P`P@2  T`T@2   X`X@ @@ 㿘 l`l@2  p`p@2  t`t@2  x`x@2  r  `@2 2  `@2  ` @2  $`$@2  (`(@2   ,`,@2   ,`,@2w  0`0@2r  4`4@2m  8`8@2h   <`<@2_   <`<@2W  @`@@2R  D`D@2M  H`H@2H   L`L@2?   L`L@27  P`P@22  T`T@2-  X`X@2(   \`\@2  \`\@2  ```@2  d`d@2   h`h@ @0@ `4`,"`,4" ,0"`4 , 0`8"`88 "`88 8`8 8 8`0`,"`,0" ,4"`0 , 4`8"`886 "`88 8`8 8 8㿘` >  @s!t &R  ( "`(" 8"`," 0C" 4  ܐ 4 "7`8 "`88  2,4 84t! 0 "`8?"`88??  2 0 8`V0|㿘` z  &S 4 "l`8?"`88 a?2a0 8`*0PP 4` 0 &" ,> !t@ E 0 2  4&"`,> !t@ 9  0@ 44` 4@  (@`( ("`(@ 0 "`8 "`88  24 84ِ 8` x ``2 ,?7`' 7 ' '`'7'7.2   > ` 4 `@[&*`4 > "p ''䀢' @*Gذ  2 ,  ,2 , 0 0 02 0 2 4" "  , 0 0 02 00 0  ," ,4" ,㿘!> $ 4 0  "0`B :0㿘   (pf: ERROR! insert invalid key already in tree_lan_ext key: proto = %u, lan = , ext = state: pf: ERROR! insert failed key already in tree_ext_gwy key: proto = %u, ext = , gwy = p x y / /  x7 0 @#> 7c'c> "`Ԁ4>@ݐ">@ڐ"  y>@֐"H@e>@ϐ"h@^>@Ȑ"x@ϐ>@Ð" x  cn '>  Ԁ`" x>@" x 0 y //Z @  x!> 7S ,!7!N $ Ԁ`1>@">@" y>@"@>@"@>@{"x@>@v"Ⱂ !! Ԁ`>@c"8̒`B ":8㿘H /`* !@, @(H 0>!P>@pf: ERROR: remove invalid! pf: ERROR: remove failed pf: ERROR: next not found p> a )>  (> %"l@  x/ ( y'> / ( `x` (7 ( `x`0 ( @#7 (  Ԁ`>@"( ##  Ԁ`>@ߐ"H (@2, x 2,  @2,$@2 ,(@, " ( (,@ y (> @E#1 (@'` '`a'` '`'`'`'`'` '`$L'a; Ⱀ Ԁ` >@"hⰐa:  @̒`B ":@ 2f (%u.%u.%u.%u:%u:%x[%u]㿘.`0V.`> ` !( 3`@]2`0K     * ` 2 ` " "@ $      *  %>)>    2 @&8  .@ !@8 @8  倢>!H@6`TCP UDP ICMP %u [lo=%lu high=%lu win=%u modulator=%u] %u:%u㿘 y " >  ">>">>@" @"  @ߐ"  y@ڐ"  i x!>"@Ґ , a x@̐ @ 0[ x!>" D H P@ L T X `@ \> b# @ RFSRPAU㿘  >@"  >@ @  >@ H  >@ P  >@ X  >@ ` >@~ hpftrplpfruleplpfnatplpfbinatplpfrdrplpfstateplpfsport㿐> >#\!ta  <  @  !>נ#> 6>#\"4a(!  @  > 6>#\!Pa8 t  @  > >#\!Ța@ `  @  > >#\"haP |  @  > >#aX#\   @ } > > xah#\   @ s > "0""0#`> `""8#> #P"#P"> "#X > !"!"> "! > #"#"`> `"## > !> '#> %> '> )> +> -> %""$#$b$$ $% %aD%> "!> 7"a0!>  H>@Qa>!P>]@]@%>  "c?  0  ?  0  pf: started pf: stopped > 7"`J 0`#@"`"@B0 @ "?  ' &@ "880. , @ "/' 0 @'0  0!`@ `@0` @` @06 @" `0D`@ `@ 0@  ?00` @` @60`'@30 `@-`@+0 p 0`#@!`" @0!`@0 `@`@ 0 06 @0 0D`@`@0 J 0 @"VHg0` @> %/&@ @> @>  - @ܐ@*!>  $ `@7> '`@> '  `@` @>   0@"`@"`@> % `@א`!@>  '@" @@" (@0 @ް 0!@> 10 @ "i> 0` @> 0 )@ Ű `"@`#@:>   @ ">  @"& @@"l& 0; @"%@> @  01 $@D06 @>  0D`@ 0? @`@S> '| `@0 @"&r "`Ȁ`"`k @ > %" `$`$`̀ _$`>@< 0Z"Ȁ`2T  Q">@. 0L#@#> '!> 6̀`""`"`""4@ 2c $c-&#@ 2( !> 6"4@ ̒ U!> 'c  @`"4`` 4`L@  $`@@+ $`@<b4L`  `@+ $`D1b4$`D  <`<`<`$``$`"@" # H /` * ! > a'> ' )> 5>  ()"`d 2 (c&" %"@$H 0#> 6̀`"`$ "@b4@ 20H /` * ! > "` "&  &> "&H 00> "@ 2 H /` * ! > "@``  ``̀`` 2`̀`   H 00Y4!H 00O   `)!> 6"4@  u!L@  $`@@*Ԑ $`@hL`  $`D`@*Ȑ $`D\b4  <`<`<`ؑH /`4* !  > ""@  > > b  @"@  2 ̀ 2  H 00 $ > a+3> 6  5> (`d""`d5 2( ̀`"" "` "`  "@b4@ 5(" "`$`$`"""` 2   В`$`$` "$ Ѐ`$`̐`"`"`"` $ $`5> " 4  ̀ @" &H p@0>  @'> #> 6`" "`"`"aP@   2 $l& @ 2g > 6!P@  9 tL " $ @) $ >   $ $ " E"`  H /` * ! > > "$>  #"$"" " H 0"#> 6`"`$ "@aP@  20H /` * ! > "$@` >  &``2> " &H 00" @ 2  H /` * ! > "$@      *    H 00 tH 00  `> 6!P@ U ސx tL@ $`@)> $`H /`4* !  > "$"@  > > b$  @"$@ R 2  2  H 00j   `"$ "` "`  "> 6!P@ ’'>  $`$`$`"$"` 2   `$`$` "$ `$``"`$`"` $ $`> " `"" H 0%>  @'> #> `" "`"`"a@ z  2 $& @ 2 > !Ȑ@  ,Ҕ `L " $ @( $  >   $ $ " "` H /` * ! > > #> ##"#"H 0#> `"`$ "@a@  20&H /` * ! > #@` >  &``2> #&H 00#@ 2  H /` * ! > #@      *    H 00X4 `H 00O  `> !Ȑ@ ud `L@ $`@'Ր j$`H /`4* !  > #"@  > > c  @#@  2  2  H 00   `" "` "`  "> !@ Y'>  `$`$`""` 2   `$`$` "$ `$``"``"` $ $`> #`"#H 0#@'> %#> `"#"`"`"bh@  #2 $&> %#@ 2 > "h@: Ði |L " $ @'# $ > %# $ $ "#u"`# >H /` * ! > > %!D> #!D"!@"H 0R#> `"`$ "@bh@  20?H /` * ! > !D@` >  &``2> !@&H 00!@@ 2  H /` * ! > !D@      *    H 00̔ |H 00  `> "h@   |L@  $`@&m $`@ 4ǰ H /`4* !  > !D"@  > > aD  @!D@  2  2  H 00   `"D "` "`  "> "h@'>  D`$`$`"D"` 2   `$`$` "$ `$``"`D`"` $ $`> !@`"!@H 0NH /` * ! > aЀ  ("`l 2 (> "" ̓H p@0+H /` * ! > ca=``( x 3`", y@+, x@  "0T x@@y 0 - " U(*@  U " $ lPR@ @ $ l;`2H 0&#@y ̰ H /` * !  $ d> %" l@ $ h$ l$ p$ tH 0 H /` * ! > a  ` `2 `( H 00 `H 0> %blp"@ &ls&p" p&p " H /` * ! > aТ  `H 0.`&M H /` * ! > a +.` '.` x> %"x`(  $@''"@'F v ``> %.`&H 00 @$ >> "#"ܔ 0" Ȑ ̒  @ $ $ $ $ РPI J/t`|/u@H 7ruIB`7pH ` "Ӱ `2      ` " `` `2B 2B 2 B 2B " B " @ " H /``* !` > a> c  ` x   6DH0B6F0   , 6FH@6D H 00e`8b  >А#*` "W&`8T >А#*` M&8J >А#X*  C&`8? >Г*`#X  @ܖ "2  * "+&> ("#H /` * ! > "@`   :`:`:``̀`2:`H 00H 0`   `+@ *`̔#`  `􀠠" `􀠠" "`  @`@2 "`  `2 "`  `2 "` `2 "` J@ ` H`H" 2<  H`H27  L`L22  P`P2-  T`T2(  X`X2  X`X2  \`\2  ```2  d`d2  l `l2  "`@ h`h2 @ m `m2@ "`J ` p`p" 2< p`p27 t`t22 x`x2- |`|2(  `2 `2 `2 `2 `2  `2 "`Ā"  `2  `2 "` ̀ `̀`  * *` *`+ 02 *?0" 0  ( (2 㿈` `@_^Z`6@`0P  *   2 66@ * . *  2 *  2 *  2 *  2 *  2 *  2  * 2 * ,/`2 2`2|6㿘&@64 p?c * 2  h6@㿈  V@* P2 * J2 * D2 * >2 *  82 *  22 * 2 ,6@x\l @`kؒ좔`2@, ` 6@/ @24  7@@4  ` 4* @2  4쁒  K *   2 5 *  2 0 *  ϑ2 *  ɑ2 *  Ñ2 *  2 *  2 *  2 *  2 4 4(  0@d ڑ* 2  d22@ ڑ* 2 ܑ* y2 ޑ* s2 * m2 *  g2 *  a2 * 2 [4㿘" < `  ( `   @`i   @U  @`p0@`s> #,`$`   $`$`@$`"```  , 4$  @$  - - -     ݔ  (`4@4 `  ` $ ` 2`` $,  c  $  0-@J44 @@ /*@@ $> aߐ,444     @D 0 ( @v4   `- -    @玚 㿘  @_ؔ   沐 @V  @_ܐ0@_ߐ 0 ` @_ 0`@Ɩ   `0&@@```` ` `  " ``@ `? ?=>P(**`03 *0@.@ **`0  *0@#!  (`? (@ **`@ **` `?**`@ **``? l0  *`0  2  2  㿘>  @ x 22`   "@" &"` 㿘  > !> 7!0.`2 > 2`""`"@x@+ 02㿘  > !S > 7!0.`.2`2   6 "?@  @z?@& @  @z?@$ ?&644*2`|6 "2644 *2`h6 " ɀ2 l㿘> "$@ 8  `@ p @"'  p "#  m``@2  l 2  n  ,   < o L "   `" ` `q  㿈 @  > c S  $   ]  \    j   , ^ <b 2) 2&  2"  ] 2  \ 2   LF   , ^ <> "   ` ` `_  㿘> !D@ L / 7  `@ v @"9  v "5  s``@2.  r 2(  t  ,  < u L "  n l    7  l@ @ 8   `" ` `x   l*` p2` ? 8 (2 x`  'H  'P  'X'7&H> -4    踔@ #`#\`m`L  g'@0?cQ R怢 h 薔 #`#\`K\-4 ` B )`w `7`p "77n 4#`#\``#`\H * 2P   L` `#`#\``ܶ > "@ " `B <   @ "  H "  `4@"   " n n @4 2 n 2( m4`` X `2 l X 2 l \ 2 l ` 2 l d " m l H X̙4 2 m m "  h j@ 2  @Г4 2 2( 4`` `2  2  2  2  "  p 4 2 g "   ` 2 Z ` 2T & 2M ̀ }`B : 蒂@ B ; 7> `B : P X@t4H(2P ` 2C ` ` : 2  `H` ` 4#`-3`#\`2  `H2 4#`-3`#\``Ș X4D 4 2`P ` 怢`yް  ڰ  2 `  2 ` `2` `€` >  2`X*`" " #@ 2 怢`O p  &d  !@ .|  2   .{.yH.x *.z Ô@6,0潔``6@`汔&& &6&&椔, 6 曔`60敔@`6@`抒6,慔6,`,2 @ &H&D ` 2&L %> % !>@v &LD` `e  &L%> %!> `  H &H ` "`H &H``*   .R.b6P&T&X6`&\"&h@ &l&p &tPX@=  x` `'P 'X'7 @&-4   p ``L#`#\p  j'0?cQ 怢  `#`#\M\-4   )`w 7`p "77Ŕ`  4#\#`#`\2P-    壔` `#\#`1 > "@ " `B <   @ "  "  `4@"   " n n @ d4 2 n 2( m4`` X `2 l X 2 l \ 2 l ` 2 l d " m l H X"4 2 m m "  h jK 2  @ &4 2 2( 4`` `2  2  2  2  "  p 4 2 h " &    2&[ 2U ̀ p`B :` @ B ; 7> `B :  P X@Ж4 .`28P `26 1 `` ``4-#\#`3````2`4 - #\#`3`( 4 P2`C  ` 怢`     >  > 2#` #@u 2 怢`i|  x &d  !@ .|  2   .{.y`.z".x 66,00`6@$&6, 6 606@`6,6, .R.b&D&H&L6P&T&X&\6`> %b> &h `&l&p1&t PX@  x`` 'H` `'P& ` 'X ' '܀ :H$ ` @`? ` /  H '` ? *`  /倢  'H A-4    㒔``> z"`]`L``k`L ` fv``> ^"`A\``\y  O'ܣ4  `  S``> ;"``\``,`\   &6``> "``* > H * 2P```+  '> "@ " `B <   @ "  H "  `4@"  `" n `@" n @ 4 2 n 2( 4`` X `2 l X 2 l \ 2 l ` 2 l d " l H X4 2  @ 4 2 2( @4`` `2  2  2  2  " @  p m4 2 @r  @ 2l `  @2d ` @2\ & 2U ̀ .`B :@ 蒂@ B ; 7> `B : ܀  `P@OX4H*`2P ` ܀  > > `#`p> #@3 2q &d  !@ .|  2  .{H ``.y.z.x 6,06@`"66 60۔`6@`ђ6,̐6,.R.b&D&H&L6P&T&X&\6`> %b> &h &l&p`&t܀  `P@X 㿀`  ` ` `9& ``  ᐔ``> l"`V L8 L` Zv``> R"`<\\ ``  Y``> 5"`\\J *> `  ;``> "` / > 2 䢘  ! > "@ " `B <   @ "  "  "  `" n`@" n " n` @ 2 n 2' `` X `2 l X 2 l \ 2 l ` 2 l d " l H`  X 2  " n`@ 2 n 2'&`` `2  2  2  2  "&  p` { 2&t & 2m ̀ $`B :@ 蒂@ B ; 7> `B : `  `D.`2  `  > > # n> #@e 2g &d  !@ .|  2  .{``.y.x.z06,0+6@ !!6660 6@6,6, .R.b&D&H&L6P&T&X&\6`> %b> &h &l&p`4&t pf: loose state match: seq=%lu ack=%lu len=%u ackskew=%d pkts=%d pf: BAD state: seq=%lu ack=%lu len=%u ackskew=%d pkts=%d dir=%s,%s inoutfwdrevpf: State failure on: %c %c %c %c | %c %c h`    / /ߡߝ`7 7> a> c㑒&`2 `z  @`D`T`D`T@ H  .@o $`  @ "  l  g   `@ `2  ` $@ ,```     ` , `  `  $`` 5 84`   ` "@@   ,  '  `@ `2   2   "  @`@#  @" @ ?"%}A!ۀ4z .p2` "pt "t` @ *4` @$ 4$@ @  $$   `  ,` " `  ,` "    2  ,  ,,` `     `> %b>$ ` > % ` > %b>` > %b>`> %> %b>b> "`l ? ? ` N?"% IA!@@ C> #`>@"H >`p"`@.p2` "pt "t` @ *4` @$ 4$@ @  $$   `  ,` Y ,V,`> #`( >@n"u >p"``"p>">"#\ z@ 2>>""#` @L`>"@  1  @ @  2 ?"% 3 A!ۀ  4 $ @  5 @   6 #\@$X @` x 2,  @`$@ `(@`, !` ,   #`#\G      #`#\; @  ` @  d" `B :d蒂@ B : h`  `` `/ /r`n``77> a> ca&`2 `z} @`D`T`D`T`p "`p`t "t `2  *  2  +    > %  b>b> "`l@` x 2,  @`$@ `(@`,  ` ,`  #\ ``#`  ` #\ ``#`@  d" `B :d@蒂@ B : pf: ICMP error message too short (ip) pf: ICMP error message too short (ip6) pf: ICMPv6 short opt pf: ICMP error message too short (tcp) pf: BAD ICMP state: seq=%lu pf: ICMP error message too short (udp) pf: ICMP error message too short (icmp) pf: ICMP error message too short (icmp6) pf: ICMP error message for bad proto `   : 0 @` `        *`    2    `//MI7`7> a> c?&`<>`p "`p> %t "t"@"l     2"     @ `$@`(@  `    0`  @     0  ` ђ `/΀`"(`rϬ`#\  @t  > #`>"p?@2  * /''M'#\p ( @Q  v> #`>"x> "/'''Ĩ`0#>π 3 < +" ,     2 ΐ#\h  @ iԀ kb0gh * /Ϩ π   Y> Q#ǀ :> K#P#\   @  > #`@><"آ( /M/L4R87H.P`7J> a> c$&`""  `z@`T`D`T`D`T "@T`  ` >  @" <> #`>@G#N>#@A    x 2 @`$@ `(@`,@"E``2,#`#d#\#l#h Δ#`#d#\#l#hR ΀  @  @ @  (@p Δh#\   @2  > #`~>z#( /%/$rj7 lh`7"> a> cb& _@`x 2 @`$@ `(@`,@:`2, #h#`n#d#\#l}Β #h#`n#d#\#llj΀   @  @  (@ pΔ#\   @  > #`>#P //7䀦`7> a> cԒ& ф@`x 2 @`$@ `(@`,@`2, #l#`#d#\#h  #l#`#d#\#h @  zΔ#\   @+  > #`w>s# //k7e`7> a> c[& X@`x 2 @`$@ `(@`,@3`2, #l#`#d#\#hw  #l#`#d#\#hg @  (p@@   `>#@K p  //7`7> a> c&`2 `z @`D`T`D`T`p "`pt "t `2  *  2  +    > %  b> b> "`l@` x 2,  @`$@ `(@`, ,`  " $     {`  "   l f` d" `B :d蒂@ B : 㿘\``)E * 2    277;  7`27@> `B (: @   !  @     *`  (   7` 7@> `B : @E㿀@ * /" @N`  `8  @a 0?"`8p'Ha`D'D  '沔 @C\   H `D'   * @ӻܸ /  /H'  `H@`2`t> (`L`T `"`T "`t4 `@0` 2' P< 81| , 2 4  > ( & `L`x "`x4 @6F4   @`> 8`ha, "a,> Òc`0 "`0  H@> (`L`L "`L" ?`  @" '@Ð ?# @& ' > (`LH /f * ' > ##@G H 0" 6H /f * ' > `l`  2` H p@ $ &6&&&& > '@#, &$$ $  $ $  #@6@C >` `**` $& %?Ȑ*:`@4  @ 4  & "@ 4 @4 @BC  >&&&|  ,    & x`&x4 @5t4 H &H fԴ $ @C&@44| , 24  > ( & `L`x "`x> (`L`< 7'ؐ "`<4 @5A4   & '@A4؀`H> (`L`D "`DH  D"ܔ@ ``8 ?"`8@AH@ x k`Da 2 `沔 @A  ^Y@" ܐ * / " "  "` $ "` 2 `` 2`` " a``"`" `""a `  @J  !@J    @9 0`<@  ` a@@a 2&0@@anon-M_PKTHDR is passed to pf_testpf: dropping packet with ip options > "`Ȩ  7' ' @J "j 2>@z" @'  7 *     7 ``B <`7  '''  // ? "   l@ؐ #\ '  f̢ܓ2`*`"" '#\ @* 2``7#\#` * `7 > #`#\Y 7 #\ ' ՘ *ؒ#\#` * `Y7 g> #`#\ژ [7 #\ '  @ f #\#` n* `7 d '`B : 蒂@ B ; + { (> #`#\ 7ɖ* `7`d' `{  > 7> #耦@ bਟ. ؕ. @ B *H; `B ; (  #  " |   "  !   7 b`B 7:Ԁ  >@" `. <#/7'2 Қ 2ʔ `"  a cpf: IPv6 short opt 0> " Ȭ  7''   @I  "p 2>@" ' M7 ``''/' `  `*  ( ? `$@ (/ 3 < +" , 2  /  * 7 `B <7#\Ж   Ѡ Ԁ >@ 7  `B < 7 А * /  K : p #\ ' V nĦܓ2`*`"" '#\ @-* 2``7#\#` ۚ* `+7 > #`#\Ꞙ z7 #\ '  1ؒ#\#` * `7`d'[ `{ X> #`#\ L7 #\ '  @ W #\#` * `7 d'`B : `+  `@ @ B 8 { > #`#\+ 7V7> #耦@  ` ``. * @. @ B + `x:@ `B :`. <#/7'2 F 2> `"  a wpffrentpffrag㿐#> cT>#\c   @F !> #>c#\   @; @뗒#c @뢖 > `"`" pf_purge_expired_fragments: expiring %p 㿘>  `> %`> "@ > " %> Ԁ @@E @  ( ԁpf_flush_fragments: trying to free > %d frents 㿘> "Ȥ,  @> #`> @$Ȁ@>  `  @Ȁ@  @ 㿘  %> #> ` "` "@< @Tb ? $b@9 `  * $* %` "`" `2 "2 pВ> ` > %"& `>  "` "  " &" "`"& p   >   / 7/''7Է `"  "`> "  "> #@鄒diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../net/pf_norm.cfrep != NULL || frea != NULLpf_reassemble: overlap -%d pf_reassemble: adjust overlap %d pf_reassemble: missing fragment at %d, next %d, max %d pf_reassemble: %d < %d? frent != NULLpf_reassemble: drop: too big: %d pf_reassemble: complete: %p(%d) p   *  `  "@ & ?& > #@J  2 .`@B  "> .`6`> %` &``&`  ` .``6`&`&`>   ө> ` `&@" "`"&` -` -   2` ` @ `  @ (`` `>>>#0c@@!)2 2@>, c`" ``` ",2`@`  @>> #`>#@@" 44 >- - 2   @ 5> "7>1>   Ԁ"@,`2`@ ,`2 @ "@;U `"  "` "@> @W#T"Ƞ?` &"`4  4 `5@*6```` .`2 @` &`" &`` & &@" %@&`  ```)-> *2`  *`2 @  `` @  Ԁ``>#` ?  @u2 `2` Ԁ - >` (@f4`4 r `2 >>>#0c@H@Ô!v? c *  $   Ԁ > X@E ؐR !> @=&@#T> bȴ?"bȠ  @@紐T"Ȓ?$"@= `2 `$ ` $ *  4    "@ &  &   @&  Ԁ`> @0> #T@@:n pf_normalize_ip: IP_DF pf_normalize_ip: mff and %d pf_normalize_ip: max packet %d pf_normalize_ip: reass frag %d @ %d pf_normalize_ip: dropping bad fragment 㿘> "` @ *` 2`* * ̀ " @ "  "   "  `" X ` @" X   H l X` !  2     p  `    Ā `- `j`!`@ > "`Ԁ}>@T#Py`*`"4``4`> "`Ԁi*>#h@>2`c`    * 2  U%> > #T@ > @  >  6> (`B ]:(b>  "b& & >`#@5i G&`2D "`4` 4` ! `6 ` *2,`0  6>  `B : `Ԁ  >@Ԑ#Ѐ d 6``B <`    .`2  㿐> " \ @   " @ "  "  "  `" n @" n~ " n 6 2u n 2' m  X " m 2 l X 2 l \ 2 l ` 2 l d " m l H  X 2 mL "  h j@ 2 @ "  " 5 ̀ 2'  " 2  2  2  2  "  pⵔ 2   Ā "   ` 2 Ȁ 2` 2 ` `   E> 2    <> 2 ` 6> ( 2> ` 2` , 2` @ ` ,` ` *`*$` `2``  4`  ``` `` 4`4` `@z  > "  B:  7  . 2 ՘  redcbqnoq㿘?2  @ > ( >  #h+   㿘?2  @ > ( >  #h+   㿘?2  @?0!@ 0!@!2 @* 2@0!@ !@ 030!@ 0-@   &&@  @@  @v > ( >  #h*  @diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘@   ``"`  "  2  " " " " $" (" ,\" 0`" 4   "  "  " " " " $" (" ," 0" 4 㿘   > 2< H /f     ! * '   2 ,@7  ` ` && "` ?& `  0`& & H 0 㿘  6H /f     ! * '   2 ,@6ɐ ` ` && "` ?& `  ?& H p@ altq assertion "%s" failed: file "%s", line %d altq assertion㿘>"H@>@Ꟑ"x㿐``8 ( "d`  4``  8P @ > !h" : 3`+ @+` b 2**@ b 2`* *` B 2**@ ;C3`+  +`   d 4 2   (  @-   B<    4  2 <   @(<  < <   4 `,   8`0& `(€`@ `  $@$`& `?$`  `2 $ (   @ c < $ (tbr_set: no cpu clock available! 㿐#>`T 2 @@`T 2@>@m ~  2  0 8 2& 8u [ @ k @ 0@2 `T   @. <`   <  ?  ? @< ?<  @< > !h " : 0(@(b2*@ *@ b 2`*  *`@C+ 3`+`@ ;B 2`*  *`< $ ( 8 & 8@R  !> 4  >Ѱ 8 `>ÒcX@b @s $ 4 㿘 H /f4> '* '> '#Ȁ   ̀ "   ` `" @  2 ̑H 0`>Ѡ 8 `>ÒcX@& @7 0>" 4㿘 8 >&`&@ T 2`* @ *`@&@ &` 㿘``" 0^. < @@ U 0.. p. . && @JF &6=6  ..?.*`*  2 .** *`@  * && &$&(&,&& &$ &" &  )(& @X  6 6 .. 㿘66 &`?@@Q>  ";  @ * @@: "/ @  &@  * @`   "   @   2 .   6 .6   @@ " 2 2Y @* @:M `"@ (@  @"@ @` 8 `<4>ń(  2 *(2 2* " * `   *" ( ƒ  (@* 44Xȝ㿘`   l  l @  @ l`c) X`$` %!  2 4$ 4 2 ?$ 4 2 8$ 8 2 ?$ 8  4 @   8$  ~$ 2~   2 4  2 4  2  4 2 4>;!!Ȁ 2 $ 8 2 $ < 2 $ @ 2  $>;""` $ 4`$ @`$ 8$ < $ 2 D ( 2 D , 2  D 0 2 D>;!!Ȁ   H  $ L  D P  >;""` $ D`$ P`$ H$ L  $ D  4   *$      *$  `22`!@:  @$` @,@&$`H /f * ' . ` ``   @``2 ` $@"  "` $` $@" "$`H 0 `  &㿘@Ԓ  H /f * ' `"`"H  @j  㿘H /f * '  *``` 2 2`"  "` "@@@  뀦 2`aݑ*`H 02& h?ɀ`F ` `N$`` ``@Ĕ 2Y`@`2`S 2`$`M ``@ 2F`@`2`@ 2  :  . ```@3 2.`@`2`&!.ɀ 2! ``2`@:   !. ```@ 2 `@`2`!  `8 `2: ` 22  `4`(  `8`   `   @  `< `@   `   `2  `2  `      `    `      `<  `@  㿘`S `2U `2M ` 2D ` 2;  `$ `D !   ``4    `T`   `   *`>`P` `P*`    #  2`P 2`( "    2   " 0[2 2 2  2 2 2 2@ @0>2!2"2$2 $2$ "$$$2((2 (,2(0"(  㿘> F!耢`@Q @n 2  *  "  " `2 ` 2 `" 㿘> F$! @2  @2 @2 @26`6` &`   @[   " J 2  ip4f_init: can't alloc %dth entry! 㿘> F!"!"`  #>ɒ  <@  2 *`@劐`x  ?  "@ "`"  $  > F@` `"`@  *`耠"@  ""` @> F` `! `@ *`"@! "`  " `! ` 2; `     * :  "`!  `<@  `` @ `*  `(( `2 2 2 `b``[ `     * : `B"`$``<8  0?8  ( 8882 *` *  (( 2  *(000****altq: emulate %uHz cpu clock 㿘>!P!А>" T@>"`X>ʐ @䁒 㿘>Ѡ `   @*  " ` 㿐0! @   !2@8  a@! a@/ !@" 0 !@Ԑa@ 00! @ E  ۰  װ;  Ѱ  Ͱ@  ư  @w @Ò   @n ' @      @  '  @M @J    ' "@  <"   "` >"  >>͖Ș!Tb0#\#`   >@4  @( @% 0~``'{"``ߒ  u @q &  &D   (:& H> P>  X>( `>0 h&8 l&< p&@ &H &L &P &X&T&\&h&`K&d  2 D H /f * ' @b @& " & @ ' H 0&   &  &  &  " (@U$   >>># d"h"`lred_detach: no state found in red_list! 㿘 ` ؐ y  >``2"``` @2@"@`>@)!@}  @q @n invalid weight value %d for red! use %d 㿘 x @k ^ @ x $ 0 $ ("$ $ `2$ > l$ 2$ > d$ 2$ > h$ `$ # $$ 2 @"@ 1!+ @4  $    <>    * $ >ː"@Ô$     *  * *`" $ _4$ *  @$ $$ 8@9㿘@ 8@   (:"@ H:` P:` X:` `:`  h"`( l"`, p"`0㿘  @     $  7㿐 0 # (@& 0 <"@<* "@ *`"  @*  " * @ ?`$ `@ 8^ّ< `  * <  ,"  & ( )& ,` $&& 4 & 4   $  & 4& , $@U: `  @\ "   p& , & p & 4````@6 ``@`"`&"``&@ &```2 h l & l & h X`B > X ` ; @ B > `& ,@,p? H`B > H P @ ; B > P 㿘^_&@`$ ^@@ `"c ``2\ `     * : `B"`` 0=:<`@24 `/. ` *`< 2`  ` @ `*  `(( `22  222*`*`*@*`  㿘`         @   ?$ 㿘@`  ` "&@"`` ?&`" 2 "00   "0@Ő< 㿘` @ 㿘 @+ `2`  "$"`  ?$ "`   2& wtab_alloc: malloc failed!㿘> p   "  2   @R  >@x"а $$ @ `p $$ $ ?$`p@* $    ?]X: &  2`,$ `` 㿘 ? & >`p2 "`p@ 2@"@@  㿘`@ `1`  @,`]: .@``, cbq_add_class: no parent class! cbq_add_class: borrow class != parent 㿘  2 * 8'   8#  (@ ,@   4@>  >ΐ @U @=㿘W  2  @Ȑ "  @ 2   !$@㿐;   @ 8 "  0 #\   @@ $   㿀`$< @@"4`" l @@" d 2b  Ԁ 2^  ? Ѐ 2X ? 2S ? @   *`2 > ?$> ̖#h #\ #d#`@  >#\#p #`#d #l#h@  2&`8  "?" ?"&  & Б, "@ 㿘`@i "&  `0  `0& & .` "@ "  `0 `     *`  㿘k  2   ܐ  l  !$ 㿘U  "  !$㿘H   @㿘!$     ,``" ``@  "@``$  ؀`"  `@ 2 v&  Ѐ`"  `@ 2 k&  Ԁ` `@ `& Ԁɤ  㿘` @ No Root Class for %s No Default Class for %s No Control Class for %s 㿘ܒ   5 `/`0 Ԁ   Ѐ ` ؀ `2 >ϐ#p@ް Ѐ 2 >ϐ#@ި ؀  >ϐ#@ޠ   ̰ "$ 0+ ̰㿘`> `> `> `> `& (`& ,`& 0`& 4` & `& 8`(& <`,& @`0& D@ & H`& L`& P@ & T`$& X@` & \@` `\ `㾐g   > ` 9 5 `"``""  ?'?'?',  4%, `" ' Ve!  `@ р`%㿐@ϐ "C  %,=  @b 5 @%,! @ $ @T $ @? $ @$!$>Ɣ c#\#` $ >>>ϖ!cL$   2 > x " x$@ @ 㿘ג   :  ؀`" # Ѐ`"  Ԁ` >`x"`x"  "`" @`"@ @ܒ @ْ  㿘` 2& ` & ``@6 2    `$ `  $` `C >B> >  7㿘  @j  `  $  @r& 㿘      `    4$@㿘  , @  @| $    2&  %s㿈>`x  #>`x ̒b @<B  "`x 2 ́㿘0! @!2 @ W @ A a@+ a@?a@? 0Ba@!a@1 0:0!@ " !  @0! @* 0*@0! @  0" 0 0Y0l040d0}0 m0 0ؐ0Brmc_newclass: RIO not configured for CBQ! 㿘 p`>@܉   ؒ @ߔ @+ ؐ @(   @Ӕ $@  @ \ $ L沒$ P$ $ "$ @@$ <$ $ $ 8$ "d"` "X$ d & :  $ ,$ ,`Xǒ2  $ ($ ( (h$ $X2  $ 0$ 0`$ T`  `2lX@#而`     $ \" H /f * ' . ` @ $ H H H H 2 H& H"@$ H P `@'`<$ D'`@@`  ``` " @ @S"H 0㿘  H /f * ' 沒@?"& & 8& "`XA2  & ,& ,X92  & ( & ( (& $X.2  & 0 & 0     *  "@ @ # H 0 㿘   ,  `  %@X @%@     $ @ $  H 2 ړ, `*`    P"       @2 "  4D2 `"  P 2 @㿘`4 @ߐ`H /f * ' @i`P @ `D  "@`P "`<2  @ `D`P"`@"D&`D `D`@`* `" `H@ `H`H`H2`H"`H`*  @2 `H# #   `*` ` "@ # `*@ 9#@ `PH 0`\ @ ` @@ @ rmc_init: root class not allocated 㿀h@P! 4  <4  `&` &`&`&`&`&` &`W@#* W &`&%b  & : &` &``ؠ`܆`Ԅ`````@`   "" " " "  &`&`  " " "  \>#``d#d#h̘#\#l#p  &`>@J H0" 㿐`   @Ȣ`? 쀣 + l  p   4  L 4$  L  "  쀣6l& $ p 6L 4L$ @ `, @@  "@   @  @;?㿘  ,`"@ 2 H  , & 㿘 "- @l &( `p@6    2@4   8     ے "  D  㿘 ``ԑ* "@ PK 4  l@ &D ` p@ $= @J & l7& 4. @!  `쀢@ "# |$,@" # |` #  T€  l  & L` p@ $ L ``* "@ _rmc_wrr_dequeue_next㿐@ ծ       l  "c&   ԑ* &  "@ @   6  `8  `4 @$  `"$  l g  ` 8`6  * %2$  L 2$  HՀ`2Ϣ Ǧ`"     쀢 6  &  `& 쀥`R   *  L% L & 쀦B@ 2>@P! `2 , @@ ?"@  `$ `"@$  @2    H* " * "@  ؑ* "  `*`"  * " "   @ & `&@ِ& _rmc_prr_dequeue_next㿐@     K&   ԑ* &  "@ @     `" H l 2 -`2 H L 2 H2ߨ?`"     쀢 6  &  `& 쀥`>   *  L&@ L & 쀦.@V 2>@֨ ` , @@?"@ H "@  ؑ* "  *`"  * " "   @ & `&@E& 㿘 @&   g㿘  ؑ* @`  `` <B`C <`<` ,  ,   TA< <  <     = 4;    "@2 А"@@А"@@ @ 6И"?@ . ?/!  @ @$& И"?@ &   ?/!  `& & Ж"?@& @   ?/!  @ @& & `sд"@? `x `t " 2  $``($`$`Sǐ<< `$@<@ ; $$ $`$`,6+ $`$+ # : @@ $`l?/!?@@ $`l`$`p $``( @4`4$`$ $`l@ː`$`4`@" `̐ $` $`t `P$`x  $`h`` <B`C <`<``P`2  *   쀢  @ `l  p  6 & 쀢 4& ސ  * ' *`%   @ & &㿘 @Ԑ ` @ * "㿘   `@@!# `2`  "$"`  ?$ "` *`@ ?$@ 㿘 И &  p  l |@ " ``2 А"@@А"@@ 4 7 " 0 0 h>Ȗ"  pВ@ "?@  @ ?/! l @ @& l& p T  ԑ* `@& 4& @l4 l   >ؒb @@㿘 H /f4 4* ' 4  & l& 4@Ѐ`@H 0rmc_root_overlimit㿘>@Ԕ"㿘` 2 d ` \  ` `"`&`"` & &  㿘`2`  "&"`  ?& "`@ P 㿘` 2@u \2  ""@"` ?"`" diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿐@Sb.`? ?*@   .   ` 2 㿐  + >@SJdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKa.out[ %s symbol table has bad start address %p ] [ %s symbol table has bad string table address %p ] [ %s a.out symbol table not valid ] [ %s has bad a.out string table index (0x%x) ] [ using %ld bytes of %s a.out symbol table ] 㿘@`` >ِ! @ > F  "!>ِ"@5 @ > F   ?  ">ِ"H@$ @#>bp@ْ  *  @ ?>ْ&"@Ŕ 㿘``: `" ` `"   2   @ _  * 㿘 < `24 `"0 ", "'  @ "&@`2 `  2 "  2 `"  *  2&& @ " "`"gcc_compiled.㿘 ? ? A ->   "?`"   " J g2  @J 2 ??   d D ': `    2    ': T  * `` && ???㿘`D ?` $28  4 :/# 2+#@6(#1>` #X  H:2H:"(: # @&# *  㿘  ?`"8   "3  2. > F a*`  ?`>ې!*` € @* * * + * -* /**"    _@ *mmTm$mTm0mTm<mTmTmTmTmTmTmTmTmTmTmTmTmTmTmTmTmTmTmTmTmTmHdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKAll breakpoints used. 㿘>` "> "``> ">ې "`@" >"  Already set. Too many breakpoints. 㿘@< >@#0 >>@א#0 `""" """"`Not set. 㿘>Ѣ @ @ "  2  $@ >@Ұ#0㿘> " @ϒ "  2  2 㿘@Ґ㿘>`  >  #$t@     $    `   $㿘>`  > "$`@      $`㿘B    & & & && & $t ֒ 0>@9# 㿘   9No breakpoints set Map Count Address %s%p %5d * 㿘!> >>@ " 0@ "8 >ܤ"X#>@B ">>"h"p@  @ @bx  㿘@+!㿘" @!㿘  >@"  `   >diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘@ s @ @ "  JK2 ` 2"  `@2@%-12s㿘  !>@o @    2? No such command Ambiguous Bad modifier Count missing @ !  > "'t'x'|r/   @ 0>W!@`|#> %%>!>ݒc|  | DHB!``@ c`| `C|@@ >&!p> %c@0@ΐ /@_x x> > 6"`h"4 > "4 'x@ @Jt  |>ݐ!@@@ ?'t| `|1|  & xt| a> `> "> ">  "b4A@> "4> "b؁㿘N> f`?@#́Malloc debugging not enabled. 㿘>@З H㿘N> f`?@$́㿘N> f`?@$́㿘@㿘>@,́㿘>@@\"́calloutprocswatchesuvmexpregisterspoolpageobjectmapmallocextentsbreaksallpoweroffreboothaltdumpcrashsynchangmanhelpbootshowpscalltracematchnextuntilccontinuesstepwatchdwatchbreakddeletewwritesetsearchxexamineprintmachine>с 㿘>" ddb> 㿈> at> b4'> > > "b#""M#at> b܀ )>'>%>#>!>@  "$@ې"$@ؐ@yc"> "܀`> "!t㿘 @@> LatBad function Too many arguments Argument missing %#n P@Ā  >)#@uĀ (@Ȁ   >@  `@` ` @X@Y  >!@#>ߐ @{@Xt`  ȑ,``` "@#\#`#d#h؟Āܒ>@\ 㿘@(㿘@)㿘@)㿘@( 㿘@(㿘@ diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘J@ !>@#耦" #@: = 0x%lx %-*lr%-*lx%-*lz%-*ld%-*lu%-*lo%c\%03o㿘 > L@  `@   @  >@Ԑ"> "b`1`>"@*` €        >ߐ"@θ`-  >ߐ"@Ϋt`   >ߐ"@Ξg`  >ߐ"@ΑZ`  >ߐ#@΄M`  >ߐ#@w@`  >ߐ#@j3` ߔ  ^ >@\#%`>@W#  ` ` ^8>>@L#@H#    0   @P`@X "L@@XL@O6E> ""؁40d%*r%*x%*z%*d%*u%*o 㿘N >* ` `?* : `6*`> X €@  ->>#>#>#@Ò  >># >#(@͹ >>#0@Ͳ >  ^8>>@ͨ#>@ͤ# >@͡#8DDDDDDDDDDDDDDDDDD㿘@ 6 >@~"А@P  @(*` Bad modifier bhlAddress missing Value missing Count missing 㿈@' $ @" "> %>?!#>a(@y > a0@q >  @ia8 > @@ >!@@ >!X@ ?'@  @t쀢  >!h@ @0@?'a@㿘!>    ?> ""g 2$"؁diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKSymbol not found Syntax error 㿘@  > %#@ - < >3# > ! > "4 >  " > " > 6 h $ @ @ @ >#@W ># @J 㿘@H   2>#  $ 2># Ҕ $ @"Divide by 0 㿐ϐ / 0=  >q#   >e!  @h'@' '@Z?H'@? π ̀ @ؐ $@㿐 % @? !>  %#  " @'? @ $@Negative shift amount 㿐̐ , @?  #>!> c  #x * 2 @}'? @s $㿘̐diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘 N@  1c "@$c> -b c*`: @.@"`"@*@ې c "֒"@ ""$"㿘!> 1%> - ##> 7Ӑ"# `4ΐ"`4$$#^R 㿘`~>"*` €1> 1> 7 4#@ ( @䤐 #?&#1> 1> -#b􀢀:ܰ @J# &#> 1> 7#4 ͪ @䈐 #`4? &#ð > -> 1"􀢀  #@uJ@#"  &# > 1> 7#4  J   n `4@ J  0> 1> 7c4 [  > 1> -c 0> 1#> -b􀢀|" H y j 0u> 7 41> 1#` m J *#@%*@# #@ J#@J^ >l> 1#耢@  "l#>`h $ l> h'>Ґp@%> 1+> 7)> -1> 1`l  ? $ l$ l lJ``l) lp@`h#` @$ l$ l`4$v%"#` @$ l`$ l`4 l%"J`e `b*@h`#bJ  S">> l p@  J@ > h> 1c  `l  "l# l l " lJ l lp>h> 1#@  $ l $ l+> 7 lp)> -`4%> 1%"J`  b*@h`#bJ  "$`4"c"@ >"] 1> -> 7 4"@( T"@> 1" Z"  >> l t+> 7 )> -4'>`4"@  K`"KK@@2K> h> 1c"   " `@" KK"KK@" K `4"@ "p`$ l+@%"Y `4"􀢀 p #t> 1#>҄ p *h  # p$p pp* $pp "$ l* 0%"> -> " @ % ^ > 1   * 8 *"`$@%"""@" Œ"  HH|HHHHH\H0$HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH㿘@> 7> -> > 1  "#"c""4@v @k "*"`4"@㿘@  0 @    ?diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘> !x x > )> %"bp"а > x> )> % p"!>x > ) x> %p@?J@`"Ё>ҁ x>ҁ |㿘>`| "`|@$㿘>>" x"`|Bad character in number Bad escape String too long Bad character 㿘0? ?߀ ] ?Ѐ ` 0 >  O o T  t X   x>  > "! DU$ /  9 7 0 ?Ѐ ? ?  ?Ѐ ` @?4ޢ??Ѐ  ? ?  _>ΐ"pa ?  ?  _ \C > % \ #< ?2,>",> & p %>#>+? ?  ?Ѐ  _ \ :2, \2 , ?2,, b0H `??*`>" €> <  .4 0 . , * ( & $ "       <   >  Ӑ>@"?l\<d4DLT$t,diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘>> `@ > @֐@C  @@$@ @  `@>$--db_more-- 㿘>J` `#> %>L@ L @ߚ c"$` q ` ?`?$`$` $`L  L@ɠ L n 㿘> ` >  ??߀ ] !>@ߩ> >`" @ `@ߚ >`$  "`$``($  @ߍ >>Ґ >""f"`0 !>#> `@1B{  $` >` "`@k >ҁ 㿘> >"@ >@ϐ#hdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK%-12s%#*ln %s+%#lr 㿈> 9> 9" `P 1#>@* @ř`@ @" 쀢>" >􀢀  >@ł `">>@{ >@x (  Ւ> 7b@`diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK [after %6d] 㿘@<  " @ ? "  " &@8  >  `& & > &@#   &"$ > 7`0? "`0> ( 8`>@!>@ !    " x  㿘> #     # e > 6`P #`P# ` M  $#M@>    、   Jp"  > > 7> (> 6> > > 0" 8 #c"P"|##㿘N> p`? 3> (5> 67> 9> >  #&`8 &P&|'#㿘N p`?3>  ;> > (5> 67> 9> > &c 8 'c&P&|'#Jc>    > 6> > >   " P"c|"diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKbsd[ %s symbol table has bad start address %p ] [ no symbol table formats found ] 㿘> > 8a>ꀌ!p>!x@B0>!!`'> #$@$㸒@&    2>$@)!No slots left for %s symbol table㿘>Җ  @   ``+``2`` >ࠑ+`` #`"`""@ "p@?Unable to find symbol table slot for %s.㿘>Ң   , @ " @ 2  >#(@ʒ0 >Ґ ,  "  "  # " 㿐@H > F"@* *`` :*  **`'􀢠"㿘@ђ 2N    @Œ`?㿘@'D @D  invalid symbol table name㿘N  %>Ҫ ->L : , ` ,`@`"`@ 2`` :`,L 䀢 :@6 >Ґ ,`@%>   @N `$`@  %s%s %s 㿘@L`@"L  2L@> 2L` F>>"@ 0" @Sifting table %s: 㿐N  %>Ҫ ->L@ :`,@  , @`" @ 2   : ,@L@ 䀢 :'', >Ҥ $ @)>'>`" `@Ð"$@!`? 㿐>! `  @; >Ұ     @  ` `  㿐> ?>Ҧ   '"c   @@:` %#`` &㿐 !> &@#@ #&@&%s+%#r [%s:%d]%#ln㿀>! .Д#>"@ 쀢 > @1!x``>@*!`@䀢  >!@0>!@㿘> c@L㿘> c@U㿘> ##   㿘> ## €㿘> ##   㿘> ##  㿘> ##` `@㿘> ##   㿘> ##diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKAfter %d instructions (%d loads, %d stores), Breakpoint at Watchpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! 㿐 ' > 7 '> 7"@ 4> 6 P` >@" > |> >@! >>@! "@@!@"@`> "4> #0`' ">>@!P>@!X>@!"@ diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKlinestabstopsmaxwidthmaxoffradixUnknown variable 㿘 *>>>"Db  #> %@c D *> 9> 9" `P #> %@֐c  &   *>̐# 㿐̐ @  㿐'D @D  㿘  &@ 㿘  @"@ No value ? 㿐$ ># >}#  >n!p >g!ƒdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKAll watchpoints used. 㿘>bP "> "bPbL> '"> "bL@" >P"  PNo map. Already set. Too many watchpoints. 㿘 >>@ؐ# 0,"T @ "   2  > 2  T>@#@0 @#00 @$ $$ $ >$T""HNot set. 㿘>"T "Tʒ "  8   @ $@0   2>@ 0No watchpoints set Map Address Size %s%p %8lx %lx * 㿘!>"T >>@c 0@` "T >!%>#> a   @M#  㿘톐㿐  wU㿘㿘>bH  >"T > # #>   8  ` @  2 $H>ҁ H㿘>"T $ > #( "   @: 8 8    @* 2` >""H diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKUnknown size %#8n = %#8n Nothing written. 㿐N h  l  b> #>#   ʶ?'> %> < >@  ސ  2&> &$$؁diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿐`b ?`\>#0*` €>Ґ >Ґ  >Ґ >Ґ @=!>#'@ 2 / #> 7"`$ $#! !>#'@    #> 7"` $#  -<¬diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK@#@#` () 㿘>J"X`"X>Ң" А  *`: ?Ѐ4 L@: @0 L 2 L !   ` 8L ` *: @: J - -L@  L  >@{#РL   a`_2 @ L   >@g#؁ Score: %lu/%lu 㿘N s > FN`/`94> F> F"#$> F "c$@ 㿐>"/> F`p-> F #>Ғ -* **> F `#$`*> F% #  , `2  E @-F`@:* >"@c'p $2 - @-.@"'^> J :$J    8 $J 2  &b > 7a` "a`b@  `    8+`: J`-/b   *`:  "  :  2 J   > F8?" *@ "8 _* ?% > F#`; %> 7 #>(!> > F#$`"bJ  > F  ` 8 ` c*: ?*: ? + J  b a@`@I$ &b `?  @*@`  `*``  @*@`  @ `*`*@`  @ `*`*@`  ` @*@*``㿘㿘ܔ@ * @*`*@@ * @*@*`  `(`  @(`@ * @*`*@@ * @*`*`*@*`@ * @*@*`*`*`@ * @*`*`*`*@@ * @*@*`*`*`@ * @*@*`@ * @*`*`*`*@@ * @*@*`*`*`@ * @*`*`*@*`@ * @*@*`*`*`㿘㿘Дdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapcdlinemicheadphonesspeakeraudio`? audio: missing method audio: could not allocate play buffer audio: could not allocate record buffer recordmonitorsourceoutputmaster`>@#?> ;> 7> 3> />$ 2(` '>( 2,d >, >0 >8 >@ >D  >H >\ `>@m#&`4&`8&`4&`0 @ @ >&`4@]#0`h @@  @ >&`4@M#0>&` &`  &` ?&` ?&a &a&a &a  &a &a &a .`@&a@ؒ @@@֐&a0&a8.a<&a@&at&a|.a&a&a'  >`@7̀ "  >`@,̀ "Ȑ 'H€ >>Ҹ"b'/>->+>)>"!> a0#\ @#\at`(@ 0䀢 Ȑ@  &aȐ 'H€ ``""!  - auddetaudiodetach: %s didn't detach 㿘 &!@  d@  `H /d * % !? &!>!P>*`" (*! @ > 0@ H 0@M @J h> 7! @ 6 > 2 >b|    `@ , 2` @G@   @G;   @G6   @G0  h' @n  Ȑ ' 4 H€ 0 ̰?㿘\@S &`@K ~ ?  &@@ 6 ( @**@``$, @@/ 2(`@ * %`*`$ ``4*" &``  &`(`@ *@`2( =.` ; &@@ 5( @**@``$, @@ 2(`@ * %`*`$ p``4*" &``  &`(`@ *@`2(audio_attach_mi: NULL 㿈  >''$'@U >@  oplmpuaudioprint: unknown type %d%s at %s㿘` ">  "> >">> #  @ >@[! 㿘 0 4" T &@ L` @ &`   @r &` `   㿘 4 P  0` 0` @ts 㿘?2  @>Ґ @ +`@ "- ! " 4'  2!"  `$!`  ``2  @Ò@!? $!@E!㿘     0    0 @@ 㿘?2  @>Ґc   c*@ 2!&  "!!   `$!`  ``   !@ !? $!@!㿘?2  @>Ґc   c*@ 2!&  "!!   `$!`  ``   !@ !? $!@!㿘?2  @>Ґ @ +`@ 2!'  "!"  `$!`  ``2  @q@!? $!@s!㿘?2  @>Ґc   c*@ 2!"  "!   `$!`  ``@i !? $!@<!㿘?2  @>Ґ  `  + @ "$?! "!? ` `$!` ?``@{?!? $!@!㿘 `$ @ʐ @Ò  ? & & 3&  . ;@& & & & (& 0. 8. 9. :㿘 4ِ h  =   t x 0" Ő &  "  = "     0"  `` ("`Ȅ8"``""``"```  "`audio_open: 0 precision  r `< n `4€`0 f&`X&``&`d.`&`.`.`&a &a(&a, `<  .`< `<` .`<2a>&a&a &a &a&a&a&`&`&` &`&a&aa >` p>@"0&   @a'a 'a'a'`'`'p`'|`'t'x&`l&`@  "  `4 @`0&a,.`<.`=㿘H /d4 4* % 4 4  !, " 0 =  0€ H 0㿘H /d * %   4&!$`4 0€ H 0audio_drain: copying in progress!?! aud_dr㿘M ߀   4 l 2.L`9`` `@P$`" @#`:` H /d * % `$`$`@oH 0 >L`9 >@+!0,`9`0 H /d* %" >Ȥ d+>!PaX*`" * ># % d! @n !`% d `0 >ȑH 0㿘>Ұ #. @ 4H /d * % ` 쀢 " !,  40,@". 0@ 0.  `&  퀢 " N ܀ 2 4U 2  4 `" 4@ 0 4 ,@ 0.  @ 02 <` ` < = `. <. =`2 <`2 &!, < = `. <. =&!,& XH 0 aud_hraud_rd㿘># . @hM ;  , v = s` H /d * % $"@  #>6``># $` !  @ `$`  )$"@ 倎H 0`*@K$@$$`  0H 0 #H 00H 0 #H 00H 00}` z xH /d * %   (!> 쀢  @ Ҕ 耢`># $` !  @= `$`    ݪ  - 9H 0  ""@@& `*0@F @@ %@ H /d * % % % - 9H 0`  㿘H /d4 * % 쀢   `  `@Ґ & ` 4 0@ 0.  퀢  d  d@ & d 4 ,@ 0. H 0㿘  4`!   h>"/@@#/` /``/2 ` ?€ 0$   >(  U        ` *@`0`*@`4*@ȝx!  `  @ 8  8@p&@`  aud_wraudio_write: cc == 0, swcode=%p, factor=%d 㿘># . @L;  `    $ ,  =` `&`@ B >``23`(`. 8 ` <`B#&`>`("$(``2`Ͱ H 0Ű #H 00>@i#,9 `  H /d * % $  !>Ӕ#d># $d !  @ `$d  $  ,9H 0$"@  " @T@P@&`* @` $@0. : H /d * % $$L:`$ @% @%  @ѐ% "@ ,:,9 퀢  L8 @`H 0 `  R㿘># . @  4@ )!@ " @ "V !@ 0@"  !@ " 8!"!@"!, @"`\  b}@"+ !@"`8!@ "!@ 00!@"b~@ٰ 0!@0"!@ 0΀ "$ X X "$ Xư  H /d * %  " =H 00  퀢  ` @R  =   쀢 `@!H 00&&H /d * %  &   l@f" & t  |$ "@ &H 00dH /d * %    "   @@ :  &   @<" & $ &H 00=<&@7@2E -``)@ 0% <&` € 0&`\@ 0  `<  0€ " $!,02 0@ 0&㿘>Ұ #. @H /d`* %` `" =0, = "$@0 @ H 0 @L0 Ā@ H 0  @ݒ@H 0 㿘># . @ 4\@ 0 "4?X  @  *?L ; 2  0 , ;   H /d4 * % 퀢  @4H 0X 0 @㿐 4`d !#\`d> 0 0 t x l >`(0 0 t@ l 2 .  㿐N ߀ 2  4  @6 4  ``  #\``> 0     >`$ 0 @ 2 .  㿘 <  4  @ c   $  $ !@ (L ;@$ ( ` > $  0@0 "$ L 9 "  x, : @d$@$!@L 8 " 0 4 $ 4 $ 0!(@ &!( 耢 " @    " @   @ ( "@ * &     & &   @@ :  $  $@ +$  耢 ! @ @  #@@@  @  ( `@" * &  Ӕ  `& &  ˔ ` 2 = $> 0 @ " =d = "!,L 8 2!,   4!, d  d@6 & d@ċ @ X "!,@z !,  `  @# ` L@x& ` X @z 㿘 < h ^ 4 @y    $  $  (L ; `$ (`d H> `(0 @ 00? L 8 ` $  4"   @ $ 4 $ &`dL 9 2 `d 0"   @ $ 0$ $ `d 2 ` `(> 0 0@ " ` `  `@ & `@ L X @z| ``   "`2 ``+  "`` 2` "`` 2` "``>(``"`  `   dddpppp㿘  &`&`.` .`  4 @€ 0 2  :  &`.`  4@ 0 㿀    *Y &  :  @*Q" & : @2` `2'g [ ,'`4 '`D`0€ R` H`$`4  耢@2  ?' ΀ 03 / `4 '`D`0€ (` 耦 `$`4 "`? 'k "` "` @K㿘 &` 4 D€ 0  ` &` &&` 4D 0 ` && p@ '؀'`z ''іr` /' 4 '`D 0€ b`  \'`$`4  耢@2` ?'؀ Hؠ A 4 '`D 0€ 5`  '䀤@ ''" , `$ 耊 `4 'zЀ ܢ`Ж  ''` , ` @'@'؀  &.*`&@*. @& @"@.㿀` 2@J @F ` '> '  `$`0 2`@ 4'@ 0"` '䀢`' `$ @@`'耦" 4耢 2 4  @€ 0 @>㿀@"/ ` '    4' D€ 0   ` ```"@`0 ``@`H`4`8 g ` ` '` '`'a'a'a'a 'a'a'a'a@'' `쀢? `' `8?"` 'Ȧ ` ?" '  ?"`'̦`?"' ?"`'Ц`?"' ?'Ԧ qȰ  jఒ    ` -  ''ܠ   ` !  '' `?`2``   ,`= ,`= `=` a,  `,`=\\@`0 2 `=  ?''' '2 `=?'''' `= `0@Ȱ Ȁ  ''' ' ''''$a$a $a$a$a$a$`$`$`$`$a$a``l " `ϒ ̒ `? `2``oat b ? `2`a0 S `?at`  B?a0 1`3 at`3   3 a0 3ِ `p?"`0a `4`s '''/@€`0 `0 ` "' 0,``0 2" 0 `퀢 2 0 `= " 0H /d * % H 0  0 ` "'`t,` 0 2"`t `쀢 2`t `= "`tH /d * % oH 0 `t?`2`tǐ`t      ,`€`0$`$`l,``?" `=   `= "n``@`0 p`"C`xH /d * %  )``l" `= `=   `퀢  (  `=    `쀢 H 0 .`x? ` 8 ( `&K $``|  `?8`&> $``x?2``|?  ```Đ" 4$`İ 㿀4 `8v 0&@&`8&`$&`$&`  B$ t$=&`@`k$&``HE`@`3"&`p4  '''D€0 2&`p&`p &`$̐" &`("@$( &`,$, .`0 ,0Ԁ@ .`1@ ,1,2.`2 <2  .`6 < `,6 .`7 ,7&` h$ &`t@j&`x@f&`| =&` 㿘 \  \2  &@ej 0 2㿘 \   @u5  2 㿘># . @֒ 㿘># . @0!@ + 4 ! !@ "}@  0:@"0!@ 02    @c1  \" "$ \# `8&@`H`D€ 02`@ € 0  `` @ 0 diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapccdattach: count <= 0WARNING: no memory for concatenated disks 㿘 4. >@ * *`  @bŐ#> $` @b `%> `$@ 2>>@X!` "@@d @  @d 0"#( @@@ccd%d0> *` *  * $ >$ $ b@W 0  * * @b~    $    a     @$@"$`  `@b_ ` !$` @@Q { $``h @Q n `  2 `  (* @@d%  @d"  O ` @& W:$`$` ` $ @ `   `  &!: @&`   % `"`   " ` @c  @c I  "1 *`  * @@:$` `* @ *` @ *$`  2 ` @cŒ  @c’ 0"` @c  @c  #$ @" (' ''  @ђ('    $ $ $㿘   *  @a@&           @a $ $ $$   "@``  @ a$     * @ay $  *`  *  @ " @:  *"<$ @0$ $   *`  *   @ " *` *  *  *   ,`: " ` *`  * *$#M$ @?㿘? 2  @>#(4` B * *  > `* @ 5 `   `* `@z`  "  @6 ,` ` " "  $ $    $ @ܐ㿘?2  >#(6  **  *  > `* @ " "      **@$  **@$    @ @$ 㿘 D? @2  `@3 * * > ` * `2  < 0  <(& 4& @& 00% # `  `@!ڐ  <& @H /d * % @ H 00@㿐> * @* @` 8@Ģ `D ``T *`@`@    @`:*  @*``H` > # "`< `<0#\@L)`0`\`t "`t@Q `"$ 0@2 $  \t`"t@Q $<` @զ  @%,`"  0\`t "`t@Q  `@ ,`@a̒ ccdbuffer㿐`\ ` `  @      Q& @S`@`` "$ $@ *@`  3  :`@- * 2`@ @^:`2`@ :` *` *  @ * @@J@!- @*`  2$"* & - @   @_T @ > #  2 @_I $ - @" $$`0>  @bT&0&X`,@&,&T&D&<&\&p&t@&x&|&H'> F#>)> (@"`<  $ Hc, $c,(! @~  H ($ '` ; 0@6  @^ @K > c  2 @^ $ @   $$ D$ \$ p`% *` *  *  *  : '`$ |<'$<!> # H * @l@  8*@&8* "*` " $㿘`0("`<`<&`@`< 8`@@E" @ (mirror)%s: error %d on component %d%s ccdiodone: count㿘 x> - *  t*   `  "0($0 4`" > $4"> 4"  |@`0 (   @ /> F3>> # ,` ` H @*    @  (@X Hc, (@3&c,  @` <@` @@("> @I"@  $@- *  * @eH 0㿘? 2`  >(2  * > *  * @` >>o"! @b 㿘? 2`  >(2  * > *  * @` >>o"! @bۖ  p? 2  @>#(4  - * > `* @~  "@"`  m@"`e e@7 0  h@: 0 e`f@ `g@=0"@ ` | y @g t>   c ''`'a:` @ 耊`"`'  @]\*   @]V* 2* I#  @w " @8 .` ` @J!@& +`` ''' " @ .` ` @J@& > * * @@~X Ȑ@^ @^ @0>  @*`  &!> F#(` `&耊  `0>`#\ܔ @* $#(`0$``@`8@[@԰ ϰ @ ʐ  `*@  ` " `` "`@Ɛ  %> `8 `  @I`  @^ `*`` @ "``.@` @^ `.`2``@^~ `@^{ `@,  ?@$``@^q @ @^l @@ @ΐH/ /@u@} ȑH 0^ ` I`!U ` @ `&`*`` H&` 4C @1 >`$`` @B`İ 2`@2`- ?`5# @ `* * >`b@k`İ` @&$` " 0` 2  `$` $`  㿘!> "@  ? @2  `@ `2`*` * >  *  `2 ?+  `?b@  ?  @'''''ܐ @G֔ 8 D   @L`@@H ) `@@JP   @L`@@H 0P @L &   @L`@@Hx  ccdfictitious㿘? 2 @4`,`* > `* !@|@|"  $ < $ ($ ,$ 0 $ 4$ 8> b` @|@  4 > bh @|9 . 4 H4 J$ X$   !W $ 4 $ , $@v,`?`6  @  .  `4 * >b@ @default label㿘  * >  c@| ccdlck㿘  1> @$ !  @z "    @   $ 㿘  `@&  ?& @{diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKMSG_INMSG_OUTUNSPEC2UNSPEC1STATUSCOMMANDDATA_INDATA_OUT㿘 \ @  *@E cT? W  h ` ? 2: \ 2  3  X* \  * \`* h> @ #X?,  \,  h @ 렄? \ `*   $ \ h `@> \ `*@&㿘 \ D ` cT?   h ` ? 29& 2  2  X .   \`* h> @ #X?,  \֐  h @ 렄? \ `*   $& h `@>Ұ&㿘'>  Ȣ $@⬤8 8 $L,`  ` "? `,` d  6 :&%L& * \ *@ `* h*@ t h *@ `@㿘 \ *@! \ * `a*@ d"* t @s㿘    `@@   @9  @ߐ㿘 `" @   & %P 2   \  ``*=%P &%P@ `@ncr5380_cmd_timeout: no scsi_xfer %s: cmd timeout, targ=%d, lun=%d 㿘H /d4* %  >@"`0  ` >   @" `&  2   $L * *`@"  @rH 0ncr5380: scsi data uio requested%s: polled request aborting %d/%d ncr5380_scsi_cmd: polled request, abort failedncr5380_scsi_cmd: poll didn't finish㿘   ` `d>@.#H /d * % `  >  #@ >  >@#  Ȗ    ``8`8, $ `4`#   ?# #   #  $# # #  Đ $ 2$$H @    >@֐ H 0ncr5380_done: state=idlencr5380_done: current=0ncr5380_done: dma free did notncr5380_done: sense asked for sense %s: target %d, bad status=%d ncr5380_done: bad state㿘 2 >@! 2 >@"  @ " >@"0 ,  $,, 25    `%` `>!   # !$,   >@א"P$,$ & &  $L *`*  '"  $,>  "x@ $, 2& >@@" $L *`* @" @i $ Đ& `@$& ncr5380_sched: not idlencr5380_sched: current set%s: reselected while polling (abort) %s: select found SCSI bus busy, resetting... %s: ptr but no data in/out flags? 㿘  ` @ " >@ "$H>@ &$H$ *" *  О @ Ȅ$L@ " ?- ,@ `Ȗ 8`8 К  2@    `@0& @Ò -   z> @"  %P` & p&%P, $L"&    &  `& &%L&%P&%T&%X``0  > @ {$, &%L& & &%P&%T&%X   $  & <&%P 9b !3&%P@2  >!@Ԓ &  "  "    @& € "   `" @   >!P2@v# @/ @ "B ncr5380_reselect: current set%s: reselect, BSY stuck, bus=0x%x %s: selected as target, data=0x%x %s: bad reselect, data=0x%x %s: reselect, SEL stuck, bus=0x%x %s: reselect, no REQ %s: reselect, phase=%d %s: reselect, not identify, msg=%d %s: phantom reselect: target=%d, LUN=%d 㿐 " h>@֐ x >#X @`>D  h ΀ @2;  X  2 >      *@" >  @ 01  \ *@#X+>  h "  \`>!@  \* h*@ t h @ cT?   h ` Ԕ? >!0@ U 2  > !H d* X @ />!` @ʒ > *, $L0> &  &  &  & @&%L&%P&%T&%X `*  ` $*@   `@  0* @ 0#!@    \ & *@   v &%L&%P@2 d *@ h* t h @* ?& 㿘`  `d*`\*@``*H /f * ' `X *@`` *`\ $`\K `\? @ @ C `\ @ 2 `\ *@: `\ ` "``*``*@H 0ҐT *`h*@H 0` `X* *`\*@ `\ * `h @'a? `h `@?  `\*@ `h `@2`\`d *@`\ *`` *@`h*`t`h @*0`\ *` ```` $*@ %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT 㿘   d * \%L @ %p:" ?& %h&%p  h @> ` #T?   h `  ?   2   2 l ` " %P 2   \  ``*o%P  `&%P&  2A \`$ X%P 2   \  ``*V%P  `&%P*& > ` `%p*  &%p%h (: ``27 ``%h ` .`$  \%h %i @$ ` \* h> @ #X?   h @ Ơ? 2 \ *@g `` 9>!$*` €]%P  %X \  ``*%P \5%X "9 H \` ` B %  =%  &  8& %j   >#@ɒ %P> @Ò %P 2 %P \  ``*%P \ &%P  `4( %P ` &  \  ``*%P &%P \* h> @ #X?   h @ ܠ? 2 \ *@ݤS(SSSSSSSpTS0%s: SEND_IDENTIFY while not connected; sending NOOP %s: unexpected MESSAGE OUT; sending NOOP %s: weird MESSAGE OUT; sending NOOP 㿘 d   * \  *%L` %d%\@z"%P%T &%P&%T%P%T  *  &%P&%T` 2&%X> *` € 2 >(!P :     2  .%\       .%\ >!@  .%\ >!@  %]K&%d `@N>#T  h `  ? 2> \ 2   28 \2 %d%P 2 %d \ *@ǐ %d&%d > X *@ \*#X  h ` ?  2 \ *@ `4 h%P o` \ *@`"WVVW<WW<W<W<VW<W<W<W<W<W<W<WW<W<W<W<W<W<W<W<W<W<W<W<W<W<W<V㿐   d*` /  *`// ///     @` $ , %P`  &  \  ``*A%P &%P %s: sense phase error %s: aborting, but phase=%s (reset) %s: data phase error %s: too much data padding 㿘 ` @`><"0 d*@4  j   `>Ғc0* @ >"H@ 0[2   @>"p 4` ` ٖ  hy  h @2  ; >"@Ғ $ "  d & d @) `*  x  |    @ " $ $ %P ` $  \  ``*%P  $%Pncr5380_status: none? 㿐 d  *@   >& @  ncr5380_machine: state=idlencr5380_machine: no current cmdncr5380_machine: unexpected disconnect. %s: no REQ while aborting, reset %s: no REQ for next phase, abort ncr5380_machine: Unexpected phase 0x%x %s: parity error! %s: reset SCSI bus for TID=%d LUN=%d %s: %d extra bytes from %d:%d %s: Target %d LUN %d stuck busy, resetting... 㿘 2 >@!2>@!( m  h @ @>@ !H % ,X` @>Ҁ` #P'>?  C - d h ` ? h @2   >",  €ɒ/m+F'#>!@ %P`  &  \  ``*%P &%P>!x@ `&%L`") l   @ "   &  @ t `" l%P    \  ``*%P &%P l ` > @!%P`2 %P \  ``*x%P &%P`^`` >`& "@c ```  `>"0 @R &  8% (`4> h `cT@F  h `@" \? >"P@4  \ * ` *@ d`* h* t h @*  &%L&%X& & & & &%P&%T_|_|______diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿐'P@y[" "@q P֔ !H@   !H@ "P!H@ G"P 'P bWARNING: no memory for vnode disks 㿘 . * *  @P  >@ 0@qN> >"!"c`㿘>#` `2` [ * * >  a* @ݐ N d 2 d$ @M   `` *  4`2  `   02`   *@$  $"  `*@ `"     $  $    @ @$ 0@vnd devicefictitious㿘`!@pؐ`@pՒ"  d"$ ($ 0$ ,`@x d$ 4>b0 $ 8@p[  4 > b@@pT `Đ. (4 H2`  $ <4 J$ X$ $   aW4 $ $, @~6   p4 * >``(@ؘ 㿘>#` 2` **  * >  a* @/ " "      **@$  **@$    @ @,$ ` D> `2`*` *  * >  b@ 0 (& 0& 4 T <: & @ 0 (& 0& 4 D     @O  2 D@ J0A D  ("%H /d * %  & $!$ `$!H 0 0!0"4("0 @%"@& @@  0Ф  D * `@ H' <'''' T: * 2* ?'' Ȓ`@= h$  0 '  @= & 4!H " H < < T !H  H < 1 T' Ȓ @= & 4!H  H < ! T  $  @?W 4` 0(& 0@ & @! H /d4 * %  ! $?$ $!H p@  D * `@ Ȧ  XD`L, 4 0,  @`@ H  = 'Ē`@<=@o ȖȐ @?Ī Ȓ @?`Ȁ?" @o`%Ē *  x@M ̖"0"< 8"4"8`<? ?` "D"Dȑ= @"H"T ,>̐"H","X"\ `"` d"d h"h l"l"p`"t"@H /d * %  @| ! Ѐ@`$!@H 0 <`D@㿘  0 $@~&  0@ \`t "`t@?:㿘 t>  D `2`*` *  * H /d4 4* % 4    0h$ 0@ $ 4 < @ " @OU$ @ @ < "@@ Đa  `0@}` "a0?$aH 0㿘>#` 2`@ *` * >  * @` >>o (! @R@ 㿘>#` 2`@ *` * >  * @` >>o (! @R   vnd%d  2`@Wx!2 U>#` 6Q ,* >  b* @   m@"0e e@ 07  h@ 01 e`f@ *`g@0"@& `" @  @  @'x'P't'T'|P @8 " @0@;`  `@=  @`&  @=`$+ 3`  $ @ 2  & @L  ]    `@9^@0ʒ  @Lj H$H@@m@NQ $H@Ģ  * 2@ * > $@m>`h@>Ғcd0$@|I$X@ r@O   @+   *@     @4z @H @mfH@N @|j0H/ /@@mV!PH 0Z $S !Q $J &*`` D&$>? @ِ :$ @  2@2? 2  @?`4 # @ `* * >`(@  ~@$02  " =$  p> "@@VP$ ̐" @K  ą* 'Є" Ȗ   ?''''''`@9 ̒ @:  Ȓ @ `8P  "  Ѐ " Ё㿘>#`*` > *  *   `@`!P* @*`@a*` * vndioctl: null vp㿘> "@  Ȑ ?`& >@Z# ̐ @8 @U & & & ́ 2 > * (>҄`(@`2`Đ? vndlck㿘 1> @$ ! P @j "    @   $ 㿘 `@& ?& @kdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㾘> c T "c@> )"2`8 @~Ho o> % b a?  *a a` `,a @ @q2  a  ,a @ a,@ a,@ > ( @ <ؘCB8 ( 8(H 0>!P*` *> "@ "`@r*`>  㿘> %"!> !` +!#!  !+!  + ! +B; 㿘%> > %"! !`*!"! `  ! `@ *! `  * ! * !` ! `*!"! ` D ! `@ *! ` (* ! * ! ! ` `*!"! +` !@ `*!  * ! * ! < ! `*!"! ` +` !@*! `  * ! * 㿘> c 1 !> )!> >  `aX@q> > "`@qݒb> x  @ @" $! $`> !"@k "> #@k$> %"ؐ  *?I  $? 0     ;n vAMaX ֣d° x㿐> #`Ā > .  x@ . @ô`  􀢠Q@` `" #@ `& & 4 4 :?  ; ?#`: `: `:`:2`>>ch l" :    0 ` > x`B i:x$`$`$@2 >>҂ Ho oh> #:<l  h > > ! pB: pH p@0;" " "" ! ` `(`B ; ` @h`B  8l. !!   8@B 8B :  > )!`  > " @p `H 0㿐> @q# `> h`B :hHo o-> )>i/>' 'H 0 %> )> "   " 2 c* $ , 1 #* @g * @ * #@ +  #@ * @@ (@@ @ @ @ * @3@  @ ʈ  @B =  & &   `   & @iY Ho o#lh>   #@ <%#l%#l2 &H p@ 0 > )`Z!@iڐH/` / @i 2`,"@% % H 0@i@iW X耤/ @ ///   @/// /$ y $ C a@i > ! .`@ C : rndrd`   ` @8? @2 `e>!#*` €^ > )a  U #>  X> -``C :X>!"p!  @f @ ! 2`@8> `B :?#E- `,`:`$?#?c  Ġ,`,  $  ?# ,  0    ?#@\ ` `` 0> )@  ? @ `2  2`y  t ?# @8*`2  @\A Z?` , *`2 `*0` , 2 ???%> )> "  " @2 c* $ ) 1 #* @g * @ * #@ +  #@ * @@ (@@ @ @ @ * 3@ ?$@ ?ʂ` ?` ? @2   > "#㿘 @"@% "@ "d 8""@"H  @"v   "@"   b~@b}@ @Ho o> )"&H 0o!2@P 2h Ho o> )a`  "`"`H 0Q!2@P 2J H > )"bH 0;!2@P 24 > )"`?- #H > "cH 0!2@P  Ho o> !@gJ"H 0 @[ diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map   `  ``\ ("  `X8 @ "8 "" diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe maph  @ ''?'  ' '"  @4   X <`"?  А@ \  @T@J/  @6. @ה 27܀  @3 @Ĕ܀     @6 `T @N܀`   @5 @3` "!T' 'M =`?'؀ Ԭ'̀   (`"$ , X@@$ ,  ' $ , :`   @_ Z> a(` ' "` X' ,  " ,@+ , :   @< 7 H ` , *s ` w  q `  !@k7!T "@ ` `ؓ2` ``?@UԀ M ."!`򀢠6 M`! @pM`! m; ,@;`!  ` @7`T*  ,$'2/$ 0! , @%T* $ 0 0@2  @kw V  ,$ , , l&$ 0 ,耢 B :@:@ @;`   @  `H$$ , ( ?7$ , "@i@@^̀  r p?@$ 0䀢` > a(` "` ̀ ,$ ("( 0@< @4 0@X@ @ Θ `@20?܀ / ,@2  '@0/   @@@"X@ @ @ ܀  @4m "@@@ 㿐  `@mڒ `?@ @ '` H @ & 'diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘>ah>  9 @Y> > "`L" 㿘> "@'> %> 6` ̐ L*  "  @2 2  `@ 6` 0 2  㿘 >  2 > @L * > 􀢠b@ 2  @2 22"&& # 4 @:    2   " "cd9660_inactive: pushing active㿘 > a    D >&!@ $ @3 x`@  cd9660_reclaim: pushing active㿘 >a    D >&"X@y@v " @7$  @DV :&  㿐  '  6`x6``@     `. :   ޘ􀦠< H 26  @`x!6`x @2 `x @6`x  2 `x 6`x  2 `x 6`x  2 `x 6`x  @2 `x 6`x  * @&`|  * @&` `x&`!m6`x&`| @y㿐'􀦠 `  `  *@ :   y􀦠'`H ` 2! ```=@ ` @@`p ````d&`p&`t`@`h ``p`t&`h&`l` `p@ `p`t&`h&`l&``&`d @%㿘 gl '    &`&@H đ*` * " * " `  @a^* @, : $ @aT d@aP? * @,`,`* :`* $ @aA"?, * * "@*`@*`" 0*  d ,:`*`" *  * $&@&`   * ( ?А㿐 ?/  /  /  / ޒ / ڒ  //}   (  *  * `(diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map   (@2 x   *  ( @* | ` *  ` `(@*   *@ 2`"`RRIP without PX field? 㿘>(@S!@K ..RRIP with incorrect flags?㿘  `(@`$F`0`2 `,6  /,@ ` >(!ت ` ! >(#*` €  $@ `$@  `@h> > #( `  >(@!`,``,   @`(&`$2&`0   0`( &`0&` `$" &`$2`  ?&`RRIP with incorrect NM flags? 㿘N >(!؀`  >)!X*` €  > > #( `   ?>)@ `,``(@2*``,2`@  ` `(&``$""@&`$2`$w`$&`$ `  ?&`t|㿐>( `$* * *N !   !`a`  #\ `$ `@`(0`( `( 2@   (  *` *`  ( "`"`JC   `( x0"`㿘  (  2 "@@`h  @` h  @`` @ h l" `" d  -@`p.` 2  "@@`h  @`} h  @`` @ h l" `" d  @ޒ`p`@ h l" p" t` ?&` 㿘@ 㿘   ( ``. `.` (. (? 07 ? 0?@ . @(@@ ` ` 㿘 `? @`@&`![㿘 . (. &`` / ``..> >`  .  (.&`$IEEE_1282IEEE_P1282RRIP_1991A㿘  2-    2% ` 2  >*b( @eĔ 2   2` >*b8@e  >*bH@e  `" =&`㿐 `!`' `!a`@`2`  *` * + `  L "\`!X  ?#  ` )&` `  "`L@L@2 L`L @2 €` 2  ` (`@`: `` ,`) ``! :` B8 2  + ?@)  H`` @ @N  2  €   2 ` '>Ґ''ܔp\X6  !` x`!7'' '''ܐ !@p>Ҵ#` Ĵ ?'Đ8`$  7>Ӑ'6'''Ĕ`'& SP`>+" "&a\@d     1&a\@d  2?"'>'ܐ"? diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map *    ? * 㿐Lf ;) ;Z  А S, * @ ?Ѐ –.`@*`@ <$    ? ,"@ *"@  " . ; 0`;   ??? 㿐`\    =. `.c  ;` .F6diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapcd9660_mountroot: can't setup bdevvp'scd9660root_device > "@> 7a> @ \c`  >,> F`#> @ TcD >,@"09>,>,# c(@  1cD'@–   ?"@ h@> 0> " "฀@  #` "@`"`@ D@ K@    ݔ p  <`@| @   @ڔo @&(&&$&&,@\ d< "@ [ > 2 `& @ Q ``@*' @@*! @ 0; @,<@@2  @9  @ j ! Y% Z`@\ߒ$@  Y `@\Ԓ$@ L  p@+ D0@ FCD001%/@%/C%/E㿈   '`< ''   'm @p h@ > #D _ `@  @ T耢   ?@*J I0c ?@* 2'   I(?@n >- Hb @bf  2   " 4 :0 - ''&l 'X>-b@b?  " >-b@b7  " >-b@b/  "   2  @U'c @K'? * b> ?   9@:!d@\!d$`P ` `+  P* `@ @ *@ $`a(B "  +  *   *` $aL ` `+  গ* `@ @ *@ $aP$`/$a`?$`0`%0@&a&`d` `< &`h&`<&`@$`$`$`  " l`2%l aL?`* ` @` PH $aXl l ?&l`0 "`0@'l  $@` $aT $aTaT #`!a(Ҕ "  *  *` * $aL ` * `@ `* @*@ $a`$aP0 &0$ @    @ @   耢   @)?`@; 9&a㿘@($`D   '>-,($`<$`T$`0@b8$`@@@ I`H @a   B > c$, 5? * b ,( (@Z  8 @Z  " "   !W<  @&&&.6&&&&.&@hŐ6 `0 $`0@  㿘6` @ * a   ?# @( @ = @;] 9`<*@$`<$a㿘!!(G!T `?@v -㿘! D @ &`&` &`&` &`&`&` `T Z `ݔ Z!Laٔ p&`8  㿐 `` & x` &@ c & F㿘 @1 isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] 㿈!ː &" >  P @"  & :@8Ȑ @Z >0@ 4 @/ "`$$$  @  "!2F'6@ @ F>0 P@`!  @ݰ F>0 x@~60ے , ?@٘  @Ͱ@>0 @~$0 H @ @@ " @ >0  @~ @  F$  @l$ 6@$\@ِ     @0 H   * *   *` $T ` *` ` `* * $X @ $\"<T ' "' ` *@ :   '쀢 " @F "x@|x< @ >ڐ!X2`  `."<>1!*` €> !L#"`8> !H" 8@ > `$ "`" 8@@ `$ 'X:  @ TL@`@ "`@ &pTpppp  2@ "`\"`㿘!@ `  `0`4&& diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map `@, `2- ` 2) `$2% `,2! `?2 `2 <`"  < >1(    |tDŽDŽ|DŽDŽ  㿘  x /| @ V `   `$ `$ `x /4 `4 `|$ `$ ``$ $`d$ (`h$ ,`l$ 0`p$ 4`t$ 8`$ D`X :`< `X .  < 2*   @6$      $?'''''''''''@]耢 А$ < @8  $ <$ @`$ `X :< H <$ 㿀    1`  6 @5 0 $   @a!     @" 8 X @:b   2p `; k ;  > (# > #h'X* ) :`?#\#`@" X* ?'#\#`@ ?@$`@%@8 `H@Kz@  X : @   `0 "`0@ "u 㿘 0"z@"      @'    㿘``*@ `  ? 6`#0@* &#@#D`#H 4"@&#@?#H`?&#D&#H @K&#0 2>#8 㿘"" N" =`?  " !!? 2!@] ""!  # ! 2%.!   # ". "   ?  6"#(!># <"  #(>#4" ..㿀#P`    @5' '쀢 ,!, ,",!, $#0 $#D  2 '* @5l $#D$#H $#@ <#(#,    @7G 0 X#(  @  "#(@#(   ט  H ` 8#(  @ @ 8 Co<#(` ϐ  ˬ `!@,"  $"T* $"#(  B<#(!T >3""N ``>,"#(7"@ `"@," "` 4"L! 2 "," % "  L! 2!T ,"!T!`  !` #\`? `"$ `,"!T`2#(#(" #(>`e #,8`#(  !T  ,"ǐ & ` @6  #H""@"@ "#8@ #8?  #@@6s#㿐    !T " V ? ?2@*@  @  +   H   (`@ݐ :  $@ @4P   ` @62 @ 0@`  `@" $` "@"  "@If@6 㿘  @$ @^ 㿘  @$ @T 㿘   @+T 4㿘   4 @+I`cd9660_strategy: spec㿘` \<? >5@x  T P@2 T   T@$ "  T 0h$ 0@7$ 40?2 T H@U <$ @ T?> ` $ D!P8*` € 0@ tag VT_ISOFS, isofs vnode 㿘>5@yL! 㿘 `@*~ 4`>5(`!T`     %` $` "`     pքք,Xdppdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘` `* @?2 "! @ "8! !0@! @ @@ @2`exec: a VTEXT vnode has writecount != 0㿘`&``&`` &`` `@&``&a``2`` `` H` @ c >6@w @ِ ``@*`@ϐ``>=* @` &`*`4" ` $ `$ ` $ @` $ $ ``@*`@``* @` &`*`" ` $ `$ ` $ @`` $ $ ``@*`@``>=* @` &`*`" `  "`` """ @V"㿘`&``&``c  2 * &`` `@&```&a`@*`@]``>=* @` &`*`" ` $ `$ ` $ @m`  $ $ ``@*`@=``* @` &`*`" ` $ `$ ` $ @O``  $ $ > ```@ * @ "@ ``@ >=@``>=*` ``&`*"  " " " " " @ْ㿘`&``&`` &`` `@&```&a`@*`@``>=* @` &`*`"  `` $ `$ ` $ @`>    $ $ c```` *  " #``@ >=@``>=*` ``&`*"  " " " " " #`` *  , &`@rdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘@ސ 2!  $! @SF2  @2  2  2    2  ,  ӄF2,  @2%  >Ԙ` *@8 *  2  2    2   , * 㿘?"`  ? &   " &   @&"@@2   '@`'@  `'@>   'c`" 8 E@  @  @ >=* @  & *`4"  $ `$ $ @$ @$ @ "B @* @ >=*   & *#  "@$ `$ $ @$ @$  @* @` >=* @  & *`4"  $ `$ $ @r$ @$ @@ @8 @  @ >=@5 >=*`  `& *"  $" " " " @" 'x   #`#\#d#h#l @& 2`   D 'p'''''@   < w `@@P䰒 o X <`i `@@.! 2[`x  4 2Q`   w D  ,  @/א 25`0 'l %'h !` plh  l@ p   @ "@&&pl 'p`@ՠ ` @@1 p@'exec: a VTEXT vnode has writecount != 0㻀`  ` 3'/   8 2 ``H " ,`@ ۰ >9@s"X ,  @/Z` Đ?&`&`/, >Ԓ  2,#` >Ԡ  >Ԑ!&a>Ԓ? '. 0  `"@`: " @` @   `y . 0, 9 , ?'''䀢`)>:"`*` €``\ ``ߚ쀢 @  `&`耢? &`&`&`&`&`, ̑, ? O> c`@*@ 'O   @.$  @. K$&a &a$$ *$ ,$ $$ &a&a &a @0@}`@R@0} @` LLL@HPa a$'V aT  @0] @0Z @w`0C` ` `@`€@`@   "`@` & ' '' > # ''  ''''  ''''a''' @@0 @0    㿘,,   @.`Ԗ 6 ,* *  2"   *  @- `   `@2 ` @U1` `0* `@/ƒ @/Ò diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map#!exec_script_makecmds: epp already has a fdexec_script: copyinstr couldn't fail/dev/fd/%d㿐a`? )?` %>;aȐ@X?  2# `  @ 8  @ L  2` , @ J@ 2`*@@ *L     J@ "` "` L %  J@     2`J@ "`*@`J@ "` "`J@ " ` `J@ *@`` , ` `!@X`  "-`a ">;@q@!В@ a a  &a2` >ڐ"h"`"(2`, ?",`0?"`0`, "`@M`0` "` ?"a  &a@,   ?@, @W$@ ` ? @,Ր$`@W٠`$ ?@,̔ $a  >; @$R   >;@p"a b(@r $`&` `  4@@ 2"`a  &a@@ @. a&a ` &ah@2`" d. `+" " 4a   &a ?&aa@  `@@a ` 4@.`@  `@.Y ?  @.Q ?@ndiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapvmcmdset_extend: not necessary/usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/exec_subr.cocnt > 0㿘 `><@p?# ,`><><>=#c@p ^,`& ? @,*  띕,   @ @- ?& 㿘  :    " @   `  & @-Ȓ ? && 㿐`,> #`@ 2( ` 2$  "`  @  2` A`c  ` #`` #\@  `€ 0 㿀` .> #` #* &` #`  * #\` ?@r? 2&  #`#\@ ` #d`` ` #h@t#l 2`2`   ` @  8  @k @ 㿐`> c`A`#*&```   * #``#\ ?@0?  㿘<>&`&` > c4` `* &a``>=* ` &`*"@ `@ a`" " "``"`"`"` "```*``` * ` &`*"@ a@ "`a`" "`"`"` "` diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map swappercannot mount rootcannot find root vnodefork initpagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedcryptocrypto thread㿀@Py> >  @T"b@@>@p6!H>>@p3!@S@ZV@@@@@R@,@A@0@@> %`$``"` "$` > `($a> h  $`8`8"`<h"$`<> 74@ # (@" 4" > "`0$`D$`@> !  #!>"b  $`,$`>>,`1,a a !ؔ >``p@RD>cl`@R?> %"$`@4" `> "@`>" > 3 `"`2`&2`$`X"  ``"`"`"`%->1> )> 9> +> 7> 5> %?  $`$` : : >!lb  @@< @4$!> #  8+@ 8  P< @  !> <`#$>  @c>   $`$a $` @0 @KL@]@J@`@@@@qL    $ @  2 @ H /f* '@ @H 0@G@7> "8$`$@9>@?ܐ">" @  >>@m! < "<   €!\ !\>>@m!8` @f$ !\ @O@ߦ$  b%b"`b `h`#`&h"' "`">@#`b`$`$`#\   @ ">>>@m]!P>> ` @ ">A>>@mQ!p>> `ဒ @֔ ">A>>@mE!>> Hᘒ @ʔ ">A>>@m9!>> 0ᰒ @ ">>>@m-!>>!Ȓ @ ">A>>@m!!>> t @ >>@m!@@@J@ > @"!/sbin/init.bak/sbin/oinit/sbin/init/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d P>@!8 @ '''''@.  `>@>@@nK!H0@nH!p0@oinit: couldn't allocate argument spaceexec %s: error %d init: not found no inith> "!ɐ> # >" c'#`#\Ԗ ?@[?  >@@l"> bH"bH؀7> #F -/# `  s/ِڦ  * "$@ .@Oؐ $@ % ?\ ?V?R'''@ђ >@"(@mĒ 2 ->@@m"@>@@lA"X㿘> @ b@㿘> @}b@㿘@㿘@diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapP !2@2R I@  '''''ܐ@ٔ :@ <    @@ + > #`1> !@ "@> @H#$c쀢 "!@ @@ &!@$c@ @$c찒 2  $c@x @> #  ` $ @5$#?:  Ȕ@4  @7@7`'H /i* * > %bؒb"'`" 'Вb@ ??H 0 @`7Д̒b?' '?/a ?>!PC>!T@F" 7``` @F 7`0 `,@5 7',  ' ` "? l?' 3 /@  #`#\#d#h#l  ( @ߚ @4$㿘@Oa . c   6  `  # (.` 6 `.` @.`6 acct㿘> c$  c$>B>B" @`  Accounting resumed Accounting suspended #> %> '>Ba@`"!> `< 2 `X  ?@s L$a@ P >c$\@O dd@0a@> >B"a$$a@#쀢`"$$$`< 2 `X  ?@O ($# P >c z\@On dd@ #>B$a@$#b@j >@, >!P>e($ (@EG a@diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKweird hz㿘 > F> F"#4@"c8> #`!>!P> P ""P@EP> > "c>!T"!P d!> '! @"  ` <>C0#>C0 > '$  >C0$>C0 "c> ' "c  "c> ' "c> ' "c@i 㿐> "@&!> @` !T` " `@L` 2`@7y ` !T`  > @LԐ` > @7i > #`> %@> %b>  @b> !T `"@'`'> "#@  > В@"?@"?/!@"`">>cL?cT   #cL :`+ #cL $ #:+ "#cL Р@"?'>R#@>> #D?/!0@ ##D'6'>D"* €>#4   ($c0& $$c0Ta@KŐ >֒? $c0'T a@K >֐ $c0 ' $c0>#4`0"$c0>8`>#4` >c< ;4> '㰔 ?*@ 8$T#4` >c< ;4> '##@ + 8$T$T> '>#P  㰔 " T : "@$T T"@;  $T> # >P㰀 `T*@  $T d <T`6:` :  "@ @6: : "$T$"@M / >ȑH 0!@Mk0 > ) *a 巒 0吐 0<㿘H > %""  # " H 0  А"@? - (c(c' >ȓ, "@*`" * * >ȐT?@MZ  !P1#@D #W>ȠT@MG   #㿘  &- (c`(c& >ȓ. "@*`" * * >ȐT?@M#  !P%@Cڒ4  >ȠT@M   #㿘 , (> !\ `& ,`!"!\> #`H /m * . > #> aP> F> F"4@"c8H 0㿘 , &> !\ ߒ& ,`"!\> c  H /m * .  > F> F"c4@"8H 0㿘 @$> F> "@ ,`  @m͔ > Fc8 ? S"c8 L! `B < > c0` 2"`> c0 -"c0c8 ? ;"c8 > > b@ >  ؒ`B < > c0`  "`  >  В`B < Д0 "> c0` "`> F#4 "8 d> b  $ d> Fc0  "c0@Ek㿘>#4`Z􀢀>@ "c8? >> "c8 * "#8>c4 >#X > %> %"##Xc4#X`"##X`%!>@B8* #P#P : "@$#P:d!>  >#< #P*`: " #<#P*`:  $#P>#@#P@4$#P @&$#P㿀>T>!P>> > '!X'P'c`'' @= diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapfileplfdescpl㿐!>נ#> >F b8#\ 8  @\y > >F#\#b@!@  @\o > " \8 **6*  6 *  ? * "?fd_unused: fd_lastfile inconsistent @*`2,  㿐`@ 2 0   $ 0 @  0 ,?`$ 0@C 0  @@̘dup2: fdalloc㿐`@  ` 9 ` 5>!l@ @. 2 0&)  $ 0@ @  0 ,?`$ 0@Bΐ 0 @Cː@">G@e p@}x@ @ m 2`0`  $`0`` Q>H#d*` € ``  D ` (A`0>!l : @pܰ  24`0@`0`,?`$`0@B|`0ʐܐ@5' @ &`  @ *@ @ ?*@`* :` ?* :  ` &`ؒ 34`` %  ̒@`4` `'ؐ~ 2`0` `@'`} ~` ?4`'` `0T` 2``( <& `wذ &T` 2 ```("< "@`"D   &`@(& 2!  &``  `v` PT`  ``(޾  2`0W W䀒@耢 6 薠 ` ?` @ b ` @ B ?W "%   h`0 d`0` ",`$, ` ,`$,   @@CT` = `(`h  26`0W W䀒@耢 6 薠 ` ?` @ b ` @ B ?W      @ @ 2 `0`;  `0`,?`$`0@AM`0 8 @"8  㿘 . `"` `0 $`0` #@2< "    ?*` `&` `0`,?`&`0@A`0`> +   +@@"   2   3 * +@@"  4$ ` ' H@ @ 㿘.`"  @ >`&  *@ ?2   2*`   * *#  `  * *"  @>F@c#XT& 㿘 .` `2`09  $`0"  *@ @>`$  *@ ?2   2*`  * *#  `  * *"  @>F@c#X2 H$  H@@ A@2㿘@ ;  8`,@ 2 0"  $ 0 ` 0 ,?`$ 0@@X 0  a2`@) 2'`. `㿘 @ 2 0"  $ 0T "`  -`   "& @T ( - 0 ,?`$ 0@@ 0㿘 /> l @8@ @&: <` ! <`  "@,  ?2 ?2,  `2  2 *  ?, ?2,   , ?8??O `-    : "@,  ?2 ?2,   , ?a8?-  * @@6$<`+  ` +@@"  2 3 * +@@" @4$ @$$ &   㿘` "( @̖ o 1 2* .  ' @n* $@?@?&  @ E '  :`: ` :`: @7 ',` @D,` ' @> :  : * Ԕ@@?$ :  : * ǔ@?t$@ :  :  $ $@  '@  '$$$$$( @\ file㿐   2vy> > al0  @;`&  *@?2   2*`  * *#   ` * *" @>F@a#X>K Y& >K@a X= " >  @Y) @?  8 $ , @`" > @ $@" "@ $ `\`\ $`\" "`\$   `* "@$  $ @ "@&@& 0 $ 0 fdexpand㿘 >  @X#@>ʒ!@  @$` $` @z>Kh`( $ @7 >"  `X` ``?4`&4`$$@$`$`$`$`$`H$` $` &0& 㿘 >  @X# X  " @G " @A  `6 & X &&   `c*`@,`4`@: `c,` * @4`,` '@ & &`:  :   '  &  &  @, & ,  '@ & & ,`ܗܓ < < , ܌ , ܈  H?  @ "  R 2  `@ ?& H& L& T& P  @#`"  `  ͒ "`  `@ 㿘 &?* `F4&``" `0 "`0$ @H &   @} ' :  :  $ @r '@o ' " @F "L@@L "T@] T "> @W > #@Yclosef: count < 0closefclosef: count: %d/%d㿀 ` " ,`, " ,V 2 , (   ??77 @ v @ , 0 0@=1& 0^  ? &  0?& 0T 6 0>L@`G#& ,` #> !>L  0# @;  0`  /*  @2  (   ??77 @ 8    € `"  "` "@@&v  `>L 0 "a >L 0@`# > $a @X 㿀` @ 2R 6 3 -(  ?7  ? 7?А*@2     7 27   2   @ ٘     @ ј 0? 0 "\ 㿘B   7 2S  " y #@2r .`"@ >` +`* ` #    +  "  @ ?2   3`* `+@"  @4O& N . .`" >` (*`"@   * +@   "  @ ?2   0* +@@"  @4&  >&  *@ ?2   2*`  +@*"   +@ * "  >F@_+#X2 &  㿘  `` `)` $`kqeueplknotepl㿐!>נ#> 1>N#`#\   @Tɘ > >N" @#\a  @T >  "c㿘`4 €`4R` (>ք|"`8 "`"  4(  `2``"` 4 `("   㿘@!  > ' "@    2 ,!"  @$!2 "   & 4 6 ?Ȓ*  0 & & 6  & $   ( 4  `2``"`㿀< ,@@    &    (  `  6 & (# 2  ,   ? .@  $ '77'''@Ô   &  @ 㿐> #` + . 2` 2 >֒c`"> 1#@U] @;? && " (& H &$ H& , ?",`0?"`0`,  @:ِ`0 㿈`@ r T` "`00l $`0`  ם  2Z`0&`` D`( ' ' * `׈* D $   o4 @B ` 14 $ ` r `  ``?&` &` *` `* " @ &` &`   &``` @&`0`,?`$`0@:^`0㿘V`    `  ` 8 >֐#*` 2  "1`P@ 20  $0 `$ @`H:*`L@ "7` 2V`T @"-` "*` 2V`T @2`"`@2  `T* @ "` 2 2V`T @2`   V 22`> "@TQ  2$  $ 4 $ 80,?`$0@9ِ0`$ ,` $ 0@&`&` $ ` $ `$ ` $ `@$ $@ 0+$ ,` $ 0`$ $Ho o 8    (  $ (@H 0` " ` 8@@3 "` ( H $ (H 0`  ( Ho o  $ (@ŐH 0kqreadP ('T * A#@8'` ' ?C` @?H  H /i * * > %"А" ? @ ' '?/a  ?H 0` '' `    ؀H/` /``2"'6`  #>P $`0!@6 H 0 Ӏ? # " `'`"@$`` @ ` "` $`   "@H 0@0 (` $ (`?n$`  2  8` € 2   ( ?$ (`[$`& & & &  $&   ( ?$ (`$`H 0 8@T@tHo o " $  ($ ?$ ($ `?$`` $ `"@$``H 0,, ) Ho o `2t@`"` $`"H ` ,*%'@   㿘 ( H /e`* &`     @r;   $ H 0㿘 (@87 `   :6`>`0&`@ 㿘`  H' ( L*@ @->  @ 4`0 "`0 8@ 4o@S$`2  H& L P #?!  T*@ @3>  @  8@@SƐb$`2  P * T> 1#@S& ( 㿘   ?& @7   ?& @qҐ @ 㿘  8` € "   (  & (@  2 8㿘 @@@S@ 2 8㿘 .`L@㿘 8@ `P 2   @  @,'`P$`T `P2  %`T`H  ! (!  @, `H`Lճ*`H$* @@7]*``L "$`H@ $`H$`L `L* @@&&@& (㿘 8`` L P2  T* @@"@!> !> 2" ( " 8@e 8` " 4`0 "`0 4t"@Rdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/kern_event.c(kn->kn_status & KN_QUEUED) == 0㿘 H/` / (`" & >S>S>S!a@Y#x & "" ( & (`"H 0  kn->kn_status & KN_QUEUED㿘 H/` / (`2  >S>S>S!a@Yj#` "` "  "@ ( & (?"H p@ diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapx`(D$($$@ޖ &``<    @@P`䰒 24`X <  "`` 32`@@' @ 2{4`` I 2r @@  2k4 #`#\` #d`#h#l @ʚ J> ` "   &` >Ԩ , €  2aa  <`  ,  >a@8 `@@  `􀢀   $   蒐` @v@@e 4@f 04@b @䶐execve: argp == NULLexecve: no vmcmdssys_execve: falloc indx != i㽠> ,  $,(+>> `>Ԕ   @8%!?@ ''! ?'''@('!''''' ''''b''ؐ _> 8` @| 2>T@X5"Ƞ  "  J@,`J@   @@ ?  @ؒ ?ؐ ?'``  2` g  ?` ?%@'ѩ   `` ?I  ?" 0`?%@'ш    0#>4 ?cȲ"@  "Tcȓ* "@ @ b ` *   " А ? ' 'А @>>  $ 2 $$ 2 $@2@ $$耢  >T@W"  @ €@ ` N ''$>`$"  }#=c  w` c0"@ lW!@"Ē @8  'ҩ?,2c 42@ʐ @, $, $ ?H@3$,  , @,,*@$,, , ",@ ,!  $, $@ @e"@,(0",$4" p' ' R  ( `    ݒ'  2B``    R>T@V"@~@ᜒ 0@ 0 `H "`H  2  >2`  "h" "`( , ?", `0?"`0 `, "`@3]`0``$d \ @, >$, " ", ' H /i * * @:$$$$ࠖ *@" " @ "`"`H 0 @7@  @#@D ,€ Y (,(@# Ԓ ?@$ @`2I,@D,ސ؀  ?' @@@  @@ ?,*@($, @Y>耢 "@ @  @–@ @@ ?@ @?,*@$, 㿈`` ''f  2V !,  **` ` '&@'O  .쀢 7  @ ?' '5  ? &`+   ֖쀢  ?  '   diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘@@ *` init died (signal %d, exit %d)㿘 4 'H>X >`@U` , "> 6#> 6 @LK#, , w&!4`& , w H@1& ,?&! @9,&   @~f 2! @n>! `@2"!` "&`` `|2``x  @" @u` ` " &`@ ` "&`@l&`&`!@ݔ  䀢`& @ޒ  . 1 8`" < <"`< < 8"@ ` "`   "> 䀢 &  "` "&  T`> @1pa`H %> `L@T`,( 7&`,@"% 2`L` H6!0 !4!4`@  !4@`H& h  ,@>  H ,@  > ! H@% T 2 ,@12 ,@@  ( (@ H  @! @1  H ,@@@1@ > @"b@@& 㿘> tt & 8 #t 8"`<"t& <@0 reaper㿘#> %>Yctct   @.ct 8`" < <"`< < 8"@@h ,     H@!, 1@0 Hct@ctwait㿐@ 2`!` &@`?" T    , @" ` 4  ! @ 2{ L`  ( "s L L 1B2L 1 ( 2i LL 1 E  4&``  !0'k 2p` `"  X!4a H 2f X " `@ $ X@\ ( B ,@  @!*@0bK  ` $ `@ 8 & `4!0 !4@ H @]09 2 L2 L2 4`" L 4$ ,&``  !0*  '  L 2u , 2` 2&>YX!  @.# "_ T H > @2L "(LP PPL `T "L`TL P"`T`T"P"H㿘!4> 6@L#,@ `"  "`   "@ L`" P P"`P P L"@ @? `?  "` @_@>  @K \ 쀢 "> @ߎ> !p@K>cА?"cЁdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿐#`#\    @< 㿐#`#\    @0 㿐@` @ @ "  $@ ` `@   `@2@` 2#`#\   @  procppwaith>!d>  c'H'P'T 'X 2>Z >Z@RY#0˰ #@   :   p  > t `@? #>`@# ' >  @I!p @ T'''ؐ6''''>    @'''Юp-> #> %)> (+> 3> % "pñ@7 %@p >c>֐ "В , 1pH$ 4$ (bb $ b "` $b$ $ $ 4  ah* @ $ 8@  8"`<  4ah @ *`"  4 * $ < X@/  S $>` p@5>cl @5 $ , $  , " ,鱐 ,! , @ $ ,>  @H \$  /   " @ " 쀢 $ @݋ $ #$ %$  ` "$ @ $ ` "`! `  ,   , $ ," @ , $ , @ $ @ @ @"`D& @$ D$ H܀  , $ , T $ L T L"`P& T$ P$ T @ $  䀢 $ @4 `$ `@ @$ $   &  , @ɐ쀢    >@  <>@ X`$!  >& \`#\#\PT@Q耢  `` &``` @%" ` "`` @"" ` "`` @ "  " `` @"H /m * . > %""  " "4!2, 1@}H 0 > #&   " "Ԁ`" "Ѐ 4  " 4 , " 4#>Z c8 @+  ,`  4 `"@"`㿘@ 2 @ 2 > !䀢" 4"   @2 24 㿈#`> 'T'X#\  "  @f ,"& ,! @RT2& WARNING: thread `%s' (%d) exits with status %d 㿘  !> "@>\`4#ؒa @Q"@. unable to allocate kthread_q㿘  @   2>]@P& H@-I $ $ $>֒c`""`㿘>#؀  $$` @ @ ͒ ؀ 2diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘 䀢 ` @۵ 䀢 & @r㿘 ,@, @6 `4a &  6 h @&   @  6 $@$`  `*" 'Ȓ'@Ր@ ^  *@& X @&   ''Ȓ7''@ *@& h @&  @2֐'Ȓ'@ *@& h @&  @2'Ȓ'@ *@& h`M  & > c  8 Ȓl  @  `'@'`'`'Ȑ@a %"@&`&'  "@, 8 @4Ȼ א@ Œ  *@&  @& $ .`>`'8'<'@'DHX 8 ''Ȓ@ *@& ` @&   ''Ȓ''@ *@& P` ` @  *&   $ @ @'''''ܐ!@ 2|  @i<`  @@U  *@& l `> %"`X`䀢2`@ &` ` ``2`B2` =  !@  "5  `/` @i@1`@``@J `  @M@"  @@  *@& 㿘@ ( 2`7`&` `2`  &`?* &`&`! ` @`   㿘 ǘ T`  L " Hktrace write failed, errno %d, tracing stopped h 䀤 , @ ,Ȑ  '?''''''̀` '`(`, ''''`@ @ @i `>_  a@M> %" " 䀢2 &    2  ` 2 2  2  2`   㿘@* 'p?& & 6 & & &P  2 lockmgr: using decommissioned locklockmgr: non-release on draining lock: %dlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: upgrade exclusive locklockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: pid %d, not %s %d unlockingexclusive lock holderlockmgr: draining against myselflockmgr: unknown locktype request %d㿘 ?4  @@ 'p`  >`@Lǐ >` >` H@L  *@& `  &   !@!@>`@L x`>b!0*` € +  @  #2 M   `&    *` @'d:` & ꀎ c  & 0^  &  >`  >`@Lj   *`:` & 6  ?* & & 0 @  ?& 09 >`  >`@LH  ?&   @2%   4!   2   &    `&    *` @':` &   M *@&    & &   " >`@L    @(Ӑ  @נ >`@K!  6 0π   @Ƞ   " 032 M   `&    *` @&:` & ꀎ   & 02 M   @ `&    *` @&:` & 倎  *@&  }  & &   "n >`@K    @>`>` !(@K{P ?6  ` * & ?& 0   ?&  J@(90F >`@KX!h @9   5 1 @    &    *` :`@& 5 24 M @     & &  6 0>`!@K   @" 0@2  2  2   *@& @'ې D\ lock type %s: SHARED (count %d) lock type %s: EXCL (count %d) by pid %d with %d pending㿘 >b @LL!P   @>b !xV @L@  `>b@L:!diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map> F@ @ lkmopn㿘?2   0&% >c  #>b`##`&#!bЖ @%W 2# `#>c $# 㿘  @4 H>?" $`"" D" " "> Fc@` " ""`㿘`"  "`> F"#D "@@ >c?"c 2> F@x ز  Ì &% > F#@/  ,@+ 2 >#耢  & > F#@ 2  &㿘>c䀢 - > F#H` `D?#H`,w`#H"#H0" #H>`4@~֒ #H" 0#H"$c" $c>` @~ǒ #H" $c㿘?2   >c   !> F#H  #  #c#H## @&&# DDB symbols added: %ld bytes 㿐> 7"`'0# @c  0# @[ c @1> #@>#@ H'c@V B'0# @"0# @ 5'10 #@#@2+ > F"#H`" #@  "`H1>$ & @~" H0 c""@ & `"H"4 "<@~ H"`8"`0 & H0 #@"`8"`4"`0& >֐ "c1>#? 8   > F#H`` " (`ؐ ¼@ 'H``    &#H "#? 8   > F#H`8`4" (`0 @ 'H`8`4   &#H8 "8> F#H s#䀢   2 7> F> F#H @  "@ @%ː Hs H  "(   ' &#HHbH0H84@  <,  H>c"D<@IH` "`F&#C1> F >&#H`(   6  >h"c#H0-1> F (&#H`(   !'#H> $&,` &,@& &@-/ #H &`, &`,`&`, '㿘@ؔ㿘@Z 㿘> F#@ "  , ,`@) 2  "  2 , 㿘 ,`8 >`< "` 5 a>Ԑ"X >e`p     `a.`@ 2`a> > "X.``F `B  $` ` >ԑ.`bX `8 㿘 ,` 4`2   @f @݌ 㿘 ,` `~ "`   "8`  ` `> 2   > 1!0>e`  !0 `@  2``@ .`l 9> 2 @ 6f .`$> 1!0, `֔ `7 `> 7!  > 2 >e`    `@ , 2`a@ .`9 > 7!@ .`1 , $> 2 , `  ,` ,›$` ` ` .` .`"> 1* a0 `‡ 0 @*`"@> 2 *`@`| ,㿘 ,`A I`G "` @ `>   >Ԑ  `  `@ .``2` @ ># > @ >  .``= `9 > "! $` ` >Ԓ`.` `- > "!㿘,` >f"*` €      diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿀@ # H /i * * @|Z>>#DcH''?H 0@  >c4 @@2 `a   b"`l>֐ &>#0&P@ Ԕ D z a2`@ f qH /i * * )>%#P '>$D %>$H  #>c4# ? @ $c4 1>&#< >ވ>#8 6: : '#P> 'D>'H'c4'#<"'@''БH 0@z D c4 @@2 `a   b"`l>֐ &>#0&㿀H /i * * @{>>#DcH''?H 0 @ diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKtemprp_addrip6rrNDPip6_optionspacket tagsIPsec credscrypto datamemdescUSB HCUSB deviceUSBUVM aobjUVM amapRaidFrame dataVM swapindirdepnewblkinodedeppagedepxform_datatdbpfkey dataEXT2FS nodeadosfs bitmapadosfs anodeadosfs mountmiscfs mountexecttysMSDOSFS nodeMSDOSFS fatMSDOSFS mountISOFS nodeISOFS mountmrtether_multiin_multiip_moptionsNFS daemonNFS uidNFS srvsockExport HostMFS nodeLFS nodeLFS segmentsubprocproclockffile descfileVM pvmapVM pmapVM mapshmUFS mountUFS quotanamecachevnodesNFS nodeNFS mountNFS reqmountiovioctlopsnameisysctlsooptsifaddrfragtblroutetblpcbdevbufmbuffreemalloc - bogus typemalloc: out of space in kmem_mapmalloc: allocation too large???%s %d of object %p size 0x%lx %s %s (invalid addr %p) Data modified on freelist: wordprevious type%s %d of object %p size 0x%lx %s %s (0x%x != 0x%x) malloc: wrong bucketmalloc: lost datax> -#.`@`>h@D##@h` ` `5 3 `@0 . ba) ' d$ "  @@0@  @  @@@   @  - "@> $*`"@H /f4'* ''@?>֦#c.`:  4 @  @ @ *@  $  2s> $ c* @c`@ *  > >@: cL,@ @x 2> >h@C#XH 0  #d> $&  :  *@ B < 2 > c* @ ?#@$2>h@Ch#$ &2   B < > P"7o$   @b" *"@2`"@" "`  "$  $ *`2` >֐#:` >h# ` d'>#` ` ;'`` `'> &``  @`  > "@`"+  M"`>g>g>g#@cP@Bߔ!>i>h">i#`#d c:`@DcA> ` &`@d ` > "@ ` `>h#`>h>i#c`#\ @D>$?" 6 7o""*" 7o" 2#\*> cd> &`> $&: ଑* R@@>i@B H>i@B `H 0 " 2  *B? < $ `B < $@ $$H 0 free: non-malloced addr %p type %sfree: unaligned addr %p, size %ld, type %s, mask %ldmultiply freed item %p free: duplicated freefree: multiple frees㿘> #d.`> -# @> #P > >֐#.` >j#@B'c`& > $`: * R+ > $" *   *@ H /f * ' c A>׀h"`b` `@`3 1 / - da( $& $ ," ( @@40@ 4 0@ < 8@4@@ D @@ L HT"*`  c>֐#.` >j#@A* )c>@v+ `*@ "$`44``  6 @t @?B$@< H 00r7o"@ `>j'>k 2`#@B@Az`    7o""@`@ *"@6   4 * @ "3   $  3 2   $( >k@AM  (@8  02 `  ,@(` 0`B < 0` "`B< $`6@@@?`$@$ " & $ H 0>􀠠> t`&`> 8:`4&"kmeminit: minbucket too small/struct freelist too big㿐%>> ##> !> cd#P'>> FcP#\  @s>"c @v8*`> $b> $#"`(  *@  @p:  -c#* @*`@W /$? 6$%d,%s,`` \``` `". ``  -0`"  -> %> `"@   #>l .@@Bb   ?`* ǖ`(( "  @ 4> $> $G"E# 4> $> $@#X># $!4> %> $6#4 4> %> %/ 8- p4 04> %> %  4> %> %!!P @4> %> % ! !4> %> %!"0 8''  8 g > -*   @[>a O > "@    L>֠# .   @#D@ ``  @%!>l>֦"c  #>l. !@b@Ad   !*? @>ה _J@ "*@ @ Ɣ !@x> (`7*(   . ,  @) ' @"!"" !$($    @(0diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKphysbuftodo < 0; minphys brokentodo > MAXPHYS; minphys brokenphysiodone < 0; strategy brokendone > todo; strategy broken㿘> `?"@  @H /d * % `0 # !>n`0@&`0  8 @И `0``0 &`0H p@&`D&`4&`,&`p `@-   "` &`0`*2 @ &`T &`<&`H`<6@>n@> @$>n@> `  $, 2`H@o:`H  @n `0&`4(&`01@g@H /d * % `0" #>n ` @b `0b" `0 &`0H p@@`H@n?$`0h"`<`4 " `<`@@@>n@>\ $ >n@>W  "  $ $`;`` B# ?` '`@   o` &c@H /d * % `0?# @&`0@,0 `0 @`0*@&`0@H 0㿘>  @5N!@0 t!P#!& putphysbuf: private buf B_WANTED㿘 \ @ڐ 0 @"> >o@=!!@6 <@4" <procplzombieplucredplpgrpplsessionplpcredpl㿐> %""> "a> "#t> !>!d "`8 > ( ) : @!d> "ah:>  ) @H!d> 7"a4:>  )`@s > "a!>נ#> >o#\!pa!8  @3d > 6>o#\#,a H  @3Z > >o#a#\ P  @3P > >o!Ta#\   @3F > >o!XaВ 0   @3<#\> >o#\ \a   @32 chgproccnt: procs < 0chgproccnt: lost user㿘> !`> !Ē @ *`  ! 2   +" 6>o@=7#`""`"@  )  >o @="# )  "" $""" > @"   42 H 2 4 > (> @h( "   4  8 2 4 > H> 7 @4( "     2  enterpgrp: setsid into non-empty pgrpenterpgrp: session leader attempted setpgrpenterpgrp: new pgrp and pid != pgidenterpgrp: mksession and p != curproc㿘 "!>p@<!!  @`>p@<"O@  4>p@<"8 > e !T@3 >  @3!X $$ $ $ !     ,> b@ ?& ,  $` >p@ H> 7!4@* `$@" H!4@* @"@$`$`"% @Y !@U  @` D"`D D @"!` 2&!@# &!` & @` @"`D`$`& D 㿘 @` D"`D D @"!` 2&!@ &! 㿘  `"`x""`x`"  "` "@ ? ">  @4!X> !T@4㿘 H!@` ` 2 T` &`? &`@% T !@" L` 2 L 1?  ` "`? "`@  L 2!㿘  L 1 2 @  @ @ @ =  @ 0 2L 1 4" H4 " H4 "! "㿘@` 4@"!y 2!  !`   ! `&㿘@` 4@"!] " !!`    ! `   4& ` "`"  " , "" ` "`"  "㿘@`  R` &R @:`   Õ.  2& 㿘! 4 @ "  " 4 H  4 &㿘` @A  4"aܐ "5  2a. !`  2( `,@"a! a ` 2`4`4̐ " ` !   㿘`@`   @ 2 / @ @ `@ @Ԓa2 `@ @ʒa2 2 @"$ ? $ $ @ݰ $" `,!$`,㿘`@`2  @"  @ @a2  @ $" `,!$`,㿘`@`   @ 2 & @ @ `@ @ra2 `@ @ha2 2$ $ @ $" `,!$`,㿘`@`2  @"  @ @Ea2  @c $" `,!$`,㿘`a2@2 2@  @K&``,  22` `, !$`,R` `(@ :    *   ` @2@㿘>  @0#@’ P &㿘@? "@> @2#㿘   P &㿘ՠ P &㿘`  &`!` `  @㿘 !2   !  @` ?"  ,2  &  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘@  )  "`M "'`I    2:N! 9 )` ! . )  * )N! & @ 2N!  ) > % `&`> %"  )` `2 N! &  2  ) )?&  㿘@    "`R "-`N   A`@D; ` ! 1`  -``@. @ `"` > % `&`> %" ` ``2  `@`  2 `` 㿘    `` 4 &?Na 6 .a !2  .a @@ 㿈`  @@㿘`(     .`@    @ 4  2   @(   !2^ " q` ``  `"`@p & `>` `` > "H "P>!l>!d :`? 4 >2  (>@4  ` @`>`2%  "> "@ " "  "  > #8   @  @ @z  << 㿘@ 4   * `H 㿘H o4+@n   ȑH 0 @D@B 2 > %%&&&&#4`>!P, @,`b2*@ *@ b 2`* @ *`B2*@ 8*@Ė Д @@&Д @@k6`.  .`@c3`+ +` b 2**@C3`+ +`&  @ Д @@%А @B@)%5`- @-`b2*@ *@ b 2`* @ *`B2*@ *@r Д @l@&А @@&㿘@ `   M `  H` H@Д""?`"?/""`" ` " ?/"" `&"  `@"` plimitpl㿐#> G` !> >א##\>v",b   @,J  $`",@-   $ $ 㿘`? "`> @/g",diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map A2 ,!  ; ,4>wX* "* @"% @ 0   " @  @"  @   ܘܘܘLLLLLLܘLLLLLܘLܘܘLLܘܘLLLLLLLܘܘsigapl㿐>גc> >w#\ aؒ!4  @+ 㿘>  @,  $-!4 $!0 $"`$ $0 0㿘 $!0`@& $㿘 $a0? "a0> & $@. 㿈@   $` ` `2`Z ` G,`@ `'@ $ $  a*@ 2$ a 2a  $ a "a   $ a `  @$ 2  , " ,  $  ,@"   $   2   $  `* $  2`   "@  `$(H*`"  ("?`" `,#`,`4"`, 2`,2`,`,(#`,8"8"@  "  " "`> A2,, ", >ׄX*` 2a`耢` #`a#aa  a #aa #aH>זX  *``*!"!``*`㿘ΐ! ! $>פ"X! * 8 &!*` " ! &! & *$@!`2! $a $a$a$a ,*@& ,`P`"$`P " H "`  "` "` ? "("?"H    "pause㿘 $?! `$!$!@ 3>y& !(`ؖ @ߘ  㿈 $! 2`!  $! ``! *@ $    !  ! ?$!#@  ! $!$!$!$!  㿘`` / @  2`$ l 2` ` @> `    @㿘 $ > %"L4 $,"22 `@24/ " !t 2 (  !4 $@,"2@   ` 1? @ؒ@24  㿘 I)?  B  >   "  "   2 @@ @ 倦0    "  "   @㿘   @ 㿘    , @d @   @ $` xt@b't.` 㮘 , 2* !"/$( 2+$( .`< "< 't` t @  & @!`* &!>א"X `" $ !&!$ $(@ psignal signal number㿘 ( >z@2[#" ,׾@  ,>א"X.`  (* !   !   N!  .!  ! `   *@& 萊 *@&  耣`  & 耣 lN 1 hHo oN 1  %> G"@ , PhK `"1 耢?`2>!`A 6!0*  H& ,`  @֐02 ,h/` & `` * & "! l  . 1" l * & 耢 `@0  > 9  "`,! 2 2.!@ZH 0Process (pid %d) got signal %d issignal 㿘>ע"X   ,*@ +     ? * !*@ $  ,("  , h(2) $@@ 4!0 , 1@K@  , H  @[@ ,(" !0 " ?  *@ 2  * $  $. @`@`. 7  4`>{"@2  ,(2 ! `2 H2  H4!0`,  Ȓ @@S 2   2  ,(2 >{@2"}  $ 㿘 ,*   H. 1@ & ,postsigpostsig action> "@ `$>|@0!`? * *`. $``  x't  @t `۔  @k0H>|`>|@0Đ! Ho o  ?$`@` $`@ a* $a>א"X`"$a$a$H 0 `< "<$@ ($('t` `  tpid %d was killed: %s sorry, pid %d was killed: %s 㿘 4>| @0c  4>|#8@1m 㿘 ,!2@  6!2>& ,X.`` $@ "a$ "`/%s.core㾈, a2 ,!>"쀢`ݰ >  c  ` *   @: @ ˰  D `8$`  >}$``@1 '''''ܐ#@! e0P@ <  T?@*@2 @Ր  ?h @N@ 2 42cF!8 @d8 '@  $'$' ('$'(` *', Ė+@'0 `+ + @`'4 H -( ('((  К 0 #\;`#h#l @e .`> 0* #`("` *  4 #\#d#h#l @b  #`#\#d#h#l   @8 @- @ "㿘  N㿘@ n &&  & ` >~ T*` €& & DLLLDLDDLLLLLLLLLLLLLL > @ 2 " 4`" "`  4  `2``"`@*@   "  @ uiomove: modeuiomove: proc㿘  >~@.!X  `> "@ `>~@.א!hU Q` `?&?&8  "'@ "@   2@@j_ "@0# 2@@ǔ @&@`@"$`$@@"B &>` 2ureadc: zero residureadc: non-positive iovcnt㿘` 2`>~@.j#0``4@>~@.c#H  2` &`&@  "  m 6 *  `?$ $```B >`&`hashinit: bad cnt㿘 >@., H 4< , $, < ,     @?*``@&&㿘  ߔ  2&  `&  && " $  &" $ & $hook_disestablish: hook not established㿘 2 2@>@-ڐ!h``"`& @`"㿘@  2 㿘  钔  2&  & >ג#`# && "" "powerhook_disestablish: hook not established㿘>##@  @ ` @@@2@`2>@-" "@ "` @"@< 㿘Ho o >א#  €  2 0##    € 2 H 0diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapsysctlsysctl_disklocksysctl_kmemlock㿘> 7> !$ ߳ > >"!$ ߫ > >"@!$ ߣ X`    '`a2C ~` y @*Ȱ rȒ?` #>#h*` €>` # >#\>#>#>@ !>= !>!>!K -` l  B` > 7   ͖ 4`@\   ߽ 0%```` #\`` @\> 7  ߢ  ` `0 44(㿈`\   ' , 1 3? ?`4>"*` €> F> F ÐL> F(> F@@~>Ȑr!h>Ȑk!d>Ȑd!l#> "!> 7"'@  U S" 6 $"@6$"`4 F $"C >  @w! 8 5> 3"#(> "@@g! ( %> 7#" D!> ##Đ'@Θ$#ĐĒ> h @< @@גa     ԰>ِȘ"`>ِ"d>ڐ"`> _"p>א"e ` [ V > ) Ȁ a@  G> ) Ȁ a@" }   #\~n> 0 > h>  @W @hN>!|>#>#В@? @)8!>#Ȕ@##Ȗ2 "Ȑ 2 "> c* "  @–>#<>#@@ - 8hx,\t x@   xP4Pl(  ( X L d`    4 P㿘`\l ?` f>!$*` €>;> 5L F> > "tc* => > "t " 2* > -# @ />#>X@ @  > !p>י*` # @++  > !p@5 -       D P  㿘  @     `&@   㿘'P` @     `&@Py 㿘  @     `&@^  O 㿐''` @     `&@: 㿐@#\㿐 #\@㿘\@ Ȑ `  @@  `,  `% ` "&@@   ?*?@@@*&@  ߔ/㿘@    @     &@ʒ㿘  @ ` `&@ 㿘` @   ` &@㿘@  > !  ` *`" *  (&@`!> "&@ \s   \&&@   `7` 8   8&&@   ` `2l   > %d > %"J "G``-> *` €`4 "@a   `, "1`a ` "+` l @` ` `   `,"2`H@1!8 a8! b``2N`1 > !  $@& & \lН㿘&@!` `  P&` &` &`  &` &` &` &` tN 1  1 8 &a(&a0&a4 &a8@&a( &a0 &a4 &a8 H "&aP 4&aP! &aT! 6aX , ?` `?`l&a\`x " #&a``|&ad&a\`  @ &a|! `2 &a| `ah>#X @m `.ao`6at&ap6ax6ava@c .a a@^ .a    P>a%s,㿘> "  ڵ > ad a > " %> '> (@     7  "> 1 > !p *"  * $ 6$$  1 b*$ * >"Ƞ  (>#X @(@  0@"@ 8;  @;  H;  P#  T# $ X# ( \# , `# 0 d# 4 ݠ 8`@*?"%ad > " >#  0# 8;  @;  H;  P#  T# $ X# ( \# , `# 0 d# 4  8 (  㿘`"    >  > !Ī   \>! $ @!  8Ԓ@& @@&  ⟔ @@ >   :@) 6@>!!`&@`&``&`` &``&` $&`aa &@ &`  &` &` &`  &` &` &`&`>!!`&@`&``&`` &`&`  @6 / "> %  , # >  > * `|"*   ",  $ Ӕ  , `"*   Ȕ $@@: "&  "diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘#> G`>`@ !> G (>a@ @@B㿘> "@>ȑH /m4* . "  "H 0 >aP > 9> "`, @"D@ ސ/usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/kern_synch.cphz㿘> > #0c*> !P > %>>> @a@% " _ 1 ?` $   $ ># h 2 `G$ hH /m * . d h  d d* *  @ v* @$ h `$ dz@ n($ `@v !1> "@  ! L 1 2,! ,  22@" ,!@h0 ! @h,!0,!H 0  2 1@{> %@,"x>!P@ I㿘> #0*` *`@  `& `&  & ( ,@  "& ` ? & & `@ tsleep㿘> "@ `@ @a > Ho o> `> 8> #0`> 8`4H 0 H 0  >L 1 >  >@$ > > #a$ ,!$ l$   " ""$ p@̒`"  ,  ` $ ,( @ $   l  @ , 1 2     , 1@ @"@ ! > *`H 0 , d$ , { $ ,  @ @`@D # մ > #`@ p`* 2  耢`"   ,( @ Ր   @ @`@2 $ Ռ  $?a *  ?  @ @`@  w  㿘H/` / l`N 1 @ ,@ ,$& ,H 0sleep called with priority %d > PZERO, wchan: %p old sleepsleep㿘> "@` > @%>@$  Ho o> `> 8> #0`> 8`4H 0 H 00D >L 1 >  >@#ߐ ȑ:> #a,!$ l$ $   "  "#   , 1$@ "@ `@  @  @  @2 !  ۔ ! > *`H 0Hl8> Ȅ  2 ` ""`"lH wakeup㿘H > > c!Ȣ@ =   > 1? >@#_#0 l2($ l"`@$`L 1 2 ( , , , 1` $ @e> > 9" ,"`D> @ `Ȕ0 2 H 0㿘?㿘> "@ ! ,!H /m * . @e  @`@:" @H 0preempt: cpu_preempt not yet implemented㿘> "@>@"! ! ,!H /m * . @e  D`@ " DH 0㿐> "@@XҐ>   "@ `Đ" ` А"@ А"??/!`$`$`< (2   #X    9 X5  @4  X  @X`B <X$```" `La 2` ,a @m`> ?$``"@Xl>    setrunnable㿘Ho oN 1`*`>  €>@"G# ,( !0  * @&  , `. 1@dېH 0 ( ,ڐ , & >  0 > !  > > 9"`,"D,,L,,D,,,J!  ( `  8  *! > @ > > 9 ," D㿘 ` $ @8& `! 1! .!mawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %-10s %18s %18s %18s COMMANDSTRUCT PROC *UAREA *VMSPACE/VM_MAP PID %5s %5s %5s S %10s %-9s %-16s PPIDPGRPUIDFLAGSWAIT PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSG%c%5d %-10.10s %18p %18p %18p %5d %5d %5d %d %#10x %-9.9s %-16s %-16s %-8s %18p %s 㿐N   n.>J!` !N@" L@`L@ 2`L@m> %>@"!>@"!>@"">@""00n"wa0/"0,>>>>>"Xbx@"" >x>>>>>>#\"bؔ"@"rb>>>>>#bx (@"e#8^%>)>N1 KH> "@>cH   *@"R4L@ n"> w a" 7"'l3#P  @">,#p ? 4 l` N1, "#\#\#\ #`@"">#  @" 2N1> ! 2N1diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿐H /i * * > %"" " '`"'Вb@ ?#" #`H 0!> !h!hb?`#!h #`?/a  #!h#`>   `#  #`?/a  # #`H 0@U㿈@  @V*`" * `*''Ȕ 㿈 !2U )@ % `  #@'> 7"`'> %bb  0b f 㿐@   `  >!P'@s"'` nanosleepp@m  #@Z''Ԡ@ ~ ` H /i * * > "" ''H 0 ; $ > G> @0! ` ?"  #" ` LH /i * * > "" ''ܑH 0 "@'ܐ" 'Вb@ ?"" 'Ѐ'Вb@ ??Ѐ ''Ԑ*`" * `*''  㿐@   @U%@ڔ   ``>Ȑ!\Д denied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds 㿈 !2E 2G@   >`   5@ ' @ > > 7"`> %" " 0 " ">"@ !@ 1 0 A` >a\"a\" 㿐 !2 W@ S  O>ד*"@ *`" *  * # >!X*@ *`!X@ @(r & H /i * * > !> "!"bH 0 ` !В"@@'"@@ǐ'`    㿈@ W H /i4@* *@ 3   ' ' ''쀣 1> %" "`&'0⨀''⨐ "@ " ' 'Вb@ ' ' * ''''H 0` 㿈@ 4x `   2n`  &`  a ]@ 2W @ P H /i4@* *@ -  @> % > %""  b? ''?/a ? $ @& & & & @~@ * """"H 0 㿘    > % & G& ?/"?a  H /i * *      & @&  @ & &  ""@ 0⨀@ $ @$H 00H 00Á}x8   Є?  >T &"  6  "@ @" "    "  "  " " "  `" Є@@" "   H(> #h#lH h #`l" #dІ@;``@d` h   l"" #H(> #h#lH h #` l" #dІ@;`` ` h l##  "@ @   @4"@#diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK> Ć0 0 > # >  < " " " timeout_add: not initializedtimeout_add: to_ticks < 0㿘Ho o `>@ 6> >@  @@   &  & @   "` " & > Ē`0`&& `""` H 0 H`" ``@ `@"`"``"` H> `@> (  > Ē`0`  `  "`# "`@2F`08(   `0`  `  "`# "`@8.`08 (   `0`  `  "`# "`@8`00((   `0`  `  "`# "`0`0@ 㿘Ho o> 00@ > #> > (#c-> %@#@0 "` " @"@ e !:` `*   ' 2`:` '* @ `" # 4: *  ' 42: '* # @"@ !4:` `*   ' 42`:` '*  " @"@ !4:` `*   ' 42`:` '* "   ` #   H p@ Ho o00@x0 H 0 ?%9d %2d/%-4d %8x %s 㿐$> #&%>  Yf Y `2'>"' >@<`"   @:2 ticks now: %d ticks wheel arg func 㿘>  @>@Ɛ#p>@Ð#Ho o> ##?`H 0 diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘 !2s @`1@> P P > ) > P P > # >׆ "`"#  >>> probing for %s* %d mapply: no match function for '%s' device>>> %s probe returned %d 㿘   @>c,  `>@M!V` `>>@F!0V`@A!82  @ 2 `>@!@ , >`!p@&   " &   "& f & &  ^ >>> %s probe won >>> no winning probe 㿀''''耦` `  ` @ > # ' ,'"$  * 2  (*`: * @*``  2 v V  2V   2>#,`耢 " > >@"@"㿘` `  ` @ > # 4*`$ %` * 2  ( `*`: * @*``  2  @C T ` 2T` 2㿀>Rb'' ''''b>ɠ V* * @ 2V  unsupported not configured 㿘8 @M"  !>נ#0ƀ * @& root device %s not configured 㿘  >@"  @# 㿘?` .@  0?.@+ ` `0?.%s (root)%s at %s㿘  `  ` ` @ `* "@V   V `  6 6 > )`&```&``""`@ː`>>#P@` > #``@` > # "&  "  2 $V `@2 $V "6 V 2 $  6  $  뀢2@config_make_softcconfig_make_softc: allocation for device softc failedconfig_make_softc: device name too longconfig_make_softc: %sing dev arrayexpandcreatconfig_make_softc: duplicate %s㿈@ /`>@!0 Ӓ  2>@!H@ېV`  && ("& V`V` & @   *`   @ &   *` 2 0V`&  @ $`(>@y!  & $ -  , @, .`@$.`$.` 0   &@> !>!>!@N *`@p@  $ * ` >!@6 & ,config_detach: bad device fstateconfig_detach: forced detach of %s failed (%d)config_detach: detached device has children%s detached 㿘  ?* 2   >@ `  @  € - `>o  @  ` `>`$2`@ؐ`2`$>ɖ `"! 2$R  R @"2 R 2 $ R @2$ 怢 `"  "`> )"   "@@0 `@* "@> @ @$` 6`@@ 2 `   *`"` @A $`$@ 㿘`  ``(  -   $`(€ 2$`(㿘`  ``(  -  ?$`(€  2$`(config_defer: can't defer config of a root deviceconfig_defer: deferred twiceconfig_defer: can't allocate defer structure㿘 $ 2> >@ #P >2@`H2  ߔ  2">@ h" "#P " "" 㿘> #P #P  $@` $`$ " € Ӧ `2 㿘> ) آ` `$` Ò  2`$config_activate_children: shouldn't get here㿘> ) ذ #>``$```0 -  A @b - 㿘`  `@ @.`@ 2 (  " @ ," ,㿘 ,?  & , ``@) evcnt_attach㿘@Ð (&>@T#@.&>  P & ""  $"`$G" $`@@&$"="`$$@ @ $ @ 02`T T&*$$2$$"`$$2$"`$$""`$ $@ @  2`T T&$$2$$"`$"$ (   @*`2 %s%d%c: %s %sing fsbn readwrit%d%d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)㿘 D? 2`  2 ?`a>@c@>">#,  0: >a>!>!  !` >! <> T!: @ `' ` <`(@ `,` !> `8!@h`8@`,!>@Z!`,@>  > > d"!p㿘 > !p`>  " "   (@  2 ( 㿘 ! ژ @ , $ , disk_attach: can't allocate storage for disklabel㿘 ,   (ߐ  !&  "  `& 2 >@  h@,! @)"H /i * * > ""& P & TH 0 &> & "@"> p>   "p"ddisk_detach: disk_count < 0㿘 ѕ  ђ `"  "`> "" "> > p ?"d "p>@!0"0H(> "X"\H disk_unbusy: %s: dk_busy < 0 㿈 0??& 0> (@"H /i * * > "" ''H 0  X"@' \"'Вb@ ?? ` d & ` & d?/a  & `& d`& X & \ H 8@ >`CB> H> 8 @ 얂B> @t@ 㿘> "@  M 㿘> "@  D H(  :`@:`8:`HH(> "`P"`TH "``"`dH rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs )> F !?@P  Ĥ @4  `? 4 ` ,`* >@!,`@*`"@> 2*` '> @@  "`> Đ!@`e@  `e@ "`> Đ!@t @- ` >@e"@ ">,  " >L @ 2 @ > "  D#4 >@Đ" >L`D> G`P`P> G LL"`P`P"   `P " extentpl㿐!> G H  > >"`p#\   @  $ H㿘> G P@ "  @   2 㿘> G P@ @  extent_create: name == NULLextent_create: extent `%s', start 0x%lx, end 0x%lx extent_create: end < startextent_create: fixed extent, bad storagesize 0x%lxextent_create: storage provided for non-fixed㿘@ \`>@!X >!x@!>@!`+ >@!Ѐ  `> @"i @& ( 0& $`&    " " ' `" &   E 2&  & && & &  &  &   & extent_destroy: NULL extent㿘 2 >@I#Ѐ " `"`"@@a  ` "`  "  㿘      @ 9"'` '`  '@ "  & :'`  + `2@'  @ "" ' `""`"@@  @0 '` '` '@" ''`extent_alloc_region: NULL extentextent_alloc_region: extent `%s', size 0x%lx extent_alloc_region: bad sizeextent_alloc_region: extent `%s', start 0x%lx, size 0x%lx extent_alloc_region: overflowextent_alloc_region: extent `%s' (0x%lx - 0x%lx) extent_alloc_region: start 0x%lx, end 0x%lx extent_alloc_region: region lies outside extentextent_alloc_region: can't allocate region descriptor extnt㿘 >@W" @>"(@ǔ >@L"X:  >"x@>@A"@ * @(> @">#@>@-#@@ 2 >@#p4 `* `&>`     &  !  " @+ # ``(` Κ extent_alloc_subregion: NULL extentextent_alloc_subregion: NULL result pointerextent_alloc_subregion: extent `%s', ex_start 0x%lx, ex_end 0x%lx extent_alloc_subregion: substart 0x%lx, subend 0x%lx extent_alloc_subregion: bad subregionextent_alloc_subregion: extent `%s', size 0x%lx extent_alloc_subregion: bad sizeextent_alloc_subregion: bad alignmentextent_alloc_subregion: extent `%s', size 0x%lx, boundary 0x%lx extent_alloc_subregion: bad boundaryextent_alloc_subregion: can't allocate region descriptor extent_alloc_subregion: extent `%s' (0x%lx - 0x%lx), alignment 0x%lx extent_alloc_subregion: overflow after alignment㿘\'H `>@9!pd 2 >@2!H *   > !@ >H"@>@"HH& @ >"p@>@ "`>@" @: >"@r>@#@@Β H>@f#h  "@?          >#@N>@Ӑ#   *    " S? L 75`%?@  " ` ?@    ` @8 ? ^@ ]` `y" v :  "@  F? ? 86`%@  " ` ?@    `? @`? @ `$ `-" * ` `    &  !>  ,H@9  #d "extent_free: NULL extentextent_free: extent `%s', start 0x%lx, size 0x%lx extent_free: extent `%s', region not within extentextent_free: overflowextent_free: start 0x%lx, end 0x%lx extent_free: region not found㿘  >@ !  @  @@M>!@@%>@ !x:  @?>!@@>@ ! 2  @q 2 j K @ ; C@2  2 `""`"@@ >` 2!@  2@  ,@   $` $` "  $@" "$`   @  @ސ>!Ȓ@>@ <!"  "`@[  " ?&  㿘  * 2 !>`"`'   & ` ! #  20  뀎` `"  "` !"@H /f  ` * ' `> "@'*`H 0  & 㿘 `>` &`  &` &@ " &  '&`H /f * ' > "@H 0  &` &@ " &  &`    s& 0H /f * ' > "@H 0extent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx 㿘 2>@ a#(> #H @     !> #x@   2 diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘`%`a> ) "         @2 a& & > > "c "4>     > >   klog㿘> ) Ȱ Ho o  $%> '> H 0E #`$!h 櫘 "  H 002 @‎H 0> c ?"cĔ  `$  @&`$ ``     " 8㿘Ho o`> ) ``  > H 0  @"cH 0 㿘> #`> #@"? ? ,? > ),`? ?$? }@0  ~@w@=?0?@< v@)?07H > )   H `6#"> ) @">   > c"` "` "`> " diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mappr_rmpage: nidle inconsistentpr_rmpage: nitems inconsistent㿘` 2 @ Ā2 @>@ ! 8@:>@ !&  @ 8" & @@``"`& `@ "@ &@" &&"&``@  d @2 4``"``"```"@H/ /> G X@H 0 4 ? `& 4 &  `"& ` "@& pool_init: pool item size (%lu) too largepool_init: too much uptime/usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/subr_pool.cpp->pr_itemsperpage != 0phpoolpcgpool㿐\ 2 >נ#\     > #$  $ $ $   $  ?`$ $ " ` ( `  ?@  >#@ & & &  & & > ? & \& H& 4& (& ,& 0& d& `& & & P& @& D& & & & & & & " & L>@ #  & : @ %> G @& d & #>  T&  #>׺ T  "?@O&@J& $ '@  & 8>>>!8c(@ !@'X& & & & & & & & & & & & h` 2& >`H (   \#\> G>!@`P#\ L  R &cH& "@"& T & X "@$ pool_destroy: pool busy: still out: %u 㿘 T`" P X"`X X"` X T"@  !> G@x   D`" >@ M#X  ``"  "`>"#L "!<"$!<pool_set_drain_hook(%s): already set㿘 ܀ "& > \@ " X& ܁pool_get: must have NOWAITpool_get: %s: crossed hard limit%s pool_get: %s: curpage NULL, nitems %u pool_get: nitems inconsistent pool_get: %s: page emptypool_get: %s: items on itemlist, nitems %u pool_get(%s): free list modified: magic=%x; page %p; item addr %p pool_get: nidle inconsistentpool_get: %s: nmissing inconsistent㿘> "@``"`D>@ `D`H@>`\@ 2!``܀ a`€`D`H@ a "S``` J`ɒ` E>``@ @` 2R `@" `\>@ !>@~!(@  `d @`H/ /> G XH 0   @` 2`D`2```  z$``$```\  !`h`D@` $` 2`@>`\@2!H 2 `\>!h@  >@'!(7o"" >`\! @` "`$   "@`@`D $`@$`D `2  `Ā 2?>@!$`   `"$ `8">`\@"` "`$`  "@$` $ ` "@$` ` "$`  "$```@ `( $`@pool %s: putting with none out pool_putpool_put: %s: page header missing㿘 P D` @ \>@ '!>@" d @"  `2 *  l` ``  ``2` 7o> \@" b&@  &` " # #  &` #   @ D` ?& & @& D&  `  ?& ` ` Đ & :0` `2C 8  4  0 &  P `"  0K` "`&  "@# #  "@& H /i * * > ""#  # $H 0   ""&   "& ?@` "`&  " # " & &  # & 㿘C㿘 8@@ܒ :'> G@  d @ @H/ /X H 0 ` `@ ,@  , `& & ,ˢ , 0@ `& 0 pool_prime_page: %s: unaligned page㿘 P` ? $> \@" d @2$ ` 2 *  l` & P` 2 *  l"` P` 2 * " l P` 2 *  l&  & " & &  &&& &&& &$  Ĕ    & Ė@ & & #@  8 @ ??& @7o"" " "& " ??  "&  4   & 4& 㿘 @ (@7 '> G@5   d @ @H/ /XO H 0 ` 2 `@I  X  @  ( & 㿘` & ( 8@Ӑ 8@ 8& ,& , @ (@㿘`  8@껐 8@ 8& 0& 0㿘 D@  & & & H& `&   8@Ꝑ 8@ 8& 0& 0㿀 ܀ € '' %>  @0 H /i * *  ''H 0  4 4 ,@.Ф"@'>  2 " ' $" `'@?P@&  @ 8 ("   4 ,@耢` 1 %> G` "`' "@~  d @2 `"  "`  "@H XH 0耤 2 㿘 H /f> G* '> G<  >#H"<< "<M H p@pool %s is locked; try again later 㿘H &* @ H 0POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu page list: page %p, nmissing %d, time %lu,%lu item %p, magic 0x%x no current page curpage %p no log cache %p: allocfrom %p freeto %p hits %lu misses %lu ngroups %lu nitems %lu group %p: avail %d %p 㿘@ *   :  l"  p"  c" `@*  ` \> "  $ƀ d P>ƀ"@ (> ,"P 0ƀ 4 8> @" Dƀ H > "ƀ  > " ƀ Ā 3   >ƀ# " '> 0  ƀ $ `7o"#>@cXƀ``2@ 2   2 >ƀ#p >ƀ#  `>ƀ# d``>ƀ#`.  *+>)>  ƀc ,# 0 4ƀ 8  "'>%> ƀ  .`@`ƀ(`$.` 2  2 %s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%s): free list modified: magic=%x; page %p; item ordinal %d; addr %p (p %p) poolpool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) 㿐 `T -> P ` @   d @`>"@`\`/` 3 7o">+>)> `"`b@`c@ \@#\>@#   `b@` \##\@{    ֦@`2 P "  " " " " $" (" " " " ," 0" 4" 8"`" ` "`㿘 @q` "`$  "pcg->pcg_avail <= PCG_NOBJECTSpcg->pcg_avail != 0pcg->pcg_objects[idx] != NULLpcg->pcg_avail < PCG_NOBJECTSpcg->pcg_objects[idx] == NULL㿘 2' , "  0 2$ 2 0 $ 0 @ < ( 6 1  , 8 $ ,$ 8  >>>!8c@U&B ?>>>!8c@K&C* "  2 " >>>!8c @<&F "$ 㿘  2< 8     23&  2 H /f * ' > G!@p H 0  @703@ް L 4`& 4$ $  "@  & &  8 & 8 ` `>>>!8c@@&R*`$  @ " "@ >>>!8c`@ڔ&U  "& 㿘 $"  (€ 㿘  m  <%>'>->+>)> 8?& 8   8@&B?8b@&C* $   `2" 8" @&F  2 $ "&  $"  (€ ƀ  2 8`") 4?& 4` "`&  " "& H /f * ' > G!@~H 0 2 㿘>0 㿘>D 㿐   '  `_ `[ 2Y 2V  `2Q "N  2J 2G  H /f * ' >#HL  ' H 0   2!     0 0@g \   & \z㿘 P@€ `. ܀"(  €@€  H /f * ' @/ H 02@ 㿘 P €      `  ?& `z T 2 `t  ?$ 㿘  T`X"`X& XT"@"T T"X "& ؐ  &T   &  㿘>c> 6`\@6 㿘>c@6Ò㿘>`> 66`L@6 㿘>`@6diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapkernel %sassertion "%s" failed: file "%s", line %d㿘> @%s: table is full 㿘>`@4 panic: 㿘>!d#>  c0@?H'H 'L'P'T'X ! `!> G"( @$c0>@]!@t>@W! >c @L@E㿘'L'P'T'XH/` /@   @ИLH p@> #`L  @ G%d㿀  <@A >bx@GO`  >L @3  L   > @* 㿘'H'L'P'T'XH/ /   @HH p@> #`H  @z  㿘> #0`>"!Ȁ`  `>!Ȁ ````@aȀ""aȀ`- + ) ( > # `# > ) * `  " `"@ &"   "" `>!Ȁ` ` `>#@`:8㿘> "@'H'L'P'T'X`,  a  `   @H ,"  ! `" @"@! 㿘  @? "@> ː!X㿘'L'P'T'X       @7    @L>㿘'L'P'T'X  @L㿘'H'L'P'T'X   @H㿘!># 'H'L'P'T'X$#  @H> #0`2$# $#㿘!># $# @t > c0 2$#$#㿘'L'P'T'X  @_L.㿘!># $# @R> #0`2$#$#. 㿐'P'T'X`?' @7P*@?㿐` ?' @$*@?%llo%lld%llx0123456789abcdef(null)0123456789ABCDEFbug in kprintf: bad base8  '`' '   "Q. N nN % 逦``8  ''? N `ZY>"*` €` ? ? N ? ?L@  >`  >`< O3>a1O ``  " . L L 쀦` @L@? * :   1`"̮ < ,*@ < ,L@  ".Ӕ`L@ ` L@ 4`L@ `U`  " >.I >DN`>` !   ?    @?* : ?: ` - ,@ `>!'  x ?     @?* : ?:   2  `` -`" N  ? ' '  +N`*   ?&?NЀ   , * ?РNЀ  &֢?ՒШ  , * ?РNЀ  ' @N l2    ?/    ?``    @?* : ?:  ` -` >   x u o  ?=t:  @ ?m" ?h2    ?   2   @  ? ? ^  ?>a '  S x ?`>!   @| "@ @j    ? 2   @  ? ? # >!(>! ' ?  2   @  ? ?   2  `' ?`"R' ".  5,A> 4, 40 - 806 03- @̖ `0- @  8' 8'0-,4   4 - '!@'@א '?`Ӭ/  @&+` ` 2`@  ' " ? `2 ' ". ϔ ?< `  ".'$  `  0" 0.`  "v. 2" ? 0`  0 "].~ ?# (? 0`  0"E.f ?2 M "2 .P퀦` # ٠? `  2..3 ?N`2&njnj$njnjnjnjnjnj,PnjHXnjDnjnjnjnjnjnjnjnjnjLnjnjnjnjnjnjnjnjnjnjDnjnjnjnjnj0njnjŐnjnjnjnjnjnjnjnjnjx8PnjnjnjPnjnjnjHĤ0nj4njnjŜnjpdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘` @@`% 2   H /m * . `"` " @"`"H 0 㿘,  `@ &&@`   @۵ * 2` ` @  tt͒@? $`$` ,  & ,> 9 "`,㿐 , ,* ` @ $&@   @ۂ * 2`@   @` sO   @7sL  ?vverbosettimezonesshowquitLlinesllisthhelpffindqexiteenableddisableDddbcchangebbaseaadd㿘>ɔ + >>ȐԺ.((S7>IJ#P4P&IJ.`(@2>"c .`( # $> #!#--- more --- 㿘!>#Ȱ  >#̀ 2 #>b!(@>!8[$##ȓ,`:` `q$#Ȁ`Q >>>׀@"> (Ȇ`( "ԁ %d㿘> 5#>bd@%1>#>cؐ !> ( Ƞ@t!@#Ԓ@&#ԁ>>؀ > (Ȇ ( >"#"ԁ%d0%o0x%x㿘` ># " >4 >  >>"0>"0"%s*FOUND***UNKNOWN*㿘. > . @>ɓ*` @ >Ԑ#`V `*`> ( €>V ǐ"0 >Ð#h0>#p0>#x%3d free slot (for add) %3d %s count %d (pseudo device) Unknown devno (max is %d) %3d at root%c disable ??? %s flags 0x%x 㿘>הc.  >  >c*> @s0y*c:  >cH#& *`>͐"*`> #L >  `W0]#: $. >N 0T@>ɓ*` @>D b>? V? >7 V?"T #>/`VL | V?T   4>> > >Ȗcԕ* R  >Ȩ#  '>V*  V? > 㿘N -    N 02% N x  X2   `     ɠ  uJ  *:   2Ѐ  ? &@ 㿘     `O* Є 8O /`8 (. (> а`` ?O O "  "  " O?#66 㿘N?   +>J@    `,`cđ:  4- *>ȧ: c,`: @62 `@ݳ "`* cē:`@ - : ? &@?%s [] ? Unknown argument 㿐%> 0 +>)>'>bh@"p (@L0J@ "` "` "`J@    &@x   ؒchange (y/n) ? flags changed %3d can't change free slot count%3d %s changed 㿘># 4>ס. E< %>#>Ð`@cp, :``y`Y`n`N, :  y Y^ cl. >ɐ`*  `  `%>Ȁ `  "`$`" `$@ *``R@?  `R@?,  Ԑ` qoR@?">>Ȯ# T* E %@T?`>#x;`` ,` @ %`  >F >c>@#0T# >#50K>#H 4D>. < %>#>&`@V!cp, :``y`Y`n`N, :  y Y' cϐ!>͒& #H*`>@# & *` >͐&?b* @>#k>ў Error unknown state already disabled %3d can't disable free slot %3d %s can't disable pseudo device 㿘># 7 . @>ɐ *`@R` "   "  >4 > 2` 2` >#p> . :  ># >I dWv>#0># >>#0#H  >& ?>͒b* @>#t0q  enabled %3d can't enable free slot %3d %s can't enable pseudo device 㿘># 7 . @>ɐ *`@R` "   "  > " >2` 2` 7#p>3 . P:  >+# >ې e> !P0># >>!`0#H  >& ?>͒b* @>!0 command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devices enter ddbattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know㿘>Q##>cܪJ@ j cܡ,@E@@3)>`  %>;8`` cܗ, @ ?* : `2?*`># €>%#@08>!#p04>#00>#0,>#0(> 0$>  80 >  `0> 0> 0> 0> 0 >!@0>!h0>!#pcܑ,J@c܁LLLLLLLlLLLLLLLLLLLLLLLLLLLL|LLLLLLLL L,L<㿘>נ "#Ȧ%>#>͑, :  cH ?* ?$ȁ%s 㿘>נ "#Ȥ #>א#,   > cĀ? >Ȑ?$ȁUnknown routine /%c/ 㿘>#>צ   P"c>>ȸ#Ԭ`* W ? >ȓ.#ԯ:` ,1>T- `2@@@" . :``e `s`d :0 :0 ې i < '!0   T?͢` c$?>"cȁUnknown attribute 㿐L@?  ->L@    2`L@,L@` "`` "`` "`đ:  4-`*>ȩ: c,: @2 @N "* ē:`@ -`: ?2L@>ǐ"0   ǒ >G s0"xUnknown pseudo routine /%c/ 㿘/ ?  c >"#>  `Y'>͑.:   @Ն`2L $ @ 2D $.:    T `` 25 $T 21 $T  2+ $ *?  d e c >!0 f>!0 $ $  $,`ʑ:  $I?  $ `H @6A? .>!>׷: b#%>,`@@ب ,`*H?  d"# e c #H f" HKH#HK H* : H? `H@̑,`?  c>א?"cȁValue missing for attribute 㿐NN    2 NN "  "  " N >ѐ#(0ג  >.`.: U:0"x%s ? Not same device type 㿐?'> >ɪ 0' )> @҆ (L0L "  "  " L < 2$L>#􀢀 > /`* * @@  .`:  a>v ` ' ? q   f ` Q>_"x` `No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')h@ϒ $>#>c   >!0.:  >> !0  `  @`2 $@o " $ 2 >"0>"   a/̀?$* *଒`>` "H' '`'` '`'`'`'`''77ڒ i ̀?n a|.y: ,v: t# !̑+` * >ɒ` $  ?ܚ?## ?䀠 ?# ?# # ??# ?# ?# # ?> (Ԓ@Иଓ*`# ؔ@ "܀"" """" " >ɐ $ R>"` >͐"  R# %#` ? @>`2$@ֺ 2 $V  2$V4$ 2 @`2$@֗ 2 $V  2$6$ 2 * : Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d autoconf verbose %sabled endisUnknown command 㿐N  />N "  " N - N    2  J@ ? @Җ2  @ "  J`NN "  "  "  M@ [ >~"V *` ?* : `2H*`>"t €N >f"> l >>4"#N >T#,   >W"W N H > ` `>>"#>,#  N l- O n >Wr c@n  0N &  dذ  1ϰ G >WK dN >#P x  e ݒ v  >W" eN >﹐#8   * *:   d>W fWv G 0rN U> 0kD qs?0fN  0_x\ N  9>N#>Ȁ -%>$a\  *`:   2 NN "  " N  a a\"  ta\a\ .a\a\pD @"x >,>`?`",>#>#.  >)# \\\\\\\X\\\\\\\\\\\\\\\\\\\\dh \\\\\\\\\\User Kernel Config UKC> Continuing... 㿘$#>>#@> `0ݐcX@θ (   >А#`    N - diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿐@  " `  `0 "`0`#\`@  hВ ?'''''쀧 '4    @`2''  耢 ?  #2   `  &  \ Ș \"0,?`&0ɤ0㿐@ Z " `  `0 "`0`#\`@  8/    $  v  _  '''''fF N'   '  `=     @`2   Cؔgߒ  耢 ?  # 耤$      \" 0,?`&00㿐@ Ē " `  `0 "`0`#\`@  h '''''''쀧 ':    @`2''  耢 ?  #  2   `  &  \ Ș \"0,?`&0ȡ0㿐@ W " `  `0 "`0`#\`@  8/    $z  r  f   '''''eA T'   '  `C     @`2   >ؔfڒ  耢 ?  #   耤$     \" 0,?`&00 @    2`0b b> ` @ ?* ` @  * #,2` Ű  0 $ 0   Ȕ x `d 2 0 @   `$@ b|"9@"{"[T m b}b~2f @ 't    ?4    b~te@ 't  @  ?4    b}tQ'tT    ( "<  "@ `A"D   't 2!5  't   `vt) 2  ( `<!$@ `w@ $@  2  0`d 0 ,?`$ 0 0` select㾰 @ 4&@@`2 a- - @,  @D-  ','0''' '(88@1 Xx','0?' '(` (c 2,` ,c 2,` 0c 2{,` 2c  2q, k H /i * * > %"А" ? @ ' '?/a  ?H 0%>  %> ,`@%,(@j@ 28, 24,`  $+,Ho o,`@ H 0,%,> >Ð# H!W H 0 ",,? ?%,  #" 2(``" `c 2``c 2` ` c 2( 㿘` 'T 2 *   6<`>ذ h 4* &@, 2 03  $ 0 ` -`   4`*  `-  & 0 ,?`$ 0ܐ 0f " ?@&ԑ- &͑4``@T " 㿘@ 4 "&@ " &@ l> # @2&@` 6`㿘 3  > b  "b> 6 ř#  "&Ho ol> # 2 ,J1 Q 0 0 @ ?",H 0㿐  'I ,`2 < 2 0 2`1 $ 0 >خ >ت t  T`@ `  "  `` @4`  0 ,?`$ 0) 0 &,&pollp> al@``  * `   @aݔ @`  `2@` `?<#@ÿ* "**% *"@ *`@ *`?Ѐ f H /i * * > %"А" ?А @ 'Ѐ '?/a  ?БH 0->  -> ,`@$,`: 23,?(Ю $+,Ho o,`@ H 0,$,> >Ő# !† H 0 ",,? ?$,  #" @aL 2@M diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿈!>  ! ޣ@v ޞ@q& G 2 >2`  "`"(& 2.2 2` " "`(&$`@$ @, ?",`0?"`0`, `0, ?",`0?"`0`,  `0  @<`@7pipespace: out of kvm㿘>`@ & >!> H ( "(㿘&  4& & && & D& @@& H 8  4& 0& (& ,& $@ #& <pipelkpiperd㿘( D! #>Ɛ"$ D!a    D!" D !$ D z H O$ H  $ $ " $$ $ @ V  ?$ DpO D ~b$ D |$ De & # D>Ɛ $ D! ] 2D H D!#>Ɛ"$ D!a M 2  D!a$ D 2* H" D" D  " @ 8 @ 8   ` "  D ~b$ D |$ D 2 H@= $ H?  $ H D  ?$ D !T@8   D  ?$ D " ! D @ ?$ DC  D   <#@ '  j Expected pipe buffer wraparound disappearedExpected wraparound badPipe buffer overflowpipewr㿘 ( @   D "T  ##> c| 4   8  2  ` > H`(>" "`( @ c|@$ `$ $ $$ $c|  2( H D!#>Ɛ"$ D!a  2  D!$ D  D ~b$ D |$ Dc H $ H  "@@ $ `u s %>Ɛ"$ D! J   D!$ D 2 H "@@(  D ~b$ D |$ D(}@ "@ @4  T 2, D@    " >0!0$B 2 D   $ $@"$ >!`  $>!x D ~b$ D |$ D 2@ H5 $ Dؐ  3 # D @ ?$ D%  D   <#@    " DL  D>ǐ $ D!  2 H D 2    D H  H?  $ H D  ?$ D   D  ?$ D    " 2@ ,  D @ ?$ Dǐ  D   <#@     }@  ( ~@ @ 0@ @ 0D D    << "㿘 (`  @``"# D3  /  +  D '0"$  D 2   " !H  D @& D 2  "  D  6  D @$ D 㿘`(@6 `6`  &`@    @ C B?@Z>`0>`8 $&` (*`" *  * &` ,&`  0*" *  * &`$ 4&`( 8*" *  * &`,``&` ``&`㿘 (@ $ (pipecl㿘 f D @ ?& D  D   <#@ ݒ  " H   H !> D`& D !ؖ   H` @ "   D @ ?$ Dː  D   <#@   " D  D`^$ D$ @ ` (> H> c|?"c|> H`(>" "`( @g > !n`4(R` @ >؆"`8"` " > "`8 "`"   4(R `@ `2 "``2`  `2``"` 4(@" D2  `" `D  2     4(@`" `D" @  2 "    ` "   pipepl㿐>גc> >#\!ax L  ث diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKptrace: impossibleX@  ` 2 ,W  , O #@`#0>̐ X*` € 44@&"? (<    2!"  4ْ2 , 4 2&> 7"$&! (  H L 1 2&0&@`#  >ː#ȓ*` € , ( H$ ,4$ X`  '` :Є@   ?'''''''' @ٖ؀`&` [  ĘВ :̖ '''?'''쀠' 0 0' ' @̰" `'[ 0`     $  , 2`@~``" @+ = ?)$ `     $  , 2 @c  H?$ `4 X "  , > ! ,*@$ ,$ XL 1 2` `_4!0\ `Y OU ?R$  &`  , H($ ,`4@$ Xc &`  @  `    P?@ ?'''''' @$ @* 2` Ѐ   !?@ ?'''''' @і>["(+++/++/-(..-,L////////////////////../</8++D+D/T+D+D/T+D+D*+D+D/T/T/T/T/T/T/T/T/T/T/T/T/T/T/T/T/T/T/T/T+D+D+D+D㿘 (   @; 㿘 (   @9e 㿘c  (J "7cE2I  "~ ""}2=  ##26  ! >3 E    p" ` p = 3 3 3 p1  L # < # @`$# D <  "  2  " i r   @   ` @   @ 㿘 (H /``* !`  ``"H H0Z" t0W L \@   V 2  8 BH 0F  x"@  |" 4      `  8  H 0# L   6   @ H 0 7 d p 6 pH 0 㿘 (@2 `06` `  @ 㿘 (  @7C$ (diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘.   `@ 02 ``@q`  ``@q@    2@ 2` 2` 2` 2` 2`  "` "@ "` "` "`  2` 2` "`msginfo.msgssz %d not a small power of 2msginfo.msgseg %d > 32767msgmaps is NULLmsghdrs is NULLmsqids is NULL㿘>Ȅ!    > (*`2* ">S"#@$> )>K#(!̀  >D#H  ?422@ ``> 2b> "c>)#X`  >    "`"" ` `  > > `|`"> #h  "`(2``\msghdr->msg_spot out of rangemsghdr->msg_spot != -1㿘  (> > > >V >Ț!` > )8!̕* 2  ` 0 6 `&6 `"6   2V V ?"`>޽!X& `㿘 &`  L&` `D&` $ &` (&`  ,&`$ 0&`( 4&`, 8&`0 <&`4 @&`8 D&`< HZ&`@sys_msgctl: msg_cbytes is screwed upsys_msgctl: msg_qnum is screwed up8 ?@c ``>Ȧ!  6 * * > " `|*  (`"~ V@  @2x "4 0n\ 0k~ e `" `  $" $ $ $Q@`2` " $>4"؀ >.#$ (A V =Wה \ 7 (@` -  @8' ?$ $ > %  a  4 $ ($ D%!  W \  "&㿘`  @`) >Ȑ  . > * `|"*  (`"  2  ` f& K  a "> Cb?  >Ȇ . > * `|"*  (`2  "2  2$ $   a$ > %$   $  `$ 4 4 $ $ $ $ $$ ,$ ($ 0$ 4$ <$ D ?#*`@& msgwaitmsg_perm.mode & MSG_LOCKEDsegs_needed > nfree_msgmapsmsgsz + msg_cbytes > msg_qbytesno more msghdrsmsqid_ds is already lockednot enough msgmapsnil free_msgmapsnext too low #1next out of range #1next too low #2next out of range #2didn't use all the msg segments㿘%?@` ``>Ƞa  * * > " `|* `(`  V@` @ .   @?`(%>π 8 `` "  @  @  > c@  > `   h  b4` !X  ` 4` ư `( ˖ b">ܶ#`@$>ܰ# >ܪ#2b>ܤ#4`? 4 4`)1>!>㄀> ܓ#PԀ܍ >܈   &> )>܀ 0!̗*  `0#3 4 V&  S   z`?! @;4`' /> $->+>Д  +`: 4NH@I`XZ>ഔ@U %> )!̓.` +`: ?"`>1 p?a`( 4`;( ` 2`$`  #-`?! @4`0"$``> %"`  `$ `$` $`$4$`,"$`4'msg_first/last screwed up #1msg_first/last screwed up #2msg_first/last screwed up #3next too low #3next out of range #3㿘 ?@c` ``}`>ȸ!  ɰ * * > " `|* `(`V@` @ ޔ! ` A @" `")$` 1$`>ە!@` * >   @4 @  "`   "$`u` $`2 $`>n! 2  0>ϔX! = ` `(  ?V@c` S  > %` `$" $` $`$ 4$`0$`< @8 T    09 #E 03 *7> $5>/>Ѧ!%@  *: 4@Y ഒTʔ > )!̓.`  ؐ'@ sema is NULLsemu is NULL㿘> %" 2> %>!@#耢`>>!P᜔    "`2`᜔`@a  > > %#`"@`d> ""semu_alloc - second attempt failed㿘 >> ` `> %# > ` 2 "@""`%2``d`> `R` 2 @"`" `2R`` ځ" `̒ᜰ 㿘@2R> "쀢2&@2 R "G  2&@@ R @)  2`R2` 222R % *`: @2*  #  #  @ݔ  *`:   * `2 22"  > 쀢1R @'   2R"S  (8@ 2( " ?"2 R`@ޘ 2R㿘 &`  06` `(&` $ &` (&`  ,UM&`$+P ?@c ``V` >Ȭ! 6T > %",  ""L V@  @2F  > >Ԑ#x+  € 6> )!> " * @*`@ *`@*`$@  :` $ " @ # .` *    @* @*` `" `@ "`"  @> %""!  ! *` * ""!`@@4  S  R @ ?$ Ė$ > %  a  4 $ (_! R  R @M! `&  @6 ,` * @`9! `&  @6 ,` * @`%! `&  @6 ,` * w@! sR  m  ` @c.` @ R  ` 0Y! U`&S  @6O ,` * @E`  A`?  @;RZ  4,`@*` 2 !Ĕ %RE    ` @ .`  @R5  ` ?[O   "&NOP\PPQDQRRXRȝ㿘@  `1` >a > %".  ""  2   !> %".  o@ q` @&i  &\c _ `>Ȕ! @ U > "@ @ a a> %" b" a   `@@"2 a#> %4 b. "?" "" * > )" 222" +`> %b * .`"("@@#@*` ? *`@ & semwaitsemop - can't undo undosp`?c` @'L '>!   > %"- "V@ @ ˔   - ` QF* " 0   7  @@*` * U` `` # * `2  2 `2 @ ` 2   2 `@2 `@ Ϛ`@D`$`ښ @?* @*``  " 2 `(2 #U` 2  4  4>Ք!  '" ?V@c "U`s  2 ?4 ?4 M @\ܸ 5=R 9@ y 0Ԡ , * #>@"?V@  @d "?ؐb? 0  * @*`   " 2 0` @ ` @`*` * `4$@ LL "semexit - semid not allocatedsemexit - semnum out of range㿘> ""  2 <T  $6 @62 ,` > %b* V bV >i"&>b"Ȁ + @ *  @@ 2 @ *` 2 (T `@԰ $ $diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK> @ 6?> "`2` @ 8??@ >6 * >  ( 2  :`   㿘#> c 4 `@@ڠ*@ & 4`> `#4 > "@##"6 "㿘`?# @> ,`"* > c @ @TE*  ?&` $> %"*`$ ,  4 $ $ > -"" 㿘   >Ș!      !?!@@! "    㿈 ``>Ƞ!   I*    ?`"@ ` " R@ 2`f @!! [>Ȗ!  ` `?2 H > # 8 `     ``" #  @?@2, '@̒  '4@. @ @ #`#\ @ɚ  > %$@@ $`4$$⨐ 4$$(&` @ 2`P `8M >ؐ"*` €! 2@`N 8 9 7 20`N 8 2)?& ̖& > %  a  6 & 0 2 & V $$` 6 @?c > -" bPaaalalshmget㿘> ."* @  d@4 >ؐȒ!$ _  # ``"` @ ` && ? #*`@'  shmseg free count inconsistent㿘>Ȅ! `'Pሀ>  !@  >  > *@@: @@  t > -`? @ > /> % b2 ሔ  `@ `8@""` @  >#" > /> %, $@,` ,5 @`?*@% 5   Ő  ?c ,  @+$% 4% $ c (5 % % `%  45 $% % % ,% (% 0@ :@ # & P&#" @  ?Đ*@5  㿘`@` !@   #`" C㿘 >(&`!  ,  Y N&`  > ? c`? * "@*` `$ 2`$ `㿘 >Ȑ!  @ 6  ?} `@   & 㿘> #!>!Q7!`  $!>  "2`2` `8> -""> > "a"#㿘 &` &` &` $6` (&`  ,&`$ 0&`( 4j&`,diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘H /e * & `p &`l &`p`@ &`t`p =&`pH p@ 㿘>aȀ""aȐ@  & p 6 & x& | 㿘`l *`D@`( `@a@ Аa > #@`DB:#@` &`D> !h`$B:!h`&`$> "X?`B :"X7` @ . 22W @u  `x` @2*`p" `!@e ! "!@]!  ( 퀌@`@"`p@`p  2?h2`*&`p!d=` 2  `` @ ^ @`p@ c`p &`p ` ! @`*@&`@ @ J``( "`@ `&``6 2  ` 2 `@ܒ @ &  `x 2   `@Ē @ `x  `p) 2 " `p2 `n> 2*` * "  * &`p { c 0v 2h`  2W`p2  `2`@2 `(2` @@'*?`p( ( 7&`p ) ! '" `  ^" ~  | { } \2?(&`p? ( 2  " ` " `p@`@ `p2/  +`V``@` `"`p@`@ y` `p@ k` @ f``"6`@ڐ`6``p>*@&`p 2B  >d< b`@ R@Z  ?"`p@ F@N?  >ؐ!8  @@ 4@<?   ` @@ْ`p 2  d" @ ǐ`p 2` d` `x @2v`p@ r`p``( # V``H 6d`p @z_`p@ [`p`@ S  @ @ ϒK`p   2`ހd  6`@`(@  `p`ޒ`*`:  6``6``p@*@&`p /@8V`ܐ@  2`p `"`pV`ܐ" 8  $ `p @ ?  `p! 2`   ` `p* &`&`p@Ր 㿘` 2 > "8 `d``B ;"8 &`d`H@ ۰? <  9 `5 `ܔ   "$ H /e * & >ݒ`H@ x> b8&`d > B;b8&`dH 0`܀6`?  2?  ` > "8 `d``B ;"8  &`d @`H " 6` 6`܀ ` 2 ` ?  4? 1@`@.@?`>ސ p*` €  ' ! ^ ( ) \? @> b8 \`dB:b8 &`d@w`H =`@ > V`܀ "2?> "8 `d``B ;"8 &`d@Z`H  >ؐ!8  `?`V`>ސ T*` €4 6`` " 6`  ?6`ܰ?x4xDxxx<xDx,vwwwwwwwwwwwwwwwwwwwwwwwwwwvvwv/dev/console0 `@#`}@? ] r@<#> %``^@F!> \`{@Y`z+@@+#> %``@%`e@ `u@#> % ` @ B` @`@< h  g@ #> % 3 `@/`@ -#> %!>؀ ,   bx!! @ ՘ #!|  ,` hx ` !  " h@"7`n@>`@+ `@` @`^@ِ`a@ߒ@"q h `o@`"@fϒs@w@ѐƒ @> "}@ 4 "~  @ ] r@@@Wv@s b@Ue@  g@~  `@`@ 0ّH /e4* &  p p ?$pH 0v @q&H /e * & p$$pH p@\ ` ` @ؐS  4>!Ȁ  " > p ( (>A >ސ  @ '''''@S 3@w` @@xĒ!@z @ZS $!>aȀ""a @B " 0I ,  6666!| 2  , 2 x !2  x "y w#H /e * &  $H p@Ұ H /e * & p ;$pH p@ HHH /e4* &#@  @֐   H 00 @2@  : Ѐ€ " pH 00p2   2 $ ߐ"$p@q$$$($(` |    @|  @"<  ! @4`$@I-@`( '''' ''('$,$(0$ 4$$8$,@$<$ $$0$4$8$<$@* $$($ ( 7&  @  $H  H 0 #8 l  hH / * & >ؠ"X*`  €. €  h*` €H p@0,hH 0İ H /e * & pa   * ~$$p@ސH 0  `  ` >!|   , > h"X*`  € H /e4p* &p n> 2*` * "  * $p H 0[ ! ` `T ` |" J   "!` $|!$x! "`  , 9' ,!| 1  , -2 )  & #$x@  @ϔ   4 44x4  @͘  㿘2  *@ *`> 2"@  *` H /e`* &` `"V 0@   @ p  x 0 H  H 0  i H 0 㿘6  * * > 2" ` * `@€V`? ?2  >ؐ"8`&`8>ؐ"H`&`8&`> 2*` * "  * @ <H /e4* &   "2 "H 0 㿘 `>> 2*` * "  * @`<@Y$`   p@`  4`  㿘 >> 2*` * "  * @ <H /e4* &   "2 "H 0 㿘 >> 2*` * "  * @ < H& R 䀢    㿘 @" @ !  (    " 㿘 H /e * & # "'>؟@ H 2 p p * p`2  " ̀ `& p H!0@V  H  p` `2   ̀`H 0㿘 @ 㿘H /e`* &`  (`" @  ( `" p@   p>*@& p6 @6 @Z`> 2 n*  p* " ~ & p* € H` H@  H 0㿘>ؐ  E5 㿘  ($   p ?& p!$  ( p @2 ( !"  ( % $"  "  @  H 2  p`@@6& p @@ Ԁ €   p @& pttrstrt㿘 >u#8H /e * &  p @ & pH p@㿘 ̀`@ 㿘`A 03 㿘 p"` @` & pސ5 22  n> 2*` * "  * & p !  p ` & p  @2  | "   "   `@u& p 㿘`" p p & p ` & p  @2  | "   " ؒ   x   p*@  &  & p   ' ' '''''& & & @   p *@& p㿘 㿘> "@'L   ऑH /e4* &@ H 0| +,'x#   `  `  > %>ؒbx !@ `ऑH /e * & a;>!PFF @  &1p0z  )s`     >bT $ ]` `W` "p0Q( N(p  @  L  H 0  H 0 #>!(>ؖ!!@ H 0`" ` 2 #   # p ) #m`&ऑH 0%> %5>E 2  d$2 x  `:x !@˘ 2 2 '* !       d  @ s 6 H /e4* &  @H 0` 㿘 p @%  $" ` "  @ J H 2  p & p @@ Ԁ €  p ?& pttckoutq㿘V H /e`* &` > "@`  HȀ@$@"'>`> "@`耢"  pH 0 >aP & p  HxҘ  H@H 0 0` V   H /e4 p* & p*   @%  H 0  >ؑH 0 # !@Ә H 0ဥH 0> "@ | 2/`, "+` x& @" 2!` 2` 2`  v   > %>ؒbx !@ g `_  @2&` Hc d` 8 n 怤B) '> /> 8@ ?6 @ 6< H `8 H40  H@ 6 ޠ$8 ܚ@  d< C 6 ܒ@<8& d @$  H4 ``2 4 `A&` H?H /e4 H* & H  H 00" pH 0` &` #>ؐ & p0 H!@ H 02`0 ttyrub: would panic c = %d, val = %d 㿐` h  *@`{&`V`ހ &`ސ> >ؐ!8  `?f> * €@ w`` @"s`ސ@{ n`ޑ*`:  @0fH /e * & `p`  V`ܐ`` &`p&`@ 6` @@ f ` `p** &`&`pH 0V``ܠ$  6`ܠ ?,%`ސ ? `>"Ʋ`ހ` `p 2 &`p \@j``@e`ސ?6`ށ̝㿘`   `㿐 @@Ԑ H /e * &  (@    @'@  @  @@ ה  p*@& pH p@ 6 6 ށ㿘`p@2`` *@&`` (  ( @      ^   ^t  @ ?l㿘  p   x _  i @2``@2@?㿘 @ 2`@: !4! & 6 6  (  h* h 4(  4@A 3* @*`@*`6 load: %d.%02d not a controlling terminal no foreground process group empty foreground process group cmd: %s %d [%s] iowaitrunning%ld.%02ldu %ld.%02lds %d%% %ldk 㿈 > #0#>*` ,  , $4 ` d@ d@sZ | 2 x> ``2`>`0  >`PF|6 ަ@y 2 @ L1>4 p`    > >  %< cДb? '?/!`''' @Y>` '?/!`''@B!> h d* * " *  * $@02 L1> 1`     @3s@ ː6 ށ Z  1   `1@ "H 4 ```+8 1`4  ?@ ") $ `"`4` ,`, 2`4 `44  㿘H /e4`p* &`p ( (  H 0? 2 ȒŒH p@ 㿘  "V , : @ ?>  >  㿘&> & "@"> > "c@ tty_detach: tty_count < 0㿘> b? "b> "h`"  "`> "# "㿘  >~a!@!$ @= $ @9 ( H$@5 㿘@U @S (@Q H7 >㿘`   >    -0   -0>  "X"8> !h> #@?diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘 $ . ,   }> "`@;> 7"" 㿘> 7? 2  @ ` > * `*   k4$ p p  $" ` 0B"$ p! # a %$ $ $ $ $ $ f ̀ " p p $ p p`2 hb`$ p%>ؐ !ޘ  p `"$ p h>ؒbX* @€@  㿘?2  . >  @*` > h"X*`  €@ 㿘?2  > `. * > b@ ` "h a | @ 7`, 3 x"0 (%)> %'>a2c `2_  ` W  } "x! j Ka |   `,  x2a ( 2 (6 #>ؖ( (!K "`0* $ (` "  (@ (  (  2 (@  ( ( 0  > hbX* `@@` 㿘?2  > . * @ ̀   h>ؒbX* ` @  㿘 l? 2`  * @> *` p!  `  * "@& 㿘 l? 2`  > * @*``    ?" `* `*``@ 㿘 l? 2`  > * @*``  f P`׹ _ 㿘?> 72 b   . ) > `* @  @$@ ̠ ̀   h>>ؐ!bX$ ̒`*@    w$ ,!$, 㿘?2  . >  @*` > h"X*`    € p$ ̒ $ p0?2  . > * @@ %>؀h f # P!(  ] p `  ` ` L ` @  ,`@8  ,` > `" H `! "  Hz 2,`!/ `  j``   d H  @ T  H   p  ?$ p H 0?2  > . * @@   `p w   "l``( m`")`(  d@ 8 #"  8 p`p T @`(` `(#ܖ`(@l ِ@U  d@ 8  o G`p + >ذ"l``( # ``!2 `h``p `h* ?  ` ͔ `p  2`>ؔ0`!  "z`p`&`&` # 㿘?2  > . * @@p '` ``) 0Z= 0WH /4p* &p H  ! H 0 < H 0 p ` ` *  `! # Ւ` ` "(  ( #Ѐऀ! ո` ? 0 * > `(㿘?2  @> *`ࠐ *   `@$` "`  " ` `@, Ғ `((" `   `@, Ò ` 7$` 6  `*` * " > 2 * >c 2 `h i@"S w@"*  _@"Xq `h @M f@"3h `h ` @ ` @@ p@"[ `h `@U`@*S `h2`H> A#@`x2İ  &       ?     ?$    ?$   `H@`H `h  ` Ғ `x   `@ `h>ؒbX* `@@  6`  !@  `N, !  X  `("/`  "+` ` @ ` @:  `@`}@`u@" `@" ` `@ `@* ` `@, ֒ `"  2  "  `@    $ ,  0  `@ ߐ $ ,  㿘 >y & @g`:   >y  & @W &  & & && &  㿘  " @D  z >  " &  ,:`@6` zӒ >& & ?H4($   "` `8("@82 "  " "" " H  㿘H /e# * &  @ "  " 4 8+& " @@ &@&  &  4 & & H 0$@ H4@(@8`2 `` ` `/`, a` $   `8(": ``0   ``HH(@"&"`  #  4   ""@ ""`4"" H putc: required clalloc 㿘H /e * & @`@`2` ` 2&`>_!$  " `H 08?&`&` ` *`` `"@!  :*"  *  +  :*"  * *+ @`  ``@ &@&` `&` H 0 ` `8( @"@**/+@` `8@ + "@8*  "  ( @ ( (+@   @ * +@ @ *   +@ +@  &+@b_to_q: required clalloc 㿘`U H /e * & @>`5` 2/&>#$  ."& " " 46  "  @@ &&@& & `@& H 0  > H 00` 0  `@"  @" "  "@  8("8" > H 0  "@ "    8 ("8!"@ ?H4(&  2 "  "   ` `8 ("@82" " H  xH /e4* &  H 00?@ . `)&`' & '`'&  ` '&  `'&  `'&  `'& &`&@&`&`&` &`&`H 00H 00(?PTCLPTRTCN46㿘`h ) >  Ē 4 >  Ā   4  2 4  &&  & @  `t &`&`t  㿐>  0"@ 'b@M 㿘 >c@  p*    T`Ӑ `  , .㿘`>c@ * R ! ` `   2  # #   *@ `# # S@ `   @(8(82??2 @("`J@("`J@"` @("`J@("`J@"` @(82 ` (82 2 @@`?22(8 08 (2J@("`J@"`?(2J@("J` 2 " ?(8* 2 J"J("J"J (2 " @ (#`J@*(#`J@:#`J@?(# `J@ (# J`# 3   3  3 ` `( ` (88 * 2 ` `( ` (88 * 2 ` `( ` (88 0* 2 ` ` ( `(88 * 2 ` ` ( `(88 * 2 ` `*  `(8: 0( 2 ` @((882 J`  `*㿘@  "@ "8"@ 0  "@ "*"@   @v 0w?# @q&>ؐ c@* R ` `2c  $ @$?  $?# @ >ؕ*#@ $ "@ "`@  " `@  "  @ ޒ`@ 0   @ђ`@  &? diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘,   ` `@a?@b@dv 0 㿘``,  a ` `@aӐ?@bِ@dX 0 㿘``,  a ` `@a?@bϐ@d: 0 㿘`, a ` `  a@ q @  a `  `, ?#`,@bǘ?㿘 , " ! `  @b˖? diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘!>  0>ِ">`" >"`"@ $ 0 0>a0 "`$ 0`%> ` "```:` "`` 4* ``2`, > 5 $,> 5# ,>  "@ "#> #> H`8" >ah!> H P>`ܐ  > 0" "2 :  R  4*R   > 0 "* "   2   : R  R 2  4R2  42 4" 4 *R  㿘`> *  0"& *`2 *8    P2404*P *㿘>  0```:`  ` 4* ``2`㿘>  0`>``:` ( "`` 4* (``2`>!P2`@ :`㿘>  0`>``:` $ "`` 4* $``2`>aP@~ ʐdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKWARNING: mclpool limit reached; increase NMBCLUSTERSmbplmclpl㿈'>>`p#\ * @豘 > %> #"c>#\b!  U >ِ!D#> #\`>b  (H !>#L H >!@ <p>tz>!xv㿘> c> 6``@뢔 㿘> c@붒㿘H /f4> * '>  0` ``:` , "`` 4* ,``2`H 0> `l` "`㿘H /f * ' > ##Ȁ  !KH 0  6 H /f * ' > l.`  2 H p@  & && 6 㿘H /f * ' > ##Ȁ  ! H 0 #6 H /f * ' > l.`  2 H p@  $ & 6 && & & 㿘H /f * ' > ##Ȁ  !H 0 ' 6 H /f * ' > l.`  2 H p@  & && 6    @ 0 㿘H /f * ' T > `l*`@ ?2@  @ 7   "# 8@  <"`< < 8"`8>  $/   ( $ 0 , q 4 $ 0 ?4 > ##H 0㿘 K>  H /f * ' V * 4 @    "# 8@  <"`< < 8"`8>  $   ( $ 0 , q 4 & 0 ?6 > ##͒H 0 㿘H /f * ' > ##Ȁ !H 0 #`6 H /f * ' T`> l*  2 H p@  & && 6  2`o  `#V @6 ` $& `& `& ` & `$` ?4`& `&  " ?@& & 㿘@* 㿘@! m_copym0: off %d, len %dm_copym0: null mbufm_copym0: m == 0 and not COPYALLm_copym0 overrun㿐` >    2 $ 2 >  0:> "` 'H /f * ' > ##Ȁ !0H 0 "$ 4 H /f * ' V *  5 H p@  $ $$ 4  $ #V @4  $  $  $  $ @$  $$  "$ $   "8$    1 $  $$ $ ($ ( ,$ , 0$ 0 4$ 4 8$ 8 <$  Ȁ !$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8   $   8  `"  $ 0  " ?$$ $  " 8 $   -@   -@ 2&   > p  > H  > ch  "ch > ch "chm_copydata: off %d < 0m_copydata: len %d < 0m_copydata: null mbuf in skipm_copydata: null mbuf㿘`>!hϒ6>>!ɒ&@ ` 2 !@ :#> 2 a" -!& 㿘 2`  2& ! ` @@ *` &, `  @ +& 2  P `&$ 8" "@ " " `4 4"  0"    "    "  , 2""" *" 2" 㿘` ``a  `@` `` &@V H /f * ' > ##C H 0 #`6 H /f * ' T`> l*  2 H p@  & && 6  N& ``#V @6 ` $& `& `& ` & `$` ?4`&    ?&'> 5)`㐀*` 8   $`,  &@@& ` " $` `$`=`ڀ`` &2|> `@  "`@㿘`Q` h`( h@` h`   &@H /f * ' > ## H 0 #`6 H /f * ' T`> l*  2 H p@  & && 6  eH /f * ' >  U & $H 0 $ (  & 6 & 0& (& ,& <& 8  >& ``#V @ 6 `& `& `& ` & `$` ?4` `` 8  `+P  &@@& ` " $` `$`t`〤`` &i> `@  "`@`&  (""@`2 "` 㿘 ` "@   @8  246``8 `$" ?ܐ?" 60 @" `"`$``""`n h H /f * ' > ##Ȁ !|H 0  6 H /f * ' > l 2H p@  & && 6  2 & ) % ` " `$` " $  @@ 2@"@@ @@ 2@"@$㿘$   8  `s"H /f * ' > ##Ȁ !H 0 R6 H /f * ' T> l*  2 H p@  $ & 6 && & & ,#V @6 & & &  & @&   $"@& & $  a  `&  &$~ G ܀ vH /f * ' > ##Ȁ !H 0 ܐ  6 H /f * ' T > l*  2 H p@  & && 6    " ?@&   "%   6 H /f * '    @6  8& <& 8$ 8 8" ##  H 0 #+> # 4 H /f * ' > l 2H p@  $ $ 4 $$ $ $    0$ $ `$ >  l 9%H /f * ' c H 0  4 H /f * '  4H p@  $ $$ 4   $ %@8(1 H /f * ' >   $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  (8 $   2$ > #, @ 8$   $ $   $ (x$&@`km_zero: M_READONLY㿘 '!>   ` 8`ߐ!X`` $ @i 0 $ @b   @\  2 m_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbuf㿘`>" >>"0(&@ ` 2 "H@ :$ #> 2 bh" @ ߴ&  m == NULL in m_pulldown()㿘 >e#`&`  &@`  (   "      ( 2  8` `   "@ #@@  & $& &    @ Ԁ`0` 8`"   $ 0  @ "  ?&```     e& 3 `` 8 `  $"  ?ܐ?" 0 "# ` "`  '%  "& H /f * ' > ##ے H 0 Q 4 H /f * ' U > l*  2 H p@  $ $$ 4  .- H /f * ' >   $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    2$ 1   &  "&   W  $  $&2&㿘`I ` D H /f * ' > ##Ȁ !>H 0 g `6 H /f * ' T`> l*  2 H p@  $ & 6 && & & A ܤ H /f * ' > ##Ȁ !H 0 $ `6 H /f * ' T`> l*  2 H p@  & && 6  쀦 21 H /f * ' >  Ȁ !& $H 0 $ (  & 6 & 0& (& ,& <& 8     `#V @6 `& `& `& ` & @q&  $&  j㿘` `f  o " 2 2  㿘g o "@"   2@ "  2"㿘㿘`   `2   2  㿘      %P 0 㿘˒ ``     2 "@& "@$ @` "  @unixsockpl㿐> >!Hbx#\   m 㿘> "@ْ "] +  2VW +R )H /` * ! > !H @ $  $ $  $ $4`` 4 ` $ `   $ $  @   `@u4 H 00`> A#@  4 H 0&@ 㿘H o *@ a   ` @ H p@㿘H /` * ! ` `   @ " ` H 00 `` 4`>b`@>b`>"d@&4`4H 0 㿘      @   @ t t@> !H’soclose: NOFDREF㿘H /` * !     @  @X  2 @ u @N   5  # 2 @ʐ 2   "   !!" %>!>   !P&lV  6!pN "     `   @ `"  " >W"86 }H 0㿘  `  @ soaccept: !NOFDREF㿘H /`4 * !   >) ( ?(6   ` 2  5 `  @ H 0㿘  , -H /`4 * !      `2 8@4 "   8 `  @ H 0㿘H o *@ a   ` @ H p@㿘H o4 *@ a `   9`  %  `  @ H 0㿐` >   'Lb@'H'P L L   P`:  U@ ``` '` 2`  `' `4 "`4 ` *`*@ `t0& H 0`5`8H 0`H 0`H 0` 5`H /` * ! ` Θ`8 Ӏ 2`x`  `$2`x 9 2`x 9H 0`H` '`x`t "@``|" 4 ` `'d      (   (H 0u` = D<` *@ (L`$ !`@@! #` ? 5` ?5``@֐`tH 0 OPN`H 0P$@L >    l3> #P ;H /f * ' c͒!H 0 6H /f * '  5H p@ $ &6&&&&  &5&H /f * ' c!H 0 6H /f * '  5H p@ &&&6 쀤4gGDgBH /f * ' >  V!&$H 0$ ( &6&0&(&,&<&8 (P >  % @4  &h4( $@4@ $@P  L  " ?@&Lvݤ L` & %P `O"`` `` P` 2`` P ` 5`H /` * ! ` `   P@HH 0  ` ?5` 'P  P`L:` ? 5` ?5`?`P  T Oreceive 1receive 1areceive 3㿈 ''H''X'`'&@ 2'X   ? !2+  `  @  @  v0`2?;2& $" p      @  p   @ L  6 p H /` * !  `o L@ :j \@ @d P8a`  \` Z 2  8 L " 8>#Ȁ  I􀌠Ѧ6 8  = p "7  "1 2V  2   `" 9   # p ? 6 p ?6 pR p@ LH 0"z p` xV >_#'H    H"@c  L T" & L& T H0"@& TH "& `K&H /f * ' V> `l*`@ ?2@   "#8@ <"`<<8"`8> $ ($0,a4&0 ?6> #& `#H 0 `V >      'k  L T" & L& T  0"@& T` " ' `2'€'& `H&H /f * ' V* @4@  "#8@ <"`<<8"`8> $ ($0,aE4&0 ?6> #& `#yH 0 ` ' V "&V '!2"2  * 2  ( >F# ?6  H "8 "82#耢`2H 0t9'H /`4* !耢  $@"& "q 2|  L T" & L& T 0"@& T%& `L%H /f * ' V> l* ?2 `˒  "#8@ <"`<<8"`8> $Ð ($0,`x4&0 ?6> #& `#H 0 `2& H@ ; % "@&&  L"& L H  2 @"  & H  @Q6 @OK@# 0  ,@ L " ` p ? 6 p ?6 p6 pH 0 2     ``" 8 V `   ߐ `  2@Ő L2"& `` "   `  @ 쀢@2耢`   p ? 6 p ?6 p~ː pH 0 p耢 2X`" p@"@ p ? 6 p ?6 p~ pH 0㿘`  ``@`2      @ p L $  @ 4 $@Ӑ0 4 $H /f * ' @ $ ? 4 $ ?4 $~i $ ' ' ' ' ' ' ' ' $''@~ (  4 $$ H 0   `@@Ё㿘?#@'P  "Ϩ * `  @Pʰ¨ *"1`">` 87` *"3`@.` **` *   1`` *4 *Q`" ` 2 ``L#@4 6 `"| ` (x `` _6 *\6 "k ` (g ``$ " x  0H &F  L t@] > L 7@86&  P@80& \"? ` 8`9 >!P+>aT@|[c & !aT@|M`` 06 6 r `  ` ` @P `'㿘?#  " * `x@ vH  G&` 4 "CV @">V "9V 0X"6V 0U"3V  ".V 0M ")V 0H  ", \    "& P4$  "  x07 "`&  "V0- &`  ` "@V `(" V ` #"@ 8"@6 8`"2V rV >!P &` `@{$@p>T`$ 럐 *& 㿘 <  @l D d`4R`(2)  >0>ل@"`8 L>لP"`8 tH( "`"  $2 $H   4(H4h(h  "h`2``"`hp2pH `4( L"`   "  8` 2` 8 "`"`,  " \`0   4(H4(  "`2``"`2H 4(`t`x ``|"4" `   2`8"`82,`   , 0  `&  4(R`2" R`2@  2 㿘   ;  6 @Ғ @ @8 L    6{i 0{ 6@( L   @ t㿘  6 `8{6 @ t@ L   㿘  6 h0{6 @ t@ L   㿘T 4T 2*T 0@ @  @O > !HԒ 4 @{6  6  6  `6  &  66 6 <& < &  &  @& @ D& D x@ P@+ `   @  @=b `@ L   {( 6 6 soqinsque㿘` >> &` 0  6 0 2  6 2&``&`(`(&`,"`"``   2 0 20  "2 22 ("  , , ,  , ( " "  㿘 `6 @D t㿘 ` 6 @; L   㿘 $!  @6 $ >R &xx 㿘 $  $#>ِ  @4 $! b x " $    $  4 $㿘``$ ? 6`$ ?6`$z "  D <jw @`C 㿘 t@" @ L  \ 2  & \ 2 (&   x 8&  @* 7㿘`!>"   2* @ * @)" .`  .`&  & &  㿘@& & 㿘`  2 "@ 0 @W㿘`+   2  !&&  0& "& " "` 2 2@( 㿘`4   " R  2  2R @ !&&  "0& "# "` 2 2@ sbappendaddr㿘 @ >"       ` #@ 4 4k @ 8g H /f * ' > ##ʒ H 0` 4`H /f * ' > l" 2"H p@ `$`$@$`4``2@- $` ` "$$@`   a&&   " 0@&  2   " &    2 $  sbappendcontrol㿘2>& h     ` `"   4 $"@#    a&&  "0@& 2  `" & `` 2`"` semi-panic: sbcompress 㿘 `s `` ` N@ 2R  R V`@@B >":   8 `" $0  @"  0$  ?&0VV`@   ``  @ & ` @ &'"& &`   a&& ` `0@&  ?6& >6Ӑ!sbflushsbflush 2㿘 $ " >L#@  2 >  ><#Ёsbdrop㿘    > T  " &&   &@  0"@& H /f * ' T * 5    "# 8@  <"`< < 8"`8>  $   ( $ 0 , X 4 $ 0 ?4 > ##H 0` 2  >ѐ H( "$ $ "@& "f&  ^ >   " &&    0"@& H /f * ' T * @6@    "# 8@  <"`< < 8"`8>  $   ( $ 0 , X= 4 $ 0 ?4 > ##rH 0`" &  " "& & $ 㿘 `[> ` & )> #`  " && ` `0"@& H /f * ' T`* 4`& ` "#@`8@ `<"`<`<`8"`8> `$ ``(`$`0`,`W`4`$`0 ?4`@ #ȑH 0 2` sbcreatecontrol: message too large %d 㿘` ? (>!@^C  Ē   ; (- H /f * ' >    & $H 0 $ (  & 6 & 0& (& ,& <& 8  2 Y   ` ? & `$ $$ 㿈 7i - 2` 2 >ؐ "``@` 5m90"`(, ?",`0?"`0`, vG`0&㿐 @@ `0 "`0` @v` 2 `(%D 0" 0`, v`0㿐 @@ `0 "`0("``0?"`0`, v`0accept㿈`  `Д    @{@ `0 "`0H /` * !  ( `2   2!` #0` 8  h 6! s T 2   8    >ِ 54 8 8 u4 8   2>   6찒  $` 2 4 2$` $`( `("`,`("``"`$`, 6u( 0J쒄 h& >  2` 2>ؐ "` "(o N `` 8' 6 `0   4V7\, ?",`0?"`0`, u2`0H 00,?`$0u$0㿐 @@' k`(  !!2`0c % "`0` @M` 2C  2=   !! 0" 0`, t`0  $0?H /` * ! #>    8   6!bh rۘ "   84 8H 0  ?4 `0?"`0`, t`0 ??" x @`1` @`*` v5 h '2  2` >آ ""(5wܰ 2K2 2` " "`('谒 3` 2 ` 찒 )` B  ", ?",`0?"`0`, tM`0, ?",`0?"`0`,  t>`0 3J6'3C6ܒ'耢 "쀢 p`` ``'` @'''''И''@6؁8`   (䀢$% ( *  R 䀢*Ȓ  `@'@ 'Tƒ h@b԰     '  '? '''' ` 'ϰ  `0 "`0`@   0" 0`, s`00' Y  @  @ɖ   @2F``$8  ̀`$"  ?ܐ"   ?"  `?"`  "  ⼔ '̀` ` ?` "`?  " "" '  @`2ܒ ,  R)ؔŒԚ`( ̰ 耢 ?  #   cӒ `$'   Fښ S  0" 0`, r`0Ѐ p`   "`0'`` `'` '`@''''Ԙ'@B؁8`   4䀢$1 ( *  Q ` *@ '* @'@  `'r Su h ''@԰     ? ?''''   ` 'ڰ `@  `0 "`0   ܒ ,  QIؔԒ ( ̐    耢 ?  #   $  E S   |$'`".Ѐ2' '' @" `2@` ZȀ&Ԕ   @K԰  F̀ @?#@27& " 1&?" ` "`̀ 2!  :  & `` ?$ @` 2 &@& 0" 0`, q`0Ѐ "̀ 㿐 @@ `0 "`0(``0?"`0`, qn`0㿐 @@ a`(]  0`" 0` > ^ ``)H /f * ' >   $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8   7 2`  7  `  `$ `( `` * 0" 0`, q`0㿈 @@'찒 E 0`" 0` " '` ˔  '`(`` 2` `쀢 " 8'   `   0" 0`, p`0쀢 ߅㿈l谒 ''@   /ې/ؐ㿐 @@$ >`0 "`0` f  $  (   `  @ ` 8'`` P ` I  0" 0`, `pZ`0`p㿐 @@ݢ A`(  $ 2`09 9 "`0`   # ޾  `  @ ` 8'``  `   0" 0`, p `0&㿐 @@ B `(l  @8 -`0 "`0 z  2   7`  @ ` 2 - ` `  `    0" 0`, oÐ`0ܐ㿘8F C  ݼ-H /f * ' >  !$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2 U 7 $  \ I0$ * 㿘,+ 2R`   && diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapuipc 1uipc 2uipc 3uipc 4piusrreq㿘> "@ `  ^ -`   ` `H -```2B `<.`>!X €`7 8@]3@0 @)` & $ @ @i`    2  >&  |b @ V  2>>#`   T`, t`"  &` T$`, L`(`x#  &`x L+$`( ݐ# @  ր V < v>` ɤ 8@ À `  9`  >ْ"`L `     7 @   "`   ># `LY   `L1` `T , " " & ` `T# ,` (`L x" " & x` `L# (`  [ Y#@  5U  x&@V  ?` "?`L@&@?&``2`0> `T$` "`T`0 &(`4&&&,& &$`:&` "+&  & `` $ ` "&   "&  & `    `   & `  ~  & ># lDl`lplllnm m$moqoklppplqq$qqpunp_attach㿐 x "V P  8V ">ـ "> >>">"$ !" 8 L  " 7@mԒ 8& $@Ʈ * "@*`@*`$ 4$ 0㿘  " " @9 &  "  @ @? 6  2 " v >  ` N= @lN9   ` @?? `N `@m,  'x'T'P't'|@P 2=` d@<Ғtd@0@`@* 0@- '$8 !7d@; d`@:t 2`$ &  Ȗ & @<  P` D`  a '''''K?  (0I* @R D< > &@@: 5`"1 =TV@@, )  `$` 7 2` =  `沔 v $  $  ` $ $ $@ @Րunp_connect2㿘V@V@  )`" V  >""  "  "Punp_disconnect㿘 '& R`` 2  $   2 >r"耢2$ & ` ?2`$ 㿘R`   [㿘4 8   m$ 6 M 㿐`>  ?@2 - K   V@'$@@ `?2@K,o &   ,  +ʔ@ `? , @*?<,   (΀  @*`"  - > @?' `" " N %`&` L 㿐    ` ?#@2  @ 2 ,    ? ?` " ` 8`"   $ 0  @ "  ?&`74` H /f * ' >  Ē!& $H 0 $ (  & 6 & 0& (& ,& <& 8  ^ 7  @  ? $  & -#>  ɔ '?"' #@ "      `  "` ` "`$`    #>   ?` `?"`  `?"$` 㿘> cP  >  \>   &#P  "c?#  4  2 >٪"\ 4?#%> #'>   4  $ `2 @" T `4  (" `2 ` ``@Y  2  \> a   &I* \  ` @2   2  $@` 0 $ 0 `$  2 @R` 2 ?`( "??` @, ?`K9 &&#P㿘 > `@ 㿘 1 *?#R 2! (` 2` 2@?2  `$@  2R  ` R`  >   2`2`㿘 >  0 & 0 & ?", diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapbremfree: lost tail㿘   > #p >     㐘    2 㐀2 8> Ð! 8`> b0?"b0 0@2 > # >  @ :@  0" `"> bd" "bd> %bh" "bh ` "`#   "bufpl㿐> > ! b#\ t S > #p -> 81> 8'> /> ""*" >  ^? > "`  @h $ $@n  @U $!P#!5> +>  В t@i}>  8,` ?$ D$ H$ @$ p =$ 8 8$ 0 >   `ē:@ "d  > #"dx%`> "0> `""0 $  "` ""$ > cc $c" "c$  `@ t $   2:: > ("`<> %" @g @ :@ % %  $` ` : 4% ``  : @4% 㿘 @  0"2' 0 & 0@9M> b@, ",'@Ȑ㿘 @ 0"2`0 &0@90> b@, ",``'" @@ 2@@ @ݘ 0"0  "0@9  > b@, ",@ې ޲`@㿐\#`'P'T#\PT 㿘 0 2 \ \ " \ X "  \ < @" \@PL ``< 2`X` ` `"`p`t "`t "`p 0? 0a $ 0H /d* % @   \> "@`0 "0 \t "tH p@ 0@ $ 0@8` @@e㿘 0 > 2 0 & 0H /d * % @ QH 0> "@`0 "0> 2  F *> 1"@ !0*`  @0  0 & 0 0b& 0@'㿘 0`& 0@8X㿘 0  0`& 0@ 㿘 0  0 & 0@ 㿘H /d * %  0  0 7& 0 0"@" 8 0 & 0 8 $ p 0@; p >"4`@ 0 " \ 0 ?& 0 \ " 8@ǐ@Q 8 > > "0> `""0# >  >  `ē:@ "d  > #`#"dx -& 0  0@> #p> # >   :@  0 ` "> "d> @ ""dx> %"h> @ ""h 0 "&  &  "` ""&  & "@" 0>ߐ# @& 0H 0!> !d !dfې $!d> #؀` #> > bd ##ؐfv  0 @ 0*@& 0f㿘 @n͐> b> `*  "  P2  \2 0  2 P getblk㿐 '@n> b> `* @ >># P25 \21H /d * %  0  0  & 0(dj H p@ Ӱ 0Z 0@,H 0 2 P >  @ 2@@ &@" $@& & P& TH /d  0`0& 0lH 0Հ * % @H 0 `"`0 "`0@4㿐 @Ґ 0 "0>  "@"`"" @allocbuf: buffer larger than MAXBSIZE requestedallocbuf: negative bufsize㿐> #@@ * @ ( 8>$!"& <:A 8%>  @ 0 "0 "@"`$"  8 8$@ 8  H H @ @?" 8@& 88""8`8`< 4"`<`8 >$!8  8 ǒ  8(<& #  'H 0$& <0 "0H p@ H 8H@" 8""`8& 8"<`0 "`0& <getnewbufDirty buffer on BQ_CLEANBQ_CLEAN has buffer with dependencies㿘& -> %+> %)> '> H /d * % hc@> e!\"d @#> > "@> c>  􀢀 > #>$`"#ؒ#ؔb H 0`O 0> #x >  "!d>$ !db H 0耢` 0 $ 0 0`" \>$# @ϐH 0 p " >$ݐ#?$ 0$ D$ P$ T$ X$ 4$ @$ <$ d$ `$ l$ h`"  "` "@&cleanerClean buffer on BQ_DIRTY㿈> "@> -> %"`'> %3> %1> hc@ > >%!\   b ?H /d#* %#  > > #c)>  0 $ 0H p@ 0@ҐH /dq * %j  0 2 p>%i"( : 0@5>"<    ( 0 $ 0H /d * %  8``  đ: h@% $h$  $ "$ 0 ?$ 0)#_> ( <h@ zc"@'"'Вb@ ?耢 fhH /d * % # xhVcbiowait㿘H /d * %  0"  #>&a( aǘ  0b H 0 0$ 0  ;$ 00  0(  4 " biodone already㿘 0">&" 0 p"& 0`>"0`@ 0@  0@*  \& 0@ 0 @  0  X& 0€4 0 0 0 *@& 0chdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘>"`2*@&  > ch` "` * &> > % T "Б*   2  T@2L 2@iX ! 2 2 > ch`  s"`2 > ch` D"` 2  T `;&> ch` "` `  "`   "@$ > b`$ `""`H   > ch`  "` ch "ch `  "`   "@$ > b`$ `""` ?'&@ `>  "`  "   "@` "` "$  $  "`  "`"$  cache_enter: name too long㿘 $>>'"X"`\#> >!hc@ > > ) |ؐ @b @c%>  $c"" E ` "` "  "@ ` ` 2"  "@$ `$ `T $ $  T !$ , *ו:$ ` $ `""`> % T> c "б* @@ $@" "@$ nchpl㿐> """"`!> %>ah>  W >$"Вc> )>(#\ ` @  z > X X"`T> > %"Ї(*X  2 :X"X"`T> `5 `",`X""`&`"```  # ` ` ` @2 `@ "`"`b` ` ""` 2`diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapcluster_read: size = 0cluster_read: DONE bp㿀`>(" И ` "0` )`   @   0> b@$0`,  "`,  >"`" &`@`  &`&` ?`   ; @f- 8@ @1 ?$`4 `` : @*&` @ `*` 8 &` &`` 4'  #`#d#\Y[  ; @e$T8g@b ]@0Ȕ T?O$`4 `` : @*&` @ `*` 8 &` &`` 4'  #`#d#\ @e  `0$`0$`T@`  > "@`, ", `0">("@1 ``0" `0?# @$`0А`@0`"` `<@_`P@&`gcluster_rbuild: size %ld != filesize %ldcluster_rbuild: too much memory㿐X L\` d>)#=  ; @e<8@ y e  0& T& 00m#\@h 0"a. + >ߔ &&&&  L< &`@& L1   : `8`@@ `H@ >)#`0 &`09   @[`0&`T u&`0`0 &`0 @*`"`&   "ʒ 2  0 & 0& L& X@{ +㿘`   `0"\&`T\`0>* @c&`T&`X&`0cluster_callback: too little memory㿘 0(  4 L& L  H??@$  H@ 8$ <`$ 8 0$ 4($ 0 8"& 8  $  86 H>*N"$ @Ŕ" @$ & <& X@ + 0 0 0 *@& 0_ 㿐 P \&`&`&`&` ` " X` 2  X <` ;`  T "` X@L@f`?`P' <``8# =@c۪ ` `@2  <2 <` < @` *`` @/  ` / *? + <` @{ <  (? +?&` < ; @c=@"  T@.  T? Ր&` T&`&` !&` &`&`ɐ&`&`&`    @5 &`&`u&` T&` cluster_wbuild: size %ld != filesize %ldClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocks㿘 X L >+#@I?b   2 ` h0͐ p `0 |0V0 ` `0 2`<j?͐`8@>?Đ?/  + <א `<$`8>*$$$ `L$`0$`X`H @$`0@$`Lg  &  0 2 2b   $ `8`T:  T@ >+`PD#p T>+ P?#>+Đ# 0?a $ 0 0`$ 0H /d * %  \t "tH p@ p >",`" H@ H@`<- `8@$`<$`8 8@"$ 8 "@   ``  `0 $`0$`L$`X>4 +?"!㿘`` "  *  <. +`  & @&  .` <l?`@  .`" `& diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapvop_generic_revokevop_generic_revokeall㿘>  `"@>-!@  @(1! >-"& @X  Z 0(!(& @ @  " @`  < <@2  " @   @(2  @ >& @@- 㿘= 㿘  $=b   㿘    2  㿘   24 P >ڄ8 8 `@" "  2    -diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map -operation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operation㿘 2 !> #  :* #@\?*`"  >.>.#>. >" "  `8{X`h * $  2vfs_opv_init: operation vector without default routine.㿘>*` > >.~ڐ!Xc     c* " c 㿘>ڢ `@ " `Р   `@   Ƞ  >ڄ >   2>܄ "c   "c㿘@J@> @i!>> `" Ȁ "`̢  @$?`(diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘W` Z  "@T @ B&M `` @2`?? DB?4> 289   (  7`/  9 8`< < $ $ 4 $ $ $ $$ (\ 4   0@@6@; (0; ( 㿐V  $   (_  @; ( ###> @    @2`l; ( `laP`@ >!H @   @ @2`?*  @2 &  6 @ 6 & & , ( ,& 0 ("@$ (aP Xu    ,` 0"`0"( 0 ,"@& ;G (@D 2'  @W  `*`>0" €`" "& V   R` @Q   (;2 V R 2; (w  @  @ " `B  & :@@'^ V   R 2$@  `$`,`"0"`00"`(0,"@" ", (,"0 ("& ( $2,`  " ` '&  "@: (v  & "   B?:@'e`" "&  `B :@ ̝㿐  2'0O`B L:@@?`C>0#*` € ( ":f05 @   @"  @R $"  ( ":K   B?: ' `B  : @V  Œ¬@㿘@( "  6`6` >@ 2   ?2    @ b `B >` @?  4&`&`6` 㿐'  V   `  @ 2T lf_findoverlap: default㿘'` ` `@> "  `@6  ? ? 4 @2 $        2     4   8  & '    @     z 4  ?  4 2c  ] 4 @@  ? @ 4 2E   ? 4   @ 422  @  ? &  4>1 @ @ 4   8 2>1?>1  >1{H 4 㿘 `@2   ` @2 ``B > /&` `@  `@  (` B?> &`  (6 8` (`: (D  : :  :  0: : 0: " ," $ $" (`B> &` & 㿘 $`0"`0& (0,"@"  Ww  $2,diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapnamei: bad cred/procnamei: nameiop contaminated with flagsnamei: flags contaminated with nameiopsp,$ `@$0` ">2``2$>2z"?"`>2z" $>2z"H`$ 6^ $` $`"$``  @` `*   "  "``8' $@"$ `@? J? /2 `? *`L /"?` ""$, $  $ > !\$ `J`/2  @  `7 0~@  K  $ 5 `'` $  ?'''''''@&{а   (P`7Œ K`$ # ?( `f`7 $`*@@$`J`/@ @`$`@4$ @`@ @@d`7  $` 2  @&  `$  >`7x @S@$leaf should be empty㿐$`$  `` `"` `@$` b*$``$@#Ô`J /2#$` J /"`""@$$`< v J 2` 2$k $`  +$`$` $`@$`J  /2``"`$`Q ?$" $J`/2`J /"" "$$` $`*@$` J 2`` `*@$``  $`  * $`` 2``J` .2 `J@ .2`` *@$``@"%$ ' @@א`@#0 > !\ 2@$$@Ɛ` "$`!"X$$@# "8`   >3xΐ"?@ ?X`< ?'`@@`@"$` ` X <` $@  `*@$`` ""@$` "@$$` J`2`  $`  @s 2<  €@ 2g`@$< ` a<  @@  @@"$$` S$``@ = ` @2 @$`@`@? `( X <`# X <`` `@ @$2`@`  @$ؒ  `   @@@$̒ @@$relookup: null namerelookup: lookup on dot-dotrelookup: symlink found.㿘 ` @*@ b&`@"J@ 2>5wʐ!H@">5wÐ!`@"j "@@ ?>3w"Q O  X <`J@I @E  < @">5w!?  &  X <`!`" X <`" @`@^`2@  @$>     @@$3 @@~&@diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapvnodes㿐>גc#\> 6>6 l  `8 l > (> H> " D"`p"h> !"!"`> #"#"`> )" > `"`" > $@ "`vfs_busy: unexpected lock failure㿘 <@@` @& <R    *   >6v ؁㿘  *  㿘) vfslock㿘> >"@`̀``@Xp 2`$`2  2!@S!>6   )a   $ $ @ $ <$ $ `> `$` <*  $ <` @S`  /,   Y? &  %s_mountroot failed: %d 㿘> F ">ڟ  ̀ " !>6 "  $ "w  $ 2  > @" `d 2 @`h 2@ @ 2`d 㿐 > 2 > H  `h * & d`& h`4`h`h?# @ `>  * @ ''`h `'4`h & dJ   *`J8*  ???: H2 " X": " <" @" 8" 4" 0" ," (" $" D" " " " " 2 vnodefree vnodefree vnode isn'tcleaned vnodecleaned vnode isn'tClean vnode has pending I/O's㿘> > H>"@> `l h"*`  #`l lH /d * % hb > #`#> !`!l "H 0 > 6 l l@Rƒ b W$b 2 DH 0 >7u!@&U  "  \>7!H@`>7u!X` `"``" ` \"@ L $ LH 0  < @ >7!p@>>7ua!H /d4 t* % t  >7uP!H 0 $ @$  $ <$ $ 8@ & $ D$$   X ` d" h h h h d ` " X`" d` d h`"`" h㿘@  㿘@ 㿐?> &@#  ( &@$ <@  '@&@ 㿘<> ` "@Y @_ @>` ?> * a @    ` @ < <@2 D @9 瀦      < "  0 $@ " " " $@"" @$@ @h@& @ @!e@? 8& 8& W$<vget㿘@@ @! "& @>8  OV J  D 3` L ". DH /d4 P* % P    \`2  ` `>  "! \`" ` `"``> "# ` \"@ L ?& LH p@  D` & D@w "  D? & D@ B vref used where vget required㿘 D 2 >9t & DUse count is not zero!vnode already on free list: vnode already on free listvput: null vpvput: bad ref countvput: ref cntvput: bad writecountvput: v_writecount != 0㿘> "@>9sߐ!( D 2 ?>9!8@>9sԐ!P & D @  0P H >9!`@>9s!xH /d4 D* % D  >9s  L "  P>9 @>9s! `& L> !> # < 2& \ & \ \"`` \""& ` \& `"@"H 0 @  vrele: null vpvrele: bad ref countvrele: ref cntvrele: bad writecountvrele: v_writecount != 0㿘> "@>9sX#@ D 2 ?>9#P@*>9sM#h X& D H >9#x@>9s@#H /d4 D* % D  >9s/  L "  P>9 @>9s$! `& L> !> # < 2& \ & \ \"`` \""& ` \& `"@"H 0 `@6 @LPD2P\"`` `> `\ "\> \"` P"P㿘 `` `X `d@ 㿘> "@@"2 `  @ 2* "  D H "#  < 2  D @ "` <?  @8 > #& 8R    &`㿈>:bD'''쀠 `  vclean: deadlockvclean: cannot reclaimvclean: not cleanvclean: lock not drained㿘 D  & D @!"!>:rK#h& @`@@+` ? @  ` ?@)@Œ @@͐  >:r#O D? J& D P >:r#H /d4 D* % D  >9r  L "  P>9 @Ӓ>9q! `& L> !> # < 2& \ & \ \"`` \""& ` \& `"@"H 0 쩐 ">  @2 >:#@ / & > !L & 8 @ @?c > "& & @ & @N㿘 D  @ 㿘> "@@vgonemissing bdevmissing aliasvgonel: not clean㿘 @! ">;& @  LU 0  X 6  <? 8f D `"b D@`"2`"  2  "2 @>;q>" @(4  @    @ < <@2   `  @ < <@2 `" `>;q"2 @`@ 7#`@ @ 7& @ .ʒ &  D `;& < L 7H /d4 P* % P  >;p#> #@# \` `"``" ` \" & \ \"`` \"`"& `H 0 ;` ?> (    @<@2 " 㿐@ ?* c`@ * @ؔ @U `@`㿘 @(2 " D  @@ ` ` `< <@2  D  2 VBADVFIFOVSOCKVLNKVCHRVBLKVDIRVREGVNON%s: type %s, usecount %u, writecount %u, holdcount %u,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT| VBIOWAIT|VALIASED flags (%s) X ><q#`<>ڐ!ȕ* `H><`D#q`P`@`/>=` @V<`@ >=`(@V5`@ >=`0@V.`@!>=`@@V'`@">=`H@V `L >=`P@V`@(>=``@VO >= pqV` >=>=qO 0qL @Đ㿐`6 > ̀F    $=  2$6 \#\`,-    `% -> ȒEɔ >  ̀   2$ F ( -kinfo: vp changed 㿐 > " ` *` * " * " * N&@$@&@J > @   ? /> $ I / ''+>=`X >!쀢`pc@``d  2` '9฀ǐ$@&@   .  @* %  < <2  `  < <2`"  㿘\`  <"z $`0`4B P $`4 < "l$ <`i d  @ 1*@K`Xm\ U `\@$d_,`d" \`Z B d@$ g,  . 4 `  >  0 `"@2`` "``$€@ 2  7  @"  $`0`4ؔ P $`4 ,$ 1㿘 `  , 1㿘 %>>    (, & 㿘@" < <& <! J " <!& < 㿘   )> '>? "@@  o   2  >?o"H>?n"xެ syncing disks... giving up done 㿘H o@>?n#(> c0 >   @ @  >?>?nА#@0n͐#Psoftdep %d 㿘> "@ >   @  ' @c /> 5> 8  * "@*`В@*` ? 6  )>? 0  "  0 &БH /d * % 6 0 $ 0H p@>  ` nz# Р?  `>?#nkm@㿘`  2 -> 7"` >ڐBޘ!İ㿐  -\#\ِ 㿘  t   t L`$ L`G " tvwakeup: neg numoutput㿘  t??& t>@l" L`  & LIi tvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failed㿘`IH /d * % >@  p`.H 0@+  H /d4t* %t  p >@lA#H 0@ɐ0H 0H /d * % `l` `P  ````P &```p` 0```P &``9 %>@ P &,0 0  &0 Fʘ "lH 00+0 &00``0 &0&π l  p >@k# H 0 vflushbuf: not dirtyvflushbufvflushbuf: dirty㿘H /d4 p* % p ' >A 0   0 kXު 0 $ 0H p@ \`ଐ0 0Ѡ`` >AH 00 p  p` H 0>A"/0H 0bgetvp: not free㿘`\ >Bk? M&`\ <? ?  &`D&`D l &` l`"`  l& l&` brelvp: NULLbrelvp: holdcnt㿘 \ 2 >Bk !P#!@  `"  "`   "@&  L`"& \ p 2& \ # L x`" | |"`| | x"@& \ P`2 L>Bj  # P` D  \`" ` `"``> "! ` \"@# \> c` \# ``""`㿘 \  0"@`t`&`tr ` "`   "!P!& 㿘 !P#!@   \`"  "`   "@&  0 2 L L`0 l p 2-@ $ L x` |"`| x |!"  p <   >!>!2`@ :`  `>a@F >!@@ & @ "` $@& vfs_register called with vfc_refcount > 0 㿘  >Bk#> ̀  ̐ @Kܒ   $  $  > Ȁ@4"& $" (`" @ 㿘> ̢  $  @K  2 $ 2     $$@̀     4 $ 2 >" Ȱ  <  㿘H /d4 D* % D  >9iސ  L "  P>9 >9iӐ! `& L> !> # < 2& \ & \ \"`` \""& ` \& `"@"H 0 diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘#>!> Ha  ;O  > H`"$a>@>> H H4L(L x"|| ||x L"L> H *` "x x | "|H sched_sync: fsync failedsyncer㿘> "@> />ڬ"c+> %9> H7>)>5> %3>D  * b@ %%H /d@ * %9  @I  /H 0  @ʐ @H /d4* %  p  > < ">>Dhې 8!` 2ǐH 0@Ő ! ?%!bx (`X C 㿘H/` /> c > %l"x@FO H 0>a>ڕ2 ! :   >!`#!"! 㿐> !8  0$  "`H> H> H `| "`<">! > Hx3 2   : :`#`|  "x>!2 :`#`|"xx  $ 㿘  "X>!ϐ > $ 7  `< ?`$`< @    " `< @$`< C 㿘 D 2X  @ 0" x`|"`||x"L "L *"H syncer vnode 㿘 >Ei{  ">E#>Eir! diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapvfslockx>"``  2. o` Z$ f D ''''' Z@` 6@ 2XM  <  <@ @$ < l@  -ߒ2 "01``!* &` @E`@@(  0@  -2 "|0 `" `! o &`@  Κ < [ @   !> @`` 2`$``Cа @Cޔ  ̀``@H 2`$`20 -  )  "ݐ!@D+!>E ؐ     @>$ $ `  <* @ $ <`@C $ `$ l` " < < `@$ < <>ߐ# $ <`  ~ @  $ <` `@ 2 <@ǐ$ x <@@"&$] <@ $ < <@*@ $ <$ < <      "$ $ ﲒ0Br 25 ` $`> `$$ `  # " " @2 @H <`2   D ` 0 " u$ smount: lost mount㿐 D 6   € "> %>Ff@#"`%> ` 2  א$  2 `͐$ ``2`\$\2P@ D'''''] . X`l   ,N2 "`<0`<@ @    ٖ  `@ unmount: dangling vnode㿘 <@@& <> $ `  < & <  " < < 2   @ " @    %>  < 2  <  2 < <@*@& <``  <@*@BZ <*@& <1" @ "` @"@ `  "`  "  >Ge\!Ȓ``|  <@B)#  㿘>   @+%> $ 3 "`<` 2` ?$`< @@`  @ "``< @$`<`6฀@ڐ P@ @'''''`   X `` `@`㽨@ @'''''F $ X  D  > <* $ D !2+-  J!','(`ފ!L@ @ 3L`( X D`0 "`0 L`0?"`0L`,  A`0 > <* $ D2*  P!'t'p`O!``@Iv!>   @@F ?#P/> $ m `3@,*`D`` " `<@w`<2 $* Ŕ!'t'p! a@Y฀@Ð` ( ''J0' 㿐`@@ B @ (`@X <`  `@@ @( $ `    ` €     @ $P@ D '''''@3 `s &`P !2 * 2@ D'''''@  " SQ $  $ 㿘   <   `@@ @ 祖0@V Т`4P0  ` @$`` @ 0'`8 '8$`\@+ '\'<$'d 0   ; 8@ G   ?`\0  ?4В0 &?"h g0H $`\4 2`4>2 4"h"4 0("`(  ?7 ? 77   0 @4 @/ ;0`@ N4 24`@ @t4` 2`X  <` `<  @  ݐ4  ?@   @0Đ4]0 @0&4, ?",4`0?"`04`,  ?`0 0 !2)  & D@''''' ؐ@?̒  X d' h' X$ `O 2('T ``  @`b̰ \DX Ơ`@$  X 2  FT` h "T'T`< ` -  !@ [ XdT`<  @ ڐ XT @ G XdT@ T @ T@ e`  ?T@ Q cXT@  [X`T`H "`H\ `2`\ 2 \>ڐ"h"`\`0T."(  ?7` ? 77`  0T@ T\ @ఒ XȐ\a0.T`@ \ 2T @X&\, ?",\`0?"`0\`,  >`0 X\9T `a2' %x@U  0 2  Ft`  t@ t `= ` !2' 2/0@'  2' 2   F` ,8 2,w X P    <>*@`!'P`a2' o` `j @ 't 'P'x'T'|恐P ]` ( `<`$ /`* `  7 '8    2  '' '  2d` @ gdtd@-  d@ od0d`t@ @ ctd{  r@  'P't'x'T'|P 2-` d@ >t`@V `ː `O 0ꘐ  '$`  *7d@  d`@ ftP@ @'''''ڐ : <   ` '''''ܰ & "`@ @ }  0 @ `@ Ö Ē@ G԰  $@$٣ 2:`  'P't'x'T'|儐P -` d@ t`@Ð `8 `켰 `$ `8 !7@ {dd`t@ Kƒ P@ `'''''E . @2`@ h@쀐    vD @ ?IJĒ@   @ IāP@  '''''  '`@ @ 1ĀI0뽐 @$ @   @  Ĕ@ t8 @  2T I 2F  (`<  ? ``? " `  ( 02 / ` @ B '  @ B < @ v ``@ B  @ C < `2``  `<   >P`?@2 ` D $  ` $ @''''r'ܰ 2$ ``*`` !``2`@`@ @ $ $ @ D'x'P't'T'|EP `@d`  !2 %3 2'`ؗ `@ 'x'P't'T'| P `@?`  !2 % 2'`r `P@ D''''' `@ (@ ''''' ! <  `` `  ?''''''''@ аꐐ`" &@ @'x'P't'T'|㷐P 8`` @ ː`@X`< & `?a2`$ `@ a ?   %``'@ bF0@?@ K`0 "`0( @ `@M`X`< ' `?2$U @  ?   ސ`'@ @  `0?"`0`, :`0`?@- @ @'x'P't'T'|P !` @ +`@`X`<  睐` /7@ٖ齐0`?@: @@ 3`0 "`0( @`@`X`<  h` /7@@ 7 `0?"`0`, :9`0@ @'x'P't'T'|⦐P K`` @`@X`< 9 `?2``?!<`a2# 2`>!Ā`<`@E ?Ð*@ <##`7`'`'@@>"@'P't'x'T'|NP K`` @b`@*X`< 9 `?2``?!<`a2#- 2`>!Ā`<`@ ?Ð*@ <##欐`7`'`'@@ʐ0`@@ ]`0 "`0(` @ `@єX`< 9 `?2``?!<`a2" 2`>!Ā`<`@ ?Ð*@ <##S`7`'`'@@@  `0?"`0`, 9"`01`  @? '''  D耢??'?2@?'@ @'h'@'d'D'ln@ - P @`@J`X`<  + *" " * *   * *''''@@$ ՠ`  @ '''Ռ  Q耢??'?2@?'@@  ?`0 "`0(  @&`@`X`<  + *" " * *   * *''''@@Ȗ@[ `0?"`0`, 8]`0@ @'x'P't'T'|ʐP +` @ސ`@`<` @ @@g  E`?@f0@_@ ;` 2`05  "`0( @`@h`<` @ 2`? @K@ޒ `0?"`0`, 7`0㿐@@  0`0 "`0(`@/@  `X "  <@@#+@ `0?"`0`, 7`0@# `''''' 2< `,` '''h'l'h  @,HFb|x`< `< ` ` `<  " "? $  @ @Ā  @@` @ @ @ؒĔ|@kx@@`o`"j@Вp  " ? @ `'t'x'P'T'|zP /` d@td滐01涐 ` '$`` *7d@q d`@t `P@  '''''< 2`<   Ā`@      @ @? @9 Ĕ@@EĀ]0ѐ8@@ '` 2`0  "`0`('`< "` m' `''''''''`@Đ   ?  @'' @@: `G`耢@>"d`ؐ????Ȓ@  )`耢@2`  @ "`  X`< "` ` '  "(:`  `'"@& 0" 0`, 5`0 $ "`2$@ @'x'P't'T'|^P " `@"    H!2  `D `@(@ 劐㿘x 2R`   & 㿈@ g " ` 2S`  `(`< 2` ?`0 #`0`` #\k㿈@ A " ` 2S`  `(`< 2`0  #`0``?` #\k㿈@  " ` 2S`  `(`< 2`0  #`0``?` #\lQ㿈@  " ` 2S`  `(`< 2`0  #`0``?` #\ldiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map8`,`d$b ;  $`(i$`$ L$`(V ` 2``'7@b ``@`$ {#`@j`$``@䁐 ` `h$`h }$`$a  D$`( ]`<  T -bP d` !@ D`d< = @? 8 @ 1d"< 2 @` @`@ǐv  ?@ @\ ` H &H㈐㿘 X <`" @ <` >U#*` €   @ " @ڐ    W W W W W W W W W @" @㿘` H?$ H@-Ԑp`d hl`@a'\ '''?'쀦 '' '@Y@f$  "  @Œ 㿘( @^`@&@ > < * @#@$ @ C >@@ 㿘 ( `<   2   2  2  `X " < "  @`@@>@ @$B>@@^ 㿘 (@8@ "K&@&` <?`>W d*` €  ( 0&  *2 @ 2 >`86`6` &` &`&`>`0&`&`&` &`$&`(&`,&`@&`D&`H [p [| [ [ [ [ [8`( <?`->W!̓*` €"@0@@3 8`$ " 3&"z@ T`@%!@    @T`@r  a@ ` " "` \ \ ]T ]T ]L ]L ]T㿘  (@dV vn_lock㿘a`@?#%#>W @! "@@n  @ $ @ b 0  @@2 @㿘  ([V 㿘 (@Cdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapdefaultvop_islocked㿐>" 8"''*` €vop_lookup㿈>" 8"''''*` €vop_create㿀>#  8# '''''* @vop_mknod㿀>#8 8#8'''''* @vop_open㿀>#d 8#d'''''* @vop_close㿀># 8#'''''* @vop_access㿀># 8#'''''* @vop_getattr㿀># 8#'''''* @vop_setattr㿀>  8 '''''* @vop_read㿀> @ 8 @'''''* @vop_write㿀> l 8 l'''''* @vop_lease㿀>  8 '''''* @vop_ioctlx>  8 '''''''* @؁vop_select㿀>  8 ''''''* @vop_kqfilter㿈>! 8!'''*` €vop_revoke㿈>!H 8!H'''*` €vop_fsync㿀>!t 8!t'''''* @vop_remove㿈>! 8!''''*` €vop_link㿈>! 8!''''*` €vop_renamex>"  8" '''''''* @؁vop_mkdir㿀>"8 8"8'''''* @vop_rmdir㿈>"h 8"h''''*` €vop_symlink㿀>" 8"''''''* @vop_readdirx>" 8"'''''''* @؁vop_readlink㿈>" 8"''''*` €vop_abortop㿈># 8#'''*` €vop_inactive㿈>#D 8#D'''*` €vop_reclaim㿈>#p 8#p'''*` €vop_lock㿈># 8#''''*` €vop_unlock㿈># 8#''''*` €vop_bmap㿀># 8#''''''* @vop_print㿐>  8 ''*` €vop_pathconf㿈> L 8 L''''*` €vop_advlock㿀> x 8 x''''''* @vop_reallocblks㿈>  8 '''*` €vop_whiteout㿈>  8 ''''*` €vop_getextattrx>  ' 8*\''''''' @؁vop_setextattrx>!( 8!('''''''* @؁vop_strategy㿐 \>ܐP''P8*` €vop_bwrite㿐 \>ܐx''x8*` €diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map    dead_read: lock㿘@  " >[R. @`@   dead_write: lock㿘@y  >[R  㿘@o   >  8*` €  㿘  \ " @U    `0("`0, 0m 㿘 @ *@&   2 @7 >  # 8*` €㿘@&  "       tag VT_NON, dead vnode 㿘>[S-"0  dead_badop called㿘>[Q"h㿘 @!   "& @-  @!"diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapfdesc㿐 <@@2 -@& <  YȐ Z`@."  @.~ Z>[#Xɔ   㿘6` ʒ  㿐  @   "`< @ "@&@㿘      D `D*`"  * "" &`&` &`&`@&`&`&` d` u  `Tq Z` m Z `@-   diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapfdfs㿘> 7! > #> > H!> H1>\> 2 >b     , 2  *  Ėఒ  "v $`!   D  㿘> "@> H    F> H`> @* @@ >  2 `X2    2@ $& 2 > # ڐ     8 "`?$ $ $ $ $ @ $@" $@$   r fdttystdinfd/0stdoutfd/1stderrfd/2..㿐        `2 N .2%@H " * ư  2 >]`@32  2 X  j %@`"<' 2( >]`@3  2  , "  ` 2X   E  %@"<`   0$>]`@2   >]  >]` @2ߔ  >]>] (  `0@2Ԕ   >] 8  =X  Q  "`%@"<Ѱ 0G  >]`@@2    XD 25 А  ,`*`* :` ?Ѐ@  N "   X`Ŗ  `"  %@ `%@㿘  `>^ x*` €   "`\> bĔ  q   xl xl x4 xl xLfdesc_getattr8   ` >^#*` € `@,7 $` `` !m!m  4`$@4`$`D@2c` <`> "Ĕ!   4`$@$`D4` <` "4`4`<`$@$`D$`$` X" d> $`$` h  $`4<`H$`$$`($`,$`0$`8$`<j$`@  _  e  ???????????? 0 $ 0 `  0 ,?`$ 0+~ 0C؏< @ >ړ2` !X $@4`?# @4`4`$`$` $`$`<`$` $`$$`($`,$`0$`4$`8$`<$`@$`DЖ @0F <`H>^Nf @$< x x y x x؝㿐` ` `  ` A @?= -; ``  2@?. -, `0 "`0( X <`  <  -`a` S  0" 0`, *`0%d㾐  `   2  `  `  @+   7` 2L ,`>* `Ȁ} >a@x ` ``2 `, "'a `2  @:T "   ''/ /  H B`@&=@69 41>_ 3>]```  '`@/ , / `'O //   `  Հ`<`<㿘 `< "` `   -`@0 `㿘  `  -> b   㿘  `  -> b   㿘  `   -> b     㿘  `  -> b   㿘   ΐ$ < 㿘  `"`"   &  `>`(`  ` "`  `     tag VT_NON, fdesc vnode 㿘>`N4" 㿘  8  㿘  .  fdesc: bad op㿘>`L"diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map   㿐` 9  @ $`  ɖ  % $` $   $  " $   $`$ ` 2` 2     $    2  $( "    $   2  $(  ! K  G+>) А!b`  &ݐ  6 20  . $   &   ! +>) !b`  &   2      fifo_read mode㿘    @>aK"( 2 5 "`!4`  l    M `Д@2 ` ?4` " ` >4`  #2   ` " fifo_write mode㿘  `` >aKe#X "  !4   &      ` `  >4 `  "~@"#       'j6  "  "  ` ' j%  `   ` 'j  0"  ` 'jx   㿘     "       㿘    `? $``  " D` ? $` @D  @`   $tag VT_NON 㿘>bL&"P@ >b L "`, fifo with %ld readers and %ld writers㿘 >b "L  " "  "    "     -fifo_badop called㿘>bJl#XR  2 >݄8" 8L>݄H" 8t <`" "``$2`$  <h  "h`2``"`hp2p <L"    2    ?(2 `   <  "`2``"`2<`t`x ``|"4" ` 2  ?(2`  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapkernfs_get_rrootdev: no raw root device 㿘>l -> FĐ ("l> 7!  %>?# '?`Ĕ @ `2 @* * @ @ @f$h`Ā  a  ?>c$hJ" kernfs㿐 <@@2 -@& <' ؔ Y Z`@&"  @& Z>c#ٔ   㿘6` ْ  .kernfs_root: findtarget returned NULL kernfs_root: couldn't find root 㿘>c#@/  >cI1#@ >dI*  㿘> &@##&`#> &`bt> > !h D"" "&`&` &`@ &`&` d` Ā  `T| Z `x Z `D`@%  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapipsecversionusermemtimerrootdevrootdevposixphysmempagesizeosrevosreleaseostypencpumsgbufmodelmachineloadavghzdomainnamehostnamecopyrightbyteorderboottime...kfs㿘> H>d В  0 > #8"#8"` 㿘> "@> H    W> #8  `X2   `2`@+ 2  ٔ > 4& 2   ( > cP r    `$ $ $`$`<  ` 2$` >d@+YbȀ 2$`@ $`@$#8 $  "" ` I 㿘 `"`> "#<"ܒ  Ғ &  㿘> H   >ݠ"  H @+ H`@ %ld %ld %d %d %d %d %ld %u 㿐 5y _ "%    0# /O 0"U> 7 c Y [m 0w k 0@}>eaxI\0y>eaIV0s q&> ) Ȁ a@"o   @ @g " b @ 6"@ "" 8  Ȓ` &Q > #(>     D> "@@  *+* > c0( c0(>eaI0> "t>  >e"aH* 0> "t> >eaH+ 0@mk @*"& 㿘 / _ J?` "!> "@“> 7" DJ?` "!>  …> "#(, 㿐    ``̔$@? 8`H   N .$3 2  `@`. ,  G2 X ?"$     $@ 2 : ` ` 㿘 `@ 2!m` `   ئ 㾈  ` @#Ѕ$$ X" d  $$ @|<$$*`" *  * $4$8`" $$:   44$ 'u! 2< <  @ - 㾐 `<   -`` 'U! E  㾘 `<  # -`   @   @8& "   2  .@)oԐ㾈  <` L  8F    @#  7>b,` 1 >`H@, G2  ?"  쀢 " `  '7/ / є    `H@& <`<㿘   q 㿘>  ~@`>g0(`  ` "`  `       $ $  $ tag VT_KERNFS, kernfs vnode: name %s, vp %p, tag %d 㿘 >g`#X   F  㿘   k 㿘   a kernfs: bad op㿘>hE; diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘>  㰐  > "b| null_node_find: vget failed. 㿘> #> 6` |> * b@` #>h`2@`  X2 @ `  FZ``2` null_node_alloc: no alias for device㿘> "@   > !H   0`<  $ <   $ `` " $ $` $` " <&d  <? >  \ > !L $ <$ 82U +> ? 6`;%>  >  a: ?*    "     < <@2 D ِ ۔ 怦  " " "`&>hDS! @$ @ @h& @(b| *   $@ " " $` null_node_create: aliasnull_node_create: lower has 0 usecount.㿐"  'Q л`D 2 >i H>iD ` &diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿈<@@a -  [ T&(&&$&&,# Pl& <  ސD    X$@ } Nn 0*@ "@$` `X< "$< $<$E Y Z`@ $@  Y `@ $@  㿘!6`  D `  2  ΐ!) &! 㿘!>   b@7`퐐&@㿘! @P@ d!!   "P& DT&@X@ &`\&``&` d&`h&`l&`&` d`   `T Z ` Z `D`@˔   㿘!   - -diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapnull_bypass: %s >ު!`@>j`DC!`  *`1> x  @ $@ "$ @ 8!H@" $ @$ @` "@· <  ` 2x@@8*` € ` @?3`>ڐ"@@   x@"@@`" `!2  2  "@  `XA <  ` ؐ㿘   `X  d"`㿘  <` X <` f㿘    㿘  "`"`"  & ξ tag VT_NULLFS, vp=%p, lowervp=%p nullfs lowervp㿘 >k  ` Cz >kא 㿘  \``r$ \$ \㿘  \``x$ \$ \㿘  ` *@&  㿘 * "  㿘  `   X`<@?  ?   X`< @   diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿀<@@w -'  q  k( ` d ,0 "0> bD }谒   0" 0`, O#`00K   "   " <@ "@`" `"`" $ $  " `0?"`0`, "<`0< $<$Ő Yu Z`@/$@ j Y `@$$@  㿘!6` D ` n 2͊M!   0 "0!(! \! $!㿘!>  b@̨`&@㿘"   D&`&` &`@ &`&`&`&` d` $  `T  Z ` Z `D`@]  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapportal_closefd: error = %d 㿈'Ȕ蒒 >lA#8㿐   '%? I   > L .D%1 < D `Xp 2/ "`<    "` L +>ޒ`J@ "$    $`$@b` $` %b`% ̸㿘`"! =VV@@"` ) ` 2` =   沔  &`Aportalconportal_open: %d extra fds ``'t@ 'l  \  X a t1 ltbP* 2l` (t lH /` * ! t` `8 '>m` `>!P *t  6pw t` `8 "`H 0t`8 2`rt2 tx p @ @3 pt @2` ``'x`'|`'` 7 P'''    ?؞P''t '''''  pl 'plh耢 ' &` @'ht'p  Vp "l  'p @l  " 6l ْ`>l`@?2  2` 4 = `>m?!@ $  @?` ؔ 2` R`  z   =H 0l% \ l "tt   t㿐  ` @ȸ$ $  X  d""< $ $ @t $ $ *`" *  * $ ,$ 0< H$ ($ <$ @$ D @  !$ 4 $ 4  !4 4 $  $   @2  @ -  㿘   O 㿘    " < &   6  " `>n(`  ` "`  `     tag VT_PORTAL, portal vnode 㿘>o?  㿘   L 㿘   B portal: bad op㿘>o> diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map(%s)X Ȱ -> c  ” `1? `,>o@a ?   0`  `4`    &`2` @nF` =` "``  Ț   '?''''''@o'䰒 2k``    '?'''''''@or 2W`    K* :I`  '  "@`   '?''''''@oK / "?`@ 2L "        # W" 2 `  *'`` @&` diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapwaitrunstepdetachattachusr2usr1infowinchprofvtalrmxfszxcpuiottouttinchldconttstpstopurgtermalrmpipesyssegvbuskillfpeemtiotabrttrapillquitinthupprocfsxprocfsprocfs_control㿘#`4 4@2`, ( @_ `,6a0`H(@&`,`4&`X] 3  N`1  `H`,(0)6a0>p0|}4>p0w`,(} 7`H&`,`4`X " `,f %`,*@&`,1&`X_N`1`  &``,  @lא @` J&`0O`,(1 N`1  `H 5>p! 0   N`1  `,( `H +N`1 2' `H2# `,( N`1 !>p! "8  N`1 0 ;"@N`1   㿀 6 - '@N䰒 ,>@p#  -` >@b# N`1 2``H2 ``,(`d6a0 ` V diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㾐@F 9! $@@  `  &``, `@l` @  } 2` 2 `N`1  @` ? &`> ,2   diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map total: used: free: shared: buffers: cached: Mem: %8lu %8lu %8lu %8lu %8lu %8lu Swap: %8lu %8lu %8lu MemTotal: %8lu kB MemFree: %8lu kB MemShared: %8lu kB Buffers: %8lu kB Cached: %8lu kB SwapTotal: %8lu kB SwapFree: %8lu kB `> #  h l(   +*" +@( , + +@ #t* + >r#h#l#p#x###\#`#d#|##<" 2  "@  `   Ɣ㽐"'@  `2  "@@''`   "@ diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘  @ `,@ ` `   "`` @l3@` 㿘 `  2`,!" `4!2 `4 2`,> 7" `,@ # diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapH    @'@c  -diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapH 9 P $@@  `  &``, `@j@` @:   2` 2 `N`1  @8` ? &`> ,2   diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map %d %d %d %d %d,%d %sctty,%ssldrnoflags %ld,%ld -1,-1 %ld,%ld %ld,%ld %snochan %u, %u,%u 㾀 H  4 4!       4@m>s@h$ ,` @F!  /`@>s#\:֒!`ߐ@p , '>s `#?`l 2  `n >s:!`@- @(,!@#;L@D ,!?:?`@; >s` #>s!:>sc`א@(! ` `>s!:|>sc`Ȑ@L ,>sȐ:l!`@ , >s  ܔ ؒ!:[`@˔@Ɣ# l>s:J!`@ >s#\:5!`@ϐ l>t`  0@ @"V @E`>t :!`@ >t  :!`@V  >t'>t,   9!`@^V @V  , >t 9ڒ!`@t`@n 㿘   -   ɔ  &@4`  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapprocfsl㿘> 7>u!@@  S > H " "` procfs_allocvp㿘> "@%> H؀> 7 2 X2   &@^ 2> 7  ꡐ!@> aX  F@@  B $ "" ""* "">v . €!m2  $ <$ @!$2 $ <!m2 $ <! !$2 $ <>u7;"" " ""  @ؔ @ P         㿘 `""`> H" " Β &  㿘   `  24Y  2  > 7"`$ ` 2 K ?` F>v"*` € ݖ;  4 A- ږ& – V  Ŗ   - , ټ  ٠ ٠ H d ڀ㿘  @"!   ( "  > .@@ J?` 2&?.@& 㿘 @   2 diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapprocfs: invalid directory entry sizeprocfs㿈 <@@5 - "'ה  "* " <%  < & <   &!  Zk Z`@%"  @! Z>w hl  $`㿘@  >!`   d  㿘 4  h@"> >!d>cc&`Ԗ Dؔ c#@ &`&`&`&` &`&` d` ,  `T( Z `$ Z `D`@e  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapexecmdlinenotepgnotestatusctlfpregsregsmemfile...cpuinfomeminfo㿘   e  2 "  2   (2     "   ($  ` >x(`"` l   "       㿘  ` c  㿘 `>ẋ(`  ` "`  `     tag VT_PROCFS, type %d, pid %d, mode %x, flags %lx 㿘 >x`!` ` `6/`㿘  3  㿘  )   %ldprocfs_getattr㿀          q !>  < $@ 4`$`$`@# $` <`H@js<`$`4*`" *  * $`$$`($`8$`,$`0 ` >y!*` €,!?`" @4` 4`@ $``$`  4`$` $` `K*`>y!h € "> "@ 4`$`$` 4>xb5Ґ: <`6<`H   <`4`$`$` -<`H 4` " $``<`$` <`H - #Ȕ  *   :  P !  <`H<`>x3" D P ( 4 @ @ @ @ @ @ @   8      curprocself㿘 > "@  `%@? Ű ` 2 M .2% `  g 0`@ `   >y`"(@ `?`   `>y"0@ `?2X` X   >! >ߤ!Ġ `a @ؒ  a X€ a a䀦X V `@r#"R@A LXD `@XUC.` 9>!>߰  2a ` @=   " X€   @ 2 X ސ`7 %`Q@    쀠@ 㿘a `    㾐     ɰ @  7 B 2  >!- @>a  "  X€ " `` *  '  / /     & }> %"  t q=  K>{!,-  €  >w#h'/Ք ,@J/  '/>y"(    '/>y"0  4/X!`  . '/>w #xX!` - '/>w#  /#`@4>x *  '4b3 // &   `  = =  @%s㿈  `  > "@`4>x b >{>yaH(3  # Є #* ((Ї8 #2  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map   㿐`X``  `<  <`>|!h*` €> 7!  ` ?3, ` .> 7b  , * > 2` "* `$@j  , @o'?   `D 2 S@n N , > 2* "` *  $@  @ $@```^0.> 2  * > 7"`` ?`  > 1, !0"@*`    , "> 1a0* @``  \ \ \ L \ \ \ \spec_read modespec_read procspec_read typex     >|0ѐ!  2  > "@ " >|0Ő! 2<  >| ݃> 2  *` * " *   `ߔ0  6 (` ' `> 2  *"> 1*" a0* ` @`   `h@   `  ` " ``"g' ( 2@  >䀢 M J @   > @ ' &@ 8 `?'#\#`v ?R" @"@8 H4r䀦 " 00!j 㿘   ذ spec_write modespec_write procspec_write type㿈    >}/! 2 <> "@ "<>}/!  >} ܩ> 2  *` * " *    ` 2 6 > 2 ( `*"> 1*" a0* ` @`   `h@   `  ` " ``" ( 2@ 3>=` H`"F@ В  @ I %@ 8    '?}`@%@@8``Hb@@z`8쀦`"/<!( spec_ioctl㿘   < `` 2>~* * > 2" ` * `@       *> 1*"@ 0*`  @ *> 1" a0* ` @  @ . P㿘 `< 2 `> 2  *` * " *    㿘 > 2 ` $*`  * " *  @@ (   € spec_fsync: not dirtyspec_fsyncspec_fsync: dirty㿘 < JH /d4p* %p  >~ 0   0 .( 0 $ 0H p@0ڠ` >~ @ p` H 0>~"PE0H 0 㿘  p   F>",`"> 1@> 1, "@!0 *` €  "    "     2" spec_close: not special㿘`  <`/ `U> ` ! ` `!` " 4 @!+4 * @*`> 2"@ *` -``4`  `  u`ڷ Y 4 @!4 > 1* "@0*` -ѐ P``tag VT_NON, dev %d, %d 㿘 ?   > 2 "/- `>ԇ(`  ` "`  `     㿐      #\ <  spec_badop called㿘>-t#8diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘>    > "bx  6?@  *@2 ?*  6?` ` 2 ?*@㿘>  > 6` x> * b@@` `2@`  X2 @ r 2@0`2` umap_node_alloc: no alias for device㿐> > "@b@  "`<  "<襔 `<?    蛐 "``` " "`$ $  &v `<? `m  "<>  aL" 8@0\@)> `<6`? @'> ` > : ?a*  @`       < <@2` D א   `"@`"`" $@>,\!p`@"`@ @h& @/&"x @*   $ " " $  㿐(  'R Ґ &㿘/!` b``ܒ`?2&`#&``Ҕ?2&`?#&``@ ?# @?"&@&@ @ diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapx `  <@@{ -y  t T&(&&$&&,  iT&`< "Ɛ]  z `X@$耢``0J*$ $ H  C"A* <ܐGܔL = 0*@ "@$  `X< "$< $<$ؒ YĖآ Z`@~$@  Yذ `@s$@  㿘!6`  D `  2 א! &! 㿘!>   b@`\&@㿘! @P@0!!   "P& DT&@X@ &`\&``&` d&`h&`l&`&` d` ^  `TZ Z `V Z `D`@   㿘!  㿘!  㿘  X $diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapumap_bypass: %s umap_bypass: user was %d, group %d umap_bypass: user now %d, group %d umap_bypass: component credit user was %d, group %d umap_bypass: component credit user now %d, group %d umap_bypass: returning-user was %d umap_bypass: returning-user now %d umap_bypass: returning-component-user was %d umap_bypass: returning-component-user now %d >  `     't> +"  . x 3>  $x"  "$ @ 8b@@" $ @`$ @` "@<`  ۀ ?"$ ?n&਀  `>+R"`X਀ "  ``>`+D# ?&'t ?!xG"` ਀`  `>+*#8`X਀  x`>+#px@8*` €  @?   x@`"@*@<`  2 ?"  a2 `2  b2   `X, ?"! ?਀  `>*ΐ#p&਀  "  ``>*# ?"? ਀  `>*#t@਀` "   `> * (umap_getattr: mapped uid = %d, mapped gid = %d umap_getattr: original uid = %d umap_getattr: original gid = %d 㿘ː " G> X `d "  ` `> *`  X`b` `   ` " > *I #"`   ` " >!*3  ?#"`  㿘   x 㿘  ` *@& m 㿘 * a" 㿘  "`"`" G & ! 㿘  \` $ \ $ \㿘  \` $ \ $ \ tag VT_UMAPFS, vp=%p, lowervp=%p 㿘 >`#)ΰ umap_rename: rename component credit user was %d, group %d umap_rename: rename component credit user now %d, group %d 㿘 `  > ` $`  `> )#X   `> ) ܐu$` diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map8> !@8 26  @, @؀`' ! ҫ' Ԏ` ^  > &(@s  '&@  㿘> H  |"? 6"> H!`@ >!>"bd 㿘> H!`.    " " p  㿘> H!`.  `"  N"㿘 @ 2` 2   ` ` ː Ɛ @ @2 (@ (  ?& (`"  "` "@@"   "?  "  &   "?& ??& > 8  "???& > 0@> H ,  & " @ " &  (`& (|㿘 㿘 }㿘 < 3 ???`0 2 `4   :`02`8`8`< :`8 @[ union: unidentifiable allocationunion: . not lockedunion: allocvp not lock owner㿐a\ ` ` `>&"h " `< <@" @'     "'I '􀥠@T 2  "` #> H #> H"? `";7`"74  #> H, ``$` 2@`  2@``X2@      `2```o@2`(`( 2> >&""@ "&`  4`@  ?$` >%"`(` > ``(`$`(Ғ "@` $`( 4?$`@` @` `"` q` "``(  ?$`(`ɒ    $`   ነ $` &  `*@ $` "`G` % @2   2> !  ` *  h!d  M H`"`@ "@`< <"`<??$`$` <`8<`0$`$`;`  $`(`$`,$`$ $`(> "@ "? 4 $`@   $`    $`   `*@ $`$` $`$`> H , $@ " @ " $``(`$`(㿘  (  ?$ (`"  "` "@  "  "   "   "   " ⬒  ⩒ &  p   ?''ѢA !  є 3  @  жت )@''''''  ?% '''''' 耢`  P 㿐@ P`(` `$`(`ΰ R 2`( - T`( $`(!  @.`Έ`( `$`(`$  5 `$`@ $`$㿘\ `'    '  ' `*  '' '  `2  '  ' '  ' % 2 0Ē ' p#\˜ "" Ԑ  |'7L  WЛ n &` Џ@*#\ `0̀  .JG 0` ה  5 `$8% !@`'` R ` '' 't'p'x'|` '`'G'lp` ;`l `ڒ`l@lfl 0"4'` ή4`` l.  l  H`" Hl%Al㿘` H?& H㿘> "@@ (  ?& (`"  "` "@ (` & ( ǒ 8       ؀   union: dircache table too small㿘> ! 8 `"@" &@`&>"Đ! &    ۔㿀`'  ,`'ǒ  '*m ' `"`,"'' @'  ̵`T@@  X #\#`Ԙ  " ,`" ,+ 㿘 ,    , & ,diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map:::union_mount: bad um_op㿈<@@    -   ݐ P&(&&$&&,H  &<    ݺ  ``$ ``    } $  $$ $o $$ < 2    g  $ @ "@ $ 8 !`$    X <@ "  X`< "< $<X<< ` $<C$ Y  Z`@"   ">  >0 >0 >   > !q @ؐߔ  Z"@Ɣ? $@@0   `` @ "@㿐!6``@2 - %>  $[`D (`6   "@@ x`(r!͒ $!㿐> !"@  2 ˒ " -`      #\#`  G `y    o@ ( "(P!@!    X  2[\`&` d&`h&`l&`&`X  T TDPX&@&`&`` @|T&` `@vT&``|@.T&` D@\` `dhl`&` ` ` `@ &`&`&`&` d` ܔ  `Tؔ Z `Ԕ Z `D`@  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘 `l (`& (㿐@@ @ "' X' .&@J @ 2 Xʬ 3"# @2`/   ` € " & < 2& `& union_lookup returning. (%x) not same as startdir (%x) >  X   !  b@ $ ` ``'''P'`( 2 l %`(`$`( `g @` @`( $`(`ɼ  `"@  ?$  ? @2   ʁ   ؀    >`2= `Ɋ$ 2 $ `$ $    .` @Ȑ '= '`"@  ?$  @ ` `    ' `?`2  ?$  "f % <`# `( ?$`(˴``( ` $`( EA'  ˖ X #`#\(   " $S@ `  @2 n    J`. @>"㿈   `' ( M] ( $ ( X/  #`#\ Ж }0z 㿘 >   b@  - ( 2   ˆ 㿈``  )  (  ( $ (`J X` ` ` ` ` #`#\ 20/  㿘    ` ,  `< 2 $4 ` `s ( ז" $ $ $`&Ȑʫ 0 ( ȶ㿘  ` 2& `$`?"`$& >#8*` €㿘   `  `( 2  x  Ȳ &` !`ِ  ȣ    Xa` ` ȕ P `8      (  2 :  Ȉ 26`? ?t 2 <     m `? ?Y @ "  @ 2 ` 2  `X  d"`㿘`  ``  <`2 ``` ` @ % !  ( 2 א `` 9` ``?2``? `? ` ?㿘   "> `? b@`  ( 2     ɓ )    ` 04  4   ?Ø?0 84   <   ??union: missing upper layer in write㿘 >   `b@>" ( 2 N       0   4  ?~?㿘   " & > 8*` €㿘   " & > 8*` €㿘   " & > 8*` €㿘  `  ` " ``?`Z  `( 2     Ԓ union remove: null upper vnode㿘` ` `  ` >! 0 (  ( $ (`( ( $(`     & ǩ 0 2   X ` ``union_link called without LOCKPARENT set! 㿐   ` `> "E  88@?  2:  `ż` @2   B    ` @2 `      & 0*    0   ` '  "`(] 0  `( $`(P  )㿘 >  8!        T 8@28` F`   "` 8@` /צ ( $ ( ``8 2 ` `Đ ( $ (    2 `"  p0m ki` ې 㿈   `.  ( { ( & ( q    " = 0 X #`  #\0  0  union rmdir: null upper vnode㿘` ` `  ` >m#  0 ( 0@ ( $ (w`( #3( $(j` T    & u '0 2   X g` F`D`㿐   `  (  ( $ (-   R  "@!  㿘 >   b@ ( 2&  & >" 8*` €㿘   "> `? b@` & ( 2&  & >" 8*` €ƈ 㿘   " `?( `` &  2&  h& ># 8*` €V 㿘  )  K  (`    㿘 _ union: dangling klockunion: dangling upper lock (%lx)union: locking against myself㿘   . ` ` (  `D   } " (3 $ ( ( "  (>#p >#- > "@ "  ( 4 @@2 ($ (>#`$ ( `"@ "? 4$ @ (  $ (union: unlock unlocked nodeunion: unlocking other process's union node㿘   (` >!> "@ " ( 4 @@ ?$ (>ِ!0 ( ?`$ ( Ŝ  ( `$ ( $ (-$ @ 㿘 >   b@`?` & ( 2&  r& ># 8*` €b  tag VT_UNION, vp=%p, uppervp=%p, lowervp=%p uppervplowervpdircache:㿘 >  "  ` `>J#  `>C#  ,   !>6#   2  (2  㿘   "> `? b@`x & ( 2&  & > L 8*` € 㿘   "      v 㿘   " & > x8*` €union_strategy: nil vpunion_strategy: writing to lowervp㿘  \  " & \>ސ!@ 0@    >Ґ!XO& \diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘>!\> 5*`" * " @K%> " @$4` <@@ <* .@{@ * > 2#Ta@q>  ,'"  !n!m:"`>"x>"@  @" `@:*  '4p8D* @4p> #6p&% * ,  , @b.p6@dos2unixtime(): month value out of range (%ld) 㿘 6` &k& g2`**`" " `*  , **   d@> #c'> (=)>?"2c2     !`"!n!m`@ ` >"x>"6  ?> @e  ?  ?*@  ?, @*`" *" * b $!\*"@ *`@  &@T d* "*"@ *`@*`@*`&  >> `>  (   >>ਘ  ` `+``    "*@ .*@ ``  >>ਘ  ` `+``  *@㿐  ` *? 6*.`  .2 2.@а@ .  . .`@ .@  `   " ."       .`"2  < *`#"@ &  ?>" .@ `2 @ .@   $ &   ?? "? ."?   >" .@  `2 @  .@   $ * 2@ _.@@ ` .@7 5  @=  0?,@   @ ?@ "&  " @ "  ~  .@    @? "."(("@   ( ** *  * 2 ? (@((` ? @((` ? @((`   @*((  @* @ 2?V? ?(("@ `K@ >  * @   7` 3 >   @   #`  >     ?@   `  ?<璂  @ ?ca @ (( ` *` ` 2?R` @?(( @  (  /">( ` 5?< `  (  /%0 ` (*`8( ?< `  (  /" ( `   *`( ??<    ( @0`㿘`? " .`` ?` "`."` ` @ؒ diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘>ah> 72   ;: @ʔ > "c 㿘> "@6@+> 7)> #`@# * @ "  @2 2 2 , ` J `@> 7>  `@0(   2  2  2 ,"   2 @ 2" """@   2   " "denodedeget(): pcbmap returned %d 㿈> "@`tc 2``"`<`z  &> !T@   & =1 @ >    8"` $ $ $ $ 4`$ $ @6$ `}t "$ 0T "`0` $ ` $ ,`t#@&`<@## @ "@, d`tc 2$ p`<$ p`@`$ t !4 n4 f, e4 h4 jS4 l@ V찒 p Xo  c, d , e  * @4 f  * @4 h  * @4 j  * @4 l  * @4 n  * @$ p  *`  * * $ t 0`t    *` * $ p  d  " < p?c @  >`T*  $ t#  "`< o &㿈  X`<2 > %"" *`" *  ' * `%'`  &  n lƖ  d . d 0 `   j     h f e  ?&    ? d`&  , r @ Ҕ耢 2l X   d * *  e*`  g* f2 *` i* h2 *` k* j2 *` m* l2 *` o* n2 *` s* p2 *` d  w*` d  t2  *` d耊   u*` d耊   t*` 0 tc ` p*` p* а 0kdetrunc(): can't truncate root directory, clust %ld, offset %ld 㿈` @ `d``0  t#@>` `)!  ` @Q `t@` ` T@ 2@  @x "  `0o`p?''$`p `@  T@u2@  X@/ ? \ T" *@ D  @  T \6@ "@* ` ` 0C@``H `@"@H$`t` $$``  ` Ț  􀢿 @?  T2@$`$`쀢`  t2@ ??@4deextend: file too large㿘 `@   0t#@" d4  d " t. @ 8`> @T@?2@ 2 " P@   @$    t     & t $& N 㿘 d 8msdosfs_reclaim(): pushing active㿘 >a    D >" "L& k =$  msdosfs_inactive(): pushing active㿘> a   ``D >"e X   , `X <`   ?  , X  ; X`Ò diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘 h@, l3 4"@8+  4'  8@@ &2&  h@'㿀> c@ `0 "c@'?2`p `p 1' `d ) T`t.@ ϰ  \ @"2@& \ <".@@&2&   T`t.@ `"@ 8 ' 2&   `''@&@'> `X "`X> #8* `" Z# t2?x  @ g쀢 "  ?谒 W t H   *`  * *  ' H  *` ' t/2 t 2 ' t ' t2 ?8'  ' t2@ ??   T \"@  D?*  && $`x$`|0& "$`?$`  x    "(  " " x?  :" 㿐 x X P ) | 4 *`   *   L :4 @?24      4 4 * " 4 *`@ V8?& |  x$?  & x!  H S* P2 * P* P* * |2 * |* |* @ A  @"%   6   4 `< ۘ ' H`<`H @ }  & 4 @0n㿐 P 2* $ P  * *@# @0   @" P$ P& fatentry(): function code doesn't specify get or set fatentry(): get function with no place to put result 㿈`2`> #  >   `L`@`Ϙ`?,  [0)`t#@  H  *  *` *   H ` * o2 23  3 8 &`b?`t#"' R#&K耎 H  * /  < / 3 `H* 7 `H*`H '* < H  *  *`  * ( 3 `H3 3  * `H * `H * x &`d'耢  㿈`@ L?  0V@J  ?s #v` t?#1 a4\蒎` H   *` <  o +` 3  H*`H * `8'5`3``H*`H*)  @ H<  *  * @@ *@ ( 3  H3 3 @*` H@ *` H@ *` '@ 􀦠2q  $ d 㿘6` *@` L?*2`: `"  "    * @" ?" 8㿘   2`* `(  "  P & P `?   2'`2'@ 㿐`   q@Bh :`  qbmT  L`9 @ @$ 4` ,  `  * ?@, 8 ?t: L` " @ 4` @!4` ,  `  * ?@, 8 ?O(` "     X㿈'?@ 耢`֐ ? "$0{ P6`  $ P* ` * *#  t?#@")o" R@ #@,J t` `H   *` 3   <@`H3 *@ H@ /*` H  ** @  H !*  H@  @ (  *`+@  H+   * H6` @*` H@ *` t@ 6@ ?8@ `( L@(p 耢`Q 㿈L  2  '?," L 2 *L \$P,@ @h 쀢 2t쀢 "zݘ ?: "ti08#@  H@ @  *  *` *   H ` * o 22  2LP4 $P*  * *# L(1 extendfile(): attempt to extend root directory extendfile: pcbmap㿐p  0 d > 4! > 7!d`"!dp ?>  " c   `0( 0 2' '? p&@& p 2  $p E     ?$J$F' d  `T?`\ `D" `*@ '``@ !`\`T "@. `` `\`T T P"@ :  ! ?$ T T?2 H> 2! H@T <$ @& ?`'`2p diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapP  '`'` '  ''@?'  ''' 0"@ d 2` ? ` @ 8Аg ] . T/   - "̀` ` ̀     ^ T ̀`   I` ڦ"@` `J .2   J .  #  'ܐ  "    "` `'` '  '  2' 2 'Ԫ  Y?}Dذ i؀J H ``2?'` '3~] A &    $``'?' @ @ "% $?'% $T% (ؤ ` ~'`  + 'Ġ Đ"* @'  2"` "` , ` `  % (% $`̐(`$`c ?`@ Дݐ   *  ct    * @*`< " ܀ "` '# }t#@ "<`2 -#8`` V  p ܀` а "԰ Ԁ `"@   5Ȁ`0 -#2` { ` t p2܀`m ܐ԰ eԀ` "`([$` V # ܐf԰ `0À`0 -` &`00 p ܀`"@=԰ 0} 0  Ԕw  "`@ 㿈`$`t@ `0?``"@`T 2 '     t ? 0`T`t*@ &`t`$`T2   P  `$`X ` ?{찒 X`$ `X`H @  ƒ d , , e, g, f2 ,  i, h2 ,  k, j2 ,  m, l2 ,  o, n2 ,  s, p2 ,  d` w,  d 2 t2 ,  d  u,  d  t, 0 tc 2`(p,  p, `( < `(? 1&`(`$`X@!{谒 L`$&`$`T2@  ˘ @?`{찒 6`$`XH &`$?K Ψ {\谒 "`  d p'`t#@`<"'  #+{. .. 㿈 0  u  =`??z .H# %>#> `" 2쀢`@鎔 b@鈔  H@  { { 0{  doscheckpath: source and target on different filesystemsdoscheckpath(): .. not a directory? 㿐`d ' 1' d "i `ppb a`00@"`t>#V #@>`<N9 `d H` `  >b@" " `<  `c`t*   ` `*` * pԀ ( `<#`{2' W  `d Ֆ?`\`p`T?" *@`D`@ y``   { 2>, 8  㿘 X` ` T  \2 "@  @* * `2  T T \6"  <*@@  \ D"@*    ?y  z &  X H  '㿘  0 㿈`,$?0 &`,  *`?  `X "*y찒 1` 2- `X( ' `T?4   ?`yT z0`XH  `"Ơ $"  zt  㿈 0 ``  C A   `4 2?y ' H H@   @  z- `ͤz&  z"㿈 0   2/ ?x z 0"H@ @   @  "` `  ` @ * @y Ӡ y  y  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapx ~ |  <@@"Mx`  ` @  ϒ  <@2 - ` 'x<@"x ```l @5!  0 ` *@$`x x`ڔ| @&(&&$&&,\  < "  > 2 `&  `"<< !!`!  0m <@@2 `@j  d "_0Q$` $`4`` @ $` $``"$` p`t#@2$`@t @}0't``   $`tp Y|p Z`@ࠒ$@ x Y|ۖp `$@ @L~ |RRaArrAaU㿈   F >ɐ > #D 5 `@  ǚ     `<   ?  x ' `h ? 2`( "y``  ܰ O  "w.? 2  0 ; # 0!H@!!$@   *  @4`  * @4` ,`  * @4`   * @4`"  * @$`4  * @4`(  * @4`* ,`$x`2`"+  + (*2  $*2  ?8 O`"2   *`   * * $`,  *`   * * $`0 * @$`,$`0`?@爓2``0 @8_ ` 2,``" 2W `4 2S   * @2M #  $`t$`$`  *`   * * $`4  *`  $`` $`x A`t#@ # 2 O`@@2 O`0  @;@ 8 O`@`0.4`$`0`,*$`,`&4``""4`"`4$`4``tc $`8 " !*  #@ $*@ *@ $`<`4 ``8@$`D & %* @$`x`4 `` `*`8 $`<@$`D$`@`0 `D @ܐ" `4$`H`$`L$`px /`  `?`*?* 2  ?/  `t ///  ?#  $`t$`$``t/2@`*` $`h``h@梒$`l0?$`\?$`X$``%? *@ $`Th Ov'`x`9$u? 2[> Hc@䭔  2%$`x>c!@䥔  2$`x>#!@䜔  2$`x#@䕔  2 $`x ! !*` ! !* * $`|v'`L < 2  .* $`$`$` 2`< ` $` ` $` $`d` &a&`d  &`h" " 쀢 v  !?` ` " < ;&a 㿘6`   a` "`` `  ?` < ;`<*@$`<$a㿐! j  `&@㿘! D`@ &``&`H&` P&`P&` &`&` `T|? Z `|; Z!La|7 | `D`@x  㿘 < " ` <2`  p ` @` `` q@ 2&`@d 8 msdosfs_sync: rofs mod㿈!'''' d  > 6>|"b@耦` ` = 2' 0 㿐!`` 2& `&  2@ "` "`㿘!$`  `0`4&& diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapmsdosfs_create: no name  p`  $ t@h `$2p> @ ٔȰ 2X``  ! > %"/''" h *`' " '|*  0 *  <''l'ޔܖ $'hԐ /`  ڔ   ؔ  'd 2``@2`g  d "`\ 㿘  Q   㿐 `D 7` 2> %"" *`" *  * ''  $  &  n l编  d . d 0 `   j 策    h f祖 e  ?&  㿘 !m `d `0!  ? 㿐> %  *``0" *    * ''` %2  $``n`lo `d ,`d`0 `` `j ` ` `h`fX`e` ?$``$ `d` \`p T?"  D* | `p`  \` T?"  D* |א  <|ђ` 2 $ `d !m!4`0  4 `d @4 4`0 ` ,$ `0 $D$`t <`n`l`0 `  `j }$`h4`fx `e $@,0$4$8$$$($@ `d 2$<@$@$<`0``$ `0`tX*  㿀    0   6 d{ y s 0u  f e`T@   `X'``  "@ 8 t"  &   p N ?`q& `T@ `t* `\# ``* #\+@  q? `\# * ``?q$``@"@8 Hcr쀦 "   X <@  $msdosfs_write(): bad file typex   ' < '0  >0 䀊 " t =_  @ W  Q "t@ B 2 t@ʕ = t 2  (  А ,':`t '  B  2+``@ ((``:```@ E@`TB B?@?4"@   䀧 պ  Ӏ  'r̀ `T?2 ?';  'ܐ@`\% @]`X  @ P @E @ؒ@L @В@D4``2t@ 8 ``t 42````@- r 'H@م<T"@P`\T`T"@ ;  4 ?"`T`T?2 q "b 0a``?p\  `X`` "  t <  B 4  &t  @ @H#`p`` q3p  &  `T @>܀ J@ H   䀈? " @ b %= t ?@ 2   `0   㿘   `?   `?㿘   < ` -2    㿘  -  msdosfs_rename: no namemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirrename: lost dir entrymsdosfs_rename: updating .. in root directory?X >    ' ''Xa` d "@$2X>7#8 X@  " X@԰ Ԁ Đ9Ԁ 30f   `D ܒ `d`" J`.  ` ` @ @Д  $` 'Բ   ` ` $' +/ðВ  `pp2 c $`" `Ԓ 2``@2>#P” 2`Բ   `!`d  ذ B`հ ucΰ  ɀ`  \ ` ? $>h#x` -{Ѐ 2 >S# `  $' @><# ` N Ҡ`Xؐu u Ö$(Đ$$  u ``,`$`,$$ `ĐT 3 `  `? Ô;` X @$` ` '`&`p`2\>ِ#T?" D*@@ `m "o  H s` *`p2 *`nQ̰Д Y`ː` ?$`MЁmsdosfs_mkdir: no name `p `0`$`t@ d   ? 2p @֫> %" <" h*`" *  * 'h'l'ޔܖ 'Ԑ /`  ڔ Ṗ    ؔᰖ ?'d  \ T" D*@  `@ o  H@j ` H>!t @  H+`d2 +`+`ؑ2 +`+`֑2 +`+` +`ڑ2 +`+`ޑ2 +`+`ܑ2 +` t@ `p <" 2+`;+`:+`0ؖ2 +`1+`.֑2 +`/+`-+`2ڑ2 +`3+`8ޑ2 +`9+`6ܑ2 +`7 t@  d+`d+``p+`4 `p+`5m{ /d$2>ސ"”Ȱ "d /''`'` '|`2 d@2 ذ `  "@ w 㿘    E'  " B` @ B)  sh  Ò  s\ 㿘  -  ...p`?` '   d  0 ' @{!  ` "$ `"  'ܑ2  . `"@`" p 2 t#@i<2f @  @'2]؀@ Ymr +`mn'`ء5`:  I'>#c t2 '\<T?D" * u '  /   >#x/ 7>#  /7/  ? 7@   2`` E `" &@ݲ`  $t:` 'В@ T@eؚ X%@ ` "@ 8  t"  8 燘䴒 ?k䴒  @" H@@  @ k 2 ` ?'Ԁ   |Ԑ⭒u'?q'Ԁ , ` `ct*   ` `*` *   \<T?" D* \TD" * u@  '/\?TD" * u1 <u+  H$@ :` '/ӐԐ  e/*@?  ? '7@  ! `` &@`અ` `H` E @ o lL  2``"@""@ $< t@ Вe @  b 4`2``8 `` "@l%0" 㿘    8㿘   8 ڒ`㿘 `_ 8㿘   `0` "  2  2" \T "@  ;  t  msdosfs_strategy: spec㿘  \`<? `>x# T P@2 T`0\ TT"@  ;@ M ?$ T T? H@Ӄ <$ @ T?>`  ` $ DaP 8*` € 0otag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %d, %d, %s (LOCKED)㿘 >`  p   > P?  2`  >> h x1 8 㿐 `  t #\   4 w``0>( `  " ` $`    `     ݴ ݄ ݨ ݴ diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘`>!.` €  ..  . . .  h H /f * ' > ##캒!H 0`! 6`H /f * ' > l 2H p@ `$ &`6`&@&`&`&` $@&``+&`H /f * ' >  |!&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8` 2&`  7&` &` `"@&` &`)  `"  @ ޸ " `"`"` bpf: ifpromisc failedbpf_detachd: descriptor not in list㿘 4  . 4 @    " >ː!x   >`@!2"  2&   "@& 㿘. *  | #>  $b%> @$b@@   "```㿘?> 2 c  >  . bܑ*  2  @ќ `>#P & @&  㿘?2  . > ܑ* @H /f4 * '   wH 0@ bpf㿘?2  > . ܐ* @ 2`  @ H /f4 * ' ?   $ 21$ $>  @-$ $+$ $ > $> `@?  >!  # ? #H 00I     )$    6 "   " $  $  $ $ $ H 0  H /f   H 0 * '  $ $ $ H 0㿀?2  > . ܐ* @`2`5  `0 `  '`< (8?~  (  /H /` * ! ` H 0 "" 0" " " 0" " " ,㿘?2  > . bܐo* @  5q@ "i@ "`"h@ f@rj@"` "@O s@t@"`8  w@n@>  ~@" br@" "k@bp@" bu@}@"۰  bm@>   v@bg@9 0 "l@x0"f@"` H /f * ' ` ``@H 0&` 2    8$` &$`@H /f * ' ;H 00| vH /f4 `4* ' `4   @ ɒ   ,`4H 00] "[ X ` "U  @0P@L!Pp`>!T@ @$`  < :$` !P` @C&` @ݒ>pFT-&`,&`0(&&,`66#6@ $`8 ?$` $` $`<$`D `$`H @  $`L`D ($`@ `@&㿘`  (@ 2L H /f * ' & (H 0-@b1,`  ͐`k #@ H /f * ' & (tH 0    㿘N@ .` ` А ( `>   0@   8.@ $@ > #`"@ ` 7 @< 23@ 4 2 1 2  @S 'H /f4 * ' @   H 0 @`2` 㿘 lӔ 㿘`2? ?2  @> *` ܑ* H /f4* '   6 "  "  H 0 ? $ >  @"$;TH 0 㿘  !>( ,& , (@Ζ @G" 2 ,bpf_mcopy㿘#> 2 a8 l^@㿘`   ` @` #> ,& , (@ @aD 2 ,㿐    @ 4   ?@ $" 6 `2  0 f& 0& & & & v&  <   @` D Hd L T& T " ` <   @` D HN L T& T @&x$$@"""  2 $%&  > `@  ` & & & & $& (&  <   @` D H Lr T& T㿘    &    & & &  㿘  " (   "   " (  ( "&ے &bpfattach㿘  ߔ  2> > # "@"#""" "&""㿘> # B#>"/> 7+> 2 5%ᴢ @ 6 `  > "` `@ `,@ 2` '> %>   `㐀@ ܐ `    }  2 & ( D"@ @6   @ " @ * ( (,  ,   % "  " @  @ * ( (  * ( (  * ( (  "  "@ @6   " *  2" "   * H  (?? `!> *` €    B2  t`   K2  ֖  [2 `   #  6    @ 2ڰ  <@ @ *` *  *     @ 2  l@ @ *`   2 `   #  6 yJ w@   2 `   #  6  @ @ ^* \ Z  * U@ * P@ * K"@ * F"@-  () '  *# !  2   "  (  *    2  "  * "  0  *2  "  l%   @     * 2  ޖ   ( L < t X t |  d D | \  ` 4  , < D P X x 3 2   )  $ 944    Ҕ*` `?㿘!> H!>Ða<@㿘>#\>``"#\ `6 0%> '>d h 5>6 c\ h5>€@  * @6* "hh *  @ ` " hhV4 ` h%`*   @d hC4 d $dc\d* " `>#X& @' 9(   , (  @В`(,`( , `0hc\,  0*` 8`4 , " $`$`  `$``"``& $`& $@$`,  * & & & & & ́㿘>#\`> '""  & & Ȁ & Ȑ "` "`"Ȑ& H㿘>#\`> 'c"c"  & & & c` & `""`0㿘 @     0@   @  *   @  *  㿘H /f * '  4>>> , ;a6 4& & & @u ( "   "   > 7 > 7!x #>,  `( (  , @,@r `"  "`> '"#  "@ #> ( 0`"`& " `   <`@"`@$ @<"@ w  2H 0㿘> '#Ȁ , "%  `  2  @ @ε  4 "   "   " @Τ    2  2  㿘> '#Ȁ " 4 "  "  `  2   `"   @@{    2  2 4 㿘      >#\ > '>#`. : > '#Ȁ`5` "-` 2$    @   @`* " @ "   2``2` > 'Ȁ`` " `    2``2`  㿘  C ` "? `26 ` 2 @ "/``"'  @ 2! #  ``   @   @`  @  2㿘 ,`D ( `$`   `D` ?@\ &`D"` &`D    $ >"Ȁ㿘 4 t @ f6 4 "  4-   2      06A   `& & " & @Ð> 7!x #>,   `\( , 㿘 4 t`@ $6 4@@> 7!x #>,   `( , 㿘5  & && 㿘H /f4> '* '> '#Ȁ  T 2   2*` 4 2 `" @  2T 2H 0>!Pɐ㿘> '#Ȁ "  @c 2    㿘0a@ a$@@OKܐ  D !J@ 4 a2@ a1@a@La@"` a@"aI !F@ !F0aH@aG@a@"% @a@"6` a@a5@"` 0 !6@" a~@"  <` 0!K@" ` && 8c Dа2  4  H /f * ' ƐH 0 " 4 4 2 4H /f * ' H 0 4?bR!   4 4 42G x$ @2= <    <@f@zc 42' u  R  g -! "$ ! "8!! "` 0a"a"a "a!` a a" a% ` 2`  .a#` ` @0a a "   4aa2 46 4 `H /` * ! @=H 0x@! > '#Ȁ 0   !  `  2 &@\ > '#>`;` 0!   c  7 ` c a֔ ` " a˔  2 aĒ`  @ 2  ̀  ؒ ce  `@ a "@"&@㿘 ` ` & & "` ?& `3   x`" $ 4`2 $ 2  & $a 6 4? & $ 4 > 6 4   4  a7ذ %s: can't handle af%d p 4 A A  ̠ 2"8 `4  @  `8?$`8`4 "`4`x " `0`4  @ `0@ $`x 2`4 A " `\> %"@ : @ A @    ğ'`'' `>ǐ"T*` €@? "v `! ( 4(沔 3Ȗ (7֠@Ϙ !"7`0`O ` K ` G ` @bp  4(P M沔 3  "F```'8# `$"   ܐ"   "    $$  3   $ b"  b `7֨ b b   7>Ő"Ȓ  ՠ /@"```'`8# ```$"   `ܐ"   "  `  &` &` 2 <  $3 a a  a  , a  , +   <=   , @N  2 2  ;   ,` 7 a ; @q_ Y H /f4 * '       @&$1  7 2" &  &  &  " `  & "  `H 0 & ` h & h 4$ @H 01   T                             㿘`` % ` `  7 `*"@22&  2.&h!"݀@      (` @ "@`&` &`   0 4&&&`` "@&` &`&&&㿘`3В @㿘 4`2 @ +h>  ` @"`  2` `  @I  >#p@A  !"6 d & d \  & \ ,``   ? 6@s( ,   !2`@2 @  p & p #  4  4!  ؒ@  4 h") 4 h `0] 5@:!"݀@=`0T>  `"W > > ) *a aĒ > a > #Ȁ >  " V > > ) *a a >a >! 4 @0> @ " V˒ > > ) *a a > aa > k#f4 c @ ^  ` Z*@"@U "2 ?& & & 8 $#@"   "   ?`&&  0q    &:@2`2`2`2`2` 2 ` 62 00&H /f * '  @`/"0 & 2" "" "H 0> H>x :  0 *@ `  *@`*@`> H*!㿘 ؀      . . . . a. . >Ŗ " % . 9. :& <& . 8 ( "& "   2  * 9 *` 9_ &   㿘 `""`"@ M 7 2㿈H o4 *@ g ` ``0_- 0\ ^۔  ^զY   2  >#^Ȕ >*#     ^//////  2  2   2   2 >#^ >#^  3   //////^  H 0[ / 耊 2 `H 0L  @  2  @  2      & H p@.  7   H 0  7^>  ^:  & & ` & ` "`&``& ``&`H 0 4㿈H o4 *@ g ` ``0_- 0\ ^  ]Y   2  >#] >*#     ^//////  2  2   2   2 >#]ɔ >#]Ô  3   //////]  `H 0@ /` @M  2  @F  2  2  H 0$ ?  & H 0  `"  "`  "@’ 7`?&`H p@ 4! - \ ] ^ ^H ^d _ fl h jP l l l mLlcp! - oT op o p@ pt qH u v x0 x8 x@ xP xpipcp# .0 ( ( \ ( ( pap# .p ( ( D t ( ( Hchap%s: input packet is too small, %d bytes %s: PPP packet in Cisco mode %s: invalid input protocol %s: Cisco packet in PPP mode %s: invalid input packet %s: protocol queue overflow 㿘 4   \`  & \`>˒b n  L l`& l-.& L0`/  "! |0  !  > b   D  L 0!@"3> #`!H  !@"<! !@*#@".!! ! 0&! ``! +  3  @%  > b     p & p!h@60@! =@09 7@`03 1>ː!@!0+! 2P 4>  `"R > > ) +*a0.! 2 k> /c0h  5@ p & p@,0\>  `"RԒ > > ) *a ] > ]j > #Ȁ=> cp   ࢔ 5 L 4 0`"/ LH /f * ' `` @&&`` $`H p@ >˒c z   L` 2" $@`$``$`H 0 %s: no memory for transmit header 㿈  H /f * '  4`@@ ,H 0< 22 `@6 4H 0>!x@H /f * '     ğ''`' 2:``  * ` +АH 0  1   䀢@6`  2 2`` '> c* @ "    *` 2` ```'`8# ```$"   `ܐ"   "  `  &`&`  +Ĕ ` ` `` &`2! 4 >͒`@ ߘ  T & TH p@ 7 ` **  ** ! (2 !2!` 2 2`+6 T & TH p@a /`  @  `+& " 7&` 2" $$ $$     @&&`*  7 2" &  &  &  " 4  & "  4 T & TH p@$2 ` @ ` & `H p@ 㿘#> Hbp !> H>c"t± >!P*@ *`¾"t>bp!h &! $bp >͔ 2`d. 8& & &"|&"& & 6! 6!&! &!@i&!@ 0@@㿘> H"p !! "p! 2!!"@p 2!L> Hº"t!L! µ °㿘        ؠ  *_  ` ` & & "` ?& `@@H4 ؄( ؀   쀠 `?H 㿘H /f    K € F* '  쀤    & & $  ?& 0@ s 2 ! ' ؀    & & $  ?&  ̀ Ɛ  2     & & $  ?& H 0㿘H /f   4 & € !* '  쀢`! " !  ؀`  ̀ 2ߒ  2  H 0 㿘H / * '  2@ 1@z@w @#p @"  4j  !@e 9@]@"I[ 0:@S~@"N <Q < 4@?Ȑ*@6 4 4`   @ @`? 4@  `?`2! `! >!|@` 4 ?6 4`! 4! @`6 4>!x@0!Ѐ(& %s: cisco unknown packet type: 0x%lx %s: loopback %s: up 㿀` 4  \>Вa  0V ``>@a0`#\` #``#d` #h @A 3 ;>А!p& 066!`! @&!!  >В ! 4`6! 7@) !  Z6! &!  4@  6! h>А! 0  @􀢠@ %s: cisco output: <0x%lx 0x%lx 0x%lx 0x%x 0x%x-0x%x> 㿈> %> "h"@ *`" *  4 * H /f * ' > ##ӏ H 0 " 4 H /f * ' > l 2H p@  $ $ 4 $$ $ $ N   $ $ $ `52 *<c"*43 3 3 # # ?2 #\ >#` cH#d *   @   `& '&   $  2" &  &  &  4$  @  `   & `%s: %s output <%s id=0x%x len=%d> 㿐/  42   ` ԑH /f * ' > ## H 0`" 4`H /f * ' > l 2H p@ `$ $`4`$@$`$`$` `]/ 2  `$`$` $` , ,,4 , 4V`.`@'2 @  >#\aؖ ۋ  ">ѐ@D>ʐ"  @  `& '>&  T   & T$` 2" &  &  &  4$` @` ``  & `%s: %s invalid packet length: %d bytes %s: %s input(%s): <%s id=0x%x len=%d%s: %s invalid conf-req length %d %s: %s tlu %s: %s id mismatch 0x%x != 0x%x %s: %s send terminate-ack %s: %s: ignoring RXJ (%s) for proto 0x%x, danger will robinson %s: lcp echo req but lcp closed %s: invalid lcp echo request packet length: %d bytes %s: got lcp echo req, sending echo rep %s: lcp invalid echo reply packet length: %d bytes %s: lcp got echo rep %s: %s send code-rej for 0x%x 㿐`4`  > ``Đ 0  a*`@ @ #\> `#` ڬ``*`2`@d>"@4 ?` Ī>Ԑ#*` €`4  >  ؖΒ``La* @   4    * `>Ԑ#*` €  @ ,@S 8  @0 a,a* "  @ 86@ > a 5` ( a( `    e> !j```La*@`X>Ԑ#d*` €a+`a," @_ 0H@Z  ,@ 8@Q  8a+`a," @G > a ` ( a(   > !!``L ` 2   $  a*@` >Ԑ#D*` €aa,+`"  8@  ,@ 8@ G 8 a*@`ܚ >Ԑ#$*` €@ > a8 ً`    0đ+`a,"@@Ӕ  ,@瀤 a* `>Ԑ#*` €  @ 4@0@  ,@N 8 !>Ң`!X@O ` G a* `~>Ԑ"*` €@ 0v0 !@]0o0 !V a* `  ^>Ґ!d`Z`L`4V>0!aȀ  >В`V!>a|€0F$>Ґ!G`+  3  060 !@ a؀@2*`L` '>Ґ" `)0!>Ґ"X#`aȀ@26a0> "p ``a &a  ϔ `L &`L R R R R R P R R R R P4 PD R P R Ph O O O O O O O O O O R R N O0 N O M M R R M M M M L R R Lx L Lx LH K M ND ND OH P P P Q$ R Q%s: %s up(%s) 㿘`4 a *` !> #@`l  a* @  "a0@ 0 a,"@ @  8@%s: %s down(%s) 㿘`4 a *` !>  @j`9  a* ` >Ր!*` €@ 0@z  0@0 @r 0@m  ,@ U, U@ U, U` U` U` U` Ut%s: %s open(%s) 㿘`4 a *` !> !@"`  a* @` >Ր"*` €@7   0a * a,"@@,  8@0@$  VL V Vd V V V V V V V%s: %s close(%s) 㿘`4 a *` !> "@ڢ`ש  a* @` A>֐ \*` €@   4@ 00@ 0+@ߔ  a,a* "a  &a     ,@0 a* a,"@a   &a   r @  XT Wl XT W XT W X X X W㿘 a,+  a"@ $ +  *  !L@ *` , !LaU@%s: %s TO(%s) rst_counter = %d 㿘`4 H o *@ g aa, !>֓*` ! @>` *`    *` ?  $  *  "  0;: @G * 4@B % 4@> ! 4 * `#>֐#*` €a  &a   ۚ x0@  8@0l 8@H 0 Zx Zx Z Z Z%s: %s %s->%s 㿘`4 a * @!> `@Ǡ# @Đ֒  a* " *` * !L@  >֐#. €( [ [ [ [ [ [ [ [ [ [>P%ܔ   "!"!"!"!"!"!"!"!<"!"!Ё"!%s: Up event(incoming call) 㿘 4%ܠ ``@  @&!&!6!&!&!&!6 4#>ˀ >ג`h : !  "!>y x!ah &!`€ah>l ah%s: Down event (carrier loss) 㿘 4 >גa`  >ˠ!h 4 @"! @! 4 &!S6 4㿘"8 !  ?&!!>˒ &!!h㿘>ː!h&㿘>ː!h%s: lcp parse opts: %s [invalid] [invalid chap len] [not configured] [rej] send conf-rej %s: lcp parse opt values: 0x%lx [glitch] [empty] [non-empty] %lu [mine %s != his %s] [chap not MD5] send conf-nak max_failure (%d) exceeded, closing send conf-ack 㿘 4  $  >גb n s ` p!>%>׀" @@ @գ @ "   0F C  ` H0 ` A0  ` 90 4 `"+ `v"' `0 `* @#@ 2 ! ` >d" `! 2 ! >Y" `  &!>P" `PM `@ `% @ ` >9"-0`!3 ͔  >>+ >גb ܔ ` 9>;>׀" @@{ @" @ "3 `  "L ` `S 2{ ` ` `*  `*` * ` !Ȗ  q>א# m `># ! !Ȑ 6! 8 222,`,`,`T,`  `  `  ` J>ʐ#0G `>Đ#@,`,`,`6,` `*  7&!>Զ#P3 ` ` `* @!@" !@"8@ԡcX!2 ,`!,`0"#@2 ` ` " >ԍ#p ,` `O `@ `% @ ` d,!<!  &!<>m#-0`!3  ' 0(>]#! >А!Z >!|@6! &!< >J#&!<6! .0`!3    %s: lcp rej opts: [don't insist on auth for callout][access denied] 㿘 4  |  U >ْb ˔ D`` @>˦!h%>׀ "@@ k@@ "!  " !#`2!`!&!Ȑ ?&!Đ ?&!Ā  ":  >"0!Đ ? &!>ڐ"X@`&@` ǀ >ɐ  %s: lcp nak opts: magic glitch %d 㿘 4    }`>ْc _ l`` i`'>"@@ @Ә@ "J`  -M`2K`!Ā FE` 2C&``*`* `@*`@ !Ȓ@ 8@ `>o Q/*&!(&!>f#P$`"` 2 &```*  >ڐ U:$"$8%!&!̐  &!">>G"X>!|@`&@` ``>5  %s: phase %s 㿘 4@   >舐>А!! >#  , @ `"  @  , !Ā  !   &!!@ &!>ڠ"@ ұ># , @ `"  @  , ! ># , @ `"  @  , >#  !Ԁ ,  `2  @  ,`! @㿘 !>ڢ &!@ ڠ"@f   )>!Ԁ#,@ ` 2 ` @@@,㿘 !>ڢ &!@ "@@ "`@㿘!>ڢ "@&!@  , "`@㿈!Ę !Ȁ  P"&!Ȑ / , !Ș 2 2 2 , , , !, !Ā  ,   , !̘ 2 , !Ϙ ,  !Ā  "8,  *0 2`"#@   , *2 ,  0, b#2    ,  ! + 0 &! .!(`!3 ؔ >!Ԙ   *`  ``* 㿘!   >!|@"!@"!"!"!㿘>ː! 㿘>ː!L%s: ipcp_open(): no IP interface 㿐 4 `@ _    >ےc w 0  >!! `&!&!>ː!g㿘>ː!! @ h 㿘>ː!*%s: ipcp parse opts: %s: ipcp parse opt values: %s %s [ack] [addr requested] %s [not agreed] still need hisaddr send conf-nak send conf-ack 㿐 4      >ܒ`   `4  1 />׀" @ C `   >4" >." L+  $@`  ր >"- ` `!3 Ҕ  >   @ >ܒ` г [  X ;>9>7>܀" @ ` 29   * *`  *   ` "!@ ~ɐ !  &! >о @ lз, , 2 ,  ,  K  $@`    !    2 2  2 -@-`-`-`-`-` >Є! >}!(-  ``!3  8>n!8. ``!3 )  `?%s: ipcp rej opts: 㿘 4    / >ݒa  ``  %>"@@ @8@ 2`! ?&!`&@` 뀤 ># q %s: ipcp nak opts: [wantaddr %s] [agree] 㿘 4  h  R`>ݒb Ϸ A`` >`)>'>"@@ @"@ (`% 2#&```* `*`! `*  &!@ ѐ!  @`>Ɛ"`&@` ɀ``>ϸ  !Ԅ"!ԝ㿘!Ԑ &!ԁ㿀!  @,  /  ,@  ,@  ,@  2 ,@  ,@  !   &! .!)`!= %s: chap invalid packet length: %d bytes %s: chap corrupted challenge <%s id=0x%x len=%d%s: chap input <%s id=0x%x len=%d name= value-size=%d value=%s: chap success: %s: chap failure%s: chap failure %s: chap corrupted response <%s id=0x%x len=%d%s: chap dropping response for old ID (got %d, expected %d) %s: chap response, his name != expected %s: chap input(%s) <%s id=0x%x len=%d name=%s: chap bad hash value length: %d bytes, should be %d Failed...Welcome!%s: chap unknown input(%s) <0x%x id=0x%xh len=%d 4` `>ޒa  Ύ 0``4@ `  `0{\ `0v ?$? `!>0 !P `!>0 ! @"#``\ -`@ 02`>ޒΜ!@ >Ζ"@ @`" @ L@@@Ғ !/ @ :`>#d #\b4#`#h#l  @ٚ07`>ޒa  $ >>]!ؒ*``@2`>U H /f * ' !0! ?b# &!!Ā  !Ԁ  H 0 0H 0 @0>ޒa ܐ  >!ؒ*``@2`> 0>ޒa ɐ 0 ?$?`!>0 " @ "#``ͳ *``@k2`>"0`!+  `>ޒb@ ͝ 0"<@ @ >ސ@ >ޔ b͊ -`2`@^>ː" @* @T2`> `"@!$@0@"#``>#\ be -`@92`>ޒͥ!@>͟" `h>ޒb  L 0`@ @`"\ @I@"( @@ϐ@'  !>`"4>ސc#\ @٘  ,!$   `>>ސ"4c(#\ @ǘ !$ #!>ˠ"4_  (@0@+!$`@>`c8#\  *``@2`>4" "!$"!H㿘!0"#@!Ā  !>ˠ"4 8@!&!8( 㿘a$ >ː"4 %s: chap TO(%s) rst_counter = %d 㿘 4 H o *@ g   !>!$@Ѡ"Ж!8 ̠ !8? &!8!$ !>ˠ"4 ,@ 0!$   !&!8!>ˠ"4 8@Ԕ H 0%s: chap %s, reconfirmedtlunext re-challenge in %d seconds re-challenging supressed 㿘 4 !": &!8JY!?c >ˑ2 L!,>!PJ  >! ` > > ( . ": >> 0n0k XH /f * ' !! ` &!ԑH 0 0 H 0 ! @%s: chap tld 㿘 4 >a  !!>ː ?&!a|€p"(@II&"(I$`I$`$` !  /! .!+&! @ѐ!+ #d>#\#`#h"4#l  @p%s: pap invalid packet length: %d bytes %s: pap corrupted input <%s id=0x%x len=%d%s: pap input(%s) <%s id=0x%x len=%d name= passwd=%s: pap success%s: pap failure%s: pap failure %s: pap corrupted input <0x%x id=0x%x len=%d㿀 4`  #>c g 0``4@    0؀ 0` @   `$ !>0 #0 @ #``5 *``@2`>s"0!` @Q! @0@s #``>#\ c` ,`2`@>X#@>R"`  4/@"<   @"\  /`>ޒc !>ˠ!#\#`#d  @" ,!    /`>ޔ( >#\#`!#d  @! !>ˠ!  (@0wŐ! >c ʸ  N@`" >>!ؓ,``@2`> H /f * ' !0! ?`# &!!Ā  !Ԁ  H 0 0c t  N@`>ʴ!ؓ,``@@2`>ʭ 0>c _ 0>`c`  U *``@ 2`>ʓ" "! "!D㿘"80 #@2 !!Ā >!&!4! !0 #@>"(@!>bߔ!㿘a >ː!n %s: pap TO(%s) rst_counter = %d 㿘 4 H o *@ g   !>! @#!!4  !4? &!4! !>ˠ! ,@8 0 ! >ː!/ H 0%s: pap peer TO 㿘 4 >b  >"(@㿘 4!䀊  &!4>!>Ғa ɮ H /f * ' !! ` &!ԑH 0 0 H 0 @-%s: pap tld 㿘 4 >c ~ !|!!>ː ?&!a|€p! " .!*&!  @q!/ @l!* >#\#d#h#l#`#p!/#t  @㿀`4'T 'XH /f * ' > ##L H 0 " 7 H /f * ' > l 2H p@  $ ' 7 '' ' ' k  '  **  * 2 ,`T  X @D=@2 ' '  4` @@6` > `a#\ ڔ` , `@2`>"``@```&`&``T  &`T' ` 2" &`0`&` &``4$ `@ ``   &``㿘d  & && %s: down 㿐H /f4> H* '> H"p M >ˤ!h!`"D! 4 @?`2!! (:!! 2!> ɴ#!`"ϐ !@!  4!!  ! ` $! !뷒 !! 0! !Ȑ ' $! ,!ؒ`!  E! 2!H 0>!P*> H@ "t*`        2    "   `"   22"`2"@  2 "  2"`Af" `t @"@"@ i 0!:@2d dC "|@ @ @ @ AC"N!9@2J ! XD   0#@#@29 ` 0#@#@2. \!@ D6!!BΔ | |"Bǔ `"8@p D  6"86":B"< "\B   㿘 !>ڢ "@@&!W ># , @ `"  @  , >#  !Ԁ ,  `"  @  ,`}conf-reqconf-ackconf-nakconf-rejterm-reqterm-ackcode-rejproto-rejecho-reqecho-replydiscard-req0x%x㿘 ` (>"*` €1>&! 1>#!01> !@1>!P1>!`1>!p1>!1>!1>!1> !1>!1> H">aI    ( 4 @ L X d p |challengeresponsesuccessfailurereqacknak㿘. 06 `# b#4`"1> `   ` 1>'"%"1>""1>#` 1>1> H 1> 1> H #1> ##1> H" >amruasync-mapauth-protoqual-protomagicproto-compaddr-comp㿘 ?`>!4*` €1> 01> 81> H1> X1> h1>  p1>  1> H"0>aД Ǧ  addressescompressionaddress㿘 "1>  1> 1> H"1>1> H !X !h!x"@>aД tinitialstartingclosedstoppedclosingstoppingreq-sentack-rcvdack-sentopenedillegal %>(* >">">">" >"(>"0> "@> "P>"`>"p>"x deadestablishterminateauthenticatenetwork >* >#P> #X> #h>#x>#>"x 㿘. 06 `!"1> `#  !1>1> H b#" 1> 1> H!!1> "0 "p"P*>aЕ2Ð %02x-%02x㿘> Ņ .`  !> | *`  \x%x%c㿘?.`#`@#>!> ^ `a( `[!0*  @%d.%d.%d.%d㿘!> H"`6 6 > 6 a u    2lo%d㿘??5>" >>cX $#> ؒ   %@˒ ؀ b0> ""  D  , 8, :$$ <4 4$ $ , 9  $ $  ( { ??ِ ؁looutput: no header mbuf%s: can't handle af%d 㾀` >m# `(`4   ''' '{&`4! @"`PE4  3 A`P $`P````@$```̀ "`> $@2 ``ğ''`'```'`8# ```$"   `ܐ"   "  `  &`&`  ; ` ` `` &`2 7`"H /f4`* '`   ````@&&`  7` 2" $``$` $` "`` $``@H 00b  > `> #  > # #@L /H /f * '   @ `x# H 00 7&`  2" # > ✠  , @ # # "✒ 5 > > )*a @k `H@C `H $`H``\ $`\H p@ lo_altqstart: can't handle af%d 㿘 H /f   ؚ " € * '  ̀   2  ` ` & & $` ?& H 0`e`@   >  > # `>  @4`c l0IH /f * '   @  `# H 00.$`  2" # > ✐ , @ # # "✒ 5 > > )*a ?ƒ  H?  H & H` \ & \H p@0j` "`T 2@  1@ @"  4 @" A2 4>""  /  /" < "  " " " "" " ifmedia_add: can't malloc entry㿘  ~2  2"`>X#"` "`"@ "`"& 㿘 `` ``ifmedia_set: no match for 0x%x/0x%x ifmedia_set㿘@ 2 & > (Þ8 ># P㿘 { `xv0!50 !6"$m `@v 2c ` @2&2&X &&@ P&M& ` `&`&`&`&`€`   *  } ` .$@` &2 02   ` *`$;l "` k &`  ifmedia_match: multiple match for 0x%x/0x%x 㿘 8  @%>  2   2 㿘 #< 2 @2 $ & "@ & ꀦ>  @2` @ sl%d㿘. "* "*  }  '> 7 5$!> 7$!,@U!,@,0 >>%a"X'>$ ؒÐ !(  2 $ <, 8$ $ `$4 4$ $   $ ԴА  ,@sl%d: can't allocate buffer 㿘 2!H /f * ' > ##"!$!H 0!`' 2`H /f * ' > l 2H p@ ! "@!" !$"!2`!" !"` ! "6 ؑH /f * ' > !ߐ !"`$H 0!`$ ("`! 2!"`0!" (!"`,!" <!"`8! "  $ 2 ! >!0 4  4 4!(0 $ $ $`$ @u$ 㿘> "@`a2 f`h > 7` !,> 7Yb#ܢ`H OQ "N 7&`& `& DH /e * & `p$ &`pH p@ H /e4`L* &`L"Q &! `` @ &!$#xƔ  H 00&! &!$H 0   㿘ې ؀`'. hH /f * ' z$`&  aa $a $`$` $` Ha$a H 0X@ ?ؐ "%s: af%d not supported 㿀    ȟ'`'' > "@  p / $ p   2p 2  4 @2 4 w A@ `  kw 4H /f * ' !`"$ H 2  #> %" ' " 'Вb@ ? $ ! `@I$!     @&&` (  7 2" $  $  $  > %  $  H 0 T $ Tb#$b`"  `H $!@  H 0 ` #Զ  H   ̟@ H 4- + L H" "Q%H /f4 ܐ* ' ܀   % % $ ?% 䀤"  h % h(  €    2    % % $ ?% H 0#-> %` Hв ` `:@@`  4@  !(@t   @*#`  /9 U`%& H`  ` `% `^>  /> # 1  ` `? $  `% ` 6    ݐ +   ` % `H /f  Tk0* ' T* 5  "#8@ <"`<<8"`8> $ ($0,{4$0 ?4ȑH 0 2 Ւ "  ` ͐  X`% X P `% `% P㿘!H /f * ' > ## $!H 0!`' 2`H /f * ' > l 2H p@ ! "@!" !$"!2`!" !"` ! "?$!H /f * ' >   !"`$H 0!`$ ("`! 2!"`0!" (!"`,!" <!"`8!`  `0`$ @$ $`$`$`$`  2 $! 㿈> X`ؒ`B d:X?2 !`p 2  \` @2 \! S$!  4 `&$ \ 2 $!! > %! @6$!!  @!  $!$!! 0+> %$!   ܀ "!   2 ! 2  ! 2   $!  ?$!  " `#` 8<  @ @*  p 2 4 O*@ 4#@  @s!( ג0@Ҁ p2 L`'͒  p@s!( $ L 44 4ؐ #`"\ H ``' 8# `  $" 4   ܐ"   "    & &         & } *7 H /e * & c ]H 0   H> % $ Hb#$b`" H /f * ' > #Ȕ @ `" L l`$ L$ l0 &  2" "Ȕ> ✒`"" "✐ .< > > ) *a 8 08Ӑ H 0!  @`*@$ $!! $! L $ L!`$ $ $!$ 㿘H /f * '  a2@ a1@a @a@"9 0!{@2  `2- / 4 )6 4 `"# /  /@ 0`\&``$ `H$ `P$ a0$ a4$ a8$ a<$ a@$ aD$ $aH$ (aL$ ,H 0ppp%d㿘>   a ->+>)>'>%>$ p X%ܔ  cp!$ <, 8, :$ $ $ $!`$ $!0$!D$4 4  $ !p 1 `ܠ!㿘>  !! ``!   ``! 2`` 0'%$! %4!!X $ @8$!" v  $!@p^!t$!|$!!P "? 6"$!T$!P> %"$!$!㿘Ћ 4& ?6 4&! ސ !  &!&!"!?&!!$ʐ !$  &!$&!("!,?&!,!8 !8  &!8&!<"!@?&!@!P &!P!P2!L &!L@Ґ!&!| &!x^ &!&!! "!xV &!&!! xN &!%s: comp_alloc failed %s: decomp_alloc failed %s: no compressor for [%x %x %x], %x x Q@! S@ "a8  Z N@"@.?0倦@ "0` V@(?0 J@y?0 `G@ `F@R@PY@?0  M@" `K0 L@&?0a,&`&& !2o  @H /`4`* !` @ @@7H /f4`* '`<?c $`H p@~  !2: w> $@(p4ao l& !2) fa aH /` * ! @o2 H 0L  !2 E 4A$a !2 < 8  3X 0ـ > `  2z  < H /`4a|* !a|  ax@$ax€  $a|`@@>#` 7H /f4`* '`* $`H 00H /`4a* !a  a @$a€  $a`@@>#0` 7H /f4`* '`* $`H 00 `@@{>ؐ#Pڒ`   ! 0 L@2 at&!2I at@  H /` * !  * #`@A`@H 0a H /` * ! > %ba"&a" &H 0F "*    t2\ vf 00@   v\ &    G@aaH /f * ' ""H 0 v9   㿘H /f * '  2@ 1@1@") @"!n @" 4h 0!z@ "P!{@"[ @V  @S ?Q6 4  `  `I$ <"F / B@ /@C 8!X&!\&`!`&`!d&` !h&`!l&`! - &`!` &`!`&` !`&`$!`&`(!`&`,!` &`0!`$&`4@ 8!| "!!x`€! !`4€,H 0%s: af%d not supported %s output: 㿈@ "- 2`4 @= 2` # 2`  ``ğ''`'`?Ȗ*@6`>`  !t` !6` *  ! ` /   2" ````8```$"  `?ܐ"  `?" 4 `   2&` ° 7?&``<* * ** `  `&` `` @` @>!`@ 2!!p` *@!   2! !  "`> %"$!`*!p 7H /` * !  !T`"&`Y$!T`@  !8 @& &` `"0 7&` 2" "" "$     @&&`Ɛ  7 2" $  $  $  "   $ " H 0 T!l` $!l$ T@`P```$``$`PH 0 㿘!P l!P   *`@ `! !t"Z YO $ @ #  !8 @ `e"0 7 2" &!8" "%        @&# G   7 2" &  &  &  `"  & `" T!l `& T&!l  '$ 2 &!T㿘H /f * '  > "*@ & #" (U > > ) *a 3 02 H 0㿐!8    $!8$!<& !@?$!@   ̀   2     $ $ &  ?$ 2 !h  € -  $!h  ` `*  @! `  -01 ! ,0!( `  0  ` 02 @k<  p " ,` / -,@,`,`,`@Ԕ 0 !3  "0 !| + @' '    !x !| <   `@` M  `G  2 2 􀤠 0 !"     & &   2 ` @,`,`   & & 㿘> !H /` * !  '   !8 "`H /f * ' $ H p@  @`!@H /f * ' !` ` $!$!"`!?$!H 0 `߀`H 0if_ppp/ccp: not enough data in mbuf (%p+%x > %p+%x) 㿐` 8`@`` ` `` Ş ` `*  @@ @ @>"  0 @?`>!*` € H /f * ' ?# & H p@ 0 ` @ ` 2(!!|~@!x @    rH /f * '   & H p@ 0[ Y@! @#\$  ! KH /f * '  @ 0*@& H p@ 02 `/2!!|)@&!x@ 0 @!(@ H /f * '  * & H 0   p   㿘!| "!!x@&!|! ! @&!㿘H /f* ' ` 6`&`! 2" &!!> ✐ @ &!&!"✐ %ڒ > > ) *a 0 00q H 0%s: got %d bytes %s: decompress failed %d %s: VJ uncompress failed on type comp %s: VJ uncompress failed on type uncomp %s: input queue full 㿀!\  &!\@ ' `   >#(@` ` `*``@ ` @?А*6`H /f * '  (& H p@ D!B8  <! `, 2  ` ` `* : @@>#@ lH /f * '  (&  @& H 0    @ !`0€  2    `  h-!  @i H /f * '  7& H p@ -J/ F! B` #\` @i @ @3>L#`H /f * ' > ## H 0 #/> # 4 H /f * ' > l 2H p@  $ $ 4 $$ $ $ $ $  (M`H /f * ' >  n $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8      8 `   $ 0   " `  ?$ `"`0 " `$ `$ `$ ` $ `&` ?6`  !,@,`,`,``-M !  $ ` `"@ &`&`      8 `   $ 0   " ( a$  ?$( X$2V$   `-`  `  $ H /f * ' V`> `l*`@ ?2@ ` ` "#@`8@ `<"`<`<`8"`8> `$w ``(`$`0`,`o,`4`&`0 ?6`@$aH 0"!  ! ` #\` p@hu 6  ! @@># 0,`J ` F H /f * ' > ##\ H 0 " 4 H /f * ' > l 2H p@  $ $ 4 $$ $ $    ސ&`  &`&`` *!  "!  "`> %"&!`*!p !!-  4 !t "`0k> `` "?&`&` `&`#" " > > ) *a - > -} > #Ȗ!$ H /f * '  @&&` "H p@  @@>#  l & l 2" ""`"H 0  H  \`& H& \!@0 C L!`` &!`& L%s p +  | >  ؀ 2  @*   @ *  ** ޔ  >*>* 㿘 @diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘> "@ !2v- ^H /e4`h* &`h  `؀   H 0@  4 2 !H 03 `">@>b ؐ! 6!@&!̐?>>>ᔘ#&!&!& &!&!& &!@&! 4`@6 4` & Dx&`ؑH 0 㿘H /e * & `  ؀  . h&  @ lH 0 㿘H /e4!Ȑ* &!Ȁ  :&!!̀ " 3&! $j  ;& H 0㿘 ؀  z H /e :%>ؑH 0k H 0c* & "%>؀    @  H 0C # !(    h " !$H 0+ " pʐ (!$  $!$$!($!,?$!,H 0 `  "㿀 p     @2 h  h  "  <` @`` (|0>  lH /f * ' > ##!H 0  4 H /f * '  4H p@  $ $$ 4 &$ `#(& H /f * ' >  { $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8   "  82 `   $ 0 @   "@  ?$ `@8  x$ ` z/`)i `" ` #` 㿘 ؖ  s? P@_  U@0X@ Y  W@ "  T@M  O@F!2t KH$!!E& !2s >;$!!8& !2s 1H /e * & !( !!*  $!$!$!H 00!( 0    R@@ڐ>*  @2 (2 `* 2 㿐` H!AaȀ> F "8 H  ?ad ~`&ad5H?# 6a>   U@a@ @ 2`*  `* a `@ @ @2 *`  *"`@ Had$@&ad%+@&H /e * & H } < @ ,H 0ad` &ad@`? s o aܘa8 ;`*`   * `  }//H p@݀H 0Հ/aܔ 8 :` `;`*  `*  },@`` ,@,@` ~,@`H /e* & H |H    Ő?0 * H 0 $ad &ad $P$ H /f * ' T* 6;  "#8@ <"`<<8"`8> $3 ($0,i4$0 ?4> ##H 0 "&aa 6a܀&aȑH /e * & @0  `$` `$&`H 0㿘H /e * &   ג (DH 0㿘 ̀` ؟@  H c` p    @   㿘 H o *@ f  {& ̒ H p@㿘H /e * & ! r!>  l 2` H /f * ' > ## H 0   4 H /f * '  4H p@  $ $ 4 $$ $ $ 3&H /f * ' >  n $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0$"$H 0%s: bad char %x %s: bad fcs %x %s: too short (%d) %s: no input mbufs! %s: garbage received: 0x%x (need 0xFF) %s: missing UI (0x3), got 0x%x %s: bad protocol %x %s: packet too big %s: too few input mbufs! 㿘`؀`K`@G> X@aX`B :X  $aX`@@>!`"* `2` "``p'> 2`n*` * "  * &`p 0  `p`̐ >` &`p@0 H /e * &  ``@ $`>> * b@  * `` $`H 0`@@ޒ ~2`aa 4aؐ@Ӓ?`0@  1<aڐ @- H /e * & 0 $`@>aڐ!0``La`` $a`$`L0*$`H 00 4(aЀ @>!@{`H /e * & `La``` $`$`L$a`H 00l` ?  "` aa@ 2@$aa! " aa$a"` `H /e * & `* $`H 0%05@ +  ađ*@'H /e * &    }  $`H 00 *$` H 0a؀ @ à 2aà 2 a`@@>!X&` a`  `$``$&`$a`<c4aڀ $a``@@>!p *$aԐ *aؐ`$a4a`  &` a؀ 2a؀  @`@>!``a؀ 2a؀ "aa*aؐ aВ`$a4a  " a؀  2`@@o>aJ!*`f`a*2 `  4a`@@Y>2!a`  "@`82@` ``$`0 `  "$ @+` `  ?&@ 4$` @ 2@E@ 2 @`@@(>!=`#`$a` &` `$ ``$&`$a` > &` aԖ*@aڒ`*2 $aԑ* 2@ (4a@$H /e * & `La`` @ $`L$a`$`H 0`@@ %s input: 㿘`!!*@ &!! `  > ڐ#H!@!&!%s p ">  >/pq>2c @ + @  +  +   * >+ + 0 ! " ," 0" * " (" $" " 4㿘  , )#  $ (  22 " " & & $  #   & , $`*@  ( 8& (Ȑ  㿘 @&@ <&` H&` D&`  8&` 4&` &`  $* &`2``@`&`㿘6 & 0㿘`$L  2H   2D  6  2?  `!>#P*` €#  #)  "] " Ϥ ,  *@ P ci   @ P .` c[  & LeF  & L&& . & .  | | | |    㿘 L "e- e* 㿘 㿘 㿘`@ 29 ` 25 `6` 20  ` 2+ "! L "  !  L*2@  *#@2`T2`V. \&  &  . K 㿐#\#` 㿐\ #\#`㿀`'H`*  ` '`? ` 'T' H"T4'TH /f * ' > ## H 0  4 H /f * ' > l 2H p@  $ $$ 4 H I"$ `T@ (&`H /f * ' >  В $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8` @ $      8`"  $ 0   " @?$@  ` @,@``,@`,@`,@``2 ,@ ``,@``` 5` % ''쀦 '@? `* @,P@ * @`@  `  :$ , P@@ @ `-> ` l '耤`'7 ,@`@* $@$ H /f * ' > #c* $H 0`  2`H /f * '   5 H p@ ""`"2` CT" %$ H /f * ' >   $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8      82`"  $ 0  " @?$@ r/ `@ * ?@ `'-` .` X@*`@ `T22#2`T26&`%`% 4@2 ->  l 耤`'7 ,@`@* $@$ H /f * ' > #cm $H 0`  2`H /f * '  4H p@ ""` " 2 CT" %$ H /f * ' >  , $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8      82`"  $ 0  " @?$@ r/ 耥`$@%`$`  %` `%`$ !% *> `l耤` '7 ,@`@* $@$ H /f * ' > #cƒ $H 0`  2`H /f * '  4H p@ ""` " 2 CT" %$ H /f * ' >   $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8      82`"  $ 0  " @?$@ r/  耤` ' * 2 ,@`@ z  $@$ H /f * ' > #c0 $H 0`" 2`H /f * ' > l 2H p@ ""`"2` 7T" %$ H /f * ' >   $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8       8 `  $$@$  * ?@ `@ `  -`  `@ `<%`@T`%`<H@ VH"`4`8` %`8 %`4`H `D `%`H%`D㿘` ``*       4   `& 46 ` `?V`S` `X#@ @ *@*P  * @`      :" * P @:   #` @ *?* `.  *  T@"2 T1 3 #  L& + ,  2   @2@, @`2` 5  $@ & & $ 4  8* <  @`& 4& 8& < & @   . bsd_decomp%d: bad sequence # %d, expected %d bsd_decomp%d: bad CLEAR bsd_decomp%d: bad code 0x%x oldcode=0x%x max_ent=0x%x explen=%d seqno=%d bsd_decomp%d: ran out of mru bsd_decomp%d: peer should have cleared dictionary 㿀  'L&`"'  '  '` ?`4 ` ` $@ * ?    D> "P 4H /f * ' > ##u H 0`" 4`H /f * ' > l 2H p@ `$ $`4`$@$`$`$` `2'ڰ $` "H /f * ' >  5 $`$H 0`$ (` $`4`$`0$`($`,$`<$`8`@`$`   ?`82'`" ` `$`0`   "  ?$@  0'***!'X`R'? * '' F2 *@'a' @`0@`2`   E> @"X')'@ @@@f +> "> "ے4 @  L,   'A > " @ <`$$` H /f * ' > #cn H 0  6 H /f * ' > l 2H p@  & && 6  E& &$@H /f * ' > 3 & $H 0 $ (  & 6 & 0& (& ,& <& 8      8``"   $ 0   @" "   ?&" ``, V*``P *,`*, "HC, , @+  P@.-    :# +  P@*X`*` `T23`#2`T3`2"L$ *@+2   "',  @`2` `$ $` $  @ $$0$ " H > #H `@D$H<@ $@$D$<L"㿘  [ 㿘] 㿐`29   23   2/   ` 2*   & 2` "  d [Ӕ  > >  x`& 8& <#\&  ?   @ &  H@}  0]  㿘@# ] 㿘$# @  2 ` 2 ` ` 2 2`   2 ` "&  & &  @& 㿘 @&z_compress: deflate returned %d (%s) 㿘 `# `*`@ &@4H /f * ' > ## H 0  /> # 4 H /f * ' > l 2H p@  $ $$ 4  `&@$   (& H /f * ' >  } $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8     82 `   $ 0   "  ?$ `6   $  $   @- `- - -  : - -  $($$А"@$($$   $``$  "$    2(" ($ $" (  $ H /f * '  $H 0`" 2`H /f * ' > l 2H p@ ""` " 2 E' %$ H /f * ' >   $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8 $$     82$(`"   $ 0   @"   ?$$( А"@$($$@  > 0"> "  "R( M  ($$ 6@ 2P " @PT`$P$T@ "X&@X\@ $X$\HL@ $L$H㿘 H&@ L#&` P&` T&`  X&` \&`&`*&`2`@Œ &`㿘`24   2.   2*   ` 2%   ! 2`   d Y  > >  x`& 8& <& $ @R  &  H@zȒ 0[e  㿘@' [\ 㿘$% @  2 ` 2 ` ` 2 2`   2 ` \  & & & &  @& 㿘 @&z_decompress%d: bad seq # %d, expected %d z_decompress%d: inflate 1raid3d02rraid3d3raid3e04rraid3e5raid3f6rraid3f7raid3g08rraid3g9raid3h0:rraid3h;raid3i0<rraid3i=raid3j0>rraid3j?raid3k@rraid3kAraid3l0Brraid3lCraid3m0Drraid3mEraid3n0Frraid3nGraid3o0Hrraid3oIraid3p0Jrraid3pK memLkmemB0MksymsB0NdrumB0Oeeprom0Ptun0B0Qtun1B0Rtun2B0Stun3B0Tbpf0B0Ubpf1B0Vbpf2B0Wbpf3Xbpf4B0Ybpf5B0Zbpf6B0[bpf7B0\bpf8B0]bpf9B0^xfs0_ pf@`consoleaklogB0bttyp0B0cptyp0B0dttyp1B0eptyp1B0fttyp2B0gptyp2B0httyp3B0iptyp3B0jttyp4B0kptyp4B0lttyp5B0mptyp5nttyp6B0optyp6B0pttyp7B0 . ..misckeymaps . ..Qtermcap ...r=54;; *) echo bad unit $U for $i; exit 1;; esac nam=fd${typnam} n=$(($(($U*128))+$(($typnum*16)))) M ${nam}a b $blk $n 640 operator M ${nam}b b $blk $(($n+1)) 640 operator M ${nam}c b $blk $(($n+2)) 640 operator M r${nam}a c $chr $n 640 operator M r${nam}b c $chr $(($n+1)) 640 operator M r${nam}c c $chr $(($n+2)) 640 operator ;; rd*) dodisk2 rd $U 17 106 $U 0 ;; ss*) M ss$U c 121 $(($U*16)) 640 operator M nss$U c 121 $(($(($U*16))+1)) 640 operator M enss$U c 121 $(($(($U*16))+3)) 640 operator RMlist="$RMlist scan$U" MKlist="$MKlist;umask 77;ln -s ss$U scan$U" ;; uk*) M uk$U c 120 $U 640 operator ;; ch*) M ch$U c 19 $U 660 operator ;; cd*) dodisk2 cd $U 18 58 $U 0 ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 11 $n 660 operator M ${pre}rst$U c 18 $n 660 operator n=$(($n+1)) done ;; local) test -s $T.local && sh $T.local ;; all) R ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 R cd0 cd1 rd0 xy0 xy1 xy2 xy3 tun0 tun1 tun2 tun3 bpf0 bpf1 R bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 pty0 pty1 pty2 fd1 R fd1B fd1C fd1D fd1E fd1F fd1G fd1H fd0 fd0B fd0C fd0D fd0E R fd0F fd0G fd0H xfs0 ss0 ss1 ch0 ses0 tcx0 cgfourteen0 R cgeight0 cgsix0 cgfour0 cgthree0 cgtwo0 bwtwo0 audio0 uk0 R random lkm cuaa cuab cuac cuad ttya ttyb ttyc ttyd pf altq R xd0 xd1 xd2 xd3 raid0 raid1 raid2 raid3 std st0 st1 fd ;; xd*|xy*|sd*|raid*|ccd*) case $i in xd*) dodisk xd $U 10 42 $U 0;; xy*) dodisk xy $U 3 9 $U 0;; sd*) dodisk sd $U 7 17 $U 0;; raid*) dodisk raid $U 25 123 $U 0;; ccd*) dodisk ccd $U 9 23 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" if [ "$os" = "SunOS" ]; then eo=transform transform() { case $mode in 600) mask=077;; 640) mask=027;; 660) mask=007;; 644) mask=022;; 666) mask=0;; 440) mask=227;; esac echo `echo "$@"|sed \ 's/mknod -m \([0-9]*\) /umask '$mask';mknod /;s/-m [0-9]* //g;\ s/operator/5/g;s/root.kmem/root.2/g;s/root\./root:/g'` } fi list="$RMlist" for mode in $modes; do list="$list;${mklist[$mode]}" done for group in $groups; do list="$list;${grplist[$group]}" done list="$list;$MKlist" if [ "$eo" = "echo" -o "$eo" = "transform" ]; then $eo "$list" else echo "$list" | sh fi  . ..<altqB0= cbq> wfq? afm@fifoqB0A redB rioClocalq0DhfscB0EcdnrB0FblueB0GLpriqB0 @ ]\A1!<9<9<a<k <k < !<8<8<r.a<e<e< f@!<(<(<$paa<$[܀<$[܀< ,c!<% <% <&a<'V<'V< !<(<(<S a<*Q<*Q< !<+<+<a<,<,< Nv!<.}<.}<a !<bZ<bZ<ׄ Sa<<<> !BX~!<]J<]J<ׄ!/4a<w<w<> "Ϯ!<X;<X;<ׄ"_a< h< h<> #М!!< S+< S+<ׄ#va< X< X<> $!<N<N<ׄ$pDa<I<I<> %'p!<I <I <ׄ%z=aa<z9<z9<> &I!<C<C<ׄ&@V8[a<u*<u*<> '{!<W<W<ׄ'vpa<p<p<> ("!<G<G<ׄ(la<k <k <> )C!<8<8<ׄ)9`a<e<e<> **@|!<(<(<ׄ*llWa +~T!<"<"<ׄ+MDa<$[܀<$[܀<> ,RI-!<% <% <ׄ,Ea<'V<'V<> -10!<(<(<ׄ-}a<*Q<*Q<> .4!<+<+<ׄ.-(CSa<-L<-L<> /i!<.}<.}<ׄ/V( a<0G<0G<9 0!<1xˀ<1xˀ<90[Ta<3B<3B<9 1Rm1!<4s<4s<919j[a<6=<6=<9 2썔!<7n<7n<92)a<98p<98p<9 3RZ!<:i<:i<93 !a<<<9 4w;!<À<À<94[a<<<9 5iɭ6!<Ĵ<Ĵ<95[ma<<<9 6,J!<<<96K&a<р<р<9 7GX!< < <97z)a< < <9 8=!< < <987-a<沀<沀<9 9l!<v<v<99{ǎa<<<9 :خei!<f<f<9:Ba<ܓ<ܓ<9 ;rs!<W<W<9;za<ׄ<ׄ<9 <+b!<9<9<9<wja<k <k <9 =!<4΀<4΀<9=a<<<9 >Jv!< /< /<9>Wa}M!<% <% < /n8a<'V<'V< /ɀ!<(<(< /n(a<*Q<*Q< /~F?!<+<+< /n\Oia<-L<-L< /D!<.}<.}< /ndLʨa<0G<0G< /K!<1xˀ<1xˀ< /nm--a<3B<3B< /T~(!<4s<4s< /nwEa<5<5< /`Im!<7n<7n< /ni a<8ـ<8ـ< /AQ!<:i<:i< /nna<<< /w!<À<À< /na<<< /!<Ĵ<Ĵ< /n3 a<w<w< /3j!<<< /nL a< h< h< /=J!< < < /nK.}a< X< X<"Im!< < <#*nF'a<I<I<"!<v<v<#*nܚ1a<z9<z9<"ә[!<f<f<#*nTSa<u*<u*<"#F!<W<W<#*ne.ua<p<p<"yW`!<G<G<#*n2Pa<k <k <"`jk!<8<8<#*n>a<e<e<#*"!<(<(<#*nkAa # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, # INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY # AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL # THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, # EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, # PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; # OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, # WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR # OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF # ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # Device "make" file. Valid arguments: # all makes all known devices, including local devices. # Tries to make the ``standard'' number of each type. # std standard devices # local configuration specific devices # Tapes: # st* SCSI tapes # Disks: # sd* SCSI disks # cd* SCSI cdrom drives # ch* SCSI media changer # uk* SCSI Unknown device # ss* SCSI scanners # xy* Xylogic 450/451 disks # rd* "rd" pseudo-disks # xd* Xylogic 753/7053 disks # fd* Floppy disk drives (3 1/2", 5 1/4") # vnd* "file" pseudo-disks # ccd* concatenated disk devices # Pseudo terminals: # tty* set of 16 slave psuedo terminals # pty* set of 16 master pseudo terminals # Printers: # Terminal ports: # tty[a-z]* Zilog 8530 Serial Port # cua[a-z]* Zilog 8530 Serial Port # Special purpose devices: # audio* audio device # openprom # bwtwo* # cgtwo* # cgthree* # cgfour* # cgsix* # cgeight* # cgfourteen* # tcx* # bpf* Berkeley Packet Filter # pf* Packet Filter # altq/ ALTQ control interface # lkm loadable kernel modules interface # tun* network tunnel driver # *random inkernel random data source # magma* magma card (makes 16 tty and 2 bpp) # bppmag[mno] magma parallel port device # spif* spif card (makes 8 tty and 1 bpp) # bpp[jkl] spif parallel port device # xfs* XFS filesystem devices # raid* RAIDframe disk devices # fd makes fd/* for the fdescfs # ses* SES/SAF-TE SCSI devices PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 # set this to echo for Echo-Only debugging [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } trunc() { # XXX pdksh can't seem to deal with locally scoped variables # in ${foo#$bar} expansions arg1="$1" arg2="$2" case $3 in l) echo ${arg2#$arg1} ;; r|*) echo ${arg1#$arg2} ;; esac } unt() { # XXX pdksh can't seem to deal with locally scoped variables # in ${foo#$bar} expansions arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 RMlist="$RMlist $1$2? r$1$2?" [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 M r$1$2$d c $4 $(($n+$count)) 640 let count=count+1 done MKlist="$MKlist;chown root.operator $1$2? r$1$2?" } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } # M name b/c major minor [mode] [group] RMlist="rm -f" MKlist=":" mkl() { [ "${mklist[$1]}" ] && { mklist[$1]="${mklist[$1]};mknod -m $1 $2 $3 $4 $5" } || { mklist[$1]="mknod -m $1 $2 $3 $4 $5" modes="$modes $1" } } M() { RMlist="$RMlist $1" mkl ${5-666} $1 $2 $3 $4 mklist="$mklist $1" G=${6:-wheel} [ "$7" ] && { MKlist="$MKlist;chown $7.$G $1" } || { case $G in wheel)g=0;;kmem)g=2;;operator)g=5;;tty)g=4;;dialer)g=117;; esac [ "${grplist[$g]}" ] && { grplist[$g]="${grplist[$g]} $1" } || { groups="$groups $g" grplist[$g]="chgrp $G $1" } } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std random bpf0 R fd0 sd0 sd1 sd2 rd0 cd0 ;; std) M console c 0 0 600 M tty c 2 0 M mem c 3 0 640 kmem M kmem c 3 1 640 kmem M null c 3 2 M zero c 3 12 M stdin c 24 0 M stdout c 24 1 M stderr c 24 2 M ksyms c 122 0 640 kmem M drum c 7 0 640 kmem M klog c 16 0 600 M eeprom c 3 11 640 kmem M openprom c 70 0 644 M fb c 22 0 M mouse c 13 0 M kbd c 29 0 ;; ses*) M ses$U c 124 $U 640 operator ;; fd) RMlist="mkdir -p fd;$RMlist" n=0 while [ $n -lt 64 ];do M fd/$n c 24 $n;n=$(($n+1));done MKlist="$MKlist;chmod 555 fd" ;; xfs*) M xfs$U c 51 $U 600 ;; spif*) case $U in 0) offset=0 nam=j;; 1) offset=16 nam=k;; 2) offset=32 nam=l;; *) echo "bad unit for $i: $U"; exit 127;; esac offset=$(($U*64)) n=0 while [ $n -lt 8 ] do name=${nam}`hex $n` M tty$name c 102 $(($offset+$n)) 660 dialer uucp n=$(($n+1)) done M bpp${nam}0 c 103 $(($offset+0)) 600 ;; magma*) case $U in 0) offset=0 nam=m;; 1) offset=16 nam=n;; 2) offset=32 nam=o;; *) echo "bad unit for $i: $U"; exit 127;; esac offset=$(($U*64)) n=0 while [ $n -lt 16 ] do name=${nam}`hex $n` M tty$name c 100 $(($offset+$n)) 660 dialer uucp n=$(($n+1)) done M bpp${nam}0 c 101 $(($offset+0)) 600 M bpp${nam}1 c 101 $(($offset+1)) 600 ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 119 $n 644 n=$(($n+1)) done ;; tun*) M tun$U c 111 $U 600 ;; lkm) M lkm c 112 0 640 kmem ;; altq) RMlist="mkdir -p altq;$RMlist" for d in altq cbq wfq afm fifoq red rio localq hfsc cdnr blue priq; do M altq/$d c 125 $U 644 U=$(($U+1)) done ;; pf*) M pf c 59 0 600 ;; bpf*) M bpf$U c 105 $U 600 ;; tcx*) M tcx$U c 109 $U ;; cgfourteen*) M cgfourteen$U c 99 $U ;; cgeight*) M cgeight$U c 64 $U 666 ;; cgsix*) M cgsix$U c 67 $U 666 ;; cgfour*) M cgfour$U c 39 $U 666 ;; cgthree*) M cgthree$U c 55 $U 666 ;; cgtwo*) M cgtwo$U c 31 $U 666 ;; bwtwo*) M bwtwo$U c 27 $U 666 ;; openprom) M openprom c 70 0 ;; audio*) M sound$U c 69 $U M mixer$U c 69 $(($U+16)) M audio$U c 69 $(($U+128)) M audioctl$U c 69 $(($U+192)) MKlist="$MKlist;[ -e audio ] || ln -s audio$U audio" MKlist="$MKlist;[ -e mixer ] || ln -s mixer$U mixer" MKlist="$MKlist;[ -e sound ] || ln -s sound$U sound" MKlist="$MKlist;[ -e audioctl ] || ln -s audioctl$U audioctl" ;; cua[a-z]) u=${i#cua*} case $u in a) n=0 ;; b) n=1 ;; c) n=4 ;; d) n=5 ;; *) echo unknown cua device $i ;; esac M cua$u c 12 $(($n+128)) 660 dialer uucp ;; tty[a-z]) u=${i#tty*} case $u in a) n=0 ;; b) n=1 ;; c) n=4 ;; d) n=5 ;; *) echo unknown tty device $i ;; esac M tty$u c 12 $n 660 dialer uucp ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A tbl p q r s t u v w x y z P Q R S T name=${tbl[$U]} n=0 while [ $n -lt 16 ] do nam=$name$(hex $n) off=$(($U*16)) M tty$nam c 20 $(($off+$n)) M pty$nam c 21 $(($off+$n)) n=$(($n+1)) done ;; vnd*) dodisk vnd $U 8 110 $U 0 dodisk svnd $U 8 110 $U 128 ;; fd*) typnam=$U${i#fd[01]*} case $typnam in 0|1) typnum=0;; # no type specified, assume A *A) typnum=0; typnam=0;; *B) typnum=1;; *C) typnum=2;; *D) typnum=3;; *E) typnum=4;; *F) typnum=5;; *G) typnum=6;; *H) typnum=7;; *) echo bad type $typnam for $i; exit 1;; esac case $U in 0|1) blk=16; ch#!/bin/sh - # # $OpenBSD: MAKEDEV.local,v 1.3 1999/11/25 20:10:57 ian Exp $ # # Copyright (c) 1991 The Regents of the University of California. # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the University of # California, Berkeley and its contributors. # 4. Neither the name of the University nor the names of its contributors # may be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE REGENTS AND CONTRIBUTORS ``AS IS'' AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE # IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE # ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE LIABLE # FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL # DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS # OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) # HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT # LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF # SUCH DAMAGE. # # @(#)MAKEDEV.local 5.1 (Berkeley) 3/22/91 # # Local device MAKEDEV script. PATH=/sbin:/usr/sbin:/bin:/usr/bin umask 77 for i do case $i in *) echo 'MAKEDEV.local: no such device.' ;; esac done 1raid3d02rraid3d3raid3e04rraid3e5raid3f6rraid3f7raid3g08rraid3g9raid3h0:rraid3h;raid3i0<rraid3i=raid3j0>rraid3j?raid3k@rraid3kAraid3l0Brraid3lCraid3m0Drraid3mEraid3n0Frraid3nGraid3o0Hrraid3oIraid3p0Jrraid3pK memLkmemB0MksymsB0NdrumB0Oeeprom0Ptun0B0Qtun1B0Rtun2B0Stun3B0Tbpf0B0Ubpf1B0Vbpf2B0Wbpf3Xbpf4B0Ybpf5B0Zbpf6B0[bpf7B0\bpf8B0]bpf9B0^xfs0_ pf@`consoleaklogB0bttyp0B0cptyp0B0dttyp1B0eptyp1B0fttyp2B0gptyp2B0httyp3B0iptyp3B0jttyp4B0kptyp4B0lttyp5B0mptyp5nttyp6B0optyp6B0pttyp7B0qptyp7B0rttyp8B0sptyp8B0tttyp9B0uptyp9B0vttypaB0wptypaxttypbB0yptypbB0zttypcB0{ptypcB0|ttypd}ptypdB0~ttypeB0ptypeB0ttypfB0ptypfB0ttyq0B0ptyq0B0ttyq1B0ptyq1ttyq2B0ptyq2B0ttyq3B0ptyq3ttyq4B0ptyq4B0ttyq5B0ptyq5B0ttyq6B0ptyq6B0ttyq7B0ptyq7B0ttyq8B0ptyq8ttyq9B0ptyq9B0ttyqaB0ptyqaB0ttyqbB0ptyqbB0ttyqcB0ptyqcB0ttyqdB0ptyqdB0ttyqeB0ptyqeB0ttyqfB0ptyqfB0ttyr0B0ptyr0B0ttyr1B0ptyr1B0ttyr2B0ptyr2B0ttyr3B0ptyr3B0ttyr4B0ptyr4B0ttyr5B0ptyr5B0ttyr6B0ptyr6B0ttyr7ptyr7B0ttyr8B0ptyr8B0ttyr9B0ptyr9B0ttyraB0ptyraB0ttyrbptyrbB0ttyrcB0ptyrcB0ttyrdB0ptyrdB0ttyreB0ptyrettyrfB0ptyrfB0tcx0B0 cgfourteen0cgeight0>cgsix00cgfour0cgthree0>cgtwo00bwtwo00sound0mixer00audio00 audioctl0> ttynullB0zeroB0stdinB0stdout0stderr0 fb@mouseB0 kbd ch0cuaaB0 cuabB0!cuacB0"cuadB0#ttyaB0$ttybB0%ttycB0&ttydB0' st0(rst0B0)nst0B0*nrst0B0+est0B0,erst0B0-enst0B0.enrst00/ st10rst1B01nst1B02nrst1B03est1B04erst1B05enst1B06enrst107random08srandom9urandom:prandom;arandomHopenprom>I scan0J scan1K audioL mixerM soundN\ audioctl&fd0FaB0'fd0FbB0(fd0FcB0)rfd0Fa0*rfd0Fb0+rfd0Fc0,fd0GaB0-fd0GbB0.fd0GcB0/rfd0Ga00rfd0Gb01rfd0Gc02fd0HaB03fd0HbB04fd0HcB05rfd0Ha06rfd0Hb07rfd0Hc08 ss09nss0B0:enss0B0; ss1<nss1B0=enss1B0>ses0B0? uk0@ lkmAxd0aB0Brxd0aB0Cxd0bB0Drxd0bB0Exd0cB0Frxd0cB0Gxd0dB0Hrxd0dB0Ixd0eB0Jrxd0eB0Kxd0fB0Lrxd0fB0Mxd0gB0Nrxd0gB0Oxd0hB0Prxd0hB0Qxd0iB0Rrxd0iB0Sxd0jB0Trxd0jB0Uxd0kB0Vrxd0kWxd0lB0Xrxd0lB0Yxd0mB0Zrxd0mB0[xd0nB0\rxd0n]xd0oB0^rxd0oB0_xd0pB0`rxd0pB0axd1aB0brxd1aB0cxd1bB0drxd1bB0exd1cB0frxd1cB0 . ..MAKEDEV MAKEDEV.local fdaltqpccd0arccd0a0 ccd0bB0 rccd0b0 ccd0cB0 rccd0c0 ccd0dB0rccd0d0ccd0eB0rccd0e0ccd0fB0rccd0f0ccd0grccd0g0ccd0hB0rccd0h0ccd0iB0rccd0i0ccd0jB0rccd0j0ccd0kB0rccd0k0ccd0lB0rccd0l0ccd0mB0 rccd0m0!ccd0nB0"rccd0n0#ccd0oB0$rccd0o0%ccd0pB0&rccd0p0'ccd1aB0(rccd1a0)ccd1bB0*rccd1b0+ccd1cB0,rccd1c0-ccd1dB0.rccd1d0/ccd1eB00rccd1e01ccd1fB02rccd1f03ccd1gB04rccd1g05ccd1hB06rccd1h07ccd1iB08rccd1i09ccd1jB0:rccd1j0;ccd1kB0<rccd1k0=ccd1lB0>rccd1l0?ccd1mB0@rccd1m0Accd1nB0Brccd1n0Cccd1oB0Drccd1o0Eccd1pB0Frccd1p0Gccd2aB0Hrccd2a0Iccd2bB0Jrccd2b0Kccd2cB0Lrccd2c0Mccd2dB0Nrccd2d0Occd2eB0Prccd2e0Qccd2fB0Rrccd2f0Sccd2gB0Trccd2g0Uccd2hB0Vrccd2h0Wccd2iB0Xrccd2i0Yccd2jB0Zrccd2j0[ccd2kB0\rccd2k0]ccd2lB0^rccd2l0_ccd2mB0`rccd2m0accd2nB0brccd2n0cccd2oB0drccd2o0eccd2pB0frccd2p0gccd3aB0hrccd3a0iccd3bB0jrccd3b0kccd3cB0lrccd3c0mccd3dB0nrccd3d0occd3eB0prccd3e0qccd3fB0rrccd3f0sccd3gB0trccd3g0uccd3hB0vrccd3h0wccd3iB0xrccd3i0yccd3jB0zrccd3j0{ccd3kB0|rccd3k0}ccd3lB0~rccd3l0ccd3mB0rccd3m0ccd3nB0rccd3n0ccd3oB0rccd3o0ccd3pB0rccd3p0vnd0aB0rvnd0a0vnd0bB0rvnd0b0vnd0cB0rvnd0c0vnd0dB0rvnd0d0vnd0eB0rvnd0e0vnd0fB0rvnd0f0vnd0gB0rvnd0g0vnd0hB0rvnd0h0vnd0iB0rvnd0i0vnd0jB0rvnd0j0vnd0kB0rvnd0k0vnd0lB0rvnd0l0vnd0mB0rvnd0m0vnd0nB0rvnd0n0vnd0oB0rvnd0o0vnd0pB0rvnd0p0svnd0a0rsvnd0asvnd0b0rsvnd0bsvnd0c0rsvnd0csvnd0d0rsvnd0dsvnd0e0rsvnd0esvnd0f0rsvnd0fsvnd0g0rsvnd0gsvnd0h0rsvnd0hsvnd0irsvnd0isvnd0j0rsvnd0jsvnd0k0rsvnd0ksvnd0l0rsvnd0lsvnd0m0rsvnd0msvnd0n0rsvnd0nsvnd0o0rsvnd0osvnd0p0rsvnd0pvnd1aB0rvnd1a0vnd1bB0rvnd1b0vnd1cB0rvnd1c0vnd1drvnd1d0vnd1eB0rvnd1e0vnd1fB0rvnd1f0vnd1gB0rvnd1g0vnd1hB0rvnd1h0vnd1iB0rvnd1i0vnd1jB0rvnd1j0vnd1kB0rvnd1k0vnd1lB0rvnd1l0vnd1mB0rvnd1m0vnd1nB0rvnd1n0vnd1oB0rvnd1o0vnd1prvnd1p0svnd1a0rsvnd1asvnd1b0rsvnd1bsvnd1c0rsvnd1csvnd1d0rsvnd1dsvnd1e0rsvnd1esvnd1f0rsvnd1fsvnd1g0rsvnd1gsvnd1h0rsvnd1hsvnd1i0rsvnd1isvnd1j0rsvnd1jsvnd1k0rsvnd1ksvnd1l0rsvnd1lsvnd1m0rsvnd1msvnd1n0rsvnd1nsvnd1o0rsvnd1osvnd1p0 rsvnd1p vnd2aB0 rvnd2a0 vnd2bB0 rvnd2b0vnd2cB0rvnd2c0vnd2dB0rvnd2d0vnd2eB0rvnd2e0vnd2fB0rvnd2f0vnd2gB0rvnd2g0vnd2hB0rvnd2h0vnd2iB0rvnd2i0vnd2jB0rvnd2j0vnd2kB0rvnd2k0 vnd2lB0!rvnd2l"vnd2mB0#rvnd2m0$vnd2nB0%rvnd2n0&vnd2oB0'rvnd2o0(vnd2pB0)rvnd2p0*svnd2a0+rsvnd2a,svnd2b0-rsvnd2b.svnd2c0/rsvnd2c0svnd2d01rsvnd2d2svnd2e03rsvnd2e4svnd2f05rsvnd2f6svnd2g07rsvnd2g8svnd2h09rsvnd2h:svnd2i0;rsvnd2i<svnd2j0=rsvnd2j>svnd2k0?rsvnd2k@svnd2l0Arsvnd2lBsvnd2m0Crsvnd2mDsvnd2nErsvnd2nFsvnd2o0Grsvnd2oHsvnd2p0Irsvnd2pJvnd3aB0Krvnd3a0Lvnd3bB0Mrvnd3b0Nvnd3cB0Orvnd3c0Pvnd3dB0Qrvnd3d0Rvnd3eB0Srvnd3e0Tvnd3fB0Urvnd3f0Vvnd3gB0Wrvnd3g0Xvnd3hB0Yrvnd3h0Zvnd3iB0[rvnd3i0\vnd3j]rvnd3j0^vnd3kB0_rvnd3k0`vnd3lB0arvnd3l0bvnd3mB0crvnd3m0dvnd3nB0ervnd3n0fvnd3oB0grvnd3o0hvnd3pB0irvnd3p0jsvnd3a0krsvnd3alsvnd3b0mrsvnd3bnsvnd3c0orsvnd3cpsvnd3d0qrsvnd3drsvnd3e0srsvnd3etsvnd3f0ursvnd3fvsvnd3g0wrsvnd3gxsvnd3h0yrsvnd3hzsvnd3i0{rsvnd3i|svnd3j0}rsvnd3j~svnd3k0rsvnd3ksvnd3l0rsvnd3lsvnd3m0rsvnd3msvnd3n0rsvnd3nsvnd3o0rsvnd3osvnd3prsvnd3psd0aB0rsd0aB0sd0bB0rsd0bB0sd0cB0rsd0cB0sd0dB0rsd0dB0sd0eB0rsd0eB0sd0fB0rsd0fB0sd0gB0rsd0gB0sd0hB0rsd0hB0sd0iB0rsd0iB0sd0jB0rsd0jB0sd0kB0rsd0ksd0lB0rsd0lB0sd0mB0rsd0mB0sd0nB0rsd0nB0sd0orsd0oB0sd0pB0rsd0pB0sd1aB0rsd1aB0sd1bB0rsd1bB0sd1cB0rsd1cB0sd1dB0rsd1dB0sd1eB0rsd1eB0sd1fB0rsd1fB0sd1gB0rsd1gB0sd1hB0rsd1hB0sd1iB0rsd1iB0sd1jB0rsd1jB0sd1kB0rsd1kB0sd1lB0rsd1lB0sd1mB0rsd1mB0sd1nB0rsd1nB0sd1oB0rsd1oB0sd1pB0rsd1pB0sd2aB0rsd2aB0sd2bB0rsd2bB0sd2cB0rsd2cB0sd2dB0rsd2dB0sd2eB0rsd2eB0sd2fB0rsd2fB0sd2gB0rsd2gB0sd2hB0rsd2hB0sd2iB0rsd2iB0sd2jrsd2jB0sd2kB0rsd2kB0sd2lB0rsd2lB0sd2mrsd2mB0sd2nB0rsd2nB0sd2oB0rsd2oB0sd2prsd2pB0sd3aB0rsd3asd3bB0rsd3bB0sd3cB0rsd3cB0sd3dB0rsd3dB0sd3eB0rsd3eB0sd3fB0rsd3fB0sd3gB0rsd3gB0sd3hB0rsd3hB0sd3iB0rsd3iB0sd3jB0rsd3jB0sd3kB0rsd3kB0sd3lB0rsd3lsd3mB0rsd3mB0sd3nB0rsd3nB0sd3oB0 rsd3oB0 sd3pB0 rsd3pB0 sd4aB0 rsd4aB0sd4bB0rsd4bsd4cB0rsd4cB0sd4dB0rsd4dB0sd4eB0rsd4eB0sd4fB0rsd4fB0sd4gB0rsd4gB0sd4hB0rsd4hB0sd4iB0rsd4iB0sd4jB0rsd4jB0 sd4kB0!rsd4kB0"sd4lB0#rsd4lB0$sd4mB0%rsd4mB0&sd4nB0'rsd4nB0(sd4oB0)rsd4oB0*sd4pB0+rsd4pB0,cd0aB0-rcd0aB0.cd0cB0/rcd0cB00cd1aB01rcd1aB02cd1cB03rcd1cB04rd0aB05rrd0aB06rd0cB07rrd0cB08xy0a9rxy0aB0:xy0bB0;rxy0bB0<xy0cB0=rxy0cB0>xy0dB0?rxy0dB0@xy0eB0Arxy0eB0Bxy0fB0Crxy0fB0Dxy0gB0Erxy0gB0Fxy0hB0Grxy0hB0Hxy0iB0Irxy0iB0Jxy0jB0Krxy0jB0Lxy0kB0Mrxy0kB0Nxy0lB0Orxy0lPxy0mB0Qrxy0mB0Rxy0nB0Srxy0nB0Txy0oB0Urxy0oB0Vxy0pB0Wrxy0pB0Xxy1aB0Yrxy1aB0Zxy1bB0[rxy1bB0\xy1cB0]rxy1cB0^xy1dB0_rxy1dB0`xy1eB0arxy1eB0bxy1fB0crxy1fB0dxy1gB0erxy1gB0fxy1hB0grxy1hB0hxy1iB0irxy1iB0jxy1jB0krxy1jB0lxy1kB0mrxy1kB0nxy1lB0orxy1lB0pxy1mB0qrxy1mB0rxy1nsrxy1nB0txy1oB0urxy1oB0vxy1pB0wrxy1pB0xxy2aB0yrxy2aB0zxy2bB0{rxy2bB0|xy2cB0}rxy2cB0~xy2dB0rxy2dB0xy2eB0rxy2eB0xy2fB0rxy2fB0xy2gB0rxy2gB0xy2hB0rxy2hxy2iB0rxy2iB0xy2jB0rxy2jB0xy2kB0rxy2kB0xy2lB0rxy2lB0xy2mB0rxy2mB0xy2nB0rxy2nB0xy2oB0rxy2oB0xy2pB0rxy2pB0xy3aB0rxy3aB0xy3bB0rxy3bB0xy3cB0rxy3cB0xy3dB0rxy3dB0xy3eB0rxy3eB0xy3fB0rxy3fB0xy3gB0rxy3gB0xy3hB0rxy3hB0xy3iB0rxy3iB0xy3jB0rxy3jB0xy3kB0rxy3kB0xy3lB0rxy3lB0xy3mB0rxy3mB0xy3nB0rxy3nxy3oB0rxy3oB0xy3pB0rxy3pB0fd1aB0fd1bB0fd1cB0rfd1aB0rfd1bB0rfd1cB0fd1Bafd1BbB0fd1BcB0rfd1Ba0rfd1Bb0rfd1Bc0fd1CaB0fd1CbB0fd1CcB0rfd1Ca0rfd1Cb0rfd1Cc0fd1DaB0fd1DbB0fd1DcB0rfd1Da0rfd1Db0rfd1Dcfd1EaB0fd1EbB0fd1EcB0rfd1Ea0rfd1Eb0rfd1Ec0fd1FaB0fd1FbB0fd1FcB0rfd1Fa0rfd1Fb0rfd1Fc0fd1GaB0fd1GbB0fd1GcB0rfd1Ga0rfd1Gb0rfd1Gc0fd1HaB0fd1HbB0fd1HcB0rfd1Harfd1Hb0rfd1Hc0fd0aB0fd0bB0fd0cB0rfd0aB0rfd0brfd0cB0fd0BaB0fd0BbB0fd0BcB0rfd0Ba0rfd0Bb0rfd0Bc0fd0CaB0fd0CbB0fd0CcB0rfd0Ca0rfd0Cb0rfd0Cc0fd0DaB0fd0DbB0fd0DcB0rfd0Da0rfd0Db0rfd0Dc0 fd0EaB0!fd0EbB0"fd0EcB0#rfd0Ea0$rfd0Eb0%rfd0Ec0&fd0FaB0'fd0FbB0(fd0FcB0)rfd0Fa0*rfd0Fb0+rfd0Fc0,fd0GaB0-fd0GbB0.fd0GcB0/rfd0Ga00rfd0Gb01rfd0Gc02fd0HaB03fd0HbB04fd0HcB05rfd0Ha06rfd0Hb07rfd0Hc08 ss09nss0B0:enss0B0; ss1<nss1B0=enss1B0>ses0B0? uk0@ lkmAxd0aB0Brxd0aB0Cxd0bB0Drxd0bB0Exd0cB0Frxd0cB0Gxd0dB0Hrxd0dB0Ixd0eB0Jrxd0eB0Kxd0fB0Lrxd0fB0Mxd0gB0Nrxd0gB0Oxd0hB0Prxd0hB0Qxd0iB0Rrxd0iB0Sxd0jB0Trxd0jB0Uxd0kB0Vrxd0kWxd0lB0Xrxd0lB0Yxd0mB0Zrxd0mB0[xd0nB0\rxd0n]xd0oB0^rxd0oB0_xd0pB0`rxd0pB0axd1aB0brxd1aB0cxd1bB0drxd1bB0exd1cB0frxd1cB0gxd1dB0hrxd1dB0ixd1eB0jrxd1eB0kxd1fB0lrxd1fB0mxd1gB0nrxd1gB0oxd1hB0prxd1hB0qxd1iB0rrxd1iB0sxd1jtrxd1jB0uxd1kB0vrxd1kB0wxd1lB0xrxd1lB0yxd1mB0zrxd1mB0{xd1nB0|rxd1nB0}xd1oB0~rxd1oB0xd1pB0rxd1pB0xd2aB0rxd2aB0xd2bB0rxd2bB0xd2cB0rxd2cB0xd2dB0rxd2dB0xd2eB0rxd2eB0xd2fB0rxd2fB0xd2gB0rxd2gB0xd2hrxd2hB0xd2iB0rxd2iB0xd2jB0rxd2jB0xd2kB0rxd2kB0xd2lB0rxd2lB0xd2mB0rxd2mB0xd2nB0rxd2nB0xd2oB0rxd2oB0xd2pB0rxd2pB0xd3arxd3aB0xd3bB0rxd3bB0xd3cB0rxd3cB0xd3dB0rxd3dB0xd3eB0rxd3eB0xd3fB0rxd3fB0xd3grxd3gB0xd3hB0rxd3hB0xd3iB0rxd3iB0xd3jB0rxd3jB0xd3kB0rxd3kB0xd3lB0rxd3lB0xd3mB0rxd3mB0xd3nrxd3nB0xd3oB0rxd3oB0xd3pB0rxd3pB0raid0a0rraid0araid0b0rraid0braid0crraid0craid0d0rraid0draid0e0rraid0eraid0f0rraid0fraid0g0rraid0graid0h0rraid0hraid0i0rraid0iraid0j0rraid0jraid0k0rraid0kraid0l0rraid0lraid0m0rraid0mraid0n0rraid0nraid0o0rraid0oraid0p0rraid0praid1a0rraid1araid1b0rraid1braid1c0rraid1craid1drraid1draid1e0rraid1eraid1f0rraid1fraid1g0rraid1graid1h0rraid1hraid1i0rraid1iraid1j0rraid1jraid1k0rraid1kraid1l0rraid1lraid1m0rraid1mraid1n0rraid1nraid1o0rraid1oraid1p0 rraid1p raid2a0 rraid2a raid2b0rraid2braid2c0rraid2craid2d0rraid2draid2e0rraid2eraid2f0rraid2fraid2g0rraid2graid2h0rraid2hraid2i0rraid2iraid2j0rraid2jraid2k0 rraid2k!raid2l0"rraid2l#raid2m0$rraid2m%raid2n0&rraid2n'raid2o0(rraid2o)raid2p0*rraid2p+raid3a0,rraid3a-raid3b0.rraid3b/raid3c00rraid3creturned %d (%s) 㿐'@` ` `" ` `$@ * ``*     "z > #t &H /f * ' > ##U H 0 #9> # 4 H /f * ' > l 2H p@  $ $ 4 $$ $ $ "7 $ %@H /f * ' >   $ $H 0 $ 7>  ( $ 4 $ 0$ ($ ,$ <$ 8     82 `   $ 0   "  ?$ `6   $  $@  -- - & & @`    & $& (     2 (`"  (`& ` & ` @`  ( & (   -  $ ( & $& ($ H /f * ' # $H 0`" 2`H /f * ' > l 2H p@ ""` " 2 pH /f * ' V $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8 & $     82& (`"   $ 0   @"   ?$& (@    > 0 #> "K Ő "G  ( B$@$  H L P T@ & T& H& L& P'@ 稐 z_incomp%d: inflateIncomp returned %d (%s) 㿘` # *`@ <:8 &` ?& & ?& &  & ` & ` @ "@  > 0 "h> " 0`2` X \ H L@ & L& X& \& H㿐#\   @ 㿘  &  ?   2m? 4h?`` $ a?' (   W? ,@,@ & ?$,$L$$(  $$$H$D@$$P  ( $0   (┟$$8  D ( $<,@ $   (0  $8  >< 2 > @0& ?␑*`  $ $ $ ,\$|$ @$㿘 "(?  "$? " ? $  ?. ,& & &  $   $ $    * q $ $ @Q@L  2` ( " (" 㿘  `8  ``  & ` $`   @"& & `" $``$` 㿘 ` 2@? 2 `` > ?$`` 9>  *& ( |?* :``( *` @ؒ $ q&   "  ` "   |2   q`& `2u  `" `> ?i$`` ` l ```2 |"&  | @Β @ 2L ` "H `.`- "(`` @ 0@ p0 @ 3 `  D <*  2? D <@w*`B` ` |&  `2   2  % ?c ( ?& `?㿘   2 0.?`" 8 $ $* ( 8`" < $ $* ( <`"  D $* ( `" $* ( $ (&  㿘`` 2` "$` `2@ @@& @@`@$`$@㿘 $ D*` <*  & 42? D <@vy*`> |cЕ*` `& x@  & @ `& @ & X& t& @& d& T& l& `㿘`$`d~`0`t`p!  `0`d`p``8`, 1 ^  Y T  N  &~ 6'@ /'@ ('@ !'@ '@ '@  '@ "ɴ'@!  ` `h@ ( ?2㿘 $ 4 l d"@ @ ??9?2 $4?~  / 0  h d" T# D" <+`@& h& d& T@ "2@2@ 8+`@@ "2@2@2 #  0 d l@ ܒ@  l@`& l 0 d @ & @ ` P L*  & @ l! `2 4㿘 & p `  d 0 ` @ P L*   <& @ ,* @  8+ 2  @ <*` f2 " X d $"@>@8 X ڒ& X X l 8& X XF d h@ )"  X l x" (& l %& X d 0`& d@  @ P L*   <& @ ,*  @  8*`2  @ <* f2  X? & X d  X d& X@ 0& d @ & @ ` P L*  & @ 0  d@  l d & l& d`" l T  0   d" @  d & T `"&  l!_ l!`"  T T  0   d" @ d& T  `?㿘آ `( X d 0 ` @ P L*   <& @ ,* @  8+ 2  @ <*` f2  X  h& p& \`+& X x@:( p d $"@>@8! p  & X X l 8& X X`8 p  `2  p d h" ( p& X p(V ` X Q d l \ `# @> l p " & l& p d @& d 0 @@  P `*  L  <  ,& @*  @  8*`2  @ <* f2@  p? & p d  & X& dJ& ` T  0   d" @E  d<& T )` ` ) 0 d  @ " d T  0   d" @#  d& T d l & d& l 2  l9  d  l & `& d& l l!( l!`"%   `   0 d  @ & ` T  0   d" @ d& T  `? %" [l%' [ \Xx>#l> J> J"   ؞   +  # a(+@ ?` >#* > J"   > I * $@ +   ㈡**@ ?  *"; >#> J" *> I + "?,@  ` ?㈡(!*@?  $`2? 62> H"  ,   2 7耤 !> H" ,  3  7ꀤ!!> H" ,  3! 7怤!> H> H" ,  3! 7> H"@=!> I#  4`@T 4@  `㿘> I#`Fbbbb b& >>>& ธ ̄ )*t&+&+&+&+$&+(&+06&&@!0t060 H060" 2"" " 㿘.T7H.46.P*` /  ) (`@/`@*  / / / T@.@@  ..  .'@ ..T 㿈`+4@ '`  +R ' 2@ L +T'*` * @2  `<;",@, @* @ `@$22 4!,`   5 $* @@@ @ & y@ @& <쀥C- ?,``,``",` `?2 *   2  2 " ",@  * @ `" ?@ 8$@@&6`? 2`ߑ,`xؚ    * 2 ` ` ` *` *6 @2 6 㿘 LH"= & ?@& P+T " 2  & * # +@`@`H +T '+4`P b b  *  & % % , 4 + ?&   "@ &  急 H&2`@ :`` `4 H L P*+X &&+X ,`+X?&* $ +`?&* $  ,   4  @` -+`,`2  2`&+Xe  Ϡ `L +X& *% 5㿘?  `   .<c:0jt "-.@7@ .@7@j 6j 4jj6j6j `       ͞㿘 ?      c* @R 1 +`b tbv "@.6 (&6 .@ "&>6@(6&  `v@,v+`b #@t.6 ( &0.@ #&>& 6@(&6궺b #@$.6 ( &0.@ #&>&6@(&6b .@6 .`6` ( &0. '@( 4J꺺b #@$.6 ( &0.@ #&>&6@(&6b  .@6 .`6` ( &0. '@H(Lb #@$.6 ( &0.@ #&>&6@(&6b  .@6 .`6` ( &0. '@&>@& 6(&6      @    * 㿘+; + 7)+(>   *v $  * `"?  * `@$ 㿘  ~+  6  `+  3  *   & 2`*  " ;6 & &  ~* @6 &  *  6  `*   3 *@   & 2 *  " ;6 & &  +  6 &   +  6  `+  3  *   & 2`*  " ;6 & &  * @6 &  1)"">  *v`  * @+ @6   * ` & 2* `$ & ; 6`* @*@  6&㿘  .  6  `. 3  *   & 2`*  " ;6 & &  .  6 &"` * @ &@̖ 㿘" "   *  ` & 2*  `?& & 6 & @b   ?& 㿘   +@  6  `  *   & 2`*  " ;@6 & &   * @6 &> H"d⸢ #d +@  6  `  *   & 2`* #?;@ 6 & & d * @6 &!" ` @& "" " [ "  +@ 6  `  *   & 2`*  " ;@6 & & "  *@6 &bd #d +@  6  `  *   & 2`* #?;@ 6 & & d * @6 & ` @& " &㿘!" `?  `&@Vz+w+""    2 2 (     &@{&  `0p 4  +@  6  `  *   & 2`*  " ;@6 & &  * @6 &> H> Ib@Ɛb 8b  +@  6  `  *   & 2`*  " ;@6 & &  * @6 &++ ` @)b b   &  @ b  & "6 㿘" "*`2 "` *@ & . @  +2@ " > J & a @ *  2 `> I# *`>`!# @*)` # >`!# *`@ 2  | '"2# d> Tc" *)  @@ `?`" "2@ 64  bb  `?㿘☺@ > I>@ l@@+ @ ) / @@ #@$@@@.7@ ``(@ `'`0.@@ #'@@@('@7@> J⸅(`  @"@@$@.7@ ``(@ `'`0.@@ "@'@>'`7@@@('@7@(`+> J"@ "@'@/7@ / `6`(@ `'`0.@@ "'@>'`7@@/@'@7@3  (`@"@ "@$@@@.7@ ``(@ `'`0.@@ "'@>'`7@@@('@7@>+> J"@ "@#@+7@ +`6`(@ `'`0.@@ "'@>'`7@@+@'@7@@ 1"d @"@@"d@.7@@ ``(@ `'`0.@@ "@>7@'@ '`d"@(@7@'@d'@     *```` ` *```` 3  *``` `?*  0`* 2 b b ( "2 (" "2 b (   " 02 " ( "2 ( " (""2㿘ڐ" & 6 8*@  & *@  & *@   & 3 *@  &   @ `*@ & 㿐 "? 2& ?& &  ` " @ 㿐 ? ` $ 2`0 @ $  (  $ 㿘 2 1?  (  )& "  `"   "`  ( ː?"  `  >-" *@ѐ  "` ?㿘ǒ unknown compression methodinvalid window sizeinvalid reserved bitincorrect header checkincorrect data check㿘 "? ? `>"!,*` € ܔ  & &  @   `" &  ">!` 2    >!"  &  " "   & &  @ ` &  ">!`   * @q2  $>!a $ `@{`      @8``  " "~  @ `  "@ "@  b? `& &    * "` &"  `O  & &     *` " &" `:  & &     *` " &" `%   & &   " &@   ">!a  &  "" " ? ?`2   " ?" $ h  \ 㿘` ?@Y㿘 F?`2@0@  "@"` 25?     `0 `  ?( "@$$$ "` $$ "@???㿘 8 " <&? 8  `$*`(  2  ( @  @ @ (& 8& 0& & $& 4   & <㿘   ( @    (  & (& ,& 8& <0 ( $ @ invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeatp 0 4@` $ "? ,"` J>&"X*` €?  *`` 4  `&  `/`2  `4 $@&إ4@ @耢 & & $& @&``$  &`&@& 4? && &  &4>#& 0&`4& $& @&``$  &`&@& 4??  *`` ?c82   >#& H&`& $& @&``$  &`&@& 4Ҕ? ` &&  q `& $& @&``$  &`&@& 42D  , ` 0 ( @ "?"`22 & 4@k 0 4 "@ ,? ," ` 0 ( @ "?"`2 & $& @&``$  &`&@& 4u 8 " %%@&     &?  *``  ?, `& 4   ! >#& h&`& $& @&``$  &`&@& 41?@ ( ` `(  & & $& @&``$  &`&@& 4? & &4&   2  @>  4Ϩ?  *``   *@ *`"  & 2  4    > 4* *`"  &  &   @4 ?2 & $ `(*`$  && $& @&``$  &`&@& 4 &&  4   ! @  >"" @,  y?  *`@ ,   *`    $@ * "  & R4    @  ]?  *`@ + 4$@  4 @ ! @$@ 4   >#& &`& $& @&``$  &`&@& 4E?  ( ? + "@ &  4   ! @    @  4 #\&  `   !`''#`@ܠ ?2 & $ `$*`( && $& @&``$  &`&@& 4@^ؠ 2 @H@E& $& @&``$  &`&@& 4ߔ?`(*`$ & & & && $& @&``$  &`&@& 4@L @~  @ @  0 4@` $ "? ,"  `I&  && 4@b 4 0 0 4@& $& @&``$  &`&@& 4 && $& @&``$  &`&@& 4q & $& @&``$  &`&@& 4c?& $& @&``$  &`&@& 4U& $& @&``$  &`&@& 4G& $& @&``$  &`&@& 49& $& @&``$  &`&@& 4+& $& @&``$  &`&@& 4& $& @&``$  &`&@& 4& $& @&``$  &`&@& 4?@ ( (  x T 㿘 (  ,`(`$" `(`$ @㿘 0 4@":? "`5?  ,@" $"  8 <& <`@&` ,$@& 0 ("& 0〤& $& @&``$@&@&`& 4 2?"  #+3;CScs !1Aa  0@` 8'H\'L'P'T''''''''''''''''*`  " H  !":  `   , `" @*   ,``"@8 " *,  @   /`,` @?"  '' "@`  ,  *`#`" H`@*  '?'p ͮ / '@"¸ ._H . @``'(`(`  "? " `@*8 (''' @  p@`? ! p"" //'*` $4@, ""4H*`'  / /L    `/'LT" *  `P/L" P* '4@ *  ?, * ""   *@ @" @4 @2@ *@? @  %*.? @ E 8/ ` `2?oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths tree㿐#\#`    ??>(#x & @>(c&?oversubscribed literal/length treeincomplete literal/length tree㿐`\>&>'#\ t#`!K ??>) 8/$ -@@>)``$ %?,`>'>'#\!h#` , ??>) 8 $ 2 @@>)``$ ?@@0 >> J (#t">   ")>%> O-> O'> O +> O"`" U`>)>)!ax?h'pH "? 6"  *```"a a *``a"a4  *``a" $#\>&>'! ! t#`  "? 6" $#\>'>' #`!h ` % `?$`%&@ &`& 㿘  ? *`$`( ? 㿘 (    * * " " "invalid literal/length codeinvalid distance code㿘 0 4 @` $ "? ,"` >,!,*` €)` '& $& @&``$@&@&`& 4   @o  0 4@ ` $ "@? ,": $   $ $ $ @ >"`  *`@ >"b+`@   * @  @$@ 4  $ $  @ $  $ $_   $>*$ (&`& $& @&``$  &`&@& 4? @ >"`Y  *`@ >""+`      $ $@ $ $ $4  @ >"`H  *`@ >"b+`@   * @  @$@  4 $  $ A$ @ $ :$ >*$ H&`& $& @&``$  &`&@& 4H? @ >"`  *`@ >""+`    $ $@ $4  (    ," "@  "$27  ,  0 ( @ "?"2% & 4@ 0 4 "@ ,? ,"  0 ( @ "?""& $  ( ,   ( ? $ $2D  ,  0 ( @ "?"22 & 4@Ԑ 0 4 "@ ,? ,"  0 ( @ "?"2 & $& @&``$  &`&@& 4 (m$& 4@ 4 0 0 4@& $& @&``$  &`&@& 4r $& $& @&``$  &`&@& 4b & $& @&``$  &`&@& 4T?& $& @&``$  &`&@& 4F& $& @&``$  &`&@& 48& $& @&``$  &`&@& 4*& $& @&``$  &`&@& 4& @&``$  &`&@& 4& $& @&``$  &`&@& 4?@   p d 㿘`(`$ 㿘 4 0@`  ,"` " `"&`&` 8 <& <> ,@@ 2)&`  4  (& 4 4`"   " `"&`&` 8 <& <@&` & 0㿘04@$  "$" ##@""""4 , >". .`(  ( ( @`x@>*(" `!d7`(`!   7 (   (>* @H@" `!97 `( & (  (`@!'@@ 7'@/@ `/@ `,& &/@ `(/@ `6`@2 1 (`@ ("`@` (` (`  !/@7`[1 " "$" ##@""""4?` e 1  "$" ##@""""4 0.95Pbuffer errorinsufficient memorydata errorstream errorfile errorstream end㿘?6  ` f a !E&@`@`@@`@ `@@`@`@@`@ `@@ @`@ @`@@ @` @@ `@@@`@ @ `@@@` @@`@ @`@@dĒ#@d#񀦠,`diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe maptun%d㿘!> 7. $"4 :֔ "4#> *`@\!$`X"4 :>/!>/>3b"p)>.X.  4 ؒ! X 5@$, 8>#X+ $ <4 4$ $ $ $   $  , :$ X$ L$ T$ H$ P$ \r$ ` (  b4 X㿘@E 2 "?> 72 4 @@   >  X*` `؀   2`ذ 㿘> 7?b42  @ s >  X*`  ?# 6 ؑH /f         * '    a  ` ` & & "` ?& `H 0 4 "1&  ؀$2-& ܑH /f * ' ې 4 @  `2   ؐ2 @*   2H 0& S `4?`ؐ` A2`492`ؘ2/" `4"`4`؄2``4" `" `4"`4`2``4" `" "` 2`2 㿘 H /f * '  a@ a@a @% a@! a1@ a2@ a@" 0& <"  / / H 0㿈`ؐ " { @    ğ''`'```"`8```$"  `?ܐ"   ?"  `` ?`&`&`  ɑ `" `` "`` &``" ( "`Y` H /f4 * '       @&&`  7 2" $  $  $    $  H 0 X %$ XH 0 P ``$ `$ P`؀`@?# @4`Y`؀  `܀  `I` ` > 7? 40   > X(H( "}@"dw@"z@"d0t\@"<0n ]@"!v"~@"<0b@T [@\"< *824["D" 8242DS"4 H H 24:24H 9 "؄+2? "؄!2?2؀"""" "  " "H   H  tunread㿘> 7?b42  @   >  X*`  ؐ ` ? @# @6 ؑH /f )>1H 0ذH 0а* ' )>1 ؐ " !>1!  V  ؐ  ̀ *  2!  ` ` & & $` ?& `%` ؀!`@H 0 # €  `@6 ؐ!  V `" ؑH 0`i`_^`>  ` @ 8 ``LH /f * ' T`* 4`c ` "#@`8@ `<"`<`<`8"`8> `$t[ ``(`$`0`,`9`4`$`0 ?4`@> ##tEH 0 `"` `"" L & L㿐?> 7 2 b4  ( > X* `c  (H /f * ' > ##r< H 0`#+> # 4`H /f * ' > l 2H p@ `$ $`4`$@$`$`$` ` ݰ 7W 7' T` O>  l 8 $` `K͔$``7H /f * ' cq H 0` 4`H /f * '   5 H p@ `$`$@$`4`` 쀦 `    "LbL z$L" "`( `"` ?" `?"`0 > #  > # 8 /0RH /f * ' `` @` #`H p@X 7 $X02" ``#@"``> ✠ `, #`#`"✒P > > )*a  H H $H\` $\H p@㿘> 7?b42  @ 6 >  X*` H /f`* '` `0  > H 0 b@ڒ0 H 0  H 0 㿘  ̀ + ̀    `"  €   ؀`@?# @4 Vc ؀   ܀   FR  bridge%d㿘. * "*  5B %> E$ !> $ @V  ; >4 >8>9b\#%>?#>3 d "/ !$!$!4 4 4 4!4 ! h],$!P$!X zc@ , 8>#X%ܐ , :$ <$ $$ $ $  (   Ѡ!`x> "@ @H / * &  H@"`4<@"i`A S@ P@@@E@   !@"*`4 @"` =@ɐ?@v  B@)G@  0S@P@~ !N@"L` T@!M@  q A@АF@"g 0 B@Ð 0!C@>@ W D@O@D O >a2 IШ "C `, 2= X  t2 22  `8 7 `4 ,ؒ @T`4' `4`47`    @T֐`4 4`47`       2   4    `8  ~  @U_    7$ x, `$ $ t$ d d$ h$ l l$ pP`$P" $PP$ $`,`>oa2 ͐P  t @^  2 t " ,J t` "` "@@ M t@ V` 2 t0c@В>@a2  " `,  2 X    t2  }  3  ΐ@T $ t$ d d$ h$ l l$ pX`$X" X$Xd$ `>a2 dX  t @^:  2`"  "` "@5_  2 t > ; Ð "6 `,22 P ".  t2 "'  x& \.$ `.% t `1.&`=a2  " `,2  P ? t2 ? #@ "$ x `8 2 $ x`=a2 u " `,2 P "  t2 "ٰ %, `@ Ѱ=ta2 Ґ @ ư`=ha2 ƐG " `, 2 !"@U    `=Ka2 @ "&`==a2 @ 3$ `=1a2  $[  >!PZɐy v& "`4@ې`4 n @j `= a2 i "] `, G2W P "S  t2 "L  ? 8F ! ` @`@ ” @! 5@  0<Ӓa2 1 "% `,  P  t2  @ @ `<a2  @הH 0㿘 ,P  t2`"  "` "@ @ @ 3 & , 2 tp!P     !X `  `2!P` ,`'*,* В  @Rr t`@Rm  x' \ (/ `/ t` 1@/ ?,``(?&`  'ޒ !X 0,` '+,* В  @RB t`@R=  xa' \ (/ `/ t` 1@y/ ,``(?&`  'ݒ ,* &`hڐ`  `  `, 2 aP``t 2@`2`d `l `   ` `2  ?,* "* ` -w` @Qؐ`tؒ`@QӔ  /  ./ / / / / / / / / / / /`$ @/ L,` .?&`  ʦ`l ?,* "* ` -6` @Q`tؒ`@Q  /  ./ / / / / / / / / / / /`$ @/  ,` .?&`  ʦ,* "* &` 㿘 4 @%!T 2 4 0  &!T !T*"@i&! 4! @ 6 4>!P!  X㿘 4 @ X!  @ 4 6 4㿈` Ä  ?` ,H /f4`4* '`4 @ͪ @  Ð ʙ   @ zH 00`  @ kH 00 @aPt 4 @" 2  @&   & `T`w$`T  +    R沔   21G`T @@ 2@"@    ` @`$           @&$   7 2" &  &  &  `" `P  & "`P`T $`T"`` @$`P$`` `& ` h & h 4$2 @2utʐH 00c @_ 4 @2  H 00R` ` "     @&&`  7 2" &  &  &  `"`P  & " `P`T $`TH p@0"```$``$`P `& ` h & h 4$ @H 0 㿘>   3%> * * "  * @@)H /f * '  ` ` $ $ "` ?$ H 0 `༔ӑ*x 4 @ ( `C H & H \`!P@& \  t2  x " ` \   `  (  x  2 x?#@     " x @3  x "` \ ` #   @ƒ@2`0`"&  4 x      ^i" x b  ^  ^Z x @b Q d@ J @ ` # 2 d`2`4 d & dH /f * ' @<H 00 @!P  t2  x  l \   l@X >0f @Ĕ _` ```H /f4`* '`   ````@&&`  7` 2" $``$` $` `" P` $`"  P T & TH p@0 ``& `& P``$```h $`h`4$`@H 0bridge_input(): no HDR㿘 ,    2 ?>;qʐ!6 ,4 @P  t2 @J  # >`@TД  2  x@ ] "k  x "  \ c a _沔 C  W ``' 8# `  $"    ܐ"   "    $ $    %     $  Ŕ H /f * ' @& $ 2H 00 2" &&`&H 0>  " c > > ) *a !  8  8 P Ӕ t 8`2   6  t& 3 t x " P \   P "1  t `8 2(`ؐ@T   x ` @&  t&  8`  6  t 0`@S   2 t ``' 8# `  $"    ܐ"   "    & &  є  "S      & "J   H /f * ' @& & _H 0,  2" &&`&H 0>  " ⏒ > > )  *a M   2 !  㿈!P t`0`0 "x  \  "2`4 # "`4 @"` ``@ ` $` T`& T@Ē 2l@ " +     Y沔   2ҐN T @@ 2@"@    ` @`$  @@ "G` `"` ````@&$   7` 2" $``$` $` `"  P` $`" P T & Tb ` @& P& ```$```h $`h`4$2`@2Ht d㿈!X 沐   `"A!X ``' 8# `  $"    ܐ"   "    $ $  t  }     $ t ꖔ !X`k`t`4 @"c@` ``@ ` &` T`R& T   "/ T` `e` ````@&&ܐ  7` 2" &``&` &` `"  P` &`" P T & T & P  `@& ` `` &`` b"`4`h &`h`4$2@`@@`2`t㿘!T  2  *u  &!T !T,``c"@*&!@!T,`@ ' !!@w  *V  q   , $ , , !T,`@ $!T "`!T" !T@ S$ `@KԔ   "`,` $``",` D` !!@<  *  6 鶔 , $ , , `$$ `"!$`2Ϣ!!@  )   阔 , $ , , @ $@" $@$ ! &! 㿘!T @!T* @ "  @Kq    4    `' `ṕ* `+ ( `* @ `! 2 "(""2 "  2 "(""2"  2  "( ""2"  #㿘!T "1!T!!@(,!T@O!!@%!T ,`@"`  "$ "@!  +Q&!!!@瀢c$!T!T` !   4  +9 &!T㿘H o*@ a@  H 0㿘!T 9 !T*@$  2 `? * * "*  $ "! &!* ݖ$!T! >!P!  Q㿘!T / !T*@`2 2 $ "! &!*Ò $!T!   4 !T* &!T 㿘!T 1!T* @ "*  @O  2`"  "` "!&!* ! 2  4 2  !T* &!T ܐ 㿘!T , !T*@2 $ "! &!*Z $!T!   4 !T*J &!TpT 9 ` 6-`  T- @ "* Т` ''۔   ֔  Ҕ  /` ( @/ -```(?&`( ݪ` #$T-`* &`㿐` (?  (":  h 5@/!"݀@+%8, ` '  I?c*   #2  2 (   5(!"݀   㿘"    `@O  2  ` 2  @N  2  2  㿘  '  `"  9 `( 5 `!` ,  ,  ` , $ p" & p ` , $ h"& h 㿘 d " l d d@ & d& h )^  d 2 d l  l l@ & l& p )M  l 2 l 㿐  h.'T!"݀@)e`  ~  ?c* "qT #l i( `T TВ `T˒ h!"݀@TH T` BT`      'T> (`L`   8"` T<  > (`L`X #"`X2 < `L` "`    'T> (`L`  "` T@* `6 > (`L` "` @T T$ T 2"@ "  "c T"`vFT TT`݀ `   'TT` T`6 T@D6 T` '  (  'T> 8 `B :T @ `!> 8`B : > 0c\>!Ȁ >!`*@T`B :wsT T  `@T``$T8  T`$"  ?ܐ"  TT?"  T`?"`T  " T  'TT` T` T` "`T F  寐T``$T8  T`$"  ?ܐ"  T ?"  TT`?"`T  "  Q 'TT` T` T` "`T   p TT   㿘`  +.`^.`N ؐ>`0 &`@ `X>`8@6`L " 6`D`&!6`D 6`F 6`H `]6`J.`O!.`P `D  `0.`]@.`^` @, XH o4'*@ g' t 4 @2  H 0 0ހ   @ H 0 0ΑH /f * ' > ##`Ē H 0" 6H /f * ' > l 2H p@ $ &6&&&&   4H 0 0& && /Ē B?//*` ` '@ ` '/ƀ/ł`@ 2`* 2`* 2`* 2 @2 ```````777/'7//////777//////~ > y  &7s `n &      @&&ܐ  7 2" '  '  '  `  '   4$ @H 0      ܄`? `8B 2` 8; `86 2` 8/ `** (`&   `  8 2  `8  2    " `Z`?㿘>``$&`>`6`Z@`2 `2 `2 ` *!㿘!P  x  @ "  \ Y 2 x`    ``X`Z`? 㿐  tH /f * ' > ##_] H 0 " 6 H /f * ' > l 2H p@  $ & 6 && & & k  & & `ؒ & ^ > Y  4  / B//?*'  /'/ `C H /f4`4* '`4 @/ ` `` ``@&&   7` 2" $``$` $` `` $`  `4$`@ H 0 |㿘@@z㿘!P d  x \6 2X \ "T  @ @ 2L  @(G`"C` 8? `  @7 872  ` @80  @``@ *&8%`  8 ` @ 82 Z `@8 Z`Z@* 8  X`X@: 2 x`&  & > `> `` & 㿘!P = x 5 .  ؀@)  ܀@$  @*8      䀢@ 82 X  @8  X Z@8@ 2 x :` "` `X:`2`Z㿘!P ! x " 耤, ^ , ]n " , ^@ $@, ]@ 2 x㿘`\ @  `(@ 㿘`\ ``?  `_ "@ @ @`(* \㿘  .!!@Ԓ   !  2! @ɒ  .!㿘! @.!㿘 *`]_'D!P'P ' x `t 'x "tP `ڀ   "@P  'P ኔ  B2P B2P 2P* @2P 2P `  P/D@PPŒ & 'P \ &Р ԅ,`' 'd?ә,d'?`?'|բ 'l'?h'T'\?4\d?X4`+,ܠ ޕ-`|-?xT?P \* X + x,`d4 @* |'t*`T3P 2`* 4@t+@| \   +. +ׄ ?  ذ  τΆ @ ??'77777 /4D//@ P = 㿘`\ : -ǔvn 2 耤 " @!! "  @!! @  耦@  0Β 㿘`\   㿘!@[ 㿘' _%    6  6 d6 @B! w!@9 㿘`\  Q `(@, 0I @  `_ @!P`" `x"@` 2 @` 䀠2@ `2`x 㿘c! @ *!*!㿘 `^ 㿘!P !  x " t 8 2 ` 1*  4 X  ؒ@Aה  6 t 2 x2 @a0] ڑ(!+ ٕ+` ۠ ܆ -  ;  -`     ݖ     6 ! > 6 6 > & & .!@.!@!!L  >Ja !8G!L 2!P>!PH !8!P ! x @G@K 2 x@@d 㿘!P "!L |@\ @Z $@X (  !L  H!8@K!@I! @G!㿘 \  .`_`$.`]@8.`^@6`(@4` 㿘㿘> `$.`]@.`^@`(#    6  6 (6 @! ;!@ 㿘ɐ!P  x A 2<  2 x>  `  6  6 6 @Ԑ!  !@˒ 㿘 26`Z6`X `@ `@ .`Z2  ~㿘&`} * _* _p`t4  '0 a6Ѐ 2 `\耊  " `\`\ X0  Z0`\ S㿘H /e * & !P! !  ! x  2 x @] "  @U " K @M "!PK!P "!P x "  @= $ ڒ 2 x!P " 4 x " @) (  @! " 2 x 4 @>!PF!8H 0 22 22 㿘 .` !* @ 6   㿘 =@  <@J aQ@":aP@+0AaR@5aS@'090!P@ "!8 !R?@-T@*0*@ "  !S@0!6  2 . 6!  * 6 *  6  *  6  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘  ` 8 R 2)  &   2    Y  $`& ~^   2    vlanattach: MALLOC failedvlan%d㿘. "*   > `"">Ka!!>  @>$## @'>K#@>N>Ũ`4" %>KԒ" cA>cX$ $ $ $   $ u9}  5, :, 8`@ vlan_start: impossible (altq)p 4$6 4 ̀ )  2   " 4  & & $  ?& " 4`4 A A`$` T`E& T ̐ € v ` " ( `8 >K`{ (a6# "`|pP`|  $  &4  N  a777  X  2  L & L   $  @9  `` $`` b"``h $`h` ````@&$ ܐ  7` 2" $``$` $` `"  P` $`" P T ]& T & P`4d2X `@S ̐ ;6 4㿀 > c > *Ԑ" * @  耢2.` 2  2 &U 4  O  ɠ  !777 ``' 8# `  $" 4   ܐ"   "    & &         &   @  {? A A"& B? ( " Hoe H`$ Hz 㾘`  `   2``L  C$`L` @ /> c > *Ԑ" * @` 耢2 򀠀2  4 A A"` ?&``6 ` `` &` &`&` (  ''' (o H`$ Hz %s: initialized with non-standard mtu %d (parent %s) 㿘`8 @ +`耢 < $``| "`<`< $`<>M $`<!`a8``4?  @4`4`8,`8`D$`D`|  $`|`0>`* `0 *`   **   ` `ؐ   㿘 8  ` 8 |ސ|ے "   & @  2 >#`% 0& <& *    * @<* @<  㿘 4!  w       w  ?$  %s㿀> "@ 2@@ 1@ @@"  @"% 9@3 00a!@a:@Z 0{ 耢 "x `4 4`4 ` p@ 0l ؒw 0g`"e `| `<?@4Z `-$W U$`<`%;a2 Nؙ  GO  Itr`4 ?<4`4 o@8 u 1  ,4 `4`@a4`40$@;ߒ  耢 >N 0`{ 7g   F  耢  R` ` ` "``R`6`   R` `  "`  "``R`6`  @  @    ` "J2#  ` @ *J@@ `J@`  "  J   `?㿘   ` @Q  2  @>       2 `  @ `> O  8@ @ @   @ ` @  㿘@V``  ` `  "``V` 6` ` `     JJ@   ` p` 20j: "  :  ,@8 `V`4 `Q K``"` 쀊 `@ :@ `" ` T4. `2+ 0 @8  "       "   2  "  2  I    2 @2`  ` 8:`( 0 " ? 2"( * 㿘@`     JJ@ *J 5&&"  *`:  ` ` @ ``V`8`     $ $ &` &   @ 2& & &  rn_addmask: mask impossibly already in tree㿐> #d @ " @> ! , )> O> O`   B` @<$ -> @ '>〤  L? "? $@4 Ā6$n , 6 "@@9͐ $*@  `  @? 2 T`Rd  0b  I d@9`0 0 7` >PaX\ 4 0-   "  $L  :  `> *`J:`@ 2 +  + @8`6   .  @ 2  :  @ ` *  Mask for route not entered 㿘> `  "`    >Q`\6  @9+  6 .  " & & & $Non-unique normal route, mask not entered 㿐  `    2` ` 8`=  ,:  @뀦``"T I  y   2 2$  , $ `2$`$` $ $? . & 6` $ `4  ` ` ,  @@8 T` 6 @`2*: ` "`T`&`@ 2 `I &``2`` *V: @ "$V &$&`P-`T:   0J  & E$ `T@@21,V: @&!4* "  ` >QaP[A Ӑ ː 2<`V@&$ڐ&rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Mask㿘. 4  @@=۔" 2 `ǒ        2  `"T O >R $`a`Z  >Ra`Z 8  ? 2" `T V 8 4,  V 2 >  & 2> "@""2 >R Z~a   ` C 2 & 2& &   `  ```" >R`2``">R "`aZM  r & & & &  & & `2"`"`" ["`   `2"`"`&3 V  @ 2$"@ >   & ? " " `2# >R>RaؔY "  &`& `& ` & `& `& " " ``2"`"`  # ` , , #㿘V  6   `2  "   V ` V  6    @   2  "  㿘  t9  :  "3 @6 t&> O``, `\ * " " @8*` 2`$`\`!> O# `>Q# ` >R# `>O# `>O >S# # |aX $@$` $`$`$` $`( rn_init: radix functions require max_keylen be set rn_initrn_init 2㿘>  0 !> (d@4$#d2(#d`*`>T`pY0 0)  Ӕ #> O $`>TX #d*@6@ #d> O`> O  " " *  **> !r >TXې 㿘  > 7> 2 "$   `4 4 > b,b, $b," "b,$  㿘  "``"  "` "@j 㿘  `>  ,㿀> ",'T'X'P'H'L H  @@2@ `" `@28  "  @; 2.  @; 2$沔   L F  ࠀ    2 Ly )0 |ࠀ  0 raw_usrreq㿘 `  k -    \ -J`U.`>U"t €  M (I "F 9DC "> 9O0 8 1 8$ + 9 `€"  $ 1   2   2   90& >UW  U U8 T T T T UT Up T U U VH U T T V V T> 㿘>  0  "  $* €  2 㿘f> 7!x㿘` `@  `4  @ &`` 2   X > 7!x*` 'H / * &  `3 `€ .> +`8`"' 4!" 8̒     @ ' 8 $ 8  4"  ` 8 $ 8> `8`  "` ` @4. 4'Đ@ h H 0㿘`  `@  `4  @ &X > 7!x*` 'H / * !  `F `€ "A  2= `5' 4!1    @ "' 8 /$ 8 " 4"( @3͒ 4 ' ' 0' @ "  4 ' D' 4 @  0 8 $ 8  > `8`  "` `   @3 4'Đ@ ۔ H 0rtfreertfree 2rtfree: %p not freed (neg refs) 㿘 2 8>VVW#x?-& 8 4 )  > >VVG#b<? "b<>V#W0@  @M D`" ` ?"`    ifafree㿘 2 >WV ?ے 0& Xjǐ   3m @'  0 @2 @9 2  D@ jF 2 A`=`` "`4  `4 ,  n'''''' @``4>  <> 4`@ "4  @ A  ``'@@ `> `8 "`8" $@2 4''''ܒ@  -㿘` `  ܐ?  i iÐi j 2q "   8 4?` & 8 `  2 D  D " `   jW "`@2T 4''?Ȓ@\㿘 ,   `" ( ` 2  (iϐ " (` & , ( 2  (  " (id& ( ( 2& (    "  "   ,`" j& (`    $ $ d& ( (`" 3 , ` & ,rtrequest delete㿘H /` * ! `> 7 ax* @  /`$ 2&` "  "T`(0=0Ԕ`` 2 ` ̰   " `x>XT!8 $`x  8 ?$ 8$`x`4`D ? $`4 > b< "b<&`8  $`80"  2 4  D >&`$ 0&` H`&`  &`$ 2`(/ `(    u 7@1i `$ $ 4$ `@s`  d 7`  `@ɒ `ϝ  `  2  x "  ے ؒ @   $ $ D $ @P$ PT$ TX$ X\$ \`$ `d$ dh$ hl$ lp$ pt$ t$ | T 2 P 2  x "  T$ T <$ T& 8 $ 8H 0㿘@ ?    ?    0 "  ?  @8  `(   w  2 & 7 @ & x & 0O  x `8 ?"`8& x 4 "   & x P 2   T`T( & T 㿘@.@ @`.@ `     .@`@ *@ @0m"rtinit: wrong ifa (%p) was (%p) X ' `0      2 7 5 " 8 D?@$ 8g 3e A L$ D@0% 4 ' '''̒''```   @ 8 ` $ 8`27`24 "0 8 D?$$ 8>ZTA  D`   D` ?"` $ D $ @ `<$ T   &   @R/usr/src/sys/arch/sparc/compile/GENERIC/../../../../net/route.crt_init_done == 0㿘#>`Ѐ " > >Z>Z>Z"bRd#u"" !> O (>\` 6\>!P6l $`Ё㿘> Ѐ`  6   @/ && &  & >   `&  "`" & "rt_timer_queue_destroy: rtq_count reached 0 㿘3 `"  "`   "@` "`&  `"@ "  €       ֒   ">[?& S   2  ` "`  " rt_timer_remove_all: rtq_count reached 0 㿘 '#>[ `"  "`   "@`"  "` "`  "@ ` ?"`SAaP  2 rt_timer_add: rtq_count reached 0 㿘H /i * * > bH 0  ,>[ 2%  `"  "`   "@`"  "` "`  "@ ` ?"`R0>  2    D   7@. $ $ $ $  $   "`  & $ $ $  "@&  `  "`rt_timer_timer: rtq_count reached 0 㿘H /i * * > bH 0H /`4> * !> " `@ 1``"  "`   "@` "`$`  "@ "  €      ʚ  ` ">[?$`Rh#` " ` @ & ``2`H 0>!P4Ґdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘`      & @-Ԓ `* (   > )aؖ ?"a > )!" > )!"> )` ?"` `?"`H /``* !`  > "@`   H`>  ;   H 004  > )aؖ  "a > )!`" > )!`"> )`  "` > $ `)"  @6 H 0route_outputP'L'P'T'X'H  '  `  `  ڒ  2` 7` 2`>]O `K('`@ '     ' 7   > 's +"@`4&@, 4 'L@ߔĤ`' ` 8[ Ȁ "  8S Ѐ " ɔ  "I 7 @ *B 7@2ǒ` "< 7 '  @`a2 "- ?`'>_ ̓*` €  8 D&8Ȁ     P @[$`8?"`8"H> 7 ax* @2  / ̠ "  " 8 &8 c  π0 ʀ0 '0''H' 0"@`"'` 'D'`4 "'D '`06' @ @     " 7z ǒ @ 4&P&$T&(X&,\&0`&4d&8h&<l&@p&Dt&H~&  zȀ   m E "c " `؀` Ȁ   "cؒ -$ D؀ c  2  Ȁ  4' "  "  D "  D   D` Ր?"` $ D  ' $ @ $@s P D "   Ѐ 2$ H P * $ P $ $ P - "& @&"   @ > )!耢`4    =0/ @v` . "@   24 Ā ` >2  >>>`؀  4  w@ w w w { { { w  `" `" @`" `" ` "  `" `"` " 㿘@+   :  *" ?  @ *㿘 J  @*@  &@T`  3`8 " $@@` @4@@ 2@T`   " $@@$ ` "` @&ݲ    && rt_msg1㿘   L  T L$ >_Mg#0  .- H /f * ' >  D & $H 0 $ (  & 6 & 0& (& ,& <& 8   ߐ "0  & & & @*Q`  ,`-@@ &@ ?   J``,`  ,4, 㿘 &@    L  T L2 `,` @*@&@ ?    I``,`)%`$  &   " y    &&  & ,,4㿘> )!`` @ "`"`@> "`  22>> `؁`> )!耢`@) 4   D` 0 84 V 4 $ > $ >> 3 `> )! ` `c  ->+>@)l 4  `  `    @' `'`''ࠒ ;  0 2 `$"`"" ` >〤`% '0'' "`  024" "" > 22`]`آ```@    4`@V @) 4 @  0' ' H''  D''4`'  ` "1` ,  4#  t#  P# $ T# ( X# , \# 0 `# 4 d# 8 h# < l# @ p# D t# H @`0# 3 # # # O` "`&`&``@( 4> '#Ȁ"d ``" 0@2X @ 'Ԕ n``C'` ?804 T4 D$ ѐ $ ` 2;+`@ `2(`'` '`' C```` `02 `"`$""`` "`&```Ӏ '''2` x  f `a  @(1 '   ''''H /`4ؐ* !؀ %   0> 7!x %>a`` .`  `@2` ( `0LH 0  䀦@ '"  &  *` * " @&^ &route㿘b@'̠ ( .t-* "?  .L$,   6 &. . 㿘  (b @' @'/@/h@'/@`.`"* * ? @* "?  "* * $,   6 &. . 㿈@?`    ',@   B @ &` `@2``@2  ` *  @@ "/ @ &` `@@ ``@ @ ` *  @  @ 2&`& 2 ,2@&#$@" 3 @` @ ,``@``@ < @  ܐ` *`@-` Ґ 2   ?* @, Ɛ "  * 2`?* 2  2`, , , ,  @ " * 2   2 , , , , ` @?#,2  4, ,,  , `  ?#x+ 2  3 , ,,  , ``!>d! -` €`` ^@\`2`` "2 ` ` "2` `` "@ ?* 2  3 , ,,  , ` 2` `IJ$ `@  `."@ `@.@ `@ ," @.@  4 "@& & , , č     & `Ą ` p.` `. \ 㿈  #\@  @` & Ĵ&@   D$㿘\p"3   ? # @/ 7 *" *  `*`* /h `( ` 2 * @`․@6   ' '@$ ' `@   "  $? ' $ ? c 7 /  `*`" *  * /h ` *`*` 3     + `   `0  "@    # W#   @"@ P#   +     * @3  3   + ```2    *  @ 3   ` 3  ```2    *   @#    # `` `2    *   @#    # ` " `2    *  @ 6    ` 6   6 &@ " 6 6` @@`?# @3`@ @3` 8 6'@ $ ? ` ' 7 enc%d㿘!> # آ@$Ҧ ( 1>e/>e->e+>e)> "PIH#X&  Ȗc$$`<,`8$`,`:$`$`$`[:$@ W~ @7ؠ ؀`؁㿘H /f * '    ` & ` & & "` ?& H 0 `P 0ہ㿘J `&"`T @" 48 @"  4 @ @2   4"@2 42 4 pflog%d㿘!> "H@$L   (!Ȥ 1>f/>f->f+>f)>  pH#X aH $`$`,`:$`$`,`8$@Z$`< V @78ؠ ؀`؁㿘H /f * '    ` & ` & & "` ?& H 0 `ǐ 0ہ㿘 ` "`T @" 48 @"  4 @ @2   4"@2 42 4 gre%d㿘!>$!d.  p !d>"!`@#*`!d .  >f>hc"p#>f bHN    % /. 9. 8. :& <. &6 4& & & X& L& T& H& P& Z&  ( VZ ad ܰ!㿈'D f   D@)v  QY       DDC 7  D ( " UP 7π />!p`2D( D`   D` ` * @  D`@#* * 7 '$  @    7 '$ 7@p7``$" :m` H /f * ' > ##= H 0 " 6 H /f * ' > l  2 H p@  $ & 6 && & & 2`D 7> & `& ` & ` & `&` 6` c,  *@ @ & & `@&  ` * &` ` `*`" &`  &&``@&` &`   *` ݔ \4 e RD>!h`2DY D` "  DD`(E /``8`$"@ܐ"   " `  &`&`  ] ``  `` &` `2 D 7` R"`D `"0I / ` @" - 2 * 2 . .  . `7"2 . 2 2 . . . @* 2`. 2`2`&. . . > !.  . `* 2 2 . . DP`"PD ` ` @ `@(Ϛ D`T "`T㿈> "@ H / * '  f@e@@"T   @'@"%Ԧ 2@ϐ1@ ̀0a0g@" i@` 0h@j@"w   $  ` `$ X $ 䀦 耢``8 ?"`8$ @ 耢 2 4$ $ H 0  " 4 2 4 ?6 4    70v /,  4?+@,  4?&@"j / fd /` ga2 ]`/, `7  4 ? 4 ?ؒ* L6 4?ؐ*@H6 4*@E6 4C6훐 $$ ` Ba2 8@$ @2 $  + 䀢 ' 耢``8 ސ?"`8$ @$ 耢 2  4$ $ H 0   6 4 ', 0 H 0㿘 @ ϒ    $ , ,  4# `   $ 쟐 耢``@2  4`8 ?"`8 $* $ $ 2`  ` ? ( ? 228 * 2 diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘H /` * ! >!P>)x')> ( $`!> %` \@"8@ؐ `2`H 0arp_rtrequest: bad gateway value arp_rtrequest: malloc failed 㿘>`0 `L> % `" "!> O @>j` &Δ>!P&ސ`4 "` 0"+ 02 `4` &`4`4a>` `@> % `8`0,`@ 04v&`\@" ` ``@ @l  >j 8`@`耤` `8,`@`0Y4  m  &`L>jaB 0L> > "㈒`#""@ $``4$&`4> (`$`$ $@`$" "`$$`` `D`H- &`\`@ ,`  ݔ >!`> " &`@> c?"c@``"``@"&`L`4 ;&`4` "=  㿈 a  5  `%  % @X% >#p (4  4`(  4 4 , ,  ` ` `   // arpresolve: can't allocate llinfo arpresolve: unresolved and rt_expire == 0 㿘!>#p= "  ^// /   / / q/ `"`L @ 2  `2 `\>kaA Y `0> %" ( 4  2  4   ! 0B 4 2?  "$ $ `\ 2 `\>kC!8> %b&`\`\"* `4 ?&`4 `> %⨀" >&`\  @  $ `D ؔ4`  >!`4`\` &`\&`4$  arpintr㿘>a V H /f * ' a a $a"`"`?"`H 0 >k 2 >kA7#     #a a   *   @   a h@@o a a arp: ether address is broadcast for IP address %s! arp: ether address is multicast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s x`   `   > ( 0H @,`"< ,@" < H@2< ` @  0H ͐H2< `@2<Hت @#n    >cp@#c  !>l'!!>l'!@@@\ 0 ܀!>l'@x!x\<@H ' @ `?@ ~ z0v 5 `@## L4@!>l'!@H\ @ 0Y@#>l'"a!>l'@1"0[ @  $\@" ,`" , #>l'b`@@ [֐? 0"  `,   \ > %>| $\4 ?$4 `%  % 0B    @e    0    ܔ ( 55Ҕ Δ (4  // arptfree㿘 `2`8>n?@ $``0" `  2`*& `4 ?"`4 `    arplookup: unable to enter address for %s 㿐> O X*X @ , $ 4 ( 28 4? dd"80 `"L`   !>n' @I?   -㿘`H  `>ja0!&`&`㿘      *   h@@0㿘   /  >0) ' 0%!` >!  #>a > Oؐ @!  > O`l   > O `h  $a> Od h}㿈   4  %  % @% >#p   54`  4(   ؖ 4 4 , , Ԕ Д ̔   // revarp㿘>!` . >> "a"!'> O%>o#>Ƞ??aaPh2 :  #"?a %!> O l > O h   3㿐ƒ[NULL][%d,] 㿘 2>o?e!0>o?a! >o%>o#>o?Y? ?Ta 4>o?N!  ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d 㿘 >o?0!>o?+! >o?&! >o $! ?  la_rt=%p la_hold=%p, la_asked=0x%lx 㿘 >o "h ? rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p (%s)(NULL) ifa=%p genmask= gwroute=%p llinfo=%p 㿘>o>Ӑ" t>o \" 4> 8>o>ɐ#] >o>Đ#X >o>#S 0 @>o># @`">o>o#(>` D>#0 D>o>#8 Dr >o>#H7 H x>o L>#X LRoute tree for AF_INET (not initialized) 㿘> 7!>p> x >ocpt 0>p>{  in4_cksum: offset too shortin4_cksum: bad mbuf chaincksum4: out of data 㿀  `/ `8 >p< 8>p<!@ /7 ` ' `'   @          $@ `  ( ">p?c     @"   "  &, 2 4 @c4$ * @,    %                         ߘ ,      , "1 2 4 @c4$  , 2 4 ?c 4$ ,       ? * @ 2i >p=!0, ?# , 2 4 ?c 4$ *@> > O l p㿘> O p  2  &    2  8      p""" $ p&  ?㿘> O p "  2   8   p """ $ p  㿘> O p p  2   "j 8㿈> 'L'P'T'X'H  ` "   ``$`0  ` : Y 2 ` $` "& & @{d `_"0y  "@& & ```0g0d  $ 4`^ `2Mv  90S"`"`8 @2D > ( 0'' ` ``t`<`'`'`7 `2` 2@8 ? " &`@  2 &`> "#l `` ``t`<`'`'`2`0< 8 2 `$ 0 " > ( 0'' ` ``t`<`'`'``2)@8 "@@ 2`?`>s!*` €`( S&`@ G &`> "#l &` `` ``t`<`'`'`2`0 "4`<` 8 2^2Z ?@> (0`" 0` 2`<`"0`0& 0` ` 2`<```t``@@  ``"u@ 2``n&`` "`` "` d b `&` `"[ Y  "4`S<` 8 2" `*"0D?@> (0`" 0` 2`<`"0`0& 0` ` 2`<```t`#`@@  ``@ 2``&` `" `` >s!l*` € &`@(Ȑ T T \ \ T  ( ( P (㿘H /` * !   ?8 &   4`2& А?@  X& @L 2 & > "#l& H 0㿘    8 ?   4`   `@ 㿐> cl Q H /` * ! > ( 0$cl'' `4 `t`< '+  ? $   2  ` @L   @G  $  $cl ` `t`< ' ' 2 H 0H(> Op 2    2H@H /f * ' > ##0J H 0`" 4`H /f * ' > l  2 H p@ `$ $`4`$@$`$`$` `;> #, `$`  $`$` 2* *2" ""` ` ?$` $`*, $ @x4 4 ` `  $` $` /' /  @š > ``  "` >Ȁ> (0`" `,`( " `<`2`, > (0`"  `4`0 " `<`2`4 <  8  ?     * H"*  @"   *  @   :@2㿘@\   . ``:` `*`?&@ #: . in_control㿈 !@  !@ 00!@0  " H@߰ > ( 0   2 < a@"'a@"< a a@qa@2 a0a#@ a!@j !@  aa%@` a      2 < H@2 < !@2  " 1  > >u7 2a   w x@Œ x$ <> (`0` <$ @`""`$  $ "& D T d $$ $ , d4   , T, U$ $ t4 5 > ` /"`   P  "    H ``<` ` 2`<`H 2`<` ` "  ) 1 a@a@"H4a @0 a@ta@00a"@" 4  !@~a!@ 0a#@a%@0 D& H& L& P&4    T& X& \& `& d& h& l& p& ְ  T' X' \' `'$ T$ X$ \$ `  $ T$ X$ \$ `   $  㑐 T$  ㋔  4 2 $ T$ X$ \$ `@ $ 4$ h E    2  D & H& L& P& H@" 0 @V0 $ d4$ h8$ l<$ 4$ p4 "! 2@A  $ T$$ X($ \,$ ` 24`"4@/ 4 ;! 7 $ T$$ X($ \,.$ `@ ` "`&  "@ <`" @ @"`@> (" 4 @ <"@ ?$  -  invalid argument to in_lifaddr_ioctl2 >w6  !@ "!@"ɰ -0!@2İ - @" 2  2  `  2  @  "  8  !@ 4t!@"  -0!@(t - @2 @ @2 . "&  //q aj@ǒ  @0at @@ 2[   !@ P    `2 t  2  09 1!@x D Dޒ4  T Tג0@! h&&  @z @Ɣ  D D’4  T T d d a㿘@Đ㿀H /f * ' `D &`D'`H`L&`H''&`L `P&`P' a  &`D&`H&`L&`PH 00WH 0  &@`D&@ @ ?0 @ ??&`,`4``,&`h&`4 &`,`,`d`4 @ @ &`(l&`0@&`$4  `4`0`,2`(&`X2 &`8 @  &``U   @T4 8 '@ː㿘 X H> ( 0 h @h `4  "HX @2<  <2hA    $ 㿘` 2` P `4   `X`H> ( 0`h 6  h. `4  " H X 2$ <  2  <`4 ` `  ` $` 4         $  < 2 h`4 ` `   ` $`?1 /`2`> 'Ș @ "1 >`4"(`` "$`a2H"X" 8 " 0" (2  2`@ 2`4 xH /` * ! > ( 0` ` 2`<` `t  $@      $ 2   $  Z&  6{  2 @H 0R  && & 0 2<2 & O 6H 08 t & t "`t"t&  ` @// ' a1؀  ` "`  "! 6H 0  nH 0xH /` * !  ? &  `"  "`  "@ / '  a2 6H 0㿘&&   ߖ & 6 >(0 *`0 *  * 2`~0> ( 2`~> 0(@ ` *   㿘 ܒ   ^ 7@ > a> >>, $  ", , , $ 8H /e * & $ `@$ &`"` &@ 4  6 `  `* @ $@ "  4  6 `  ` * " 4  6 `  ` * @$ H 0  & ?$ `2$ Ԑ!$ `$ ԰ 㿐8>     '@"@@ > ( 0` 16  0    ` ` '`V`` ` `< 8 `6`'@(  -`ְ 1 2"-`2  0#2w İ #> `b 5 @  "  8 @  0b5 @ " ` 8R  2` 0`&0`266`  >>!aހ 29  # "X   >>!a֓- , 2 2`@9 , a@U&@$, 2`" 4)>  ܰ 10[?* 2`@46 : 4   " @,0 ܐ866, *@$@, 2`$@ 49>   10$ * 2`@ 46 ( 4  g " @0 ܐ66@S IPv6 pcb passed into in_pcbconnect㿈 8  ``@g `!"` >{1@# " [  " V / I> ( 0" 0  ? H2  0  4`" 0X&  0 2 0 8R` @ @ 2  0쀢 . 1'* `'`'  @v 6 " 0 0 2  6 2 `s 12`  1$ 0 $   @4 4㿘 8 `>;!x!x` & `& `& & & @6 4 8 `@㿘 8 "` " @| @ " `Q `!@q 0@ H /`4 * !    ` "`"  "@ "   ` "`"  "@ " @W " @W Ā " @W Ȁ " @W ̀ " @W Ѐ @WH 0H /e  "@* & ` "` "  @ "`"`   @ "`H 0 㿘`  @ B&`  , , 64  0$ 㿘 8  @2`@Β0   @ (&`  , , 44  $ 㿘` /\``+'./ 2 2` `!2  2  8 "  42  62   0 ` @2 `㿘` `` `!2  2  8   뀤` @`& @@  4 D'`0'` '`4 `4  ``  R`00%㿘 @ & @㿘 @ .2  6/ 2 @2 `v  `!"  $ 2 ( 2  , 2 0   $   $  $  $@_  2{   2  2   2  "    2@  2 @  2@ @  `   `  ` = @(  2D  42@ 3` 2/`` 2+`` 2'`` !  `!2,    2$  42   0" 0  0 2 `````"  @6 ` 2U 6㿘 @ 7 @@ ג  8 `#2,             . .  &  &  &  ה&    . .  ׈& 㿘@ ` @28 8 9?"8&@2@@   @ 2@  .`.` ^&`` @ x @` `@ 4`"`D 2  B4  2 4 B 4 > ( 0 2  1֐ &@< 8 2 D" D> ( 0  2 <  D 1'  DH(  `!"14 46    @("   @(  46  (" 46   ()" 6   @("   @( 4 6  ("4 6  ("H in_pcbhashlookup: faddr=%08x fport=%d laddr=%08x lport=%d 㿘@.6/  7 @  *  1 `!2( 2$ 42  62 0 2@ `"  "` "@ &@" #@&  2 `  >!` (+ >"Ȓ2.3 in6_pcblookup_connect: faddr= fport=%d laddr= lport=%d 㿘` @. 6/  7   *  6 `!- @0  2( 42$ 62  $@!  2 `"  "` " &" $&  2 ` >!`>.P H,`>2`.K h,> .F2`internetdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘>!4 9>"a8icmp_erroricmp len㿘 ` * > 7b "b?@ 2% `!  @*            > 7b` "`  #  @  8   @ @*  8  (8' w^  0 - H /f * ' >  #h $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8   x h  $  ܐ"   ?@$ `( >+"> 7" .` ``" *"` "*  `2 *2* "* >2*z   2    $?쀢 : >+ʐ" ? $ $ $  @$ ?*@  #?*  2* 2 "  " @w㿈'L'P'T'X'H ` $> 7b` a"`@8 @ :  z\ 2 > 7}b "@& & @kh > 7b` @"`  "@& & (3> 7"*  `" `(( > *` €n> |. €   _b Zb Ub   ' `#b  *`@`<  8 "<b  )2 >䀧`C0@6b` "` `*``0yߒ@ 2 b` "` * > !<#  > !@ >*` *  *   0b` "`>!$`2N/  # bG/>!$` `  # b`Đ "`Ā`e @/' 1' >! `` $Zb>> L" aL"   `s?L n /h'  2    4 2X " X&    b6 `"* `@# 0K  j >!0`?b`#( `  `*` @`8 b` )"`>!\#  >aL"`> !<"  ' 9쀢 >!4`>!8> ؈b쀢 !<!<t @0v" ` ` `H L ` `  ` ` 4  ` ` ` 8 ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` `x   ` *`o' 2   ?  " uА> ( % `0 > H@L `4  L H@ L  4`" < X@2 <L  "  ` > 2& Hؐ@Β ܐ * /"ҩ؀`2 `t> (`L`T y"`T9   H`D "`t`8 ?"`8 H % ``- @ Ѥ    t   $ "@8`  D 2  ْ  $ $ $    (  `@ހ   4     *@   $  "5 @* @%  "`&  "&    |6 @ tÐ㿘   , "@& & 4`@h"@4`  "@& &    @  㿐@^T@ da* &. . @#㿘`E ?`?>"*` €>! > !$>!(>!0 3>˜a45>8  a4`t  &8a$a4 7&8 *4㿐Ѯ  "3  4 $> 0   T " P"P T"T X"X \"\ `"` d"d h"h l"l p"p t"t>!>`ֲ  㿘> !< < %PT  `   * $ >䠒`@ <>!| P a|*@( !' @ <   "PT "T icmp_mtudisc_timeout: bad route to timeout㿈 2 4>( Ȑ  2# P   ' ''  ' 0> aF>* *  *    0 "& T㿘>!(>> # Ja,`?icmp_redirect_timeout: bad route to timeout㿘 2 4>'!      ҃ 0 㿘.`  .2 .   ,,`6 2 @ 6 , 4 @ 6` ,`6 㿘!%?'> O)!$@  #c4  > O> O2z2`x > O 2`|$` 2 !> O 4 ! > O2`~ 5> O7>3> O1> %->4   @ *  `#$@ ݒc4 $` >"` ,,`2   , @ ˑ4*  2` , 2  @ ` ,2`z  @ "` ? 6&`56ᘁ㿘>!a/  > %> Ob!> O|!> O $  a 2 @/@ $ i -> O> O> O ~``) xߐ@ V!?4 x`> Oa> O |x@ &5a> O`z>ᚔ . 6 diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK%d.%d.%d.%d㿐>'1> O bh(Gipqeplip_initaeshmac-sha1deflatex"K7"""#g""7777> >b77777"7#\   C   oڔ  >>&l"#@ *"@ *`" *  *  * " * "> a@: > 7> (`*@@ 6*@>   @/>!+ +`" " **"@ " *` * @  *`*  @ *`* " "@ *`* " #@ > @@``2 `4S```:* `4@ #8> c>" "` 0 0" >a >Ӡa>"a> "@* @   +``2`*` (  #  +``2  > #0 +``2`*` +` +   >> b @">> bȔ @#> > b@ ipintr no HDR㿘!>H /f * ' > Ȁ` ` """`?"H 0 ` ` %"(@ 0ց㿈> ( 0`q'D> ( L`" L   LtR  'D  `$ D<  @ L`X P"`X2 <L` G"`  t. 'DL` ;"`   "   D  4`DL`p %"`p` 2 ?  L t `" " t @e  L`  "`"` L`t "`t @DL` "` L` "`$ D 2"@ "  "s D 0hD D> `0 *    >䀤""@=D  D@' "   4`2k  < 8 . `0D     <  @2< t`@  ` ``@ 2``2: lL42>!Ѐ`bD z H o *@ f  ( @>  D#\ @Me H p@ ;LD@: 0U ?@D`   s6 'DL`  C"`  H /f * ' > c   H 0  > 7 %cH 0 > 7!8    2  @2   @2  @"  2   "2 4 *` `" L`` "``H /f4%c* '%cH 0 0  * 4 *  f L%>`>`  $`@`d $`dH /f4%c* '%cH 0 0> " `d $`dH /f4%c* '%cH 0 0 `$*D" @" 'DH /f4%c* '%cH 0 0|`@ $`@` * @H /f4%c* '%cH 0   "4  ΐ < ` l9 7 )5 3 1D yg H o *@ f  ( @=  D#\ @L- H p@  LL(D`o$"(0L4>  "4 a@ @ >* *  *  D  0o D> (0=H"8  4 40 ", >耠`"!<`2<4"<X`8 `0`(2 <`  `2`2H 㿘`  ` *`  " & -&   ޒ  > (> 7a8a8 &@" "a8&` <.` ` .` `6` &`   &` r&`3 `2q` i`` ` `  `@` ``  (`````  " ` > ( p`2`"2`4``  +`)>->  @ "@ "@n?` @``"``@"C"?` %"`  4`2 @` $` " &` `  $ $@" %@$`  `  `` `@` `  p `? @c *   > (Lh`@b"h^ ` !> pM&@">b?`"b  "?$"p52 5``%` `%`@`"``"``@"@߈  @ * @& @  *  "@&   @& L`m"> ">b ?"b㿘 "'> %>m ` "` "? $`"  "` "@6 㿘H /` * ! H /f * ' > c   H 0  > 7 $㨑H 0 > 7!8> ( L ? *`  `$` 2 H /f4$㨐* '$㨑H 0 H 0㿘H /f * ' > c   H 0    $H 0   "> 7a8  > ( L `!8`P$`!8 2`H /f4$* '$H 0 㿘 2#> 7L `/"a8>"*` > : @?> (attempted source route from %s to %s h   * ?   `>"7>䀤`  ? ` @ $`Dw ``Q`ά%`2ʬ%>!؀`"    $4Ȑ />䀤`% ?  '@#%ɔ `2 4ސ  5@'Ԕ H%   < , 8 @ @ ?  ? v  4|  H`@'Ԕ H   _,耢$逢` 2   *` ? {'E% А?c   "   ($g $c   ^" 4  #HE   M: 4  /'̒ ̒*  /% ``  >!Ѐ`@p 6 4 'Ԥ@r !>"h'   ?  ?  $   *"@ 5  ٘ > (`L`P  "`P㿘>  ?` #> ` #> `8 ?"`8> "   , $ ,S``   D > save_rte: olen %d 㿘>! `@> 0 `+ !> O 2 >"b$?㿈   //'7/ 2 8L Ȳ 4 ?$ 8 4 $$2: 8 0 `> '3 8Ȟ4 #Ȁ`"+ 8` "#` 0  @2     `@ 2   8 ?$ 8 y  2``2`  8 ΐ?$ 8 ip_srcroute: nhops %d mlen %d hops %x %x %x 㿘!>"  i  "H >!+ `& >"    "> O`* !  "@ > "@?  *`*` `   @   %>!쀢 "@P@$@ > O! `$>"Xؒ 㿘  @` * ǔ"   "`&  "& @* @@ $@forward: src %x dst %x ttl %x redirect (%d) to %x 㾰>! `   >`  (` ` ! > (`' 2 `> (L(`j"(0Ā`  , Ǭ> >  ,` -> `@    8 ?$ 8> "   ,,`$     E 0` D4 j|  " @ @ `l*` @ @2> 4 0.>  (>!Ԁ`$`#> > D!4` 0 > 4 "` 0    > H >!`  !#\  @ > ( L(` "(> (`L$  #"$, ",(A > * €      T` @'\ `L`L "`L iG0??????????????????????????????????????????????????????????????????㿘` ?`> *` €>Ř!>!>!܀ > 7"` >!>!!>ؘ!!` !>! >Ua$! !>! | !w $!!>!>a!Z 0>m!>g!>a!>[!>U">O!>I!>C!>=!>7!>1!>+!>%!>!>!>!> "> #>!8 >    -AHA`AxDAABBBBCC DDXC8CPChCCCCCCDD(D@ABlD|ip_output: IPv6 pcb is passedip_output no HDRip_output: tag of length %d (should be %d'X'p'H'L'P'T't 'x   `!t>ѐ! t `>ɐ!@ @||'ttp`  <* @ &6=  `* *` > (6&L8  "8F "$ *  W @ 4 "8@" 8 ?"8$  p  ,,$p "/ 2 0# @> (  . 2g`2`t> ( L T1 A "`t4`D `@0< 8 H& H /e * & t qA t `$" >!X* $ @5 ( t?'xtq `#\ x @D tH 0x ?V "'xtH 0J ĝ c$qDa  t `@  a@ t @  tq+ 2 G `'laH 0t  @" @ ^ t? c " < 8 p`2V2@Β 4 "8@" 8 ?"8$  p  ,,$p "/ 2 /9 V> (  . 2}`2`t> ( L TG A "`t4`D `@0 2H& < 8  tR !"t` 2  `.@ 2t .t  T`4@ " `4 2  2  > ( L T 3`" T'x  > (0`" 0` 2`<`H& 0` ` 2`<``t*`  !` 2`t ` "  @ t@ t? c " t@e t`4 $t02t'嶒 "t`4 p 1'x` 2 'x`<@at`!` >2`p$  "  P   6 H /e * & > c $t   A'xH 0gtt 2  H 0<l@3Ӓ   A'xH 0Jt@@  >!`R@Ota KG> %""a:` 8 2>ta t9 /$ H 02`"'`4 `'  /'/''' €"`T` (`8 Ӑ?"`8$ (t  <2t@R~ 'xH 0xt o  t`|  @@ dtm A  @``| `,  @w t? c "  `| `,   @d t` ?"`  $+t  At'xty `<@ 3* `| "6 `, 2 6  > ( " `L`x "`xt@X6 t`  @`> 8`ha, "a,> Òc`0 "`0`t'x@@ ('x4   P > (`<T 8"T> (`L`L 7"`L" ? '| (/'x  @ |@ t? c " | t`> > ( l`LH /f * ' > ##p 'tH 0t`% 2`H /f * '   5 H p@ t "t"`t $" t2t" t"` t  %@> t#, "t`$$ $  $ $ t` #@2@b ?  `**` $t&" ?Ȑ*:`@4  @ 4 | "@'|  4 ~@4 |d^ t"@t@ D|"`t"``| "4 `, 2 4 t `" `x'`xt@W4 `H '`H| P't$ f t" t` 66`|`"6 `, 26 t> ( L`" x "x> ( L < 7`" < 'x Hxt@WN6 `'tt`"`x  `t'xc=t 'tx > (`L`D "`D"xp```8 ̐?2"`8x ( >!`t@Rc߶㿘 ?` c @ ` 2$    $ " :a H /f * ' > ##1 H 0" 0H /f * ' > l  2 H p@ $  0   :>    `       &  6     ?`& & , &   &   @& &  & t   & 4 malformed IPv4 option passed to ip_optcopy㿘  * ?쀤'`  $)> ,@` 8 g#  `#Д@$ 〦 " ,@  `㿐> 􀦠"@ `   `  2`>#d*` €`@Ԓ`" ` 2 ``>#P*` €.`e.`l`` &`` ?&```` &`` ?&```` &`` ?&```@`" ` 2 `"``"`` " ``  ?&`` ?ߐ &`` ? &```" ` 2 `8 ` H /` * ! ```"`"``"H ` H /` * ! ```"`"``"H >0= ,08>!􀦀 63.`2ۼ 2, *.`! 6&.`2ۯ 2 .`>! 6.`2ۡ 2 .`>" 6 .`2ۓ ".` `@;`<*@ * &` -` =  cS 22` "`  ݀` ׀`` "&`@"ܓ*` € _ '` "$`  $` ``` ^ ' `>$` >"ȓ*` €6`e4`l``1 ``2 ``2 *`@2[ ^ے ' $` ``  2   $` " ` `"`````6" ^ ' `$` >"*` €`7` 7`7`7``Ѐ 2T `2@`  @ $`  `3T  *ff f,f8fDfLddee edlfddddddle(e(e(e(e(fffffe@exexexeeeeeeex\\\]]8\d(\\\\\d(]\]\]\]\]\d(d(d(d(d(]t]]]`l`l`l`d`l`d]㿘 `^`&`  `U ^Q La`   F `&`  `@T `$4`  "0`   `- )'``2$@` ?&` ,`} `$@` ֐ ` ,& ^ 㿀@   X 5ι &@ ,$,4?`>!*` €"  2 > ($ 0`  `H2`<`2`  T4@"װ 1$"Ұ  2ΰ  ,"ǰ  2ð  8 ,"  2 <8 @@ 2   /' *" " 1 @> ( 0`  `H 2`<`2` p T4@l @` @`@  ,` @2`@2`@ `f 0b ;d,` "@ Y 7 U4"R  2N <8 @@ "D   > ( 0`  `H 2`<`2` "0 1 @ ,` @2` 2`@ ,` 1 ު`@ ,` `$?@  ?4 -  @@@@Ϛ 5&@ij`jjl`㿘 \   &0  # -0+ ``"` @`> ( 0`""` 2`<`""`H"" `` "` ` ``"` `*  -㿘     , @ =  , C 5㿘沐 ^'  ` 4 `@Q]*`4 L 㿐  @ +   " a * ` 7 `  <c7 `   0 , 2      o0 2@ 㿘> 6# 㿘> 6 >#  bx#"`D `!2< m`"0 @240`"  @2, ` @2$沔 ]  Lbxt1 \ 8s3ࠀ  82`Lbxt \Ð0 sࠀ  0     # > (\> ( L 0 4" 4" 0㿈 'P'T'X 'H'L ` ` J`  ?`#@I ``" 8`  $"   ?ܐ"   ?"    ?`& &  \  "    "   &   .`6` m.`  6` 0.`&` /&` ?#$ \C- (@@  "`  `@ 2 <@6`\,  > (6`> (`L`\ "`\  ; @㿘`  C  ?[쀢" 5k3d1 0' `" ` 8`  ` `  ?$ ` [\ Zː ' "  `  "@  - [ rip_attachrip_detachrip_usrreq㿘``  ן ``2 `.`>  € "`>!耊 > >"r x> 6cܰ q`n, m` "i 9pΐ >!Ő_ > '#Ȁ`"U 1? 8O 1 "K$ 0#Ɛ "F 1C$ 0 = > '#Ȁ`2 6 1? (/ /pM$ +qJ'`   8 2 9    -  >#"[vw w0xdwxdvxxdxwxx\xdxdxlxxd㿘> > ē* "@*`@*`"@ *`@ d""$@4 4 $  t]!XT t@ !XT  4O <!4 p 4@ <4 p $ $ $  $ $ $ $ $$ ( $ ,$$ 0@ (4 p㿘 x` 8!> "  > 8h`Z"ܰ  +> 8 ``"     `" $)`h``` " `$!`@` #`` ; BZc;`o0\"&`@&``h`#``Ȓ ; B;`ZI `"  "` "@L "$  ` " $$ 6 " "2 \ $ 6` $ $" & $ $" $$V d $N  "J     h ->  L `&   ` `  $`  "@ x`"  ``!"  `@  @   " Y p``   ͔ p   㿘H /e  > @  0>* & > ## .`2   '<` @"  R`d 2 6@ "c2<cc<`@" R`d  2 8 `h`| 'L "`|'P'T'X'H  2`'''7''`'̀`     `'0 ``0`(( Y$0 `  \   ") b    " '@;5  2 ?߀ @ h!( `"  ;"!(@L* `<5$& ha( <"a( "'`2  2 ?#@  2  2  ?#@        @ ( h` "` @ 2 * `Ԁ@"h` "``;' @ : \&  h` "` "     '` '$ J 2 `@B @2  2   ''''  `> #@ > '#'іآ`2$`<ha   "a `> #  > #   2`<ha "a>Vd ad '@*@''`8  &  7 2!>   @ < > b"b"" " """" " $"$ mN 2 &mE ` U `< 2 * * @$ `` '$ `` "`` "`$ `` "``Ā "`$ `` "``Ȁ "`$ `` "``̀ "`$ `` "``Ѐ "``$ `` "``` a`` !$`` k,`kd$`d 4`6 $`$$`( $`,$$`0$`0$`n`< 6d`P@ a H o *@ f  ( @%  #\И @4D`: -@1 ` 2 `! "`$`!` "``Ȁ 2 `!| "`$`!|` "``Ѐ ! $`!`  "````"`"``"@$`H 0Ѐ G>  DVd &$>!P> 2`@:`4 @ "Vd  Ē #\@R 2 Vd&Ԓ@&Vd 2P 7 2 P̀D@,PĀ2P @2P@2P L" `D&H&DԀy"@ $P"@ 4P@*PVj 2Ph!̒` "!`DĒ"@ @ `(" ," `D@ "@ h" `` >`B ;`#`x` t``!" `@  @ to'&VK&@0 2>!P2`@Vh9:`9 lt @2gP 2cPLP"@XT" 4 4WP  h܀ " @h  Ė & ;`B 8 x` ``! `@  @ Xv@Lll5ࠀ  p >"` 6p>  l6pɐ|pP@'L"XT"@@ 4 `& Ē"@@ & Vd &    ݀  `ր@2   2 @쵔   @  #       0< 8 ' X؀  TN   G g  $ **<" " ""2`d* "`$'`('`,'`0'`$ `( `, `0  $`$$`( $`,$$`0@ɒ /$`$$`($`,T$`0W``!  $ ** " @72`0`$`0׵ $`0T7T@? &t@% 7)' Ē #\@R  p" & 2&@&>!P>2`@pb :`&&6p6d&&&&&&Ē춐4h` y"` `ha "a"  "  ̔  "@  "@  @ =  &&쭐p &`&&6p"  & ) " "h`i]"p  ` `6dCB.@.A  (`D@y"@ l & 6d &@"@V h`ؒ < `ДB;`ؘ '#`и? ?&&̀ ! 2 D`Ȁ <`DH" 4&DԚh :`` aB #a#`;`" <` &`?6?ߠ?Ԁhp6pԸ?`` < B #` ;``` < B ;`#`'@&Ԑ"'"6?6 Vd  " @h`" @ " ?h Ԑ  ,# В : ؖ B ; Vd 2Đ"  }@@' a Ā@\ ph 6p`" ؒ < B; ؐU Ը?"'̀ D@ L"  `D&H&D  L@d?* : `>"*` € = 6486dh `" @^ 6# p  [Vd h `h"p  ` `6dCB.@.A  P&" 4rԀ  2|6j@ah` $``\>j * :`@ H6j  l2 @Ē@6j(  & &&(```B <``@ːVjl@&&(l&&``B@<``Vjl@$ &&l@ @&Ȁ6j >Vj" '@r  'l &Vj" @ 2Vj&@S :6j@L&6jVjb@&6j" h` 1"`h"   ̑>`B`;  # `DĒ"@ @n`(" ," `D@_"@ @20X ' 2>!P2`@Vh:`l @bVj  @?# * 8 &"tx`" t``!" t`@  @ t@  t" &tj  j"&  h &&Vd "$   0E/ 50@ >  f>!P> (2`@ :`預L )6d' 6d@ސ>!P2 :*"@ L鎓*`fؐ @ >!P2 :*"@ Lx*`] 4 @ @ , Ԁ & @! Ԁ @ ha "a&&&8@8&8 ' ":"6Vd 42L>b (6-?Ȕ@ " $&L"  ? $H @4e0< ?.<ր@!@Ȑ"@ 4&Ԁ 2Vd oVd kĀ@S OLp  >"`  6p>  l6pՐ|ԄhĔ & ;`  B 8 ` x`" ``!" `@  @s S;Lgifࠀट S)p`6p  @ P? "AVd <  fpĐ `6p&Vd "    ( >"6d6d 6d@>!P2 :*"@ LW*`e !P2 :*"@ LJ*` "T `?  > ē* ԓ:`@ 2  > *ԓ:`∐ &  p @30 UPp`@(6p0v>">> "煒b C @  # ;     1 0< 8 *' א؀ #    @   Ԑ 'Ԕ   @ К `0[0,"x 8`T  > ē*ԓ:`@  0 > * ԓ:`∐  O`[X,4444㿐\V7`P> *` € 2I@ D`~ @@ 2=@ 8  p @6 p`@8/.!C 2-@ '`~۔ `~ה  >  p!6 pD@&!H&!D 2@ 2@ " @ p"6 p@@&$ @`` $  ` $  @`@)0$$p" X ܘ  #?䀢 ''`` Đ" 4""`"" ܘ  ܐ"  & @ΐ  Ā   & &  6 Ė "" ܖ  Ԁ n   Ѐ'$'  `䀢 `" 4 ܀" " "`䀢 $ < "`"`  ܘ `''?+ ܀  䀢 ''`"?"`"?  $& ܖĔ  "" ܖ耢 4 ܐ &  ܘ?  + ??""쀣 & & tcp_sack_option㿐 2  "   &  l >?#} } "  " `"@  ـ!" Ԁ `" > #\X & `$ $ $ $ & &   l@">b 8 $ $ " )>'>   ,   $  l2" "   $ߐ\ِ\&  S? @ $ $ @  $   $  $  l" @" :$ 32 " -\ )  $`$@ $` $` @*$`  $   $  $  l@v" " :$ $   & "  @&> #\  $@$` l@O">b 8 $` $`@$`$` $  & &  㿘 (V d $ `&@   #> `"& `" 4 @`.c\ ?& <& ` &@&` &  " ܆   㿘` @< < &!(` !"@" l  l&! tcp_pulloutofband㿘` > 8  &@>!H < < `*<*= " |J ?& > 8h 0* `(:` * 20 20(& 2(8"@(  22 22((2022*84"(2f0*`R2(8882h2h  2h2>㿐>"x Đ TT` @`N` (   T 28"`C``4 20`<` >!`2(`< ( "!`<  2`<  2`< ?#@2`< { >!`2 `<Ǚ' `<"?쀦 ``<"? * `44"" 8 @*pb  ` 4 ?2$l 6 4l@}$4l 㿘 x l< 8 ~V!0 2>dl ":dP @a @ێ* 2``6!4 ` 6!4=`$@6!0p "*`z@丒`H6!22 :  : 6!2!0V!2* :  : !4 6 h6 h 6 hd "x:?$`@䐐}>b 8 b#t` "P?@|}>b 8 bL``"hP@h ,` * &!㿘``@  ``a$a(`$````l" @ @n$a`& `$a$`` ``l"@ a"@ " $a` ` >  &    < `  2   `  ؔ``  ` " ``<" tcp_output: options too longtcphdr too bigtcp_outputtcp_output: template len != hdrlen - optlenP! ' x 8 `? '  '>  D!$V h"@@ *  l&!   !@<    ! "@ >V d " @ 2N n>"V j@ &N nh "N n   "  l "@    !" &!N n ' `t* ?  6 f` `t  "6 l  Ⱀ  6 f 0 & @H l   '`t ?`P`L "@`X`T" 4   q  p :i!TN n 2e!T!82` `2^!T !@ X`2W!T?!A#* 4!( Đ" " 6F!T*  6B!T p2>!T 2;!T  " 45!T "0!T ",!T!"    0 >!P 2`@V h{:`ð "   2  0 2 @6 f !T       ( . < . ( 6 p `1&   //ѐG 7Ɛƒy;   Ȑ 2  p @A p"@A 'Ԫ  p   @"  p!B@c "Ъ` p ` 2 2  a" > D!D@B` " " "`  9>  ?#> #V d <`( p ""7`( ܀2 $"Б2 @   ` 6*䀢 ''̀`"  #̘ #  ܚ`@&*@Aa  `((! >A " ' ?#,(>1!" pN n  2  > 8 h`l "`l !@ > 8h`X`P <B ;`X #`Ph`H`D <B ;`H#`DH /f * ' c; H 0`" 4`H /f * ' > l  2 H p@ `$ $`4`$@$`$`$` `#,H /f * ' >   $`$H 0`$ (` $`4`$`0$`($`,$`<$`8` `H `#,(`"@"@ $`$` `I=  $@H7 7'`J` $` `t " $` > 8 h`h "`h > 8h`x "`x  " > 8 h`p "`p> 8h`t "`tH /f * ' c H 0`" 4`H /f * ' > l  2 H p@ `$ $`4`$@$`$`$` `-H /f * ' >  T $`$H 0`$ (` $`4`$`0$`($`,$`<$`8` `G `#, 7n'`$`  $`$` t`2` >!(&"`>!8wS` t   `  ? p   !@& 2  2  0 "! ` $2' $ &  Ā`$Вw! `2`<**` $ , `P2 ? l& ?!A#* 4! Ē"@ & 2 = 4  "@` @ 8 4 ,  & !T "`   $N n N n`  @$` * 2 ?c 8"  4ؖ $` @ (4N n   0 2k  & "    p `& 6 p   `"! 2 !@"@ & !(  &!>  D> 8 h&!(&!, "  ` 2:` !@>!P 2`@V hx:` 0 " * 6 f  2 `  @>!P 2`@V hxޓ:`ސ 0 " ` 6 f!@"@ 4&!`  V d` Ś$`!T "`  95`>`2 x `l* x `e* x`@` ` ` ޽ '` ?ؑ* `2 2 , , ,  x@V ,  x` @  @ ''> 8 7 x@ I ( x@ђ A A 22  pV d 56!> p >  l^ |- h@ "@ p`  " $  p !@"@ 4&! p? Đ &!L6 p 6 pr |" ?a' tcp_output REXMT㿘!0V!2* :   : ># X!4&V f>"ȕ* x  x 4 x>!P  2`@ w:`V f  f`6 ftcpcbplsackhlpltcp_init㿐> >#\ a8!X  ﶘ > >  a@#\#\ ﬒ >"> Ð#km> 5㐑2 > ;"`D <"> c, < (>>Ɛ!P@g"@㿘t Px D  2T "   >  #,> #,  (& > #, `( `-& H /f * ' >  Ȓ & $H 0 $ (  & 6 & 0& (& ,& <& 8  2TEf T  "' N6  @օ  4 , 0?$ * 2  2  2* 2` * $ 2 2 # `" *4`<$$ ( $ , $ 0$  $ $ $  $ $d*  3 3 3 ,, , , , , @, ,   (4`6` 4@* <*@4 $` 4`4`$`$`,` 4`㿈   x`8 T P L X" " 4 !T  `? `@@< `? D  > #, &tK <tF (+ D&& <& ``(`'` '`$'`'&`` &``&``&` &`$&` &` &` (& ``` &` &` 44  <`( 4`  (`& && * <*@ $ $ $  , !A<?#44 64  ` ,@,`,`,`,`   x@4 ؓ*`2`2`,`,`,`4  ` `*@  @ (4  ` `*` * 2 2 ,`,` x    @š 0@o 4` 4 @854 >4` !>,` `  $ x I 㿘>  i P @G!X&>">6 l |aP6! >   ,``` >" >䀠 "`?&  >" *`: *`6 p6!2& x6!06!46 h6 h 6 h&!&!`!  &!T`!> !3,k> !,l$<㿘 xV d  `86 dې> 8`h`  "` > 8`h` "``<V!> 2@4 8㿘 x !T8 @ "x ` 2 ` 2 ` 2 ` " x   "x   @ x * !@@ ` ^\ P @ V!0*"@ *`" *  l * ` 2 $ l$ l P  V!2*"@ *`" *  p * ` 2 $ p$ p P 2  d!`" d h 2 l d2 @ l* 2 2 @@,`( !T  `<`(u) h  2 $ h$ h@.@e p`?# @6 pN | `"  t#> `c\ 2` t "> B>   XJ$<F> 8`h` "` 㿘@  %> `"  "` "@B @  ?  *!B !B *!B* * !B㿘 R`f $2a>Ra> "2a>4 8ӊ 6X L   X tassumption failed in tcp6_ctlinputx`>`k!@ g e ?>!耢 >}#0  > ! `N>; "  6 `@ <@Ӆ D  > #`)   Қ   @0#`#@}#\0 > #`##\ @} 㿈`>`P! M>"$.   >/!? >}(#0  >!`>  `*`  # Ɗ  >͜> "  ># 0 >  `*`'  ##\0#  <l pؐ@  > b   > >;//'#`'''##\  @}l 㿘 < `" `4 2 `Tݐ  `T  ? $ 㿘 <ʐ    4 ?> ਖ     `(((2 *`0㿘>  h >   > %b  ?`  @ > > "#`3 2㿘> #a/  > %> b`##*``6#2 f> `? * .  (㿘> a 2>  @"a> c 2>  "c> c !>  @"c l >aP@Х $ l㿘H /` * !  p`6 pH p@H(> > D> (* "` "DH 㿘  ? 㿘 " & #>  c\ & 㿈H /` * !  f`*`:  6 f > 86 f`h`$ "`$V!>  < 0> 8`h`( "`(!0V!2* : !4 :  * V f>"ȕ* rd !4* :`@ 6 h6 h`$>Ȑ 6 h>!P 2`@V hrO:`O>!`"=V f x"9V fV d 5V f 3 8 t`"-V fŅ " !T 4 "!T P 2 V f!T` @P  // ˍ' " V f P  $ Pě V f $  q x!0!2* : @6!26!0 &!(& ! & ! 8  l2 @ ( q&!&!6 jH 0㿘H /` * ! > 8`h`, $`,!0V!2* : !4 :  * V f > >  D!$㴠" >"q  `0`$`0 <0 . n. nH 0㿘H /` * ! > 8`h`4 #`4V dC  x 8`+*>> (  > D> !$ "@ @.h`8`#`8 t   ? j 4>!P> 2`@q]:`]0 >!P> 2`@qQ:`Q 4H 00h<`"<w ( >  D!$"@ @ >!P> 2`@q:` L0eH 0diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘@tcp_usrreq㿐 `    @@   >  0H /`4* !  ` H 0` ` >     € a 8@@ ]  " T 2 x4O < `!@wGC 6   `!@w   2  /4 d ` C ` ` 2  2  "  "  2 6 2 6?#@2 6 `< @8 `'   6  @wD  @x*) `< 8 ' 2ְ `' ΰ  6  | ŀ   . $ t  7 P4Rא>!P> 8h> "h2`"@  4 doœ:`Ő 4$ $ $ $!$ %$  -@ `!|0~  S@ |0  v r tTUiŒ 5dx&@H 0m H 2 @"R !2N  !<  H  D #&  !=>*@ !< :,!<tx"@|" 4 t=Q* 7Tt  , n $ a, n `!@y "  `!@z & >3!      H 0,,\<,PT$$㿘 H /`4`* !`  H 0 6 <\ <`  @` ` / @+ ڐH 00ySo!C **? *"<  (8 `" p p /4 p?# @*4 p"(  (# `$  l@4 4 l"  8T d  4   p$" `"$ $ #`P  > >>#R !> cW ` 2 2`d` ? p4`` 7 4` `!  "aT 㿘 xV d` 8d   T  8  Q6T L@   㿘V d`>!*` €<6 d  6 d V d  xQ$`8V d  >!P> (2`@ :`mɠ Lɐhhh||h 2 2 2 @"  ii" 2y  2s  @x  В @n  _ Z H /` * !   `!> #W!> '`#'`Ȕ> 8`ha   "a`# #``   8  ?'8`'?''H 0"&@h"㿘`b ?` \>!*` €>M">G">A">;"> 5!> /#, -> " @$>#>#>">" * <`xdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘># >  㿘@@! > #'L`'P'T'X"#'H 2  '  0  /  / `   `@= ` "`"    `2 ` "` "  8$` s"`<Ȑ ''' ''+  2  2 ?#@T      ?#@F @d* `67 ` 9"`/` * 2 ?! ``("`(9"`0,@   6 @-* `7 `9"0& `( "`(`  "` 0/@  //7  @'// 7'@  //7 @ے @֐// 7 @ϒ  < 8  > А'z  ʀ>   @  ``!2`6``!2``6 @2`"`0`$ `$`(  `$`, `$`0 `$@Є  `@2f`"` ` ``  `` `` `@e  ` ` @2G``4@2B``8沔 9Ֆ  0 '``@@;`LPT 9 8`   "` OM`  '`8` " `` @j`` "` '``@@;^`LP O`  !>     ' ' ,`?`$  "`$       ( ' "  c` "  @Y 0& & & &  &7 0 B| H o *@ f  ( @  #\ @A`?`8 `: -@ ` 2 `! "`$`!` "``Ȁ 2 `!| "`$`!|` "``Ѐ ! $`!`  "````"`"``"@$`H 0 6 '``@@˖ `` 7  @) ':r`8 LO' `8N, L`8   0 `  "` 7ǐ 7㿘 6    g4 `& $ $$  㿘 82 8 8M L 8    8M t8>"T`Ѩ ` @ ɀ ǐ? >}#0    >! ` @` '`'`  '` '` '`''@3  "`  @y   // ''' ' @O'  `@'`'`'` '`'` ''@ ]`P@ W@E  9F@<   //``'` '`'`'@' @Ӗ 1 %> Ζ   w   @#\#`@r0 > >;#\#`  @r 㿈>`2"T` .@ * (>"$. ?򀢠 >}#0 `0 >  `*` '  #\0  Ԗ IPv6 inpcb to udp_outputx ` 'X'T'H'L'P  >~"? #@  (    0 8H /` * !   " H 00 2  9``' 8# `  $"    ܐ"   "    & &  6f  S 7     & J 7  @7  .` 6`  0>&`  &` 66` 4 6`6` /  & ` 2`*`2`@ + 2@ 3 2 @ @*`22`?#@ @8"@6`6`6` l> .` e.`,`", 8 @  0 #\$ 0$ `H 055㿘@udp_usrreq㿘 `   `! @x̘ 3z- ``2 `.`>Đ# €  H /` * ! > `H 0` >>#Kɐ    `!> !3. k> !. lH /`4 `* ! `! @ngÒH 0ŀ  `!")    8        H /` * ! @oH 0`  8H /` * ! H 0` I{  `!"         d 9H /` * !  `! >;!x!x` $ $`$ 0`$ ($ ,$ 0H 0  ?>6 J;  `!@;4Iߐ@H$  `!@q8 i  `!@qH m   - ->t"x 4c4^@T@|lH|P8H@@@@@@㿘H o*@ a H 0㿘`!  >    *0  *0> ##0 @ >#>#diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㾐 @R W/&  H $ H \ @N$ \ `0 `* @@ ``@2} @2`@2` `! `* @݀@ > 4"h > e  >@2a >!l` >  #'@ > "✢ Y > > ) *a d  d  '<    ""@& & &  (   ''' (H /f * ' `` @``3c$`0 & ` 2" $@`$` $`H 0 㿐>!h'L'P'T'X`'H3B0 T / 38㾈>'H !p'L'P'T`A'X@ 7 ;& H &H \@&\`  ``*`*`@ * ` 222.` .` .`.` ``*`*`@ * ` 22`2.`.`.`.`.` `*  "@20S. **@  *`@ "* " b\@ "& `"@6` "& @6` `@&ɓ*`6` (> ` #Ȑ '''( 'H /f * ' `` @``2&`0 & ` 2" &@`&` &`H 0> >d ` ` 䀠 2    4 ! 㿘`    *0 >!h>!lr㿘`    *>_!pdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKIPcompIPsec ESPIPsec AHIPv4 Simple Encapsulation㿘 l@ ` lw  l @ `;#@ i  (! l?#8@8N dL W@z&@ (BH /` * ! @;H 0 2)@]$ a>! a:!$ $,! $ $@W,!>!`> $aP ;`  $ $c< ɧ (  '@ 㿘>#`y >#` )>+>W# $##Ā #W %##cv@  @,  ?$ 2 @#ca @  @&@#cR @ cbҐ c8  @ 㰐@Gc  8  @  @  @ 㰑,`@  2@!@L 2!2㿘>#` >#` `)>1>V $c#Ā  V %#cb @   @,  ?$ 2 @#bߐ @  @& @#bА @ #bP #8  @ @Ŕ#  8  @  @  @ ,`@ @!`@28  $ 24  @!@Œ 2- !`" !` "!@ q "  !`" !x` "!x@ d " !x` ` @ X " 0   2!㿘>#` >#` `)>1>U $c#Ā  U %#cbC @   @,  ?$ 2 @#b. @  @& @#b @ #a #8  @ @#  8  @  @  @ ,`@ 0!`@2(  $ 2$  @!$@ 2 !`" !` "!@  " !``  @    2!no tdb hash table tdb cnt bucket cnt %d%c %d +X!># >!06@Ғ @># @#,`   `` 2`*` ` @ " >ɐ" )>'>%>  "(`8@`` 㿘>#` * ># $ c,`@ ``#@@       ##@c㿘 $  @ @Ő㿘 $$   ̀@@ @㿘 $  @ $ & $㿘 $$   ̀@@t  $ ;& $㿐!># K* '$# ӑ* # K  ̑* #   Kő* #`*`@#`@ *`#`@*` a>#*@o'1>/>>#`  T[>䀢 "c#Ā  TQ &#># `@ @  @-   ?$ 2 @#` @  @& @#` @ ` 㼐8  @ ,`@}c  8  @  @  @ ,` $& >>co>1>/>>#`  S>䀢 "c#Ā  S &#># `9 @  @-   ?$ 2 @#`% @  @& @#` @ _ 㼐8  @ ,`@ c  8  @  @  @ ,` $& >>co1>/>>#$`  Sw>䀢 "c#Ā  Sm &#># _ǐ @  @-   ?$ 2 @#_ @  @& @#_ @ _$ 㼐8  @ ,`@c  8  @  @  @ ,`@ $&@ >􀢀 >>c> K>c>"c8 K>c>"c2 K>"#㿐H /`4'* !'>#1>䀢`(;># K  #* #&㰒`*` K #'c`*`  K>#"`@_*`#`c@Z*`#>`@T*`>#a`a` +>9> Sa$R %cĀ  R %c_@    ,  ?$ 2 c^ @  & c^ @ #^d #8  @ @ٔ#  8  @  @  @ 㰑+ @ p k! #* * ` d ` aRB %cĀ  R9 %c^@    ,  ?$ 2 c^ @  & c^q @ #] #8  @ @f#  8  @  @  @ 㰓+   &@"  aQ %cĀ  Q %c^1    ,  ?$ 2 c^ @  & c^  @ #] #8  @ c@#  8  @  @  @ c,`  &`"  aQ{ %cĀ  Qr %c]ΐ  ,  ?$ 2 c] @  &c] @ #]* #8  @ >@#  8  @  @  @ >#,`@ &`#@ > %>! ; '! : H 􁊀㿐>#`># `!! X p +>3>!$ ( @''P %cĀ  P %c]D@    ,  ?$ 2 c]/ @  & c]  @ c\ c8  @ @c  8  @  @  @ H4㰄(㰕*   ` @2@"@ ! &Pt %cĀ  Pk %c\ǐ    ,  ?$ 2 c\ @  & c\ @ c\# c8  @ >@c  8  @  @  @ >#,`@ 2  "@ ` `2` "` !P %cĀ  O %c\V  ,  ?$ 2 c\A @  &c\2 @ c[ c8  @ >@'c  8  @  @  @ >#,`@ 2  "@ `"  `2` "`  &  @ & `"`&!"@"!2 !`"`&!"@"!2!  `"`&!"@":!2 $ {]& $! "!@&!! "!@ &!! "!@&!! "!x@&!!x "!|@&!x!| " @&!x `" ` ""`  ``""`E K> Sa ?"a H p@㿘  KC!@!&!!&!&!!&!&!!&!> %b>b#(;`?> >ʒ`&!p (;>ʒ`L @6>ʒ` X1>ʒ` p,㿘>>#c<@ .`2 @` `@*@ uniqueinvalidhalfivpfstunnelingnoreplayrandom paddingskipcryptousedtunnel@@@@@@@ @@@@SPI = %08x, Destination = %s, Sproto = %u Established %d seconds ago Source = %s, Proxy = %s MTU: %d, expires in %llu seconds Local credential type %d Remote credential type %d Local auth type %d Remote auth type %d Flags (%08x) = <none> %s,> Crypto ID: %llu xform = <%s> Encryption = <%s> Authentication = <%s> Compression = <%s> Next SA: SPI = %08x, Destination = %s, Sproto = %u Previous SA: SPI = %08x, Destination = %s, Sproto = %u %llu bytes processed by this SA Last used %llu seconds ago Last marked/unmarked %llu seconds ago Expirations: Hard expiration(1) in %llu seconds Soft expiration(1) in %llu seconds Hard expiration after %llu bytes Soft expiration after %llu bytes Hard expiration after %u flows Soft expiration after %u flows Hard expiration(2) in %llu seconds Hard expiration in %llu seconds after first use Soft expiration(2) in %llu seconds Soft expiration in %llu seconds after first use (none) 0>Ц` HWJ !>!@''' ''''@ѐ c> %b b@ 8>Дb Vap$#>(@,a0'4'8'<''''@> A`@#>D@Ha'L;>'P'T'X'''@"!>А@!᐀ bb: ᘀ 2xᜀ (xb>baᘕ:  `  @x " |>А@a| " >А@bሀ " >А@ޒb ጀ >@Ւb8>$bPϐ@$xQ >А@ǒbh->7> 9>Т  ->7>9>)>Р $@@ܲ"p `` 2?>А@ܥbxܠ@``@>ܗb "  >А@܍b "   >А@܃b "  >А@yb!>@' "''''' @' aZ !>@' #0''''' @'  a;਒p6@䀒@"b>bc:  @&b 쀒@#b>bc:  @b #@$`b>cb@C: @ @c $  b>`b@C: @ @c $ @>`@$!@>ݒ`h$ @>Ԓ`$"@>˒`$ $̀@>b>Ȓ`b@C: @ @c ؐ@aۯ$$"$̀@>b>Ȓa@b@C: @ @c А@ahۓ$'@>ۋa@ۇaHashmask: %d, policy entries: %d 㿘`"U !> O А@ &@>c(>c >#c(>#da?>#>8  Ԓ ГH p@-# (  >H / * ! +  (p 2"p2pH 0  ߰     @?    >  >  >@   `  -`` "!`` "`"`ᤐ`"` "`  `` "!`` "`"`ᬐ`"` "ᬁ%d.%d.%d.%d㿐#>cȔ`'"@ (  !> S Б* >`ڨ$ccȱ*` . (unknown address family)㿐 ``  1> '@p" !@ " "  `?2  2   2      ipsp_reffree: illegal reference count %d for object %p (len = %d, malloctype = %d) 㿘 `4  >V "8  ? & Z 㿘H o *@ a       $ # $> %:; H 0㿘H o *@ a       $*@# $> %:; H 08   )   ))20T3ː 0  &Xت  * @Ȑ` &K ( @ )?ت @3!   $-Ӕ  `@- $` &.  , , , $ $ $ $ $@ )` (&@Z? &@ H /``* !`   //'`Ȑ ̒ //'''' 2 2 $H 00   " H 00n 2 H 0"@ %`@W  `  ` K `6   $-+  =`@ $3` %,  %~, `  , , $ `2$@  , , $ $ $ $ $@ 3  %\ * @@㿘@@2  V ` @?   >#\`  &    ?&@ 4@ @   ,` 0`, `6 /& 4`,`  %   %   $  ////`'` ' `  24` @ k $  $ 0?>4` 4`,`  $֖   $і   $̖ , ///`'` '`'`'`'`'` '`$' `(  24`* @ . $ . $ 004`,}20#\&#`   A`"8`  8 ?"8 A  `?"8 2  A`>ؐ#*` € A }  "   a ?0 >;  b >; "  b @A  2 a  a  " h  d 2  l 2   p 2  t "   $   ` "`"  "@$ ` "  ?2 2&@ | 2 &'>䀢 W    2A  (< @27  | @ߒ 2-  "   !`"$  "  "   !`" | "  9 !x`" n / `"  "` "a  "$   <   -  &> %"":`<  |F $ $ ! $ !" "a&#\#` "   & |  `@z  ߐ?ǒ |Œ"M  ǀ |a$@Ea$ 2@ a@2;  "  a`"3  ".  "  a`"&  ! " $  ` "`"  "@$ $ a $ a"@'a&#\#`"> @2  $ |@ $ ":  `"  "` "a  "  < $ >#  @ ##   > %"":`<  |6  $ $ ! $ !" "a "$   . ;&  5& 0?ꀤ |  `@ "&?ꀢ 2 |  `@ #\#`&@ & \4\4\4c\,\4㿘      0    "   ` "`"  "@ !>@3  Ȁ`"  "`>"#0  "@ " n " h " b > \ > !L#?$#㿘(  `"  "`>"#8  "@  >  ` "`"  "@> #ے㿘 " @@  2@ ipsec acquirep >z cԀ  #>  "c>ٚb c#\   t c c @’ O  >٨aHy 0 , , !, P, Q   "b4 "*c4 "4 R , $ 4, T 8 "   | ' ' ' ' ' '' " ?$ ($ ( 8$ X < "   | ' ' ' ' ' 'k' "  ?$ ,$ , <$ \ />, 0 @->, ` +>䀢   ٦  4 2 B4 b 4 4 D4 d4 R , $ 4, T 8 2  < 2   @ 2  D "&  2 | 2  |  2 |  " | ' ' ' ' ' '' " />$ ( ->$ ,+>$ 0 $ 4    g X*? 6* H/>$ ( ->$ , +>$ 0  $ 4 8 $ X < $ \ @$ ` D$ d H 2  L 2   P 2  T "&  2 |  2  | 2 | $ " | ' ' ' ' ' '' "  $ 8 w$ <  h$ @$$ D* 6* ($ 8 $ < $ @ $$ D H$ h L$ l P$ p T$ t (, H X, x X P *4 J Z4 z ,4 L \4 |^ PPM̒M$ c4$ "@"$  $  "@& $ @5` >4"  22 diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘>#؀`` , 2 > cX` ! "` 0!@@! 㿐>#'H'L'P'T`'X  ,  H> X `" 0H@ 㾐> cX "cX     2    (0 00   :cX2 `  /`    *`*@ 2`/   cX`"0  2   " (     O cX` "`2   " ;   @]4  *`*  2 / @]  * *`@ *  * 22 2 ` ,,,** , *`@  * 222,,,,  "> 4 23 >#؀`-> '#Ȁ`"* ` ""`  ` 2 ` @z"  ` 2  `@%  "mcX  䀤``2`  cX" :  B; > #Ȭ > # (   '( '''H /f * '   @ `% cX  " H p@0-&   2" % > ✠  ,@ % % "✒B > > ) *a M 0 cX$`"$0 Ms H 0㿈  a 2 `/`"a0ra%  > a( Xa 2  > X,`U",& ``' 8# `  $"    ܐ"   "    & &  t  <     & < @* @ *@@ $@ >4` 4` ,`a($` a $`4`  /  ,` )`` 4`͐   )2 /,` 4` /@[x,` 2a%a 2 a%a 2a%a > a% > a, 2 a0 2 a4 2 a8 2  > X,`",& 7??  ? ? 2* * ? ? ? ? 2 ** ``' 8# `  $" ' (  ܐ" '  " '  ؐ (& &  (        (& 2  > cX` 7 "`& `,@,`,`,` >* 2 2 ,`,` ,`a$`a$`a$` a$`$a,$`a0$` a4$`a8$`   )[,`&` / ( M )2 /,` @Z/ @ `*  `*`@* ` *  2 2 2 ,`,@,` ,`> &cX`( 7 3"`(> #X``#`&a  `` `?쒂B>` `?쒂B;`a 2 `` `?ؒB>` #X ?ؒB;   "   ipe4_input(): should never be called 㿘>)"0 㿘`    *>#ذdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK8> !>#'L`'P'T'X" 'H  , 2   `V" 0 !`L$!0 } `  ! ` 2 " `4"0ـ  ؒ!` "`ؤ@S @O   2``` 0$    ///A/  <   ///0/  +! $!z !  @ :C  8    06 ` >#p@   !"6 W > 6 d -7> ᠒`؀! d`܀  d`4 A  @ܒ  d᠒@   d᠐ ,` d dٲa d!`"02>a.  *  c`& d "dH /e * & !* @[H 0 !`["㿐a%   > a   > a% `@ > `` (  `4"   CH /f * ' > ##i H 0`" 4`H /f * ' > l 2H p@ `$ $`4`$@$`$`$` `2  > `" 70v#V @4` ,$` $` 0$` `$$`  &  ?6 `> @$`$`$@$` a`#```(# ; B;`(a    ?/`<* @ *@@ $`>4  !ߒ a, , , 4 4 4 a($ a !$ ` `*@*`*`*``>* 2 2 *`*` *`a"`a"`a"` a"`$a,"`a0"` a4"`a8"` /4/ ~& 㿘`    *>w#diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKh 2> > c `, "`,c`( "`(  2> > c  !"c c "c 3>#耢` 3 l>#쀢` l2 >#`2  22> > c c`L "`L -"  2 2> > c  "c c "c 3 l`   ؐ` '̐آ@ /ـ  0 /ؐ  0/ؐ  0 22> > c c` "` .H /` * ! ̒ 2$H 0 22> > c c` "`  "H 0 2> > c `4 o"`4c`0 j"`0 2 H 0i 22> > c c` "`T  2Ȁ l> #& ̀@2/H > %; >ȕH 'ܐ '$` "bВ7@̐ '$d"bВ*p`  H 0  H 0 @> %" "a :`a>``22> > c c`  "`  z ͒ 2 `2> > c  "c c "co 7    `*`4 @ 4 4 `"'  `*` aA  aD`쀢 aA   `22> > c  )2  `*` (ؖaA aH aL  aP aT aH@  aA   `22}> > {c ~  'S ( 2 `2> > c  j"c c f"c ؓ*` 2`2`**  " ) aA  aD`쀢 aA   8`226> > 4c  )6  (`aA aH aL  aP aT aH@A  aA   `22> > c c`L "`L ) a l$  $”  a`2> > c  "c c "ct  E] a *` `' `2 7 `2`l` "` $6 `  >    (6 > #0 `''  ,'''Đ 'Ғ`302`3`l`20) 0&@ې&@m"@,`l`20 0@@ @n .㿘`    *>q#㿘`    *>^#㿘`    *>K#㿐'L'P'T'X'H   3㿘> #ȑH /f * '  @>  `""H 0' 7&  2" "> "` "" ;> > > ) *a E 0EՐ H 0 㿘 `  @  @ 3㿐'L'P'T'X'H  { 2㿘> #ȑH /f * '  @>   `""H 0' 7&  2" "> "` "" :Ԓ > > ) *a E 0Ek H 0 㿐'L'P'T'X'H  " l㿘> #ȑH /f * '  @>  `""H 0?' 7&  2" "> "` "" :{ > > ) *a E9 0E H 0 㿀 ^\>!`X<  R2!'N <@/   //'Cu H /* ! R  $  7> %H 00##> $ @?2 &H 00$!a    3 *  *  4@džp@ & > c! "cn $@% !㿐'D 'HA > #8>> a p>!D D 44> H 6  ``B >` ,> 0c\'>!Ȁ #>!`*@D0`B :0* @*`@*` DH>  8`B :D esp6_input: l went zero or negative㿐@`'0 `('  (%> ' 3 *  *  4@В@ & > c ! "c  $@ !㿘eipcomp6_input: l went zero or negative㿐@`'0 `('  (%> ޖ 3 *  *  4@ƥ@ & > c! "c $@D !㿘㿈a2 >#耢`3l>#쀢` l2`>#`` 2`$\+ A a  ``̀@/H > %; >`ȕH `'``$ '`@]3```$ '`p]&2`a " " (  "۰ 7 ` * a 2  0`$@+``% a ``@2`a a  aa aa "p`a@  "j`   " 7  @  `4`*`@4` 4`  ' ( " 7 ?ؐ#@( u ?ؑ*  2 2 ,, ! 쀢` "   쀢 [W'a 쀢 '쀥 "`$   Z  2`C 7` 4``$@ &`$``@51`@,(a  "  ( a  @ *  a l2`   "@@ @ @ 㿘> %""a :` >` " 0  2``'?ؐ#@  ?ؑ*  2 2 *`*` > `$ @   $є  a.  @w a *` `$ ֐``a n a              @N  a23?0.``$a`2 ` `$   ?D  a " (0 㿘H /` * !   )> %'>$!"     > "> > > > # # x  8 X` *u ` 8q & ` $ @6!*`2 6!  ">  >[ >W   Ԕ  @"& K   & &!d`&!h L6 * ԑ2 &!`?p @ $  '''* ''   L 6 * 2 &!\?P @ $ @ * ''''   @V 㿘!\ " !`@ !\ L&!\!` @ !`u L&!`@V   > 㿐`$` `a a    " 2> 4 a>  `w"  a *`$@2'   aad@Hah  >   "    `">  (`"(J 0 ##`# ; B>` > """ : #  8@ B ; 8`$"`$``@8`$``@ @琒 㵐Ű `$!``@ ``@ @x`$ ~&`$     `(a@``@` a@  2 2 @XK ܐ ` 0 0 L~   ͐@X `P 7 p"`P@ 0$ ,$" `"@" """a\"`4*  " "@ޖ 0 $ ># $$($$` <$ $ $$ (`a$a >, -$ " $a" $`$ @ aa '  8* a` '  $ $a`$`* $`@ @Vx  `(`$`,H /` * ! ` `ܬ@  L 2 > c ` "`    @" =   # > H 0@VÐݰc ` "`  > c `P  "`P`  " 7 `0@+  > c `$ "`$  @W) $@!  7ܠ  > # `"# H 0j2  ]  25"0$@ *! ( L"@  " "@$$ >"   2$ " "@$ $"  = "$ "@$ Ȗ"@ > #  `" H 0 $@2> #  `" H  h( ` s OH p@H 0 C@V}㾀``@h a  `''$'`('> #0 '' 'I`$@a   " @`@$ `  > c  0  $ 0`$@ 2a ad 2 a a " a     b$   @?@#@  ې `H ( L"`H Ӑ ` . D"`  `# ; B>` `@# ; B;`@`$ !``@8`$``@ @ ?  `$! ``@8  ``@ @`$ ~&`$   " 8  !  " 8" 沔  -    ` g% ܰ 7"$ `Ȗ  2  V ` 7 "``;Δ `$@ ad'`&ad ;`@R 2`$ 7@   ,@  &3Ґ*P  2/rS ` 2 @Ut  C 4@`$'  " ' ' a%@' `$ @ 4atar/a ;ja 6   @ 8* a &   ' ' a`' `* ' `$ 0 L{    0 Ő@T `P 7 4"`P@`aa$,  ;4  >"ؒ $`$`$`($` $```<@$ "@$ "$@$a\$`* $`$ @@ @T2㿘  H /` * ! ` `@}D L 2 > c ` @"`   @" <   # > H 0@S6c ` "`" > c `P  "`P@T~ $ @! "  o!tH 0H 0 !@T[ 2+   " : (# "   >   22>  (#  (  (㿘`o ``   "  *  R K  2   !    *C H /f * ' > ## H 0 2H /f * ' > l 2H p@ """22&  0  &  & ` $`  p ">   >>  >8 >    >! !(  ` $  &!d& & &!h  L6 * z!2 &!\ 9А@i $   *'''@P 㿘!\ @S !\{ L&!\@QU   > p``y 0C  &> c 7 8"c ,, 4 `4 4 84 4 @  @``>  ` 6!@ "9` @*  @$ @@`4 `&  @  ٲ@@@ `Ҡ  ?9*  > ' "9"@@> & @ΰ А  ʔ (Ԁ  > ` " ('/א ؐ ``/ِ " 7ڀ` ِ  `7耢``  `   7 o ((  ؐ Ly0   > ` G"z 7 ( w آ (  ր_`+K@`<`0JI@  * 6;!> @2*  *  #` $#6zݒ L?   `> '"8 #`$#zƒ L(  * & @ * z L> `"    (oz L 㿐`$!`'D    a ", `$2( D   aadah  >   "   7D`"0>   7D`" 0*`? > $ D`"$0D> ` `""B>``# 8""@ B ; 8`$ !``@8`$``@ @̒ DW 0`$!``@ ``@ @ഐ`$ ~&`$@Q  D: 7@c`$#@ #`#` #`a\ #``*@#`:   (a@D `@D a@?  D 2 0  0  Lw   D 7@Q7c`P E"`P@% 0 D  0D  " D> ' n&Da ʘ  'y L@Q$D `>$`$`D"8$`$`(`a<@$` $ ($ $` $a , 7>$ , @ @PZx   ( $ ,H /` * !  yi L`2 > c` "` ```@" =`  # > H 0@Pc` "` @P`  > c`P  "`P`$@    2ߠ 0 @ > c`  {"` , m   pmu  ؠ > #`"#H !d  2       ;4   *# ( "    `" "@$`$  "   2$ `" "@$`$" @ @6g   "@$  `"@$`ϘH p@H 0` Ð "@O㾀` @'D> #0 `a h`D'''''' ̒> # ,`$ ,ad 2`$a  `$@ D   X$ `$@  a  2DD? c  p (#`H ;"`Hi .#` 4"` `# D; B>``#`@# ; B;`@`$ !``@8`$``@ @ް ՐD; 0 `$!D``@8  ``@  @ޘ`$ ~&`$D !  " 8"  ͖   `# 7`D%#0"'D$@ D  g  2  D 7#` "`D!  ?2 , 4 `> '$ D l`$@ad$  &ad@O:  DDʰ 7 # $""`""a\"`* "`$@  00 Lu   D 7@N#`P v"`P@Ւ 0`$ @F 3D і`0a  $ 3`25  @7D kĔ `44  @7D k  3* 0D/k Da N   w/ L@N0*/D kD `>$$D <$$(``<$ $`($`$`a$@a 4,` `$ @@ @Mِ㿘   0 (H /` * !  ӈv L`2 > c` >"` ``@" <`  # > H 0@M4c` "`  2 `$> c`P  "`P @k! @NH p@H 0Ȑ@N p > !|& & &!h $@  @'В@Kp 㿘@K   > 㿘` @N   03>  Ltr  (@ 0`$" >" ""$ ,#"  " $`$`($`$`` l<@$` `a$$ ($ $ , 3 @M g@M> c`@ 7 "`@㿐   ( $H /` * !  ҵv L`2> c` "` `#  ; B<`> "  : # (@ B ; (`$ ``@8`$ ``@  @܇ج `$!" ``@8  ``@ @o`$ ~$`$  ``@" <`  # #H 0@L` "` #`@  x"`@@M   @$ i 2# $#H p@c   /<   6?2$ @ *! ( *"@   " "@$& "   2& " "@$ &"  2  ?& $i c H 0H 0V@L㾀` @| > #0 a  ` '''''' c> c  $ a   0 ?@#@$ 0?@#@ 8 ( $ 8`# ; B>`  0# ; B< 0`$ !``@8`$``@ @d ׉ `$! ``@8  ``@ @L`$ ~&`$   " 8 @ !  " 8" 沔 w   ``$u 7"$@   2 `` 7 `"` @Ȑ`4 a  " 0   ,  ,` . E"` l/ h@K  2$q1 "  0"@"" "@ L"rB  @ 0` $ (a$, a1Ւ  >  &&(&&& `@J> C@K}`@ 7 "`@㿘  `( " H /` * ! ` `Б@s L 2 > c` e"`   @" <   # > H 0@J[c` H"`2  > c`@  ?"`@@6 ! s L@K&H 09  "0 2`?ؑ* 2 2 *` *`ʐ> c` . "`@JH 0H 0@Jcc||ww{{ kkooT`00PggV++}bMvvE@}}YYGG Ag_E#Srr[u=L&&jl66Z~??AOh44\Q4qqsb11S*? RF##e^0(7 / $6=&N''iuu X,,t4.6-nnZZ[RRv;;Ma}R)){>^//qSSh,@ `yȶ[[jjFgr99KJJޘLL԰XXJk*OCCŚMMf33UEEPPx<!KKa pp|>>BqffHHaaj55_WWiX:''8+"3iip3-<" IUUP((xzY  e1BBhhAA)Z--w{˨TTm,:cc||ww{{ kkooTP`00gg}V++bMvvEʝ@ɇ}}YYɎGG Ag_E#Srr[u=jL&&Zl66A~??O\h44Q4qqsSb11?* ReF##^(07 / 6$=&iN''uu tX,,.4-6nnZZ[RRMv;;a}{R))>q^//SSh,`@ y[[jjFgKr99ޔJJԘLLXXJk*OņCCךMMUf33ϊEEPPDx<<%KQQ]@@?!Hp88cwucB!!0 mL 5&/__5̈DD9.WU~~Gz==dd]]+2ss``ўOOfD""~T**; ʌFF)k<(y^^ v;Vd22Nt:: ےII lH$$\\]nCbb917yy2CYn77mmdҜNNIllVV%eezzGoxxoJ%%r\..$8WsQ#|ݜtt!>ݖKKa ppB|>>qffؐHHaa_j55WWiX':'8+3"iipى3-"< IUUxP((zߏY  e1ƄBBhhÂAA)wZ--{TTm:,cc||ww{{ kkooT0P`0gg+}V+b׫MvvEʂ@}}YYGɎG AgԢ_E#Srr[u=&jL&6Zl6?A~?O4\h4Q4qqs1Sb1?* R#eF#^(07 / 6$=&'iN'uu  ,tX,.4-6nnZZ[RR;Mv;aֳ}){R)>/q^/SSh, `@ y[[jjF˾g9Kr9JޔJLԘLXXJk*OCņCMךM3Uf3EϊEPPKݖKa pp>B|>qffHؐHaa5_j5WWiX':'8+3"iipَ3-"< IUU(xP(zߌY  e1BƄBhhAÂA)-wZ-{TTm:,cc||ww{{ kkooT00P`gg++}VbMvvE@}}YYGGɎ Ag_E#Srr[uᓓ=&&jL66Zl??A~O44\hQ4qqs11Sb?* R##eF^(07 / 6$=&''iNuu ,,tX.4-6nnZZ[RR;;Mva})){R>//q^SSh, `@㱱y[[jjFg99KrJJޔLLԘXXJk*ŪOCCņMMך33UfEEϊPP<KKݖa pp>>B|qffHHؐaa55_jWWiX':'8똘+3"iip3-"< IUU((xPzY e1BBƄhhAAÂ)--wZ{TTm:,cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTQP~AeS:'^;kEXK 0UvmvL%O*&5DbޱZI%gE]/uLFk_mzRYԾ-Xt!Ii)Du‰jyxX>k'qݾO f}:cJ1Q3`bSEdwk+pHhXElR{s#rKWfU*(/{70(#j\+yNie4bĦ4.SU2u 9@`^qnQ>!=>MFTq]o`P$ֽ闉@CgٞwB[8yۡ| G|B 2+HplZrN8V=6-9' dh\![T$6.: gWOa ZwKi⓺ *<"C ǭ-WuLݻ`&\rDf;[~4C)v#ܶhc1Bc"@ J$}һ=2)m/Kܲ0 Rw+lpHGd"Ġ?V},"3IN8ʢ 6ϥz(ڷ&?,:Px j_̛T~Fbظ.9^ï]iГ|o-%Ȭ;}cn;{&x nY욷One~!Jo6 )|1*?#1ƥ05ftN7ʦа3JAP/vM֍CM̪MTߞѵLj,FeQ^5]ts A.gZRV3mGa7 zY<Ω'a5zG8$4,£@_r% ('qOf }:cJ1`Q3EbSdwk+XpHhElR{#srKW*fU(/š{70(#j\+yNie4bĦ4.SU2u9 @`^qQn>!=>FM潵Tq]o`P$ֽ̉@CwgٞB8[yG| |B H2+pNlZrV8='6-9d !h\ћ[T:$6. gWҴOŢa iZwK ⓺*C<"  ǹ-WLu`&\rDf;4[~vC)#hc1Bc@" }J$һ=2m)K/ܲ0 Rwl+pH"GdĨ?V},"3LJIN8ʢ6 Ϧ(z&ڷ?,: Pxj_bT~Fظ^.9ï]|iГo-%;Ȭ}nc{; &xnY욷Oen~!ٺJo6 )|11*?#0ƥ5f7tNʰ3JAP/vMMCT̪MѵLj,FeQ^]5st. AZgR3VmGaz7 Y<Ω'5ah,8$4_£@r %(kXq'Of :}Jc13`QEbSwdk+hXpHElR{#srKW*fU(/{70(#j\+ϴyNieھb4ĦS4.U2u9 @`^qQn>!=>FM捵T]qo`P$ֽC̉@wgB苈[8y G||B H2+prNlZ8V=9'6-d !h\Tћ[.:$6g WҴO aKiZw *C<"  ǭ򋨹-WLuݻ`&\r;Df~4[)vC#hc1Bc"@ $}J=һ2m)/K0ܲR wl+pHd"GĨ?,V}"3NLJI8 6ԁϦ(z&ڷ?,: Px̛j_FbT~^.9À]|i-o%;Ȭ}cn蜻{;x &nY욚One~!ٺ6Jo |)1#1*?0ƥf57tNʦа3JAP/֍vMMCMT̪䖵шLj,QFe^5]tsA. ZgRV3Gma z7Y<'Ω5ah4,8$@_£r% I(kq'O f:}Jc1Q3`SEbdwk+HhXpEl{Rs#KrWU*f(/{7(0#j\+yiNe4bѦ.S4U2u9 `@q^nQ!>=>FMT]qoP`$@C̉ٞwgB[8y| GB| +H2pZrNl8V=-9'6d \!h[Tћ6.:$ g WҴO awKiZ *"C< ǭ򶨹-WuLݻ`&r\f;D~4[C)v#hc1cB"@ J$}=2)mǞ/K0܆R wl+pHd"GĨ?},V3"INLJ8ʢ 6Ϧz(&ڭ?:,x P_̛j~FbTظ9^.ï]Г|i-o%Ϭ;}cn;{&x YnOne~!ٺo6J |)1?#1*0Ƣf5N7tʦа3JAP/M֍vMCMT̖ѵjL,eQF^5]ts A.gZRV3Gma z7Y<'a5G$4,8@_r% >>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<h?>h??` * `(` (@ @. @1 @( @@  ``@  ` ` `  ` ق```(`(`.  ```(`(`. 9 `>h?>h??`* `(`(@ @. @1 @ (@@  ``@`   ` ` `  `$t ` `, `(ӂ```(`(`.  ```(`(`. T `>h?>h??`* `(`( .1 @.   @ ``@`   ` `$ `(  `,% 1 (1 1 `  .  @ ``@` `< `0 `4 `8`  㿐 ې' ( (@ ?"@"` "`"`"`"`  "` " ` >bh?`@?`2  c@ 2`(`2`@@2, @2 @2  @2` c` 2@2  @*3  `@ - *`@3 @ c3 *@ @ `>bh + +`@ @ -@ @>>h-(bh@ (,  * @ !>>"h,h,  `+,` >h@ -  `>bh . .`.@@>@h. `!>-`"h@'@@  '`'`y'` 㿐'D/`*@ + /    *` +(  . (D* **@  @  @D@ 1  ` 5>h5>'h/`5 0`0`0`` #,` 1 >5 5  .  "h#>*  cbh@ %> h 51 >h # >h/`+  >*  h>+`"h D```   `5`1>"h5`%>h/ 0`4 9>(c"h5+  5;> bh@ 0`> c"h 4 4 >bh+ #@5 c@ 0`%> h 5`> cbh@ >h/ `/`  `>+h D  >`$, `("h `, 51>"h5%>h` /  5 1 9>5 5  (c"h0`+  0`;> bh@ 1 > c"h +>bh #@0` c@ 1 %> h 5> cbh@`>h/  /`  >+ h D>, "h`4`8 `< 5`1>"h5`%>h`0/  0`4 9>(c"h5+  5;> bh@ 0`> c"h 4 4 >bh+ #@5 c@ 0`%> h 5`> cbh@ >h/ `/`  `>+h D  >`D, `H"h `L 51>"h5%>h`@/  5 1 9>5 5  (c"h0`+  0`;> bh@ 1 > c"h +>bh #@0` c@ 1 %> h 5> cbh@`>h/  /`  >+ h D>, "h`T`X `\ 5`1>"h5`%>h`P/  0`4 9>(c"h5+  5;> bh@ 0`> c"h 4 4 >bh+ #@5 c@ 0`%> h 5`> cbh@ >h/ `/`  `>+h D  >`d, `h"h `l 51>"h5%>h``/  5 1 9>5 5  (c"h0`+  0`;> bh@ 1 > c"h +>bh #@0` c@ 1 %> h 5> cbh@`>h/  /`  >+ h D>, "h`t`x `| 5`1>"h5`%>h`p/  0`4 9>(c"h5+  5;> bh@ 0`> c"h 4 4 >bh+ #@5 c@ 0`%> h 5`> cbh@ >h/ `/`  `>+h D  >`, `"h ` 51>"h5%>h`/  5 1 9>"h(c5 +'0` 5   1 > ch0`, #> #bh@0`%> ch 1 >"h  5 c` >h/   /`+  >+ h D      'H ` e'P5`5`#>%>bh.h4 @/ 0`4 @5>(h5@9>*"h 57> ch 0`> h 4 >hc5 0`5`> h # c  #>bh.@` `.@/ D+ @ @ @@ @ @1 1> ("h5>h5>.h5 >/ h0`5  c1  9> c"h 0`7>+ h 5 >bhc@0` @51 >h # ` #>bh. / @ D.@@  *@@ @  @ H@ 0`%>.h0`5`#>bh@5`@5>/ h4 5>7> c("hh 4 9>*"h 5>4  bh@ 5`>hc c5 > h0` >>h #.bh@`.+  `#>D/  bh@@ Ȅ ̲@@ @0`1>ą("h1 >h1 >.h5>/ bh@55 c5 %>*h 0`;> #bh@ 5%>h 5  #0` c 1    >h. `/ . @/`@ D   І Ԅ ز@  ܂@7>5`h#4 0`H(?D?+`?c @ (@ 5`@('D @`@(5P1 4 ,@1 4 ,`1 (,`,`  D@  `(0`55,` 5@ 5,`5@@ (,`,`@0` @ @(5`#5 ,`5 ,`   5 ,` ,`   `0`,` 0`,` 0`,`,`㿐'D/`*@ + /    *` +(  . (D* **@  @  @D@ 5  ` 1 0`>h #1 > h,`55 >5  .  "h550`#>'/`*  cbh@ 1 %> h 0`>h # `>h/`+  >*  h>+`"h D``  `` 1 1>"h5%>h/ 4 4 9>(c"h1 +  5;> bh@ 5> c"h 55>bh+ #@1  c@ 4 %> h 5> cbh@ >h/  /`  >+ h  >D, "h`$`( `, 1 1>"h0`%>h` /  5 5 9>5  (c"h1 +  0`;> bh@ 5> c"h 55>bh+ #@1  c@ %> h 0`> cbh@`>h/  /`  >+ h >D, "h`4`8 `< 1 1>"h5%>h`0/  4 4 9>(c"h1 +  5;> bh@ 5> c"h 55>bh+ #@1  c@ 4 %> h 5> cbh@ >h/  /`  >+ h  >D, "h`D`H `L 1 1>"h0`%>h`@/  5 5 9>5  (c"h1 +  0`;> bh@ 5> c"h 55>bh+ #@1  c@ %> h 0`> cbh@`>h/  /`  >+ h >D, "h`T`X `\ 1 1>"h5%>h`P/  4 4 9>(c"h1 +  5;> bh@ 5> c"h 55>bh+ #@1  c@ 4 %> h 5> cbh@ >h/  /`  >+ h  >D, "h`d`h `l 1 1>"h0`%>h``/  5 5 9>5  (c"h1 +  0`;> bh@ 5> c"h 55>bh+ #@1  c@ %> h 0`> cbh@`>h/  /`  >+ h >D, "h`t`x `| 1 1>"h5%>h`p/  4 4 9>(c"h1 +  5;> bh@ 5> c"h 55>bh+ #@1  c@ 4 %> h 5> cbh@ >h/  /`  >+ h  >D, "h`` ` 1 1>"h0`%>h/ `5 +0`9>"h5 5  5   5>( ch1 , 5#> #bh@1 %>c ch0` >"h c ` >bh/ @ /`@ >+ h>+ h D      'H ` e1 5#>%>bh.h5@/ 4 4 @5>(h1 @9>*"h 57> ch 5> h 5>hc1  4 5> h # c  #>bh.@ .@/ D+ @ @ @@ @ @5 1> ("h1 >h0`>.h5>/ h5 0` c5 9> c"h 1 7>+ h 5>bhc@1  @0`5 >h # ` #>bh . / @.D@ @ *@@ @  @ H@ 4 %>.h51 #>bh@5@5>/ h1 4 >7> c("hh 59>*"h 5>4  bh@ 55>hc c1  > h >>h #.bh@ .+  #>D/  bh@@ Ȅ ̲@@ @1 1>ą("h5>h5 >.h0`>/ bh@1 5 c5%>*h 0`;> #bh@ 0`%>h 5 #1  c 5    >h ./ ` .@/`@ D   І Ԅ ز@  ܠ@1 7>h#54 H(?D?+`?c @ (@ 5@('D @ @(1 5 4 -@5 5-`5 (-`-`  D@  `(54 0`-` 0`1 @ -`0`@@ (-`-`5@` @5 @#( 55-`-` 5-`  -`  ` `1 -` 1 -` 1 -`-`㿘 &  & @{ 0   &  㿘  㿘 F H;j&. 0㉘ `va  " : "" " " 㿘 .3`+  `?@ @C ">   `@X @e  @` @ @@@& D@㿐'D`2*@`*2*2222 ///////*2@ `? @" /@>c D "   . . 2 .  .   ?`X?@?`?`?`?` ?`(?`0?`8?`@?`H?`PH?'D?;?   (. 6`0&D @0( 1 )  0(5`-` @ 0(5- @Ć0( 5- Ȅ@ 0(0`(` @̆0(1 ) Є0(5`-` Ԇ@0( 5- @؄ 0( 5- ܆@0( 0`(` @0(1 ) 0(5`-` @0(5- @0(5- @ 0( 0`(` @0(1 )  )3a6 . 5`-`  -@@ 0(5- @-0(5-  -@ 0( 0`(`  @(@0( 1 )  )Є0( 5`-`  -@@0(5- @-0(5-  -@0(0`(`  @(@0( 1 )  )0(5`-`  -@@0( 5- @- 0( 5-  -@ 0(0`(`  @(@0( 1 )  8 0( 5`-` @3zc6 . 5- 0@0( 5- 1@ 0(0`(` 5@ 0(1 ) 50(5`-` 5@0( 5- 0@ 0( 5- 1@ 0(0`(` 5@ 0(1 ) 50(5`-` 5@0( 5- 0@Є0(5- 1@0(0`(` 5@0( 1 ) 50(5`-` 5@0(5- @-3# `܆0( 5-  (@@0( 0`(`  @)0(1 )  -@0(5`-`  -@0(5- @- 0(5-  (@@0( 0`(`  @) 0(1 )  -@0( 5`-`  -@0(5- @-0(5-  (@@0(0`(`  @) 0(1 )  -@0(5`-`  -І@0(5- @- #܄0( 5- 0@@3*T aN0( 0`(` 1@ 0(1 ) 5@0(5`-` 5܄@0( 5- 5@Ԇ0(5- 0@@6 . 0`(` 1@0( 1 ) 5@0( 5`-` 5@ 0(5- 5@ 0( 5- 0@Ą@ 0( 0`(` 1@؆ 0(1 ) 5@ 0( 5`-` 5І@0(5- 5@0(5- 0@@6.0`(` 'D'''    1@3(c0(1 ) 5@ 0( 5`-` 5@0( 5- 5@ 0( 5- 0@@0( 0`(` 1@0(1 ) 5@ 0(5`-` 5Ȅ@0(5- 5@0(5- 0@@0(0`(` 1@0(1 ) 5@ 0( 5`-` 5@0(5- 5@0(5- 0@@ 0( 0`(` 1@0(1 )  -@3ta$0( 5`-`  -@ 0( 5- @- 0(5-  (@@0(0`(`  @) 0( 1 )  -@0(5`-`  -@0( 5- @-0( 5-  (@@ 0(0`(`  @)0(1 )  -@ 0( 5`-`  -@0(5- @-Ȇ0(5-  (@@0(0`(`  @)0( 1 )  -@0( 5`-` 5@3\b0( 5- 0@0(5- 1@0(0`(` 5@ 0( 1 ) 50(5`-` 5@ 0(5- 0@0(5- 1@0(0`(` 5@ 0( 1 ) 5 0( 5`-` 5@0(5- 0@0(5- 1@3\ b0( 0`(` 5@ 0( 1 ) 5Ȇ0(5`-` 5@ 0(5- @-ذ3]b6 . 5-  -І@0(0`(`  @(@0(1 )  )0( 5`-`  -@Ą@0(5- @- 0(5-  -@6 . 0`(`  @(@ 0(1 )  ) 0(5`-`  -@@0( 5- @- 0( 5-  -@ 0( 0`(`  @(@܆0( 1 )  )԰6 . 5`-`  -@@ 0(5- @-0(5- @0(0`(` @0(1 )  0( 5`-` @0( 5- @0( 5- @ 0(0`(` @0(1 ) 0(5`-` @0(5- @ 0( 5- @ 0(0`(` @0(1 )  0(5`-` Ć@0( 5- @0( 5- @0( 0`(` D    D@@D&&&& &> Sa( @ > S   !(/`7`!@  @@  > S7 / a(` 1 @)    > S(7`/`@ @6. @1 )   @ @ > S ( 5-  6.@  %> S(7  / @ @5- @ @ 7`/`  7 / @  1 @ ) @ @7`/` @  @6 .  1 ) @  ' 5 -@ @6. @  $7  /   5-@  @(7` /`@ @7 /  @ ' ,1 @)   7`/`@  @06 .@ @@  41 )  '||5-   6.@  87  / @ @5- 'x@ '> S@ |(<7` /`@@ 7 /     5 x't1 @) -  @ @ 7`/`  @4t6 .,  @ @1 ) @ @@  4`5-,`@ @ @ 6.  07  / (  @ @@5-@  47`/` , |z#@ @ @@@ @7 /   3`@1 x) +`@  @ @ @7`/`  06.(  @ @@t1 )  3 + 5- @ @@@ 6.  4 7 / ,   @ @@@@5-@  5`7`/`-`@  @ @@7 /   5@1 ) -  @ @@|7`/`  6`.`@ @'6.@ x  @@@ @1 )   6`5-.`@  @ @@6. t | 67 /  . @ @@5- x@ 0`7`/`(`@  @ @ @7 / ' @t  0`@(`@ 1 ) @' @  @7`/`  5 -  @'ؒ@ 6.  @1 )   5 5--   @ @@@6.  47 / ,  ؒ@  @@@ @5-@  0`7`/`(`@  @ @@7 /   0@1 ) (  @'А @ @7`/`   3`6.+`  @ @@ @1 )   05-'̒ ( В@ @ @6.  7 / @@ @@ 4`̐أ,`@  5-  @47` @/`,#`ܤ @  @7 /  @  @0@1  ) ( @ @ @ 7`/`  3 6 @.+ @   @1 )  @ 4 5-,  @6. Д  @   5` -`@ 7 /  '̔ 5-@   @5`7`/`-`@ 7 /  @ؒ@  @@ @@ 'Đ   ȗ5`1 ) -`   7`/`@@  @6`6..`@  Ē @1 )  @ @ؖ @@  5`5' --`  @ @ 6.  67 / .  5-'p @В@ @  @@4@  , 7`/` '@  7 /  ̬@   @5@1  @) - @   Ȓ@7`/` @ А @ @  5`6ē.-`@ @ ̒@ @ 1 )   5 5--   @ @ 6.  @@ 07 / (@  @  5- @@ 0 ( @p @7`/`@   @7 /  @@0 @ ( 1 )  '@  @ 7`/` ' @ @ @@@ 0`6ȑ.(`@ @   @1 )  @ 05 -(  @ @  Ą6.  07 / (  @  @ @@@@ @5-@  3`7`/`+`'2֚@  @Ē@ @7 /   3 @1 ) +   @@ @p7`/`   4 ,  6.@' @ @@1 )   35-+  @@ @6. ' p7 /  3+ @@'@@ @6`5-.`@ @  7`/` @@@7 /   6@1 ) .  @@@7`/`  36.+  @@ @ @'l1 )   55--  @ @@@@6.  5`7 / -`@  l@@ @5-@  7`/` 5  -  @@@47 / ,   @1 )  @@ @@@@7`/`  4`6.,`@ ' @@@1 )   4 5-,   @@@ 6.  37 l/ +  @@@@ 5-@  07`/`(  @@@ 07 /   ( @1 )  @@@@ @ 7`/`  3`6.+`@  @@ @1 )   3 5-+   @@ @6. > Sp a(> Sa("@"`"`l "` "`"`"`"`"` "`$"`(27 */   > Sa( `,5- `< `0 `4 `8 @  @   @& && & & H;j&. 0㉒`v"" " " " " " 㿘 . &  6  & 2 ?`? @"   ^  ? @ ? @   & J@㿐`      #* 2@, >a ` !! #>a ` !!     @# *`2 .  㿘&0@@33#3. $(``@7`7`#7`.`$(`33#3. $(` @7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(` 33#3. $(`$@7`7`#7`.`$(`(33#3. $(`,@7`7`#7`.`$(`033#3. $(`4@7`7`#7`.`$(`833#3. $(`<@7`7`7`.`#((`D`@@&@&`㿘&0`D@33#3. $(`@`@7`7`#7`.`$(`<33#3. $(`8@7`7`#7`.`$(`433#3. $(`0@7`7`#7`.`$(`,33#3. $(`(@7`7`#7`.`$(`$33#3. $(` @7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(` 33#3. $(`@7`7`7`.`#((@`@&@&`1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىyP?##`H> a.**`2`  *0 : *0@`( ` 2㿈.7 6ݐ, 2 @ + @2$@  7'' , 2`*`$@ `**`2 $@   , 2   Ւ.`2  `* *`+`&@2&  , 2  , 㿈/ 7 7 , 2 @ + @2$@  .67'' v'o', 2`*`& `**`2 &  6 ,  2  O'H'e, 2   * *`+`&@2&  / 2  נ㿘.;6㿘.6  : *`2 `  㿘.6   *`2 `  㿐 .``(`*`@*`*`@ `+ `+` @ @ ? 000000.@.`.`.`.`.`.`.` ֲ`㿐 .``(`*`@*`*`@ `+ `+` @ @ ?+ 000000.@.`.`.`.`.`.`.` ֲ`㿐 :   @  . ( *(*`*@ + +` @ @ ?0.00000....... ʴ㿐:  * ( *` * @ +  +` @ @ ?000000? ,, , , , , , ,   ,( ʠ  * ( *` * @ +  +` @ @ ?~ 000000,, , , , , , ,  @ ,( 0@ԟ k/?%z!?/M`@ϟIԯ'@Жuncaf"(h;oY#yw_PC@/V|ҽ-4lHam"T/*2Tk"V:Af@ȧ9/M/-ޗ?JRvD7,QYoZ z{hА."TY5Km/PdfI-3";K4]E@1?.Ueձʭ-Էm P"@ nO8O[rVL/ŜSITFiXcE]WSj9=7*T:x}_bvzB j)r'^Pg8Ƶˌ*ZJ'ѓk*҆Vґ׉C`B\u &ql-sJ5&{M 0n٘&fVH%^V c|cp EP(r#Hp -;MyBA &G LGMj| ^\#Y8r۫Sn/#qFVEn9 q+A|ʉiHCyB}B{ZIݏ\e  [i~9?Caz zUrQyNr5Zc60_ }/{Y6 DDY̳A; *{B [%AzzƩX0ދw?Nyi${[P5%a_b1T UKc]h!fY=cs4~\g+!a9b60W;`/d:͜F5-' zyl0%7^oo; jEt'N:4Oi>M5YdE8Cfr%c3N?( 'ᛥզRTUfpdw M&g!CX`T0orSGUb]hVk-n;ۦк=\w 3L9{^+_Soa Cd^xc"g&рI"{^U-%Rr7yҕ LHϢ 0qc/ S!ET(5c)1BƎI# 0(_qȾ`a輨M/".pN40';yaٸHi?(;CZᗘv/܆7ӱÓnƼ>Q7Bh(Re-jw5'K \n.ے^)XXOTi{&g̅`HK8` #l8~ I` 5sܱGLV>#d8^FB kzOdEA^\#>];Cוr~m|llq`9spvE#@%]=G`6KDʐPQHX_0.r| ],*IPڈ'WyoIR}rY}@EE]t>OuVi#A.`' v䶔etyvwvNHam❄/}4 ȖH0b \8D=`nm`T:IW'H+8 $hE%;` E}(/P4b +md+10ZRXAB휤1\2>F63S57 ާ{sJO{dWQC~(zc _5y Cddc$J(_OC@ " 07O-${MQgqL-_d_ !S>^'Ҹ_Bar%΄q=Ko&;~ԄT~DmLl&I߮63P?~w a8rPP.wWOgF3Ti 1M5=\f][̩o꟒oF"/9F}mCOC!N ? (X&Hn>׊ptw|- %y 껁(;#iޭ8t߇b!@7{ @YVOv/@U{ MV3i5W#'ȰVÑke^anu2Uw?[-;%m;$ cf8( 2T2bZg,uzT1w&16o FjHVZyjLRC~/v t,߷t*M . k|AT嶠5!=B,|&aeR1%i &c1\!^ rIyٍ 1p>d >Ӷ È0lrqn/ބkD؋V9ñ/ʴ1x(o}2X~$ŗ{sa0-!!))*\e0,Ъ?\Ԟ, T ͆_wޠ:xV^V!\uㇳQ#wE)/i߯zpIJ[̘v9F څ8/sgD)k)I/•fgni~/%p^QS$jlD!>Yye)CA9y+WMN҂z) Gl ыiWw@~˳PM xQ VA$ VWUnaX $K'{UahwdlkDMfdi~կI/07O,5jsI@v;M(BDHsnL )_}Oao.w+᪐r<}F+YEEYTNmHo |cD_sVjprn] `yE`۩11\"NB\rr,%@N2N/@g#\xnu"xMkXnD O?H{wv#uV_F*+ (=8 6RJf;tQZרխly ueXJh&pSF\l(vk07h)҅6*$gk %huUD,eI40ʸ"W ubIb~U^vSEFmG,lLHg3|hC\2US `ߡWc톹^9283Ia7b^~N#tq܇&3@~C/ ^A (lؑ0~foo䬘s`*4-K6%░#% =HI6oJ8@CzT¼pOWAZ:TUY5|ūZǵޯ:G:S%e=~jT&IQwP[]Dlvȸ!`Xi[)Y;LJ]5UkLD5$bI/T81q(TH9)[u/@3+gf-V*o` ('Md)P,2\K6ޠ_AP! NhÁ\yCMIP8CA<?f϶&`ued$zHܩóf(` ߨ5mw 5k*HiMuN{:_Cg7I3BfΌAT:lG()G%7j+z \D7bB ntgr9X7EXVn0!$Eˆ)^18FXJNFFPx)C_$;,NmdTJOëoxnn<UV6;]޻a<tb3<L(m tyl{nwe\R0+@`>x7T0}ȧm2羾-yy"SuwXkxoZc\]3򎿰€vzҰyBq3j'`CP=Ăm+NvH%6f(NAa =IϺ߶_撮d:枨 +}?pP+ObZjyb.H@@Z,Қ"-E4S֙)nIloIrB~>VofblqTL+*)9ܰX򮞢RVLf.v9Si.Ӡߦi>҅tFL+OuvV]93x2#O=2]K&ǟ/<~~^O?v)f=oEӵ4+4NrgU="Ҩ`g8k0=8}cQXӐTyGawY-WSVXNcF.xe~yU@0ј5?P=@!IXLQ6p΃yǔqoKK0 ڽ5dw$,ϰ/ t*Bv-:7ޚޱ ,p) @$:7ϴNy ]H 1hZfB1?ru3 BQ\}mc@!d SWz13]oCqF8"ΔԸGi[bUfg N[GLoŽĸWrndzx]D`Փl 9_] c~2p PI) *m~SHX~;t.R/G~'ͤ![<z8BOv5`9'5ɯ{6 g{qp-^3TIZd,= p4wB&Ob$ҿF%dN>7`xͥE{_ v"1.{$%r_m LPm=O%#so(%Iy4azn|n6lTAV'JA<șgmB`{u $ž9g;?q0T;2dB̰E}JBp} W[z?Z MΤ(y043w;S7x倳Nhȳ~ 9|*OC/}"6ʢ7ߓ+$W4xgaoHR^^A$e.{@鎠XӐ[HV8Wrs޼[d1~OPa`{ I8,v%ѷ%$K vGX YѤf 0nN&Qd# Ph㿘` `(`(`.  @#0(3>&>'Рз.3>(@А #@3`>)` / c. `+.   D@ # 0(33c(3 @#.  H@ # 0(33c(3 @#.  L@ # 0(33c(3 @#.  P@ #0(33c(3 @#.  T@ # 0(33c(3 @#.  X@ #0(33c(3 @#.  \@ # 0(33c(3 @#.  `@ # 0(33c(3 @#.  d@ $# 0(33c(3 @#.  h@ (#0(33c(3 @#.  l@ ,# 0(33. 3@ (c  ^@ p 0#0(33c(3 @#.  t@ 4# 0(33c(3 @#.  x@ 8# 0(33c(3 @#.  |@ <# 0(33. 3@c ( @0`0`0`2`2`2`/ // / / / / / 㿘@`.`/```(. (`/ `` >&>'!>(c#>)| <'0(6"б. 6bвc@6"Є@bе. x@8' 0(666c@(#@. t4'0(666c@(#@. p@0'(066(c6@#@( l ,' 0(6"г.`66bО"а@b. @ h@('0(666c@(#.@ d$'0(666c@(#.@ `@ ' 0(666c@(#.@ \'0(666c@(#.@ X@'0(666c@(#.@ T' 0(666c@(#.@ P@'0(666c@(#.@ L '0(666c@(#.@ H@' 0(666c@(#.@ D'0(666c@(#.@ @@'(066(c@6#(@ 1 *1 1 0`0`0`*******X   & 'Ȇ ''`   'Ā& (& @?(&? (& &ĸ  `'>+>,>-ЪЂ'Ąd„ >*ׅ(". >*г7`7`ȳ.`@2 (7 Ѕ('؅7 7 ۴. 2 @@'߇6(66@(2 @@ #@@@7`'7`̷.ӱ7` . .`@'''_'%>*ߤ܅(. س7`7`.`@2 (7 ('ȅ7 7 ˴. 2 @@'χ6(66@(2 @@ #@@@7`'Є7`ӆ.۱7` . .`@'''''Ą V    0M  3>*000(b@>*л6  #6 /`+6 #>*+`" + 2`2 #2`,` 2**`, *@@ @ @@ @  @ @H `%>*0(. 0* *`67` 7` >*c7 " 6++ ,`67 .  7 @+`#,  @@ @@ @  @ @ ` ` `    G 'A>*ޱ. .`(($%>*ձ. ˳.`χ((7>*. ڶ޳.`( (>*ϱ. г.`Շ(("@@``@`  @ ` ` ` Ā@` ```  @ ` ` ` Ă`8'Ĵ  '   Ą'ā㿘> 8  !4 l,``&@  * $ ` $㿀  @ '@  ' @` @' @     ' $@'  @   @ @@@ @@  @ @ @` @  @ @    @  @@  @@ @ @` @@  @@@  ` @@   @   @`      @ @    @  @   @     @ @ @ `       @@`  @       @@ @ @`   @@@  ` @  @@` @` @ @     @ @      ' @ @@`@@`  @  @ @    @@        ` @  @   @ @ @    `   ` @ ` @  @ @ @ @ @@ ` @ `  @ ` .@@.`.`.`.`.`.`.`x    ' '    @  @ ' @@   @$ '   ' @ @  @@@@    @ @  @ @  @ @ @   @ @ @ @ @ @ @  @      @ @  ` @@ ` @ @     @ @   `@  @   @@@@  `  @@  ` @  ` @   @ @@ @` @      @@`  @ @ @@`  @` @ @ @     @ `@ @@ `   @     @ `'  @` @`@ '܄  @ @ ` @ @     `@   @@  @ @    @  `    @@ @@@  @ ܄ `      @@  `   @`.@@.`.`.`.`.`.`.`                              A@@A@@A@@@@A@@@@A@@@@@A@AA@@@@@@@@@@@@A@@@A@A@@@@AA@@A@@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                             libdes v 3.21 - 95/11/21 - eay㿐 *   * +    *`  *  * ''@000000.`.`.`.`.`.`.`.@''㿘0`(@@7`?(@@0` ̆3(@@7`?(@@0`UUU(@0`@(`7`/``@>8p!#%'"$& @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7`` / 7  ?7 (`@7  7 @`?. 7`7` 7`@`0`>8p!#%'"$&`x @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7``/ 7  ?7 (`@7  7 @`?. 7`7` 7`@`0`(`1 ) 0`UUU(@1 ?(@0` ̆3(@1 ?(@0`Æ(@$$㿘0`(`7`/``@>8p!#%'"$&  @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7`` / 7   ?7 (`@7  7 @`?. 7`7` 7`@ `3>8p!#%'"$&`x  @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7``?/ 7 ? ?7 (`@7  7 @`?. 7`7` 7`@`?30`+(`$$        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$   $ $$$   $ $            $$   $ $$$   $ $                0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((           """"    " " " "((((((((    """"( ( ( ( ("("("(">@ * ``( >@ ` `(  㿘>"D @QĔ     ` 㿘>"@`" א ? " ? *`   +  *  @  *`* @ *@ 1 c @. (` 33 ) 6 @@ @ 6 @ 1 UUU . @ 0`? . @ 1  . ? # # *`@ @><<"@ 3 @ 2> "Ĉ@ @  - `(`) 0`1 (`) 0`1  @ @0` 0`  `00`0``? `< ,`1 1   <  +1 1 ,  00`0`   0` `8( 1 @ ?,+  *@ @@  @?.   3` &@3`+`` &@  ` 㿘4㿐 + *`   +  *  *  *`  * 0c *  0)?# *  0' ̐3 *  0%? *  0#UUaU *  ?`?0 *  0 *  0 *  0 *  0 *  000000.`.`.`.`.`.`.@.`㿐>#`k H /f * ' >#  1>#    `$ 8 "!  4 2  2 `@ @`  $ c  `2  c  D`D ژ Dc  , H 0 * 8'      @ < "H 0㿘>#` : > @ 2 H /4*`* '*` c* @  ?"@c @€c@ 4 @  @I DH 0㿘H /f * ' >c   $  l!(N >倢` "#H 0s$   *@ @I*`   >#    `< 2   `4 2 @ G  D D G.  . H 0C?-  l(     H 03?!>* #*皒 *` * @IC@-  $@  @ #**`4$ )ؒ l$#H 00#@ *4H 00H 0?㿘>  ` `40 >) H(. #($(#.`0<\&@&8&# ``>#` . * @ `$ @ 2 *@H 0* c.`  $ 2  `` "``* c D@H`c 4`* 4c"H 0 㿘H /f * ' >   ,>"#"H 0 H$#0 > ,""H 0  㿐 "g  ( 2 $a #>c2 & @T >  @ 4  4 "04`24 $ `Ȕ  #> #& @2 *` *  `4  ' c <` $4  4 "04`24 $ `  #> #& @ @ 㿘 $H /f * '  $`" > !> 7`4& $c H $`2`4> !HcH 0cryptopcryptodesc㿐H /f * ' '> !> >Bb!H#\ 8  `V > 7>B Hb#\ 8  `L  $!Ha H 0' H 0 @G 8'> 7Ha @G{ 8 $$ 4& $H 0crypto_wait㿘H /f#>* '#>%>C## $ ` E #`, $c#㿘 (@diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK   0#e ( @  #g #f@ð 0݀@0#h@԰ 0` >D!$*` €>#>#>  >  8> X> x> `>D *` €>  >  > >!D>!`@FԒ $Р@FВ $&*`'' @L  @ H &  L %h:  'A: 62'Ȁ#* '' $  &  L %B: Ԁ'ܔ: >#@   `?  "' L܀ 8'  L04Ԓ :;`#\ :#l#h;p@ &@O @V@@C   @'@7`(4@LX       crydev㿘`#     ! @Nl  ! X@E   p$ t$  l$  \$ hX$ @E$` L "$`"@  @$ @  @ 2   `$ 4  `$ X` K` `  %`% % % <% @* % `    ?$ `$$$$$(* $` X>E \$`$`$`$`($` <@``Z  V,    O``  $ $  $"`  $ `$`" $`  D) $`0>DX  C `x 2`` X`  ````  `0`/ X@ % L㿘   x" `#D  ~ X      @@D`v>F *` €  m `i, e `a, ] ` Y, U `S,   @ "@ `    6!&  @ 2   #b L  $@ @ : 2*    `&   6 , @ 2  @  2    ` , "% L,0Pp   -㿘  (`"`$ "@@ 2$ L& ( ><     㿐0#d@1  L " &@&`&`Ք $ƒ L0 2` 2 ># ""`(&, ?",`0?"`0`, C`0   2  " 2 "   񀢀  "@ "`  "  "`"  㿘`\ Lh l p"vt,4 / 7`< $ $$ ($ <$ @$ $ $ $ Ւ㿘  $ " <$F L < "$@ L$= Ldiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKcuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: empty㿘 `>F#f46>G>F#f- ` `2 f$ @ :&@ %>G`2 f "ᄔ&  cuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: empty㿘 `>G!eߒ6>G>G!8eؒ ` `2 eϐ!X@ :&@ %>G`2 eĐx"@/&  `    @   &  `2 ??* ""?%s: len %d < 0cuio_apply%s: off %d < 0m_apply: null mbuf in skipm_apply: null mbuf㿘>G>G#ceh  >G>G# e`c3>G` @&eR0.`  6"$ #>G @&eBcP.`  "@   @  Դ& ` diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK`  `@Gy  2` -  ` l ĺփ'Ē^  ` )`!` A `Ǵ@ " `$~  @T Rؐ˖`  6     * &  €#€      * & 2Ȓڔ@ o&  @ "' "'\@  D  $   @, &  €(ߖߑ €$    @, & 2Ȓy' @ 4` Kİ @>2` -`  @V Tؐ`      * &  €$-( €     * & 2Ȓߔ"Z -`@`@ I@  $   @, &  €)ՔД € $   @, & 2Ȓ޷'@` O4` 0L   >`ޚ  @`s` `` "C?`1>J!*` € `€q`` ``€ `2 ``€ `€ 2  0``   F`  ) ) ) )h)h))))㿐` l      u "    h l 2&`;   /Ŕ   $  "@?" ?&?  + @` :"`" "` + l 㿘 q`o>#Ȧ`#>c̤ :` " c̔  ,`2Ȁ`c̀20Ȁ`c̐ $c * $cc̒ l*   cc̀ 2 $c$c̐ @P= 7@?B*`Ȁ  c̒2݊*ג l$ȑ,@`'&  l۔  $@?' @?` >L!*` €>#> #>  > 8> X> x` `  :" > > >   l "` `   l "` ` #>'> @  6*@ ` & : &`  €```  *  2 ` cH :  @"* 2  @  j*@ ` & : &`  €```  *  2 ` ㈐ :  @"* 2  @  \*@ ` & : &` [>! >!(  l "` `! ` &  l:  "``  ` & : "` ``   ܙ: €```  *  2  €>!D>!`  lٔ "`  "ܐ  @ " >!|"` @  @"` `ݠ -L-X-d-p-|---//-1`011L㿘>#̀@  >#Ȁ`.`@O `L   c"`:>L#\*` €  1 `@ -   @=` e l  " `   @=` V l  " @= L l   "D lA lc 2  2d2d2d2d2d222222d303330㿘 2 $f  Z   U>#    >#ȓ*   K&      # : `    1  2  * ?`$>M!H*` €    & `4 H  &  &  & `4`#ڐ 444444444445444Software crypto device cannot initialize!㿐K !>倢`w$#>L##\ >J>L#aܒ  Ӗ ##\    ˚ ##\    Ú ##\     ##\     ##\     ##\     ##\     ##\     ##\     ##\     ##\    { #В     s#\##\    k 0>M_^!diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKDES3DESBlowfishCAST-128SkipjackRijndael-128/AESARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160Keyed MD5Keyed SHA1MD5SHA1Deflate㿘$ 㿘 㿘  lΐ  @<&_㿘@<  l&㿘 㿘!  㿘  l!&@;!3`/``+a㿘@;ޒ!{ l&㿘 㿘, 㿘!  ls H H@;&.ֺ6㿘@;`HQ l&㿘 㿘ዔ 㿘!  lI H H@;&#㿘@; ) l&㿘J㿘V㿘  l" ( (@;o&㿘 ,` " `@;`! l`` @;V ( l&㿘 㿘! 㿘  l#В&@;9#е.Ӗ !͖ 㿘@;'#Ē l&㿘.2 㿘.@;2 㿘.2 㿘@  㿘@ Ȧ@: 0XP "? 6">P>Pa!('''' '̔  l,` % T "@ .` } l,` % T"@  $   PT''>!= > !#\?  7 2e,`* т    T̀ ؀`2܀`K`I l<  C&'& &`'ܰ  l,  2&ܐÐ # @ ش@@ l@&@ $ا@ l@& ` @ 2@&  & l` @  О R 㿘 lה 㿘’ l㿈a"@  o6. Ґ ' "  "`"@"`"`  o6 ?#\  @7 `     ' 7  6bind failed krpc_call: sosend: %d RPC timeout for server 0x%x rpc denied, error=%d rpc denied, status=%d h \ /'А Ԕ   Ū  r '̖ "  "`"@!?&# `` \ '̒` "` "Ԓ# ` ʐ '̒` "` ,@,`$`H /f * ' > ##S!H 0'> # 2H /f * ' > l$ 2$H p@ """2 "  "Ԓ Ɣ  R`H /f * ' SP!'̑H 0̀`!̐ 2`H /f * ' > l" 2"H p@ ̐`"`2`"@"`̔  "  ,@,`4`$`̰̀ >P]K" `H /f * ' S!H 0 2H /f * ' > l$ 2$H p@ """2 " "Ԓ :  ƀ` r  ` %`    < %% @8 <'> ᘀ $ᘒ  $$ $ $ $ $ $ $ 8$ 4  '̒` @`'% % d 沖  f'Ԓ   _'>P`\"H`CЀ "('̀ !@!'''ȒД̘ؖ ךȰ # N$  ڀ` Հ`ᘀ@Ѐ` >P \z"hǀ`` >P\r"`& <   Ē   ' 7>P"0\\``    ? Z̀`'''@`  Ѐ ԁ㿘` ? h:   `-H /f * ' >  Qݒ!& $H 0 $ (  & 6 & 0& (& ,& <& 8  2 +   & "㿘 H  "    ?      ސ.@&I 㿘 0   "  " " " " "㿘     2    "  &@.@ .` .` .` diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapnfs_read modenfsbioread nfsbioread: type %x unexpected 0X!  'P   >SYِ!@ 2x 6s " @bP@~`   P%`ٖ [#%`Pϖ Q`@P @  0C@?0;08%`a "PPP%a@P "@ <`P` `>S<> $`` "`@6Ǖ<`   @ `a:` Y >#P `K' G 1 `aC:` e 2" @ "  0" 0@$ 0@ "   0 $ 0΀ |   `: @ ǖ` ,   0@  @@ @ٖ "  0"   0 $ 0@ V'$@ 8 ` "@@&  /$. l h@@ l $& l @ "o  0 d $ 0 0 >SX!PJ Z   l@ "@&, +> $0`"0 $@w "?  0"2  @ 0 $ 0@V  @$" @ 8    Y!` `" H@)<``>S Y!` ͼ  4@nfs_write modenfs_write proc8  X  `  !>TXD#  2 <> "@ "<>TX8#Ѐ   `  ?`5`@" @b`@}`" `  %` @  ` %`* `=   6 װ Ӏ"a @ `B 2a` %   0h$ 08a "%aE%a $`5> $ @W`$ "`$ @5"<   @ $8 հ:` @ 2<`5`  B` 2 d`( d  B=``   @9  d @ `@ 6  H$ , ːV  H(  d`@ `8@ $ ` $ d$ `$ d l   ` & d h d@   d$ h $ l8  @ $ h $ l 0` ?$ 0$ , " 0@  0`$ 0$ ,@R  $  X 㿘 X! @!_ 2#>Ȑ @ZΔ  aP+ N "   B nfsvinval㿘 X! @  >!P!*`   '>V 4   @1   @Z 27  `4   @Zw  ? 4 ?4 3   , 䀧  ? 4 ?4 3t  㿘>#P`*> > "h`H   ` 0@2&  0@ & 0&  & "@"#3N # ``  0D @ H /d * % ˗H 0ώ Process killed due to text file modification nfs_doio: type %x unexpected h \ 0` ''@ % % +%  T : <2` H* @ % *`  0?Ѐ@ = > $`` %  "` @ y> $``,'̐ "`,% @Ik 0@"o T < H% ''% `<  G>WV`< T> $``: 2*  * #`= @֒ ` & h < T" *` @"   @8 H @2@& l <& l`(`@ $T >VV##O ` &`> $4> "@"4  = `@W y 0& 4(& 0s> $( `:  d2 H* #($% * @ 'ԑ< 0C @=   @'Ѐ`% '̐ ' 0@ & 0@Ȥ ̀  0  0 ?& 0 0@*@& 0% 0 !H /d * % zH 0 0 Ȁ"  0$& 0" & d 0(& 0%& 4 5& d& ` `& @@l`XRnfs_boot: no suitable interfacenfs_boot: using network interface '%s' nfs_boot: socreate, error=%dnfs_boot: GIFFLAGS, error=%dnfs_boot: SIFFLAGS, error=%drevarp failed, error=%dnfs_boot: client_addr=%s nfs_boot: set if addr, error=%dnfs_boot: bootparam whoami, error=%dnfs_boot: server_addr=%s hostname=%s X> # 'Dj1>Xؤ5>XĦ7> ;>X9> > '#Ȣ؀ 1>X5>XĦ7> ;>X9>   4  2   >XT ؐ V    ">XT}! 0aj ">XTr!@1 `7!j ">XTd!`R ">XT\!-'ĒUΐ@1x  / ,! $j >XTB!@1b ?'//ɐ!&(@z ">XT-!ؐ-~'Ē UbDϗ  nfs_boot: bootparam get %s: %d nfs_boot: mountd %s, error=%d nfs_boot: portmap NFS/v2, error=%d 㻘@ >Y  @j >Y ВUd0$ab  >Y UW0@7CiO :.` K.  * . nfs_boot: bootparam_whoami: bad reply 㿈  '` "` #a b$$ Y$  "@  o$ 4?#\b'  >`  g  %'    >  > 4`$("( '> 7"D> b@D '2 '>YTߐ" H "T Nnfs_boot: bootparam_getfile: bad reply 㿀> #(>   '@6 "@5 a#\b   ) Y' '쒒 '#' 耢  '@08   &..>YT# 㿈#ab   2@6`; '( ?#\b  C `  H` #    $ '  B 0 Hdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapnfs_hashlocknfsnodepl㿐>ah> 6  $d\> "cp> 7>Z"  / >גc> >Z#\#b!  HM    㿐> "@> 6`\> p* @ > 7  X 2T 2 @5w 2   Ɣ 2[& 2 > 7" " b 2> !P Y & Q 0>>  If#@/H!$`$ !`L2` @5; 2 `< 2`@ $`<`@ $`@ $" $@$   Ҕ $  $  k4 b  & nfs_inactive: pushing active㿘 >> !  b@ D >[!ᬒ   <` `$`   ͘ @(_  ` 4`  ~ nfs_reclaim: pushing active㿘 >a  ``D >["pt `" `< 2"  "@`<  %>  " T H  T @$! > ! "!! F`Jk$` diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapbuild > MLENL0 @8,'TE'P  "    'PTP @b+L wL - HL $T<8;`#\  H @Qd@ <8;`#\  H @QW@    TL  H"Z T  P@ "@    'PTP @aL 2LJ L T  P@ "@  PT@bT  0'PT  P@ "@   'PTP @aL 0LL0 `#\#` 4@g "3L $T<8#\;`  @P@ <8#\;`  @PԚ@  j L  H @fg Ѱ  4!0@H 2 4`<     0 @H 2,4`<    0  @@H 2,X4 PH4 $TL <8#\;`  @Pu@ <8#\;` \ @Ph@   L  H@e<    8 `    $ 0@  "@` <G   ?# ? ##G !H 0 2H /f * ' > l 2H p@ """2<"'<" < '8< 8`" 8 '8$ L  0  @X 8 ,'TE'P  "  ` 'PTP @`L `L@ - H L $ T<8;`#\  H@O@`<8;`#\  H@O@` C  T L  H" T  P@ "@  ` 'PTP @`<L L ʠ  L 0T  P@ "@  PT@`   0'P L0 `#\#` 4@fQ , L $ T<8;`#\ @OM@`<8;`#\ @O@@` ֐ "  L 2? H 4 4 $ T L <8;`#\ @O@` L  D T<8;` #\@O@`    L  H <v      8  L  D T`    $ 0@  "@@  <G L  ?#@? ##E!H 0 2H /f * ' > l 2H p@ """2<"'<" < '8< L 8DT#  L 8 T D'8@dP80 @ 'L , ?E  "    ' @_䀢  - HL $TԒ;`#\  H@NHԒ;`#\  H@N;؀ ѐ  L  H"r   @ "@    ' @^ʘ䀢  . L   @ "@  @_7  0'׎`  @ "@    ' @^䀢 >    @ "@    ' @^x䀢 m  /7  @ "@    ' @^_䀢 T @  @ "@    ' @^E䀢 :'  @ "@    ' @^-䀢 " @  @ "@    ' @^䀢 '  @ "@    ' @]䀢  @"  @ "@    ' @]䀢 ְ       ?  @ "@    ' @]䀢   (  @ "@    ' @]䀢 '  '> %"" *`" *  * ''  @ "@    ' @]䀢 u  (  @ "@    ' @]e䀢 Z'  '> %"" *`" *  * ''  @ "@    ' @]?䀢 4 f  @ "@    ' @]&䀢 ' L'  @ "@ $ ' @] 䀢 0?# @@> % /7"l@2'"l@2' "l :?"l@"''"l@"L'*`" *  * ''LȐ `#\#`Đ ̖@c  4`L $TԢ#\;` @LԢ#\;` @K؀  " #\L ɀ H0 #\ 8 Q8̬    l@ p@ # :׈L $TԢ#\;` @K`  xԢ#\;`@K؀ = " #\L x H߰ #\l ??2`<Ȁ &  X`<0`<   Ȓ @Cf ̖F̔, !̀ $TL `Ԣ#\;` @KM` D xԢ#\;`@K=؀ Ӑ `L  H ` #\8@_i     8 `    $ 0@  "@`C G  ?# C?ԑH /f * ' > ##Aے!H 0 2H /f * ' > l 2H p@ """2"'"  'Ԑ` И D#` ЖD@a0'Ё80@ 'Lp,  ''F'  "  ` ' @[H 2z@ /L H $T;`#\  H@J;`#\  H@Js    L ) H"s   @ "@  ` ' @[ 24 f L   @ "@  @[p  "'  @ "@  `' @Zј 0(@ 4 ? $ H )L  $T;`#\ @J ;`#\ @I  " LL  H L  ``'#\#`#h''#d@]`  ' -L  $T#\;` @I  X#\;`@I = ]L ^ H V @&Z @ X d% h% X$ C; $TL #\;` @Ii  `D`X2 X#\;`@IT   L  H  @^L m    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##?!H 0 2H /f * ' > l 2H p@ """2"'"  '  ` " ` '#@ i    8 `    $ 0@  "@` G  ?# ?H /f * ' > ##?!H 0 2H /f * ' > l 2H p@ """2"'"  '`   #`  Å' @^@^0h    8 `    $ 0@  "@`C G  ?# C?H /f * ' > ##?!H 0 2H /f * ' > l 2H p@ """2"'"  '`  D#` D@^g'X0'@08'L ','L'P' '''H'  " $ '  @Xz c 1 HL $T#`P#d#\  H@G`#dP#`#\  H@G` 8   L  H"а    @ "@ ( '  @X2 А – L >    @ "@   @X  0'>  l  ''̑H /f * ' > #c>.!H 0  4 H /f * '   6 H p@  $ $$ 4 H /f * ' >  =!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  ܀ $ ''"' $($"$ $ $ #$LА `   %%=%#`̘#\Ȓ %%%@]ఒ 5\L $TP#\#`#d @F`P#\#`#d @F` ; L  H @\8 Ͱ `< " ܀`  p CL;쀦 "$TԀ $TL P#\#`#d @Fb`܀   \P#\#`#d@FQ`  L  H"  @[ 2u ` Ԩ%   $"@ @Z"    8 `    $ 0@  "@` G   ?# ?H /f * ' > #c<!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '""nfsrv_read iovx`0`' `L`@ `8'H'`,'L'P'4'0'H  "   '040 @VJ, , 0 H`L %`TP#\;`H  H@E #`P#d#\H  H@Es     4`L  H"Ű 4  0@ "@   '040 @V, n,f `L 4  0@ "@  04@Vo  0S'0`!4  0@ "@   '040 @UΘ, :,        0@ "@   '040 @U, , 4  0@ "@  '040 @U, |0@,`L  '`<   @4 `L '5`L H %`TP #\H#`#d  H@D'P #\H#`#d  H@D'5 `L Ȁ H `L `#\#` H @[w 1`L %`TP#`#\H#d @DsP#`#\H#d @Df  `L  H   <       !  @<3L   @  @<*L8 L ' P`L %`TP#`(#\`  XP#`1#\ 2'T' :`F TT("' %`T`L P#`#\H#d @C ? `P`dP#`#\H#d@C֖Pl P '`L  H"&  l    8 `    $ 0@  "@`c G>   ?# c?H /f * ' > ##:z!H 0 2H /f * ' > l 2H p@ """2"'"  '>   d" `d'$'gT    8 `    $ 0@  "@`G G   ?# G?H /f * ' > ##:!H 0 2H /f * ' > l 2H p@ """2"'"  ' `H" 'H'D` ?`# >  l     8 `"   $ 0   @"   ?$  $ \H /f * ' > ##9!H 0  4 H /f * ' ` 7`H p@  $ $$ 4 H /f * ' >  9e!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8$ %4 .  ے " 5 2 >gA#    8 `"   $ 0   @"   ?$   $   @##    $  "`:`"`"`"`     8 L D' " %`T`L P#`#\H#d @A   XP#`#\H#d@A w `L  H4 8@Ws, "͉@X78`% 4   ? "@@V9%  $ >  > #@$$(0'@ 8'H'L'L,  ''''`'@ `E  "   'ЖԒД @R"̀  - HL $T;`H#\  H@A[`;`H#\  H@AN`   L  H"˰   В@ "@   'ЖԒД @Qݘ̀ Y̐A L `  В@ "@  Ж@RJ  0>'Ѐ`&  В@ "@   'ЖԒД @Q̀ & '      ?   В@ "@  'ЖԒД @Q̀ l0[̄ ?  . `*Ԁ`К  "@ " " ` "`" " `" #"@"   2 60LL  $TH#\#`#d @@  `H#\#`#d @@t `   " #\L 〦 H #\  `#\#` H@WH /`L $TH#\#`#d @@E `H#\#`#d @@9` ϐ " #\L  H #\Q 8L' < `         @7L 8L $TH#\#`#d @?``  xH#\#`#d@?` ~ L W Hf #\8 @T] 3 .F %%` "" "2    %=%%%> $H`"H  `LX " $TL `H#\#`#d @?``  ``L```2 H#\#`#d@?l`  `L ۀ Hـ`#\@T8 2ް     8 `    $ 0@  "@` G   ?# ?H /f * ' > ##6 !H 0 2H /f * ' > l 2H p@ """2"'"  ' `" ` '    > !h!h  i     8 `    $ 0@  "@`C G  ?# C?H /f * ' > ##5!H 0 2H /f * ' > l 2H p@ """2"'"  '`  D#` D@T'nfsrv_write: nd_mrep not freep'P'D&D`'L" L 0 @ ,''% (% 4 % H> %"":`4`, @,`b2*@ *@ b 2`*  *`> %b@C3`+ >!+`<B <`BI=` ` " ' @N͘  3 H`L %`T#`P#d#\  H@>#dP#`#\  H@=P P @'`L  H  @ "@ ' @N T `d `L   @ "@ @N  0; '$  @ "@ ' @NT $       @ =`%`H  @ "@' @N2  ?  =` ` ;`B=`%`P #  "@ " " ` ""  "  # "@"   @ 4ڐ %`T#\;`  @=/#\;`  @=! #\ 8 @Qژ  %`4=@%`,H /` * ! `H @   `` @`` `8`` @8` ` %` ` ` "`$`  $` %` `H` "`$&`H`H%`$`, h `p *  @@`  `d d@  2 ` `` @ `d``  @`d d@m  "`"4` %```"`$``%` L `` `@  ` @R P 2@  `@`d `@`d d@9  "`L0 %``"`$%`H 0> %bb: 0(@(b2*@ *@ b 2`* @ *`> %"B2**< @ B H /` * ! `H + ' 2 4  ! 4 2 `" $ $"`$ $ "@ `"  "`  "H p@ , L% , 8 #\ L `#`  d@R ' '䀥8L比' <      ' 2  H L@3Ě  H    &&& >  "&6`H   2 2  + &$ & "" "2 2摖> $H`"H  LC';>  l &% T#\#`#d @;g #\#`#d x@;[#\8@P% T  `L``2 #\#`#d @;;y#\8@O    8 `"   $ 0  @ "  E>   ?# =H /f * ' > ##1!H 0 2H /f * '  5H p@ """2"'"  '>  h`"  ' P `H h  h     8 `"   $ 0  @ " C E  ?# C=H /f * ' > ##1x!H 0 2H /f * '  5H p@ """2"'"  '`  D#` D@P' ,`% 4>o9 H /`* !   =`H% `H "`$&`H% $`(   `" $ $"`$ $ "@H 0  H /` * !   =@`H%` `H` "`$&`H%`$H 0> %׀ H 0H /` * !   4 "  ` $"`$ $ " 4P"D"@ 2 4H 0 nfsrv_coalesce: bad off㿘``"``"```"@` `"`$`$"`$`$` "@` @4  "` @ ` @`>s9L#H$ ,`, , (@ `,@@ 2@"@`> +`, (`H` &`,`2 ( H 2 (& H ( &`  (` "`$& (&`$`(   `"$$"`$$ " ( "  ( "`$& ("$`(2 㽠`8 `0`@`' `L `, ?@'''''$'EP  "  ` '@D@ @I< <@ /D`L H %`T,(;`#\  H@9 0 ,(;`#\  H@90   D`L nH D  @@ "@ ` '@D@ @I< y<  `L D  @@ "@  D@@J  D0` '@D  @@ "@ ` '@D@ @Is< J<@ 4 ? $ H".`L`L %`T,(;`#\ @80 ,(;`#\ @80 0 " `L`L H `L$ ` #`@D''#h  '#\#d@Lb$` 80'Į '$=`L %`T,(#\;` @8R0   x,(#\;`@8B0 ؐ`L H #\8 @L$  p0D  @@ "@ ` '@ @H< <@ "     'T ' Dl D  @@ "@ ` '@ @H< n<> @ D  @@ "@ ` '@ @H|< S<` /7D  @@ "@ ` '@ @Hd< ;<@ @D  @@ "@ ` '@ @HK< "<@'D  @@ "@ ` '@ @H4<  <@ @D  @@ "@ ` '@ @H< <@'D  @@ "@ ` '@ @H< <@ @!D  @@ "@ ` '@ @G< <@`      ?D  @@ "@ ` '@ @G̘< <@  'D  @@ "@ ` '@ @G< <@'` '> %"" *`" *  * ''D  @@ "@ ` '@ @G< d<@  H D  @@ "@ ` '@ @Gr< I<@'`-'> %"" *`" *  * '!'D  @@ "@ ` '@ @GL< #< H   '7 @'  @@ "@  '@ @G+< <$>ڑ2 aX <@' ' /` 7``  `    :? ' ``!Œࡖ   ȐHJ ' ``   ' :  6Vv 2`L %`T,(;`#\ @50 ,(;`#\ @50 l `L 2hH0f'K  8 `L %`TՐ,?# @'''' $ @@` p֒`L` %`T,(;`#\  ,(;`#\  ڦ  ᶒK4 Đ9្?  @-Y  ?5 @ @X d' h' X$     $H@  2 $'k$%`T`L ,(#\;` @50   `D`T2 x,(#\;`@40 `L UHSw,    8 `    $ 0@  "@`# ,G>   ?# #?,H /f * ' > ##+!H 0 2H /f * ' > l 2H p@ """2,"'," , '(,>   ( $" (`$'(#@``#@  @J#\8@I0 ,    8 `    $ 0@  "@` ,G  ?# ?,H /f * ' > ##+!!H 0 2H /f * ' > l 2H p@ """2,"'," , '(,  (` # (  '(,    8 `    $ 0@  "@`C ,G  ?# C?,H /f * ' > ##*!H 0 2H /f * ' > l 2H p@ """2,"'," , '(,` ( D#` (D@J'(# "  ߲@ʐ ?  9㽸 L  0  @  8  ,P?H'(',E'  "  ` 'HLH @DD D@ /L L H % T40;`#\  H@3=840;`#\  H@308~Ɛ  L L H L  H@ "@ ` 'HLH @CD PD $  L L  H@ "@  LH@D.  L07 'HL  H@ "@ ` 'HLH @CD !D@ 4 ? $ H". L L % T40;`#\ @2Ě840;`#\ @28~M "  L L $HE  L `, HL''#`#h '#\#d@F,` 8O'(9L L % T40#\;` @2u840#\;` x@2h8}( L րH #\8 @G,    H@ "@ ` 'H @BD }D@> c* @?   r  cL` `H "  ` 'H @BD OD> @ L  H@ "@ ` 'H @BD 4D` /7L  H@ "@ ` 'H @BD D@@L  H@ "@ ` 'H @BrD D@'L  H@ "@ ` 'H @B[D D@@L  H@ "@ ` 'H @BBD D@'L  H@ "@ ` 'H @B+D D@@!L  H@ "@ ` 'H @BD D@`      ?L  H@ "@ ` 'H @AD D@  'L  H@ "@ ` 'H @A٘D jD@'` '> %"" *`" *  * ''L  H@ "@ ` 'H @AD ED@  (?L  H@ "@ ` 'H @AD *D@'` '> %"" *`" *  * ''Ȑ? &L  H@ "@ `'H @AqD D|W6,`?@c *   *` '   ' H B   ܱF. !?# @'''n'Ғ 2@@  ܂ؐ@  @ X d% h% X$ , {,% T L 40#\;` @0!840#\;` @08{ L Hw(4    8 `    $ 0@  "@`# 4G>   ?# #?4H /f * ' > ##&!H 0 2H /f * ' > l 2H p@ """24"'4" 4 '04>   0 $" 0`$'0#@``#@  @E6(#\@DM8# "  ۠@ -  ' 8 0  @ ' L ,  '''F'  "   ' @? 2z / L H % T;`#\  H@/(`;`#\  H@/` z   L  H"   @ "@   ' @? 24   L   @ "@  @@  "'  @ "@  ' @?y z^0 4 ? $ H + L % T#`#d#\ @. `#`#d#\ @.` z2 "  L L  H  L `  #\''#`#h'#d@Bg`  P5' - < 2  @W  @    @ ĔsĀ0  'z % T L #\#`#d @. `  x#\#`#d@.` y  L  H  #\P@B 㼰80@ '<L ,  '8'4'0',h'd'`'D'@'('F'  "   '`d` @>{\ 2\ /dL H $TLH;`#\  H@-PLH;`#\  H@-P y<  dL  H" d  `@ "@   '`d` @>5\ 2c\  L d  `@ "@  `d@>  "dI'`d  `@ "@   '`d` @>\ 22\ 4 ? $ H ".LL $TLH;`#\ @-7PLH;`#\ @-*P x " LL  H+ L`'$` `D #\ d''#`#h< '#d@@D`  ׾'8< 'D CL $TLH#\;` @,P   LH#\;`@,њP xg 8L  HӰ #\ @A#\ H @AyD   Gd  `@ "@   '` @=I\ w\ - HL $TLH;`#\  H@,PLH;`#\  H@,uP x   dL Q H"v d  `@ "@   '` @=\ 2\ (h L d  `@ "@  @=r  0'`d  `@ "@  '` @<Ԙ\ w D\ $w H%L`, `#h@ ' '#`(#\<'#dh@?@`  Hֻ'09 '@  1/tDx <` <    ` `  23 2 `  `2X  X`X@  B   B  Ā  @k "?  |Ĕ|Ex׻@Ԑ I "DתĐ?" pߒ D 3'4D@ )',@ƒ $TL  LH#\;` @+HP   LH#\;`@+8P vΐ  L  H 84@?#\0#\,H@?ޘ' D "@Z@ "T Npn Ԁ Ee !=;` 8  0  @P' L ,  '''Ԑ' ''F'  "   '  @;z 2 /  L H $ T;`#\  H@*;`#\  H@* v;    L  H"    @ "@   '  @;4 2   L    @ "@   @;  " L' L G   @ "@   '  @; 2z /  L H $ T;`#\  H@*8;`#\  H@*+ u    L y H"x    @ "@   '  @: 24   L    @ "@   @;(  " '   @ "@  '  @: un0-`4 ?`$ H * L $ T#`#d#\ @) #`#d#\ @) uB  L  H  L `#\#` @@ < L $ T#\#`#d @)  X2 x#\#`#d@)o u  L  H @?#\ P  <`2  LF S L  ` '#\'#`#hД'#d@=% 䀢` P'q '䀦 ,`    X`X 2   Ԯ6 @N Ð  Dӻ'䀢 ӳ'20쀦 $ T L #\#`#d @(֖  X2 x#\#`#d@(Ė tZ  L  HԐ@>U#\ؐP@=l 㽈 8 0  @ ' L  ,  ? ''''F(  "  ` ' $  @9/ 2@ /$ L H % T ;`#\  H@(g ;`#\  H@(Z s  $ L w H" $   @ "@  ` ' $  @8 2= M  L $   @ "@   $@9W  "$#' $   @ "@  ` ' $  @8 2 @ 4 ? $ H ". L L % T ;`#\ @' ;`#\ @'ޚ st "  L L  H"  L ` #` $''#h '#\#d@;`` 8t' '  `9`V$   @ "@  ` '  @8? > @ $   @ "@  ` '  @8# w` /7$   @ "@  ` '  @8  ^@ @$   @ "@  ` '  @7 D@'$   @ "@  ` '  @7ؘ ,@ @$   @ "@  ` '  @7 @'$   @ "@  ` '  @7 @ @"$   @ "@  ` '  @7 @`      ?$   @ "@  ` '  @7l @  ($   @ "@  ` '  @7Q @'` '> %"" *`" *  * ''$   @ "@  ` '  @7+ @  ($   @ "@  ` '  @7 d@'` '> %"" *`" *  * ''$   @ "@  ` '  @6 >@$ qːZ H ᦐ    h?x'p''h'l''t'  'p@4 `2.@$   @ "@  ` '  @6 q$`7.@ 6V @*  # >` `2`*?# @`''''  Đ@ @Xd%h% X $ nf  `  X' % T L ` #\;` @%|`  `2 X`2 x #\;`@%f p ` L  H` w     8 `    $ 0@  "@`#  G>   ?# #? H /f * ' > ## !H 0 2H /f * ' > l 2H p@ """2 "' "   ' >    $" `$'#@``#@  @:#\8@9)  9  "@ |  `` 㽰 L  0  @  8  ,'L?H'('$',EP  "  ` 'HLH @5;D rD@ /L L H % T40;`#\  H@$t840;`#\  H@$g8o  L L H) L  H@ "@ ` 'HLH @4D -D [  L L  H@ "@  LH@5e  L0 'HL  H@ "@ ` 'HLH @4ǘD D@ 4 ? $ H". L L % T40;`#\ @#840;`#\ @#8o "  L L H  L 'L `, HL'#`#h#d '#\@7,` L8΄'( ',< L % T40#\;` @#8  x40#\;`@#8o,( L AHY #\8 @8F, N Ğ(LL  H@ "@ ` 'H @4D LD> @ L  H@ "@ ` 'H @3D 1D` /7L  H@ "@ ` 'H @3D D@ @L  H@ "@ ` 'H @3ɘD D@'L  H@ "@ ` 'H @3D D@ @L  H@ "@ ` 'H @3D D@'L  H@ "@ ` 'H @3D D@ @!L  H@ "@ ` 'H @3iD D@`      ?L  H@ "@ ` 'H @3JD D@  'L  H@ "@ ` 'H @30D gD@'` '> %"" *`" *  * ''L  H@ "@ ` 'H @3 D BD@  DL  H@ "@ ` 'H @2D 'D@'`)'> %"" *`" *  * ''  H@ "@ `'H @2˘D Dm,` /7  '4L0G# ; ,@ @ X d& h& X$ L̥, L̛'$,% T L 40#\;` @!8  2 X2 x40#\;`@!8m? L THRw(4    8 `    $ 0@  "@`# 4G>   ?# #?4H /f * ' > ##O!H 0 2H /f * ' > l 2H p@ """24"'4" 4 '04>   0 $" 0`$'0#@``#@E  @6ɘ(#\$8@5 4    8 `    $ 0@  "@` 4G  ?# ?4H /f * ' > ##ђ!H 0 2H /f * ' > l 2H p@ """24"'4" 4 '04`  0 #` 0 '04    8 `    $ 0@  "@`C 4G  ?# C?4H /f * ' > ##j!H 0 2H /f * ' > l 2H p@ """24"'4" 4 '04` 0 D#` 0D@6'0 "l@   z 8 0  @ ' L ,  ''''F'  "   ' @0 2z / L H % T;`#\  H@`;`#\  H@` k|   L I H"H   @ "@   ' @0u 24 ٔ  L   @ "@  @0  "'  @ "@  ' @0D k)0 4 ? $ H + L % T#`#d#\ @s `#`#d#\ @g` j "  L L ʀ Hɰ  L `  #\''#`#h'#d@32` '~ ' : L % T#\#`#d @#`  x#\#`#d@` j  L x Hw #\ @3Ę8 l B <   Ā  @ 2  2Ԑ ʽ  @! 0  ɓ8' % T L #\#`#d @`  x#\#`#d@` j?  L  H  #\@3W8 P 0 ' @  8 L'L , ','(''EX  "   '(,( @/$ $ - H L & T;`#\  H@V;`#\  H@I iߐ  , L ǀ H" ,  (@ "@   '(,( @.ؘ$ U$<  L ,  (@ "@  (,@/E  0:'(",  (@ "@   '(,( @.$ "$        (@ "@  '(,( @.$ ik$:  ' L ` > < % %%4 L `#\#`  @4 4 L & T#\;` @'̠#\;` @'̀'i   L  H"C В @3<  5L'耥    @ @WL &L   L & T#\;` @O'̀  X#\;`@?'~'В ɬ   ذ0''Ȑ8'''ؐ''' '0?@'L'4'8'<'H'P'T`' ~ 'L ` `@ "   ǽL '  aL BH2 R  " LL  L & T#\;` @і  X#\#`Д#d@ hV  L ? H"y ̔@2R 0q  & T  X``#\#`Д#d@ h%rД@2(    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##:!H 0 2H /f * ' > l 2H p@ """2"'"  ' " '  f    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##ϒ!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '> #@>     0k'@ ' @'@ '` @ "` ` "`@   X'쀥 & T L #\;` @h  X @@#\#`Д#d@Q f  L Ѐ H΀pД@0    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  ' " '      i 82f`   $ 0   "Z@   ?$T@ p &@@$ H /f * ' > ##!H 0  4 H /f * ' > l 2H p@  $ $$ 4 H /f * ' >  O!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @>  &@u`@ p &@@$ H /f * ' > ## !H 0  4 H /f * ' > l 2H p@  $ $$ 4 H /f * ' >  ؒ!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @&@`@ p &@@$ H /f * ' > ##!H 0  4 H /f * ' > l 2H p@  $ $$ 4 H /f * ' >  e!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @@&@`@ p &@@$ H /f * ' > ##&!H 0  4 H /f * ' > l 2H p@  $ $$ 4 H /f * ' >  !$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @&@``>  l@ n &@@$ H /f * ' > ##!H 0  4 H /f * '   6 H p@  $ $$ 4 H /f * ' >  z!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @@&$@@ @.@?`@ p &@@$ H /f * ' > ##%!H 0  4 H /f * ' > l 2H p@  $ $$ 4 H /f * ' >  !$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @v&@`@ p &@@$ H /f * ' > ##!H 0  4 H /f * ' > l 2H p@  $ $$ 4 H /f * ' >  z!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @&@`` '@ ?'@  @  ` ꀥ ` ?" ''䀢 @' @ p &@@$ H /f * ' > ##!H 0  4 H /f * ' > l 2H p@  $ $$ 4 H /f * ' >   ڒ!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @> @&@`@ o &@@$ H /f * ' > ## !H 0  4 H /f * ' > l 2H p@  $ $$ 4 H /f * ' >   e!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @ >  &@> c@&@ `@  &@$  &@@$ ӫ Ө X 0 '  @ 8 L'L , ?@'''E0  "   '@D@ @&Ƙ< w< - H L ' T,(;`#\  H@0 ,(;`#\  H@0  a  D L e H"= D  @@ "@   '@D@ @&< 2<  L D  @@ "@  @D@&  0'@D  @@ "@  '@D@ @&Q< a70<  '  L   @   < % %%4 L `#\#`  $@,d 2' L ' T,(#\;` @`0'Р,(#\;` @S0'Ѐ '`  L ƀ H Ԓ HH$  L  $ @   @ #L #L$ L ' T,(#\;` @0'Р,(#\;` X@0'w'Ԓ {$  '''Ȕ,(0?'? ?'$?''' '(',`' O 'L$` $ $L$ =L` "  " @ $ ""   L ' T#\;` @ #\#`#d X@  `,  L  H Ԓ@*(ڰ $#\' TД#`#d h@k `ԐВ@*,    8 `    $ 0@  "@` ,G>   ?# ?,H /f * ' > ## !H 0 2H /f * ' > l 2H p@ """2,"'," , '(,>   (" (> '(   @  XU 0A@'' @$   @ " ` 2'䀥  '`   "  "   h''耦 ' T L #\#`#d @ #\;`@  _)  L  H"߰ А@)&,    8 `    $ 0@  "@` ,G   ?# ?,H /f * ' > ## 8!H 0 2H /f * ' > l 2H p@ """2,"'," , '(, (" ('(  ,`  ( `8` ``$`0 `  "@ `  ?$@@ I F>  l`"3  .$  X  " '` 2!@勒 Xd#@h#` X $   L |`t` @ ''쀣@ '@)|> ` 'x'''p @ o't,@(` &@@$` H /f * ' > # e!H 0` 4`H /f * '  6H p@ `$`$@$`4`H /f * ' > ` 2!$`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @&@`@ n,@(` &@@$` H /f * ' > #!H 0` 4`H /f * '  6H p@ `$`$@$`4`H /f * ' > `!$`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @&@`@ n,@(` &@@$` H /f * ' > #c!H 0` 4`H /f * '  6H p@ `$`$@$`4`H /f * ' > O!$`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @&@`@ n,@(` &@@$` H /f * ' > #c!H 0` 4`H /f * '  6H p@ `$`$@$`4`H /f * ' > `ݒ!$`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @&@`p>  l@ n,@(` &@@$` H /f * ' > #!H 0` 4`H /f * ' ` 5`H p@ `$`$@$`4`H /f * ' > `e!$`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @@&n$@@ $> .@?`>  l @ n,@(` &@@$` H /f * ' > #c !H 0` 4`H /f * ' ` 5`H p@ `$`$@$`4`H /f * ' > ْ!$`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @@&$@@ `?' ' 4$@ p,@(` &@@$` H /f * ' > ##{!H 0` 4`H /f * ' > l 2H p@ `$`$@$`4`H /f * ' >  F!$`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @> @&@`@ o,@(` &@@$` H /f * ' > ##!H 0` 4`H /f * ' > l 2H p@ `$`$@$`4`H /f * ' >  ђ!$`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @ >  &@> @&@,@ `@ `&@$` (` &@@$`   `L0 @8,'E'  "  ` ' @9쀢 v@ - HL $Tܒ;`#\  H @rܒ;`#\  H @e Y  L E H"D   @ "@  ` ' @쀢 1 X L   @ "@  @b  0'  @ "@ $  ' @Ř쀢 Y0LА `#\#` Ԗ@$ 6L $Tܢ#\;`  @ ܢ#\;`  @  Yz " #\L ŀ Hİ #\  @"8 Ԗ Ԗ: 8Ԗ yԀ $TL ܢ#\;`  @ ܢ#\;`  @  Y/ " #\L z H"y #\@"H 2n     8 `    $ 0@  "@` G>   ?# ?ܑH /f * ' > ##8!H 0 2H /f * ' > l 2H p@ """2"'"  '>  hؒ`" h '#@ #` L0 @X8,'E'  "  ` ' @ `@ - HL $T;`#\  H @ ޚ ;`#\  H @ њ  Xg  L u H"j   @ "@  ` ' @`  Ĕ L   @ "@  @͔  X-08'L `#\#` @#u 3L $T#\;`  @ q #\;`  @ d  W L  H @! `X `  $TL `#\;`  @ , `  X```4#\;` @   W `L  H`@! 2     8 `  4`    $ 0@  "@@  G`  ?#@?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  '``  4 `"`  4 `+':  @ $$ : @ $ $   ;`@; $ $ $ $ $ $ ($ $$ 0 $ ,$$  $ $ $  L  0  @X 8 ,'TE'P  "  ` 'PTP @L `L@ - H L & T<8;`#\  H @ %@<8;`#\  H @ @V  T L vH" T  P@ "@  ` 'PTP @L L    L 0T  P@ "@  PT@  Vt߰'P L0 `#\#` 4@! 3 L & T<8#\;`  @ @<8#\;`  @ @V@ L  H @ = 4W O4#\& T<8;`   @ @V@ <    8 `    $ 0@  "@`/ <G   ?# /? ##.!H 0 2H /f * ' > l 2H p@ """2<"'<" < '8< 8 0" 8``0'8R   "?  #`,#` #`#`#` #`(#@#`#`#`#`#`$㾰L0 @X8,'TE'P  "  ` 'PTP @L `L@ - HL $T<8;`#\  H @ Ě@<8;`#\  H @ @ UM  TL u H"< T  P@ "@  ` 'PTP @FL L  L 0T  P@ "@  PT@  U0 'PL0 `#\#` 4@ [ 34L $T<8#\;`  @ W@<8#\;`  @ J@ T L  H @ݔɰ  ܔ, 4 ֔(  4 ϔ$ 4 Ȕ 4 ޔ4 $TL <8#\;`  @ @<8#\;` p @@ T L  H@ 2t <    8 `    $ 0@  "@` <G>   ?# ? ##!H 0 2H /f * ' > l 2H p@ """2<"'<" < '8<>  > 8`" 8, '8"(" "c@ $"" "x L! , & T;`#\  @Z `;`#\  @N` S  L 2 H x T ,  L & T L ;`#\  @( `;`#\  @` S  L 2 H 8`2 < X <`"  @ <    2 @&  @  @  `   @" diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapnfsconnfscon sotype㿘`$P P T]X P R $\  2H /f * ' > ##m!H 0)> # 2H /f * ' > l$ 2$H p@ """2 "  " e  H /f * ' #,!H 0 "   4 H /f * ' > l" 2"H p@  $ $$ 4   $  ** 2 " ]R vH /f * ' #!H 0 2H /f * ' > l$ 2$H p@ """2 " " e  7 \ O 90-`^[ (H /` * !  &8`$ #>>!P 6*c* `"8 2 ``<@  2 8`>Ȑ  48H 00H 0`A>!P*@ 44r4r4T  ࠖ!ऀ * ! !ऀ *  * " ># `"C H /f * ' > ###!H 0  4 H /f * ' > l$ 2$H p@  $ $$ 4   "@ ?$ cdW  R `2CࠑH /f * ' > ##ޒ!H 0 "   4 H /f * ' > l$ 2$H p@  $ $$ 4   " $  d !a* *` gɐ #>aP> p @#l@4@4p* $l$$$x$t$p$$$$| $ ?4H p@@/㿘 %> %@( #>?x  cЖ   ؒ  >  `" `2@`$ @"`$@`2` 㿘 P & Pc> \Qnfs send error %d for server %s nfsd send error %d 㿘$ "Pߐ D P 2 ? @&$PՐ : &$\ R    " V` @? ` ]/ !> a $  @  &$>a@ ܔ ? # 2 short receive (%d/%d) from nfs server %s %s (%d) from nfs server %s impossible packet lengthEgad!! receive error %d from nfs server %s `> "@&"@  T "  P@I 9   $`@w 0- P`@%> $  沒  P``$` `W   ? " @R 0 $ @2 @K  s}x ̖А  ''?''''''آȲ @'Ȑ   ^Κ #   # $  #"'Ȁ 耢    " >b  *  w *@  ! ' > >bȔ  b ' @'Ȑ  ^ #"'Ȁ "'Ȁ?"'Ȁ L耢H>  b̘ "  > !'''آĀ !Ā Ȓ 'Ȑ^`Ā`O #   # $ = #耦 "Ȁ  > #  " " '̀ G E?D Oq  & > c  @I 0 " 0*2. ,    А"@'''̤آ'Ȑ ^ # $ 倦 #"'" '̀ O-&@ nfsreply nil㿀> $ @T  @~  @v  ? #\ P2 8$` "N  '쀣`' '  @䀢 N$> "|  !(`N%!($>  `> 1> 0!` 2@` 2@>$` $`0耢`]$`> `, * * " `4* " `4*` ` dl|` *`l |  :    : *`l |  :    > % " `4*` ?*  `4*` ?*  " d  h` $ (`$ "`8"@  ,`  ?"@$ ,4`$< @@@ $$`$ ?$`$$`$ !`4* `*` l `8: #@  `# `4* `*| :`#@@ " $`2Z` ` @!$`N%!$ $2 $  > `  is alive againnqnfstry@'D X !'H'L'X @Ӕ L$<H$4D    $$  @' $+'ܐ 'Ԫ@   Ԕ@# "#\#`@#  " MH0 W     *  '#lH#\#d#p#h#`ܖL@ l܀` _  T <L``"8`$"  ?ܐ" 4 ?"   ?`$$  M "   $ ? "@L$̓*`$ '/> -> %  e h$(> $,`$8 $$$$> $ a$  "aH /` * ! `$$""` P ? T  (  @2H 0  \ @  P `  M  \`@   $ @  !% $` $$H 0 ?$8  H /` * ! `""`" "H $` $$ ?% 2 $ > <`@ ' '   "    'ĖȒĔ @ 2> #H@ "> 'c2 -$> ) 䀢 2 2  PАLd"@La  L\$ ` #\@"zİ  `Ȓ` Đ " 6   @ΒĀ 0.'  Ē@ "@ $ 'ĐȒĔ @2  k  Ē@ "@ $'ĐȒĔ @ L0W A"& #" FK @.`7> %#> x` ˘ @ >"}ڐ`` F2zD" X"@\"@` " K  X"@\"`"K~ 0 K +Ku build > MLEN㿈\H /f * ' > ##ؒ!H 0`")> # 4`H /f * ' > l 2H p@ `$ $`4`$@$`$`$` > #  &H /f * ' >  !$`$H 0`$(` $`4`$`0$`($`,$`<$`8>  @ $ $` `> `X &| &I > > #H&   > )`.& &` ??$` > '# & & & &`L @ `@䖒 *  L > `@2`<     @ ꀦp> l?'p '&&& `  `8` ``$`0 `  "  B `  ?$@ 4; H /f * ' #!H 0 2H /f * ' > l 2H p@ """2 $@$   $  & &&& &J KHst Ljn & &  8` $0   " B   ?$ 4; H /f * ' #v!H 0 2H /f * ' > l 2H p@ """2$ $   $   & &n  k& h&f&  8` $0   " B   ?$ 4; H /f * ' # !H 0 2H /f * ' > l 2H p@ """2$ $   $  @&&`%@`"d "> $`a "a not responding㿘H /` * ! >  )> %> $    $ 2 <@ " 8 $ $ $ ; $ 8h2"d 4>!*` d *l@ |  :    : *l@ |  :   ` >"* {  8 `4 $`$ $  ,@$  (> <`@I  $` $ $ , (@& T  $  $`r$ $ ` dl$ , di$ ,P`e?$ 8`t`x"@``|" 4  `V (   $  @6J 沔 Iz  "A  `    @     `@  )?' #"&\ "!4`8  $`"` ,  $ $ d$ , d$ ,:  $!$ਐ $$ $!$$ 8 2# """: 0(@(b2*@ *@ b 2`* @ *`B*2< *> 7@ (B  H`"@8 `8@* 2 HH 0> #lD`"`$" @" 耢` *@!(  nfsndlck㿘 `  `@`<*  !)  @@!@'>`ʔ  &  !2>!P *`@@2`@@& nfs sndunlock㿘@@*@>!h & *&شnfsrcvlk㿘  *`@! '>  < "  $`Ȗ֙ a2>!P *`@2  $ nfs rcvunlock㿘@*@>" & *&j㿘>b4  "b4l >  l  "^H /f * ' > ##!H 0` 4`H /f * '  4H p@ `$`$@$`4` (+$` H /f * ' >  u!$`$H 0`$ (` $`4`$`0$`($`,$`<$`8$` 2 `>b8  "b8 C F&Bad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad P`0`@`,''   " ' ( ' (@ ٘ > $`X 0   "    ' @  $`T$`L> !@  I> #`@  J  K`2 $`L`$`D `8 L`L ` L2 `D>`* @$`D!`L> 5c ? $`L    "    @  04'  @ "@   ' @ K `@a P $`$`$` g  *` "    ' @ '  `4*"`4 *`:  4`@`!2 '   "  ' @ x 0> c   x ?  ``&`&` 'E H   Ж`!?''''Ԁ 'ܔ@   @ "@  ' @  }  > ! `  @ "@ ` ' @  Z  >!8`at  &a`L`@$`L` &` >֐!Xv`  @ "@  ' @ Q %  >!pQ`  @ "@  ' @ . E0P' @ޣ'` *   L``5> %`2``< ``    @` 뀦` > %"`h@  `l@ ``pĀ@ `&`h` $`D$`T @``L  $`L  $`D$`T  $`0$`@nfs server %s: %s 㿘 " >a h`0`V H'`$ 沐`t&`0沒 "'̐'ԔؖИ SM̠  #Ѐ2` ##`0%   "`8" $@&`&`8 "&`  2&` @T > `0 9&`0 6&`0沪"ԦآФ̐ '̒' S Ѐ` (ĐԀ`Д "`( "&`$" &`("    ` #2`0Ѐ Ր  `$ `0 @nfs getstream㿐 0  >  $ 0 < G 8 $ 0    s{   `?& &      *   `?& &   8* ?$ 8$ < 0  0 ?$ 0 < !@ F 0 8  $ $ $ <?$ 88  @ .  @ "@ D] $  < "@&  < ""@&  < 0 #  $ <@֒ 8$ "$ 8$ < 0 ?$ 0 , ,  @@ 2@"@ 0 "d < (  (` ,"`$ $ ,$ ,U$ (㿘& 0 ". 7 $`2`( 7 & $$`& (T`  $   Р$ ,$ 0$ <`$ @Z  &&a C, nfsd wakeup㿘 0 #> !(" 0>  ? `"` D `& D" 0 2 0> ؐ & 0`"؁diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘>b>  4tȫ > "a<> 7"8""8"`nfsrcnfsrv cache㿀 <  > x >, ؒ  Ѡ >  X ct2  > a<*  q'> $> 7"8 X @2f   D 2a       8@U  "U   2ΐ  ` ,  "` "@$$ "@$   >~!2 a,  )$a, a4 $a4 #`#d#\      a4 $a4  C & a0  $a0,    ,  ,  0 2 X>"8#> b` "8 4   @W b  $b, %> 7> 7"8  " #> ,  aؖ  8     ,  `"  "`   "@`"  "`8"  " " A   @"T H /f * '  > R `l`*@ ?2@  `  Kђ   `"'  8 ` <"<  8 <"`8> $ǐ  ( "4,$0 {$   2  "0 > #@#' H 0  , $8$ "@" ,  X$  8  `  ,  $ 沐 @,  8 B+ $  F4  Xct2  !< * ` $  X 2  * "`  Xct2`@!< @ *`"  X2  * $  ,  , - 㿘 < h X> ct2  > a<*  [>">>c x#> X @2M   D 2H       8@ ߒ  "<    aؐ ,     X  , `,  D*  `"  L 2  * ` T $ 沒 A $ `,    ,  , Ð0 2 X㿘> 7"8"> "8` "`  "@`"`$`"@  4 2> ""diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘H /f * ' > ##͒!H 0  6 H /f * ' > l 2H p@  & && 6 (& H /f * ' >  땒!& $H 0 $ (  & 6 & 0& (& ,& <& 8 & &build > MLEN㿐  ?'D'L'`hpH /f * ' > ##^!H 0"7> # 4H /f * ' > l 2H p@ $ $4$$$$ `( & ۑH /f * ' >   !$$H 0$( $4$0$($,$< $8 " @$ $$ `  ` `8` `$`0 " ? %@ 4; H /f * ' Ւ!H 0  4 H /f * ' > l 2H p@  $ $$ 4 $$  >c  $ ` !>#  (db $#'%#!> -> ('b!> -> d `&# %##a&$@"`$@`$@`$@``  $@``L$@L> x* $@`􀦠$`$@8   8 ` $0   " K   ?$B $@ H /f * ' *!H 0  4 H /f * ' > l 2H p@  $ $$ 4  ($> @$  $ $@@`$@D`` $@D`? $@?`$@`,  $@`>  l  8`" $0  @   ?2_H /f * ' 髒!H 0  4 H /f * '   5 H p@  $ $$ 4 (&$H /f * ' >  u!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8$$    8`" $0  @"   ?$8 mr &$ @c "$ $ ,? $   8` $0   " B   ?$ 4; H /f * ' !H 0  4 H /f * ' > l 2H p@  $ $$ 4 $$   $ `\ $@\$`>  l  8`" $0  @   ?2_H /f * ' 蕒!H 0  4 H /f * '   5 H p@  $ $$ 4 (&$H /f * ' >  _!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8$$    8`" $0  @"   ?$8 l\ &$ c\ " $,? $ $`$@ d$%`l%`"㿘  "@ "P ` $] @`2`W @@`*0"L H "@` l`jG`` < B#$@>`&`$`@@`8@``?&`&@"@@`""`&4`&&6 @&nfsm_uiotombuf: iovcnt != 1㿘  >D#`? ?"ͪ >  l     8`"   $ 0   @"   ?$x H /f * ' > ##E!H 0  4 H /f * '  5H p@  $ $$ 4 `"&$ H /f * ' >  !$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8$ %@      8 `"   $ 0   @"   ?$       k   iA  $  <`  B#$> & M&"`"7"`$k     8`   $ 0   " E   ?$< $: H /f * ' > ##{!H 0  4 H /f * ' > l 2H p@  $ $$ 4 $ %@  @*@` $ &  &' nfs S too big㿘 & &@&@'@o l H>ې!8H /f * ' > ## !H 0  4 H /f * ' > l 2H p@  $ $$ 4 $ $"$  '@j&@  " H   i ' @"$ $ @ 40$ & &@   "   H &" "@㿘      8 ` $0   "  ?$ ?@"@ ` $   i &$ >  lH /f * ' > ##\!H 0 4H /f * ' ` 5`H p@ $$$4(&H /f * ' >  &!$$H 0$ ( $4$0$($,$<$8  0  $ $  "@ `?$      ?"@ i @&$ |&  &@ 㿘>aP> %?a >  >  > !> "l3> %> '> )> +> -> '/> )1> 5#> $ # #c`&`,$$|%#H%`%%&#$c@ d@! !> $#l$#l@  !> S>  " "`!h>Ic0㿘> "h>  L"? 6"`H"`H"  㿈 DX@!  b"  T C쀢 ` @>`' ``+`D*``*'`H  %'@> cБ* @`< >ڐ!X2`  ``4'`8*`" *  * ''􀦠2<" <'$<> #\$8<? > #XX$8w > $ $$ $8y${C$&$$(( /6 & D`& ,& 0X`d-& ` "6 `  & ` & ``     @ > & ``       > H`8& `<& $`@& (`L& 4`P> P& 8.& @` 6 ` & `& ` > `& ` : 2* @* > H`(& `,& $`0*`" *  * & (& (& @`< & 4& 8`@ > P& <  2 @!> % 2   8 2   @( >  < @p > %<> %"$g `$!"&$&(" &,&0 㿘 > %`  X!`#`@ɐ" < 2` 2      > $``  E"```( "` ` 2`( `@!`( 2 `  8 `2  ` @( `<  <`` @p <`gE ``$!"`&`$`&`(`" `&`,`&`0 㿈\$`  $$ @  @@"@ $ "| H "K  /2 n `@$  ,@ @`'@ ?",@& & 2Q  $@$ #\$ h0 #`@ 2> `< w 4 w5 `$$ # !$ d$ q 2   @@`  wQwwJ  $@d$        +" ' (0! , " "   ( #2" 㿘\`@c@    8`   $ 0   " C   ?$ 4< H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2$  $  > c@ $ #@r    8`   $ 0   " C   ?$ 4< H /f * ' > ##Ꮢ!H 0 2H /f4 * ' > l 2H p@ """2$  $  > ` $ #@` #@#`,`#@0#`4`#@8#`$@'@@㿘`c    8`   $ 0   " C   ?$ 4< H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2$  $  > c@ $ "f`    8`   $ 0   "W C   ?$ W4< H /f * ' > ##௒!H 0 2H /f * ' > l 2H p@ """2$  $  > ` X$ "@`X&'㿘V`&`& ` & L 0>@* &`? /&`&`&`H&`L& `F&$`D 3`  &(&,`&4&0`&8`$&<`(&@`,&D`0&H`4&L`8E&P@>c* @&@`2>>!` *`! ` &`&` &@ ?`D&`H*2 @ & `&$`&(`$&,`(?"&0@w#&0`,&4`0?"&8@n#&8`4&<`8?"&@@e#&@㿐> "@\&`rE 2 a F`0 2X `   O` ` 2`c R`` h`+0"t11  d ` &`&R 66     "R   6   $$`       @  H( ``X2 `p `d00 0`2`XH  L`R D>(R   P?# @ >  ( * " **  㿘@ P &@  &` &` 6` V 6 V` `   " V V` Ð`㿘`> % X !`@H" < 2!!!!`     diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapcld kerbnqnfstimr㿘@;  @27@>N#!   8 ̀@8` Ā 2 ` 2 &  & &  @& &  ` Q & @24 #> @2 &`Ȕ  &@2 @>aP@¦  Ē!cԘ  ?2 @  ` "`  "@`"`& "@  32  #" nfsd init㾘 @!2 m> b` "@ '> 7#>"`(`$"` b(  "``(@ O N!6` `K K D'''''kݐ @@ " X ra쀦 5 @ @+ $ ` @ ;``  S `0 "`0`'Sd    0" 0`, `00@ 0" 0`, ဦ `0݀ `_۔ | @ À   `0 "@@˝ *  L    @2  <        逤  >#X`@ 6 `0 $`@ | 3 `0   3~@ ` `"  "`   "@` "`$`  "  1   $ a* PT $` 4 $ $ l> %$ lpx$ p" xt  a$ h < "$  `   $ ` $ 沐 $ Ḕ`< 25 $ $` $ ` "@$` @  *  L` $ @ *  L "` @ * " L@ *  L@$ Ḑ``L @"`L@ " `"` $`@ ? 㿘(` R`   >  d0`"T@1+ڰ T@  !!G "T@10ɀ 2B` H /f * ' > ##S!H 0 2H /f * ' > l$ 2$H p@ """2 "@ ?" cC ` `2E`pR 2A`pH /f * ' > ## !H 0 2H /f * ' > l$ 2$H p@ """2 " "  C@ `p4`r`  ?4`p4`4`  2_!@!$  $ $> 7($ "@"$ $   $ $ H /` * ! >"P$`$` $ 06H 0 nfsdmbuf siz=%d Bad nfs svc reply㿐'L'H'   H /`   L Q`?"`* ! L  4!&@N!L%!%> (% "@">c` "c`L`  #``, 2 @L  2  #> "؀`!>%> #\`% $#\! Ә #\ $#\ b؀ " 2 > "؀`> 7"(0 ` 2D  $0$D% 2 bؐ ?$b " 0 W  @ ?4$0 獐 D!> %":`, 4` ,`@c3`+  +` b 2* *> %@b`C!> %3`+ "  +`<B  H`" @ 8  2 ` 8      %  0   " $ 'H 0 `  `V@4􀢠E> %b "\b`"``< ""`8  # ?%  8`& &\!&d`\  2 h!\! 2 H\۔ | ޴  H   ?%  "`D "T > $ > %"H.< 9􀥠2 ! D`>>!` !Ֆ  D<*` ! !`'!큒  < " .!> $ D!d+   o$ " , +>   !@  >Ȑ# >⥐#$ `:$  ``"  8 `  $"   ?ܐ" 4  ?"     " " .  "    "   $   "@> 0   < g.J b0 @T <`"X ,H /f * ' > <`lR `*@ ?2@ <`  8&  < `* 8 ` <"<`<8<" 8> $ ( "4,$0$`< ?2`<" 0> #<#ȑH 0 ,  - @  ?2! @VH /`* !u >"0`@͔ -`,-`< > % '> %bb: 0(@(b2*@ *@ b 2`* @ *``B2*`*;@ B H / 4H* !H` @   2 `    H 0vH /` * !  "Y   % @% Q L?"`"  "`> "!, "@H   4>c`&? "c`@ѐ 㿘 0  ? & 0 0 $ 0&    ?^"  `PH /f * '  > R `l`*@ ?2@  `  6   `"'> # 8 ` <"<  8 <"`8> $  ( "4,$0 $   2  "0> # ݐ#ȑH 0, , $  ! ` "`   "@` "`&  " , u 3`2 H /`4 H* ! H  "$$$ $$ "@ X  2 & HH 0㿘 D? & D 0 `"  "`> 7"", "@3 2㿘> "` " >b"($` #> 7+> /> )> -> b( b( 0 ` "`$ "@ 2 2 0[b($b($ ` `$` $` a(" %a(ؐ ?%ؔ  2!% d@H! d`"` "` b( "b(" $  db($b(" !  2%@/!" "" " "@$ > S* (      2 L@" D@ @ D ` 82 ` `> % \"*  `( ` (`"@ ( ` ` `!   !!nfsidl㿘>  h`?      h+  2  > *h" P `` "P %``, '> @'> H eH c`> "h%>͒! $@X Q H`R ! NH`"``"`H" ``"@`0 :H?!`\H o *@ e  p    0 2 RZ 0 $ 0   0 @$ 0Tw \`t "`tH 0 2`\H`2` H`hcP?%`"&cP㿘> Xb@ nfsio㿘>  h  >, `2  ,  )d  8 " "d#>!>ΐ`  o!? `  >  h, @  s      , 0d 6"dnfsauth1nfsauth2㿘\@ %#>>!P@&*  b `<a F@">*@&  l!&!& & &  & f&  2 2 ;>5>P * b(Z `<1@ P`  *@& P "  ' *@&' ̐ `$Yɔ * @ & *@& nfs_getnickauth verf too small㿈`4`>4  C@ü*  耧`> %`2``> %`h" 6@> ``"`& `@"@'@ '` "@&   ݔ  "`t & &" '`lbb   b  `p` `b'`l`'`p`'`p`l '`p'' '' x @'\ '   "  ` ' Θ܀ ܢ)~@> %`'@ '`@, a,n>#X ܀ 6   & ܐ | 3u `"  "`  "@`"`& "@&`&x&h &l&tX&p& & "@& `@ C*  耢` &`@ C*  "` `@ C* " `@ C*  &     " &  ' ג )6''@diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapbuild > MLENp L "' b  5 @> $@> $`` "`  D N' R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > ##ɒ!H 0 2H /f * ' > l 2H p@ """2 >] "'" '? @" ' R`#  "  RWu 찒 n(-0.`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > ##J!H 0  2H /f * ' > l 2H p@ """2"'"  '   #  ' WE #\#`  ٻ谒 " .#'  @ "@  ' 처ܖ 9  ؖ Q -؀ 耢 '9䀤` `  " 30   4''  4{ܖ 'a 0b&@ 8 8&`"&`      @ + 3`  &`        @ + 3`  &`      @ aC 3` +  &`c &`$  &`&`&` &`&`&`&`D@ `TV Z`V ZLaV X `D`@Ȕ &gpp> $`` "`  D]`R``  ?'𖊠   `8  ``$`0 `  " ``  ?$@~`4|`     8  `    $ 0@  "@ O?  ?#F?CH /f * ' > ##ے!H 0 2H /f * ' > l 2H p@ """2 >o "'" '? " `@'R#@` #?` RU S  &>0#\#`  5찒 t .'  @ "@` ' . $@   ܒ͔ 쀦 M  @ "@/$0 ' 0  % 08@a >$  $$@a >$ $$@c <$: $$ $%rootnfs_mountroot: root/root on %s nfs_mountroot: getattr for rootnfs_mountroot: can't setup swap vpswap on device 0x%x swap/swapnfs_mountroot: getattr for swap swap on %s WARNING: no swap > %> `;"@ <"А@!(>Ӓb k? >i"(>Ӕ b@@!> @C#D>Ӑ"HԒ> `&& `  """ bb`p#Dc >>"X@ H /e4> 7* &> 7a> dc` %> F>'"x̀?>Ӑ"ڗ; l>Ӑb  2+>>Ӕ b@F@lb l "`<l?"@l$$ `@ >m" *2 @>Ӑ"d|$`#$$$  nfsnfs_mount_diskless: vfs_rootmountalloc failednfs_mountroot: mount %s failed: %d8>Ԑ!a >ؾ!<@"<@ܒ X    j'''''' #  @   T$ @ݖ >Ԑ!ؔnfs_args: retrying connect nfscon㿘H /` * ! ?` ` ` +@ @  @ &H 0` 0 `, +#>%> l@aPVP @ & dl@aP d@6aPaP@l& dl@* "@ d*` @* "@*`& d` " ``0  d& h d& h`"`  ` " `  > & "&   @   4&  @ 4& ` " `$  > & "&   @   4&  @ 4& `@" ``(  <# & $` "  &  4& ` " ``4  $& `@" ``8  $& `@" ``@  $& `@" ``H`?#@$`J6!`@" !`L`?#@$`N6!!! 86!`@ `P`?#@$`R6!`@" !`T`?#@$`V6!!! 86! P " Z T 2 %>#> % !>אbx # 8   &  &$ &( d&, h&0 &4 &8 &@!&H!&L!&P!&T8 P  2p   HPސ ? a K XPԐ * W'>cd 6 < "cd   <@@!쀢` D @ b '!Lv9 @4 P 2.@ YPL 2$ Z$@@P> Y 2$@@@C  2 '@㿘`<@@ "_  !@Ւ!&a$``$``Y>aP> l@O$`    $`h$`$`$`$`$`$`$`d`$`$`$`    < $`L4a4a4a4aQ` ` ``@= `Q Z`Q ZaLQ X$``  `$`X$`T &`L  O  "Mnfsdism㿘!6`  `$%> %#>֒ xcЖ !  ` c *@$d @$" `$   㿐!`L`  `&@㿘 ` $ X2` 2 d p ` ao  2b d 2 X -㿘`(7   $ -002!L&* !K!L&$ !> $ O!L  aL   Om!L >#d      - -diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿀 ؒ #\#` `  .!Tbuild > MLENpX  b<  `<    ` `> $``P "`P  HR``  ?'𖊠   `8  ``$`0 `  " `  ?$@~4|     8  `    $ 0@  "@ O?  ?#F?CH /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2 >ԫ#"'" '? @" 'R`#  " RP S .  z0    8 `    $ 0@  "@` G`   ?# ?H /f * ' > ##˗!H 0 2H /f * ' > l 2H p@ """2"'"  '`  "`   ' <@  2 @2  #2 @2 # #\#`  찒 I .'  @ "@ '  ְ 0.   ܒ捔 쀦   @ "@  ' ̘  2 0@WYopen eacces vtyp=%d 8 `<  ``>"hd    ! "  $!@ "@  " ! "  $!@ "@    |  ": @W$ `< 2   <   ~ (#$   ~z " Ā@"$ `< 2   <    |N   @WŐ$ $  㿘   < #    X!@     @T   4    |# $   ? 4  x X!  ` "3  Ԑ > $H ``D "`D  D Q'R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$}S 4{S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > ##̒!H 0 2H /f * ' > l 2H p@ """2 >`#"'" '? " 'R"@` #?RMu   "n 10`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > ##N!H 0  2H /f * ' > l 2H p@ """2"'"  '   #  'MI   #\#` 찒  .   'o  0㿘` `  @? - ? ?2X $?2 X ,?2 X ?#@" X <`y  ? ?"F ,<?`#>ܐ *` €e  ,?? $?? ?#@ ??2 ? ??N ?5< X <`F  ` ` ` zT  6   <@@U<`?2< $?"`<  ``  z8  2` `` @  ?2< ?<@U<@oLoToTooToTp X> $!H  "Hb  D`  < X`' R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > ##Ӓ!H 0 2H /f * ' > l 2H p@ """2 >g#"'" '? "  @'R #? RKu`  n`70`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > ##T!H 0  2H /f * ' > l 2H p@ """2"'"  '   #   'KO `8?`#@l    8 `    $ 0@  "@` G>   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  '>  %> `"  ' `i     8 `    $ 0@  "@` G>   ?# ?H /f * ' > ##z!H 0 2H /f * ' > l 2H p@ """2"'"  '>   `" @ ' `?k    8 `    $ 0@  "@` G>   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  '>   " `' `g     8 `    $ 0@  "@` G   ?# ?H /f * ' > ##Ŧ!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '@ ` ?k    8 `    $ 0@  "@` G>   ?# ?H /f * ' > ##=!H 0 2H /f * ' > l 2H p@ """2"'"  '>   " `' ` g     8 `    $ 0@  "@` G   ?# ?H /f * ' > ##Ԓ!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '@ `?`?"o     8 `    $ 0@  "@`  G>   ?# ?H /f * ' > ##g!H 0 2H /f * ' > l 2H p@ """2"'"  '>   # ` ' ` `f    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '@ `$> %" m    8 `    $ 0@  "@`  G   ?# ?H /f * ' > ##Î!H 0 2H /f * ' > l 2H p@ """2"'"  '  ` "  ' `$ `(     8 `    $ 0@  "@` G   ?# ?H /f * ' > ###!H 0 2H /f * ' > l 2H p@ """2"'"  '  `"  'g     8 `    $ 0@  "@` G   ?# ?H /f * ' > ##¼!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  ' `,> %" m    8 `    $ 0@  "@`  G   ?# ?H /f * ' > ##P!H 0 2H /f * ' > l 2H p@ """2"'"  '  ` "  ' `, `0     8 `    $ 0@  "@` G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  '  `"  'g     8 `    $ 0@  "@` G   ?# ?H /f * ' > ##~!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '     8 `    $ 0@  "@` G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '@     8 `    $ 0@  "@` G?  ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  '? c " ` '> %"l <`>>!@ *`!  $`?2$ > %"l$ ` ?2$ > %"l$ `$ `$$ `(?"$ @#$ `,$ `0?"$ @#$ #\#`  c .`Q  @ "@ '  G>    @ "@  ' И .'  @ "@ ' ٻ    Zܖ   'ؒOؖ  0    X! @  & X <`" <? °  <   'xB :  8> $TTB S֒  2'&T  sq  @ > $  `"   ($ CTא&> $``  `L "`L"` `` ? $ H ӄ `' R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2 >Ǔ#"'" '? @" ' R`#@` "  RBs`  l`0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > ##!H 0  2H /f * ' > l 2H p@ """2"'"  '   #  ' B} `' ?`  ?`  `  8      $ 0@  "@   ?#|4z     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2 >|#"'"  '? @# '#@` "Aڒ   "N  #\#`  D .n . ''|  @ "@` ' : .@   ِ| "|D `!   @ "@` '  @  @ H"    "  @  '   vxs qR`2  X`@ 2 X 0sWx qx`F 't  @ "@` ' ֹ @   tX t'p  @ "@` ' ֗ @  6p  0} 'l,l ul&d ($R`2  X`@ 2 XQ> rx xH0 `F'h  @ "@` ' G ;@   h /h'd  @ "@` ' % @  Đd  d '`׹`  % `  "($@"& x 2 &x\"?3& ""Qw     X`< ?  ($㿘 `< 2    j 㿘 `< 2    j pX> $!T "Tb  D  'R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > ##h!H 0 2H /f * ' > l 2H p@ """2 >#"'" '? " @'R#@` #? R?Xu` Հ "n`̐0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > ##!H 0  2H /f * ' > l 2H p@ """2"'"  '   #  '> `#\#`  Z찒 " R . "'  @ "@` ' Q 5@   ܒ )쀦 )  @ "@` ' / @ H0 U  0pX   =`B "`8 04 H00߰ 0,`*>  l> $``X "`X@ , P 9'R`  ` ?`  ` `8 "``$`0` ` @" $S `  ?$@$|S 4zS      8  `    $ 0@  "@ M?  ?#D?AH /f * ' > ##!H 0 2H /f * '  5H p@ """2 >H#"'" '? @" 'R`#@` #? R=t  ̐ m0e`  `8`"``$`0` ` @"  F `  ?$@ >H /f * ' > ##4!H 0 2H /f * '  5H p@ """2"'"  '   #  '=1     8 `    $ 0@  "@`  E  ?# =H /f * ' > ##͒!H 0 2H /f * '  5H p@ """2"'"  ' ` "   '#@ #`#` #@`#`#@! #\#` 6찒 "| .9'  @ "@` ' - 5@   ܒ͔ *܀    @ "@` '    ` 'ؐؒӬ    @ "@` '  @쀤    Ī%@ 2   ` ` `> $hX !'P&` `> B 'L'Ԁ'Ѐ` ̰    Ѐ>  l5> #> $``\ "`\   ?` 4 X `'R`   ?`  ` 8 "$0  @" $S   ?$$xS 4vS      8  `    $ 0@  "@ L?  ?#C?@H /f * ' `!H 0 2H /f * '  5H p@ """2 >#"'" '? @" 'R`$ #?qR༐ } m ɐ.  8`"$0  @"  E   ?$ =H /f * ' !H 0 2H /f * '  5H p@ """2"'"  '   #  ':`o    8 `    $ 0@  "@` D   ?# <H /f * ' |!H 0 2H /f * '  5H p@ """2"'"  ' " `' $` $  $L @$ i$    8 `    $ 0@  "@` D   ?# <H /f * ' !H 0 2H /f * '  5H p@ """2"'"  '  " ` `'$ $ $ $F !`#\#` z  .` '  @ "@   ' m >     @ "@  ' T Ԁ    @ `?'  @ "@  ' 5   ܖ Ք Ԁ`''Ԁ d  @ "@  '  e_ 6@% " "@;` `` b >`&`Ѐ  'Ѐ`2 "'#2  А 9F '@  P "95  Ԗ 'ؒlؖ Ԁ `T"` &> $Ѐ L"@&`h X ! ` "D  > %jI  -"l> $l``"l  ? 0 T`` `< ֒ `' R`   ?`  ` 8  $0   " $S   ?$$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > ##Q!H 0 2H /f * ' > l 2H p@ """2 (>#"'" '? @" ' R`#@` "  R8As i "l0  8` $0   " H   ?$ @H /f * ' > ##Ԓ!H 0  2H /f * ' > l 2H p@ """2"'"  '   #  ' 7  Hð ?`  ?`  `  8      $ 0@  "@   ?#}4{     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > ##8!H 0 2H /f * ' > l 2H p@ """2 >̐#"'"  '? " @'#@` " 7) ` Q ` b    8 `    $ 0@  "@` G>  ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  '>  " ?*`  '#@ l    8 `    $ 0@  "@` G>   ?# ?H /f * ' > ##H!H 0 2H /f * ' > l 2H p@ """2"'"  '>  #> `"  '#@i#`    8 `    $ 0@  "@` G>   ?# ?H /f * ' > ##ޒ!H 0 2H /f * ' > l 2H p@ """2"'"  '>   `" @ '#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##v!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  'c@#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  'c@#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  'c@#@$> %" m    8 `    $ 0@  "@`  G   ?# ?H /f * ' > ##=!H 0 2H /f * ' > l 2H p@ """2"'"  '  ` "  '#@$`#@(#`    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##Ғ!H 0 2H /f * ' > l 2H p@ """2"'"  '  `"  'g#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##k!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '#@,> %" m    8 `    $ 0@  "@`  G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  '  ` "  '#@,`#@0#`    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  '  `"  'g#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##-!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '#@?     8 `    $ 0@  "@` G?  ?# ?H /f * ' > ##Ē!H 0 2H /f * ' > l 2H p@ """2"'"  '?  " F`'#@D 2  #`    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##W!H 0 2H /f * ' > l 2H p@ """2"'"  ' ` "  `'>! >ڐ!*`  > %"l$$ $ $ $$ (?"$ @q#$ ,$ 0?"$ @h#$  #\#`  찒  . `  @ "@` ' Ɯ @ C`!  @ "@` ' ƀ @  @ ^ Hڀ     " @  ' ^  Xbܔ  `/  @ "@` ' > "@@   @ "@S  TƬ T 0~'䀦 ؖ 'ؒĔ s؀`"A  @1 ` d  @ "@ ` '  G> @    @ "@` ' Ә -  ` @ `?'  @ "@` ' Ŵ @  SЖ   Ѐ쀦 "A, @.Ԕ&@rA  ` 2` " A㿐   Ah X  ' b    6 X (> $ ``"``  ? ( L` `< 'R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2 (>#"'" '? @" 'R`#  " R/s` + "l`0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > ##!H 0  2H /f * ' > l 2H p@ """2"'"  '   #  '. `  ǰ ?`  ?`  `  8      $ 0@  "@ `  ?#}`4{`     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2 >#"'"  '? @" '`#  "` -`   _ f    8 `    $ 0@  "@` G(  ?# ?H /f * ' > ##y!H 0 2H /f * ' > l 2H p@ """2"'"  '( `"  z' #    8 `    $ 0@  "@` G> (  ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  '> (`  "` 0 `'`H> V#> V!#  "## ?#@l    8 `    $ 0@  "@` G>   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  '>  %> `"  '# i#     8 `    $ 0@  "@` G>   ?# ?H /f * ' > ##+!H 0 2H /f * ' > l 2H p@ """2"'"  '>   `" @ '#    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##Ò!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '@#    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##]!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '@#    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '@# $> %" m    8 `    $ 0@  "@`  G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  '  ` "  '# $ # (#     8 `    $ 0@  "@` G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  '  `"  'g#    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '# ,> %" m    8 `    $ 0@  "@`  G   ?# ?H /f * ' > ##L!H 0 2H /f * ' > l 2H p@ """2"'"  '  ` "  '# , # 0W#     8 `    $ 0@  "@` G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  '  `"  '#    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##z!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '#    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  ' ` "  '`>>!  !*`   > %"l$$ $ $  $$  (?"$ @/#$  ,$  0?"$ @&#$ `` #\#`  e찒  .   @ "@  ' Z  `C!  @ "@  ' >   @  Hڀ     " @  '  XY  /  @ "@  '  `"   @ "@S  Tj T 0~'䀤` ؖ 'ؒ s؀``"`8d ``` @(p`  d  @ "@   '  G>     @ "@  '  -`   @ `?'  @ "@  ' r   Ж L  Ѐ`C쀦  ( #`7` 7ߐ  (` `* 2 ``@%{"`h `` 2`" 78   `<  `5 `D ฀ $  V 2W $%ѐ   S    @$ "    ฀ 2 @'B h 7t$7r㿘   @ pX> $!p `"p" $H   'R``  ?`  ` `8  ``$`0 `  " `  ?$@~4|     8  `    $ 0@  "@ O?  ?#F?CH /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2 >$#"'" '? @" 'R`#@` " R%tS  l0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > ##!H 0  2H /f * ' > l 2H p@ """2"'"  '   #  '%  % ?  ?`  `  8      $ 0@  "@   ?#}z     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > ##x!H 0 2H /f * ' > l 2H p@ """2 > #"'"  '? # @'#@` "$j   ސ}#\#`  Ԛ찒 " 6l . d  @ "@ ` ' ʘ G> @    @ "@` '  - ` @ `?'  @ "@` '  @  0ܖ k  ܀b` 2`" 㿐   XX @     "!` X@ 4 "` D (`  `2` <  @$ 2`4ې `` ```#\`@6#` <`   < ""4 40 4+44 " 㿐`` #`` `#\@pX> $!@ x" ?` "x   H C 'R``  ?`  ` `8  ``$`0 `  " `  ?$@~4|     8  `    $ 0@  "@ O?  ?#F?CH /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2 >S#"'" '? @" 'R`#@` " R"uS  m0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > ##A!H 0  2H /f * ' > l 2H p@ """2"'"  ' `  "`   '";   ?`  `  8      $ 0@  "@   ?#}z     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2 >>#"'"  '? # @'#@` "!  Ē ŀ R`   ?`  `  8      $ 0@  "@ S`  ?#S`4}S`     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2 >#"'"  '? @" 'R`#@` " R t`` m`0    8 `    $ 0@  "@` H   ?# @H /f * ' > ##!H 0  2H /f * ' > l 2H p@ """2"'"  ' `  "`   ' | ` ?`  ?`  `  8      $ 0@  "@   ?#}z     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2 >{#"'"  '? # @'#@` "ْ   M#\#` `\ C찒 "6 .  @ "@ ` ' 9 > @    @ "@` '  ` ` @ `?'  @ "@` '  l@   ܒ `܀`  @ "@ ` ' ٘ F@ @   @ "@` '  - ` @ `?'  @ "@` '  @  @ؖ {  ؀r` 2` 2`" " p  X  X b  `a  / /m `  `O> $|`"|`  ? D   'R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2 >#"'" '? @" 'R`#  " R t 2 m01`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > ##!H 0  2H /f * ' > l 2H p@ """2"'"  ' `  "`   '  R`   ?`  `  8      $ 0@  "@ S`  ?#S`4}S`     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2 (>#"'"  '? @" 'R`#  " Rt`` "m`0    8 `    $ 0@  "@` H   ?# @H /f * ' > ##!H 0  2H /f * ' > l 2H p@ """2"'"  ' `  "`   ' ` N ?`  ?`  `  8      $ 0@  "@ `  ?#}`4{`     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2 >|#"'"  '? @" '`#  "` ` `  "`M`` #\#`  C찒 "6` .'  @ "@  ' 9 n ܒؔ   i`  @ "@   '  G>     @ "@  '  -`   @ `?'  @ "@  ' ٘   xؖ 볰  `؀``]x ` 2`" `" + " h> $ Xa h   b"h@  ?`  L (`  < ݒ `' R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > ##X!H 0 2H /f * ' > l 2H p@ """2 (>#"'" '? @" ' R`#@` "  RHs p "l0F`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > ##ے!H 0  2H /f * ' > l 2H p@ """2"'"  '   #  '   2`  ?`  `  8      $ 0@  "@   ?#}4{     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > ##C!H 0 2H /f * ' > l 2H p@ """2 >א#"'"  '? @" '#@` " 4 ` \ 4`?#@l    8 `    $ 0@  "@` G>   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  '>  1> `"  '#@i#`    8 `    $ 0@  "@` G>   ?# ?H /f * ' > ##W!H 0 2H /f * ' > l 2H p@ """2"'"  '>   `" @ '#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '#@#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '#@#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > ###!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '#@#@$> %" m    8 `    $ 0@  "@`  G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  '  ` "  '#@$`#@(#`    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##K!H 0 2H /f * ' > l 2H p@ """2"'"  '  `"  'g#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '#@,> %" m    8 `    $ 0@  "@`  G   ?# ?H /f * ' > ##x!H 0 2H /f * ' > l 2H p@ """2"'"  '  ` "  '#@,`#@0#`    8 `    $ 0@  "@` G   ?# ?H /f * ' > ## !H 0 2H /f * ' > l 2H p@ """2"'"  '  `"  'g#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '#@@ ?  ?`  `  8      $ 0@  "@   ?#|4z     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2 >#"'"  '? @# '#@` "  `* `v2    8 `    $ 0@  "@` G>  ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  '> > %` "  '"l@$$ $ $ $$ (?"$ @s#$ ,$ 0?"$ @s#$  #\#`  찒 "` .`   @ "@` ' ޘ @`C`!  @ "@` ' Ę @  @ 㢰 HĀ    " @  '   XE   `/  @ "@` '  `"@@   @ "@S  T T 0h'䀤`  'ؐؒ ]  @ "@ ` ' G G> @    @ "@` ' - -`  ` @ `?'  @ "@` '  @  Ԗ   Ԁ`쀦"#T  `` 2` " #{ " h > $`  X ?a  d' "db $ H  <  ' R``  ?`  ` `8  ``$`0 `  "  `  ?$@~ 4|      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2 >(#"'" '? @" ' R`#@` "  RtS  l0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > ##!H 0  2H /f * ' > l 2H p@ """2"'"  '   #  '  ዐɰ ?  ?`  `  8      $ 0@  "@ `  ?#|`4z`     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > ##|!H 0 2H /f * ' > l 2H p@ """2 >#"'"  '? @# '#@` "`n   ! ?#@l    8 `    $ 0@  "@` G>   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  '>  '> `"  '#@i#`    8 `    $ 0@  "@` G>   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  '>   `" @ '#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##%!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '@#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '@#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##Y!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '@#@$> %" m    8 `    $ 0@  "@`  G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  '  ` "  '#@$`#@(#`    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  '  `"  'g#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '#@,> %" m    8 `    $ 0@  "@`  G   ?# ?H /f * ' > ##!H 0 2H /f * ' > l 2H p@ """2"'"  '  ` "  '#@,`#@0N#`    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##C!H 0 2H /f * ' > l 2H p@ """2"'"  '  `"  '#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > ##ܒ!H 0 2H /f * ' > l 2H p@ """2"'"  ' `"  '#@    8 `    $ 0@  "@` G>  ?# ?H /f * ' > ##v!H 0 2H /f * ' > l 2H p@ """2"'"  '> > %` "  '"l@$$ $ $ $$ (?"$ @k#$ ,$ 0?"$ @k#$ `` #\#`  К찒 6  .   @ "@` ' Ř @ C!  @ "@` '  @  @ ۇ H     " @  '   X=  /  @ "@` ' g "@@   @ "@S  TՔ T 0j'䀦  'ؐؒ _؀d  @ "@ ` ' * G> @    @ "@` '  -   ` @ `?'  @ "@` '  @  Ԗ ˰   Ԁ  ` 2` "   `"`[ `` `@ gа  `<`2  `" `D`"`L` ;p  X   b,*LJ m > $t`"t  ? $ H ג 'R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > ##R!H 0 2H /f * ' > l 2H p@ """2 (>#"'" '? @" 'R`#  " R Bs j "l0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > ##Ւ!H 0  2H /f * ' > l 2H p@ """2"'"  '   #  '  I' ?`  ?`  `  8      $ 0@  "@   ?#}4{     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > ##9!H 0 2H /f * ' > l 2H p@ """2 >͐#"'"  '? @" '#  " *  R "؞} #\#`  찒 "6l .d  @ "@   '  G>     @ "@  ' p -`   @ `?'  @ "@  ' Q   ܖ +  ܀`"I `` 2`"  "     'hX!< 'l    2 27 2 Ā@2 > $``  "`!'d " ư  d@p  .G  "@ "" @b  $G p'` > b@'p'$ 't'`'|$'?'x'@ x@Nl #@2@*@%@   x@l #@" ` \ 9h       &``  `p` ?2* 2 @ Ԓ  'h` h  l > I   `"  H  " "@@""@`"<`2 l > $d 2  > $``  "`  ""EEK! readdirrpc resid > 0 ``X>  l`'`  к ` "'L'P''  '> $`  "`  D   ̐H  '`R`  ` ?`  ` `8 "``$`0` ` @" $S `  ?$@$|S 4zS      8  `    $ 0@  "@ M?  ?#D?AH /f * ' > ##’!H 0 2H /f * '  5H p@ """2 >X#"'" '? @" '`R` #?`Ru  ̰ n (0`  `8`"``$`0` ` @"  F `  ?$@ >H /f * ' > ##D!H 0 2H /f * '  5H p@ """2"'"  ' `  "`   '`@ z    8 `    $ 0@  "@` E   ?# =H /f * ' > ##ڒ!H 0 2H /f * '  5H p@ """2"'"  '  " `'     2 k   e     8 `    $ 0@  "@` E   ?# =H /f * ' > ##b!H 0 2H /f * '  5H p@ """2"'"  '  " `' Д` `#\#`L Ԛ䰒 " ~ . ?'  ܒ@ "@ 'ܐ ˘ؖ \   Ԓk QԀ   ܒ@ "@ 'ܐ ؖ ;' ' ԋ0<  ܒ@ "@'ܐ ؖ   ܒ@ "@   'ܐ wؖ      ܒ@ "@ 'ܐ ^ؖ ?   ?"`"@ (`  5@@ "@@" "`"@ &``8 3(@@2 &@-5b- ` @&` "@`? "`P @$@+@@"@@""`"@&` ` `ܐ "  @ ~ 0'܀   ܒ@ "@  'ܐ   ܒ@ "@ 'ܐ јؖ b؀ "&'&'&" /   ܒ@ "@ 'ܐ ؖ 4`?ӆ䀤 > $`""@ 5@@ "@@" "`"@ &`      ? P "Z H0 V 0` >"Ӑ EEK! readdirplusrpc resid > 0  X  'x't`'Lx # ` ''P'' 'p'l'|'h> $`"h  \ R``  ?'   `8 "``$`0` ` @"  `  ?$@~ 4|      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > ##~!H 0 2H /f * ' > l 2H p@ """2 >#"'" '? @" ' R`#@` #?  R S h&     8 `    $ 0@  "@` G   ?# ?H /f * ' > ##}!H 0 2H /f * ' > l 2H p@ """2"'"  '  " `'#@`#@  ` 2`#@`#@`#@``#@`t  #@ #``#\#`L  F .'  @ "@` '  %@       @ "@ `  ' Ę @`'`@'`` l    @ "@ `  '  ` ` ׆ p ?"`"@ @ (`'p 6@@ "@@" "`"@ &``@8'll:+`@@2 '"`p`'p.6".'p`@&` "@?"@@& & @$@,@@"@@""`"@&`` ` "  @  0r'  @ "@ `  '  ]l  @'"@`@'"```@ ``  "S  T T 0;'  @ "@` '  &@L  @ "@` ' Ϙ @``@`` ` "    ' W`2 X`@gÔ 2 Xz'| '2#   '|_| '''4 '' (>ڒa*@  2 '| .x@#  & ^`@&@  2|x``+|  @ "@` ' M @` ``  "    0z'|ɐ '|  @ "@` '  ^@ lb   @ "@` '  A@`? l > $p p""@  6@@ "@@" "`"@ &`l#     P ?` #ϵ|ϱ|Ϭ H|ϧ  |` >%##| Gnfs: sillyrename dir .nfsA%05x4.4㿐p` ' ?c J $@g$``< 2>)", `  4>)b $` ``*`:  z,``@@ ^  `@@  "` `I@A hX> $!L `""L  $ H  `'R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > ##z!H 0 2H /f * ' > l 2H p@ """2 >#"'" '? " @'R#@` #? Rs - l0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > ##y!H 0  2H /f * ' > l 2H p@ """2"'"  '   #  '  y ?` ?`  ` `8   `` `$`0@  "@ `  ?#@}z     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > ##x!H 0 2H /f * ' > l 2H p@ """2 >#"'"  '? # @'#@` "   dр`#\#`  Z찒 "`` . `!  @ "@` ' N @  @ , H`    "  @  ' + z@`"%UR` @ '܀ @4 `>Ւ `R `@ ܀ @ <֔ "`ܐp 2 2 X@d 2X ʐ .tܰ 0P `-'  @ "@` ' Ә "@   rؖ ؀ @ ̥ 0 '^Ԗ ̙ `̔쀧`@    50'@pX!  > $`` "`  DܐR``  ?'𖊠   `8  ``$`0 `  " `  ?$@~4|     8  `    $ 0@  "@ O?  ?#F?CH /f * ' > ##wZ!H 0 2H /f * ' > l 2H p@ """2 >#"'" '? " @'R$ #?RJ S q ˽0    8 `    $ 0@  "@`  G  ?# ?H /f * ' > ##vڒ!H 0 2H /f * ' > l 2H p@ """2"'"  '  #  '$$ $ ! #\#`}K  z .  @ "@  ' E R>    @ "@  ' , 9'  @ "@  '  $   ܒ 쀦 &  @ "@ '  ۰ 0А@b  O !1㿘  "  `X L 2` $ nfs physio/async㿘  0`  >.~"( 0  > "@ 0 ( (f㿘    @ nfsfsyncnfs_fsync: not dirtynfs_fsync8`'`X?!?''L'P*  !@  '  `X!@X V H /d4`p* %`p A > @  0 22o 0- $ 0"@  T:  `3`+ +` ;B  2 ` ( `   ` d"@ @ :`C 8 @      H 0 GP&@!1 `X 6,  0?c $ 0L%H /d * % 0`t '`t 0?`$ 0 0! $ d$ `$ 0H 0 Γ,H /d4`p* %`p Y @ >. 0 * L`2K2H 0  $ 0`X H 0 UP `a>!P *`' 0 >.}"  0 2  0  0$ 0H 0*0 H 0L 3H /d * % >.H 0 P a >!P *`'`p  _`  ?`2` 㿐   `` #\  tag VT_NFS, fileid %ld fsid 0x%lx 㿘 >0  <~t8 <`2>02]>0~k! 㿘 @  bwrite: buffer is not busy???㿘>  0 "@ 0 >0|ؐ! 0?! @& 0H /d * %  ` 2  \" \`0 "`0 \t "tH p@!@  @ 1 T : `* 2`  *`  0:  d@ "@ & 0 \ ,  0* & 02  0& d ?& 0& ` !1 \F`X ` 0@ & 0)`2 p` `0 "`08   X <`  <        'e  2   B㿘 > %` >ےa3 > # `*"@ *`@ *`# @* @㿘 > %` >ےb3 > # `*"@ *`@ *`# l* @8 ` c &>ڐd4 `D` >`X <`>ڤڐ !" ' ' ""  ' '  ' >#> *` €㿘 > %` >ےa3 > # `*"@ *`@ *`# @T* @㿘 > %` >ےb3 > # `*"@ *`@ *`# lT* @8 ` c @a > %bb$ `*" *  * $  " > %bb$ `*" *  * $  $4 `D` >`X <`>ڤR !" ' ' ""  ' '  &>#> T*` €diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapdev = 0x%x, bsize = %d, size = %d, fs = %s ffs_alloc: bad sizeffs_alloc: missing credentialfile system full %s: write failed, file system is full 㿘'@`  0  %@> @  ? `>2 |Y >2zސ  >2zِ 2  Ā "C   ">  `  ̡, <  (@Vp d$ 0>  @X9 " $06 2 `@_ @VU>9 @|  a `@ $`$a'@@Xm  >2@>2 {!( dev = 0x%x, bsize = %d, osize = %d, nsize = %d, fs = %s ffs_realloccg: bad sizeffs_realloccg: missing credentialdev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blockno%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optim㿐\'` %@ `0 e@> @ 2  ?  @  >2`0#{u`>2y#P2`>2y#h ".`````̡,`< `(@U d$ $`.`  `>2`0#`{O >2yԐ# ? ': @W? `@Ug@ɘ `@ $$`dT,@" >2y#g`$6 `2'`<`*`(@U7 `̀@#>9>3` y`$``<`(t@U& d`̀@`0>3 `0y`Ԑ  $`>3 `z`>3yh >9 @: $:`@X <@ @ 6 `T&?  @ =  `$`$`d,"TC0""0H@VS%@` 2" >2@>2!(z"`԰  m'@V ffs_reallocblks: unallocated block 1ffs_reallocblks: non-logical clusterffs_reallocblks: non-physical cluster %dffs_reallocblk: start == endffs_reallocblks: unallocated block 2ffs_reallocblks: alloc mismatchffs_reallocblks: unallocated block 3 %d,>#\`' ` $ z  `` `P?'#>4`, @Td0@ A: 2 x`&` `d8->4, `P " x ,   T+>4, `T " HxwT@T:T@T:2& Ȥ @M] 2  @MT 2 `*`'x * ?0?c 풰 0'x H @` *` * ?   ` *` *  2 >4x!x & ?0.  H'@S>;#@Ֆ '|. |H ` `Td0@ : 2`>4w!Td@:@@  >4wԐ!`X <@ x  0#\@( %@ #\@*%@8 @` x>cX 2>X ` %`    >cX z  0| `X <@  ``Td0@:: `d,@ "T``Td0@ : 2>>4w\!#``>4"x͒8 @դ xx   mode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free 㿘& Ȁ f<@ 2@k,@: @[<@ L @   *@ @ ?*@  ><#@ "9 X  @ 04 `" >6 0xC>6vȐ P>6 hx9& &  &K&   &  >6@ 8>6 w԰ 㿘 `,`@RF`@RB`@R>  @`"<` @\`,`,` cP*  @ 6 `& `&  ` `cP@ 6 `& `&  `  @[= < @: , ``8@Q & : , `4&dd! ` `0@Q̐% &@QÐ @8  @Q8 " `,cP*  6& &cL @?  6cP6& &cL @% 6 cP*  @6 `  cP @` 㿘 `\@X .? 2J`8`t @  @Z``N .?   @Zt`@Q.@Q*` `,@W`@Q!cP*   6$`  8 cP @ 6``, `X (& * ``*  " `@0 $b:`8 2`D0``|*"@ *`@ @Pݓ*`?@Pِ#`8㿘  "`,. @@6&@  , `,@Wv   ݲ``,@"   㿐 .`P@T'` : 0? 8? 4ɰ  Œ.@   d, ? @HbU  > %#Ԁ  > %    0"$ @WT>6!8@"U    :`c `   ?":@ ؘ 璀 8" # 4@"U   ` :`c `   ?":@ "T T> # *`@ ?#@ #*`@  #@ T>/ @"U.`   ` :`c ` `  ? "(*@* $ $ $̚`P?$̒@` ?"`  , X <@ @$㿐 .`P  2 02  .@   d, ? @ H bU " #Ԁ     > %0> %) ǰ "$ 02 T@ܔ08>   4. `   `@ `@ "`@ I  L@@V8 .`# 4@"U  ,` :`c `   ?" +@*8`@8  $"@ $ $̗+`P@ $̔  " ,   X0W@  记 0L@.` 4!,`@"U  ,` :`c `   ?" +*@`*@ $ "$ $̀P"$̒@` ""` , ? $@*`   X <@ @#pos = %d, i = %d, fs = %s ffs_alloccgblk: cyl groups corruptedffs_alloccgblk: can't find blk in cyl㿘'H`  `H@N (8 @UI@bU ``@> 2`X ոP Ѱ|@Ne@bU| -TT  @"U"X- * @U@N;@T@T{@T@v@N(@,`U` @`@ ,`U`$`@,` @,`U 4 U `@,`U`$`,`U e @TC%`@M. L -`#\ T1* R? ?>:!s>:r*!(2T-`#\ * R@"U`@ 2(`L?2Xe` `:@ $ >:!sk>:q!P8@6 6$(x ,`@bU >`@?@ǐ$Ē$ P* "|@Mk|ﳐ@T+@Mc|祖@T!@T@TP@MP* @"U@- Ԑ XP* @?4bU -`TT  ?",r ``X< H@"ffs_clusteralloc: map mismatchffs_clusteralloc: allocated out of groupffs_clusteralloc: lost block㿐` .`T 6` ° :5.@   d, ?V @ HbU  " h#Ԁ  h.$     `@ @  @ T.`` `$z#  t# @L"8  @S_`:  l:`*  &  *@    p *`    @   A @& @"U)>; # `@ 2`p#x@$ `*@ @LO".>;p# @3>;"8pcȢ@@0ܰ cg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedfs = %s ffs_nodealloccg: block not in map㿐 .`P  2  OJ.@   d, ?k 嚰 0@ H`bU"` cԀ` > %凐  "$`@R `:`b@`\@  ?&:@ W.``0` `:" , `@"U@:@`\@ @LR 2``@"U@ b`\@ @LA 2 ``0><# qS><oؐ#@@bU " @`\@ *  .`  *><#`q6><o#p$`0 X <@  @`@"U@:b@`\@  ?  &+@*` <?$` Ȗ P$Ȕ?"  ,` $`P`$ "ihdev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free frag㿐 08 @> @ 2  8T@>  $  >=0#xp>=o#@J$@ >= p#>=!@0 -@   d, ? B0@HbU`  > %cԀ > %4 0"$`@QI0 v`@`bU >@c``@@ / 2 ` >=#p5>>n @"U@"``cؒ@@  @`-` $`ĐP $`"|@JD|쌐@Q@J<|삐@P@P|@PwP@J)* `@"U@, Ԑ@ `XPe@* @ 4`bU ,`T8?.@  `@"U@:c@``@    " %  : :@ `4?@ oT > >-`@"U>=@,``:`c@``@   : *#:@ " `  o>>n 0"``@@    ?# @ *@ +@ ʘ `$$`$̀ P@$̔ "  `@"U@:c@``@  8 " ?% ::@ @  `@`"U@= c``@@  c`$8 " $`$8̐P#@$` #@#` ``$`P$`"|@ID|댐@P@I<|낐@O@O|@OwP@I)* `@"U@, Ԑ@ `XPe@* @ 4`bU ,`T@`T@ @ "@ ,J㿘 X`< @)@$ ffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ffs_freefile: freeing free inode㿐 ,@*>@  0m@Q ,   d, ? K0i@HbU   > %#Ԁ > %= [ "$ @Rk @bU 6` \ `:   >@ hn?LҀ`2 >@l  @"U@6`b \  +@* * 0@*$ 0 , $ <P`$Ȕ     " ?$ P$ ?" ,ၰ bsize = %d, size = %ld, fs = %s ffs_checkblk: bad sizeffs_checkblk: bad block %dffs_checkblk: partially free fragment㿐 0  @> @ " $>@# m̖>@lQ#0@*>@#HlJ @G:@G* 2  dࠓ, ?S Ⴐ?0U@HbU  " #Ԁ "s F?@N0  @"U@# ``@ ߕ>@ .T >@ ! @"U@,   ; # ` ` ` ?#@; 2` ``@ >@kې#h/`?start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %d, fs = %s ffs_alloccg: block not in map㿘 @N"`  ` `, & ``: ``@:bU "@``@`8>!*   ?"? * @R5 +`@"U@ c``@`8!*@  ?"? * @R 2 >A!ؔ`lђ >AkV!" *  &`,:.@"U>>ch#    `:`c@``@  `8 "& $  : : @ @*`@  @ + `@ *`8Ӏ >A"l`>Ak"0 㿘$l h>`.`# (.> . # (.@.$p@8(& .` . @ ` @  '? 8(! .> @ ?@ !$4/  ".  ". "$ (T  ? .`.`&uid %d on %s: %s 㿘>BcP Ԙj diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapffs_balloc: blk too bigffs_balloc: ufs_bmaparray returned indirect blockCould not unwind indirect block, error %d(  P'T\'X@Pj <0 @ ?'>Cj  2%6P  @G ` f @c ` 40`*:  8 <20 @8<0  D L 0 E A +0#`T#\𥳐 n`X <@ .`0#\#\@P`+ ;   @T= $   % X`2  ,   `P* :  8` ݐ0?ݝ  `"@P< D L  @ ?݁ " ް0#`T#\+ `X <@ X#\#\@jK* :  8 D2 0 (0DL tT"  P %X`d*@ " TH@F&<" @`X <@ #\#\ @   $  % @=  4>Chؐ 0 * @'`E'   0T͚ % 'Ģ0 d'.@ <"T@EH"@`X <@ 0#\`  @њ ݑ+ 2*  % '`%  a`ڐ [. 2 0 Ж 0T} .$@*  0 ާd'.@ <"TH@E`# @`X <@  0*` *  @s7* * *` & `&'X..* ?0A { H* `Mb0T `$@0 ; d.@ '"TX`H@E<" @%`X <@ * #\#\@ * X*`& ]n ܻj  X 0?٘ 0  'd.@ " T%I @  @0_`0@ `""@?* * 0۠ ">Cgx h@*X H`&  _  < T@E< ! "@ % %!diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapffs_update: bad link cnt㿈> %"" *`" *   * ''`X`<`   ?%  @    ?%   2     `@% `%   % %  H`B = H  " ⨔% *`" *  * %   ?% e,`4 ! !5 5  ` @K`@K`* `` @LD@K`x``?* `d`0, Ϙ찒 "`X0* <@ @- `xU   "`x>Ff P@L  H* @   `X <`@s ffs_truncate: partial truncate of symlinkffs_truncate: newspaceffs_truncate1ffs_truncate2'T i  < `2a   2<W < 'X @:`  ` `! " >Ff*#@@CM   !  > & ` @Cp 2)@꼔& (& ,& 4& 0X <@ 24 > > @3 " !> "@ Tː "  @Cʔ?@> "@ T  i !`&   C   A?e08ް e4ְ   !T#\`D  T  2ð> @U@1`9T T !`&    @:e< 2`Pp> @Kْ   !T#\`D  T  2X <@ " 42> e8`L e@`0 B 88    @  !> "@T"  2^ > `P * :  8  2`0 8e<`0e<eD `L @鷐<`T$H@BNT2`ٴT`0PT`0  : D`P@KdB??'`t$ '`t$'`0 :` 'L t < X'H? @ "@ "@ @,`@"@ `!&    HM <I <>  (>  > "@ T I?'`t"@ '`t Ⱂܠ "@'`d. @ÚP 2P` $`0fL z? @+  ,!` &`P`* :  8  2`0 8e<`0e<eD `L 8< @۶ I- @E 4`0`P * :  8  2`0 8e<`0e<eD `L > `P * :  8  2`0 8e<`0e<eD `L # >Fd'#p  `T:  < H >F 0,`@ "`d#`>F  H@"d!> " &!&! `& ?@A̖ ffs_indirtrunc: bad buffer size㿐  ''P'X    t̒?P@?w0:   `0" > "@`, ",`0`<@ `8$`0$$`T>Ic!p)ܫ PXu"?"`H0 m 0 t, "@@@*` X <`@  2'رt?o?&@,  d. ?? 2'0(?@ P @E,  d. ?^ 2'   X`0 $`0؆X"diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿐  P @IP 4 0*:  8  2 0 @8%< 0%<%D  L '? 00 %< H @ & '㿘8>/  (-.`>>h㌀  ': ) @@2 8&/@/8 /`/ 8܀ Disk overlap start %d, end %d overlap start %d, end %ld Disk buffer overlap㿐> 8 > *" *  < Б*  T:` @  ;)>J"4 t 0@2/ t \ *  8 2$ t` @2 t < " t T4 t: $ t>J" <" T;  c?>Jb6#  t ˀffs_isblock㿘 8>>K0#  >K@ `?>@ *  @ *  *@  `?>@ *` @ `?a pffs_clrblock㿘 8 >  >K0 >K.@>@ *` @ *` * * .@ >@+ * .@aϐ!@ffs_setblock㿘 8 >  >K0 >K .@>@ * @ * * @ .@ >@+  .@a!ffs_isfreeblock㿘 8 ">  >K0 >K@`?>@*` @*` *   `?>@>   an"diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapffs_mountroot: can't setup bdevvp'sffsroot_device㿐> "@> 7a> c`  >L> F`!> #D >Lb 0?>L>L 0`8E 7#D@   ?"&В 0%> " "฀@  #` "@`"`!   Ԕ Yڑ @ D @q WARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck  v l W < @ @@N  L Ҁ    Ӏ  @<<* $<@u  Ӏ <@2 L Ҁ 2 Ӑ@ $< Ӏ  <@ L Ҁ  *@$< <@0@l E<@B ``  ! \   L р 2 <@>L>L!a Ӱ !a Ӏ   @@  ,   ,@=G$#L    @ `0 @&(&&$&&,` < " > 2 `&  `"<< !!` )     v<@@#   `  2 n j )  Y% Z`" @<ߐ  Y Z`@<Ғ$   Y`@<Ȓ$ @\ 4L l D`&@<@"&  L Ҁ,  Ӑ  , #L@  <@   ?, Ӑ@   ffs_reload: dirty2㿐`D `ՐP ``ʐ I ``  ̚ "@>M_A#`` @D(/`@D!`* '`` @D@D`x``?*  `d` , @`0 @  x@D  H* @ ڂ U % b%0"ffs_reload: dirty1x< '  ` .   o    >N^ߐ!`h ? \ " (<` @<'ܮ ? F H%\aT @ 0@eg8  n  ` #P##P#T##T +  h h#@40 "0 %(@%@D@  4?@:8 ##P 8 0 4x$  d@*@ ?ҙ /ܒH 8 Ӏ @K%$>M  ,  #T%$" , ''''}#㿈 ?$ } > #D t e`      ``<   ? T `h   " (<' @;T   F HaT%\  O 0@@eg( , L ѐ ?`, Ӑ , `<@>L>L!_F %L!_A  %L?    !@:ݒ! h  %` H# h h#@0 "0'`  ,  4@9E %$  ,*  b  @$$#P 8@ 0 4x%  d@*@ љ H' 8@@@%$ Ԁ `` , @ $#T%$`" ,@ &a&`d "`  "` &`h &`h`<%( &`@&`<%`%@%` t %`  d %`$ 8%`(" 6"@t"`" , $#L   ,@:D$#L!ֻ"`Ԓ" @:9%0=aH 0   @>; B?%0 8 <%0%4 <%0C Ӏ @ ߖ   #P #L  , , `<@   ?, Ӑ@  #P " 쀢 #  ` `   &a㿘  *   @ &  %L?&  &%P%, 4&$ 0 *` * ?:   t:`>%0<  @>m %0 B >%0 H L8 8   ;`; >%8>%@$ 4$&$$  @&$ 㿘6`<` @`@ @? 9L Ҁ 2` Ӑ` `, @  "#L),  `  ?"` Ě L Ғ  `  -?`#P   <*@$<$㿘`< a 阔` % , `@<  , 鄒 9`  ffs_statfs㿘!F aTe\ "`4>Q[!p&``0&``(&` `8``̠ &``<`(@7{ d$&```,?&``Ȓ D@ &` `T5 Z `1 Z!La- l `D`@8n  㿘` "  < `  p `` ` `g` 2&@`Z . fs = %s update: rofs mod㿀  )>QLЀ  LҀ " '>Q#\>Q[k#''''"h蘔耢 2< `` @ 2䀢 2'耦` <@ 2  |`   2  @=MLЀ`@Ւ 2inode㿐a @0 & >  8  5 > & RH X@8*! >RT    >" b$ $$ $@0$ " ͐0q@?Ғ༠@?˒*  @@_@?x`?*  d , 0 "xI&@@G H* @ (X <@ "T@!0$> > "⼐@KO " %& w$  2,' `$ $ X`<2, $, $$  &㿘!`  ` d,`@  F@?9  2@ "`"`㿘  ` `4?@5 *cP`8`0`49%``d@*@  { Hը`@a`8ν 2`8&`8 6 `T`d@@j" `h  W,`> %b$` `hՀHeL?H"Pe, 4H8 H"@"H`:0$0΁ 2ffsino㿐> V᐀ 2 >גc #\"> >Sa X!   O @@>㿘`W ?`Q>S#p*` €>!>!>#\> #X> !>"D/&>  D> #\>  4> #H> "p>  #D> 7  8> ( ,>  > #,/ -N<NTNlNNNNNNNOOO O,O8ODdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map%s: modeffs_read%s: short symlink%s: type %d㿀   `>T>T 8Y `H`<`X  @@ 2 ! 2 >T>T XY `H ( >T>T pY`H0 ΰ 2 4@(0ŀ 2    @ b  '  @?6 `` '*@ :   20 8 <0P  <<  D L 0   *<@* :  @ <>!`  ?#\#` $2 $ ' 4' * :  2' @8D ' D L '?#\#`̫ ?̇ )% $`@$6`H`H)g ͣ'   b 4XP`8TP " ͋  % ffs_write%s: nonsync dir write%s: typex' '  >T>U 8X`p  2<9 #  >U&>U &  >U`"=  @ ࠀ  ऀ@0  >U>U W`p>U Wܒ`p'   @  e0B  2<e4 <  `@ ` D  2   %S ߰  ` ࠐ` ?耧   `P@=  e<`0 @ "* $ #\ u<  Bࠞ   ऀ @ D   <@ '@` `@`P`* : ࠀ8 2`0ऀ8`0  e8`L @e@@ @ "@&H(T H@4]`"`0  >!`$ U   "   $ `2o  (  "    "  34  䀢`  _ @@  ' @ b % =   ` `   ffs_fsync: not dirtyffs_fsyncffs_fsync: dirty㿘 < 2   "   <@" @    `?H /d4p* %p  =# 0 $ 0  p _> b,+ 0S  0  >VV!"  P &G  p  0`     0$ 0)} 0$ 0H p@ ~0ې UH /d * % p  " p +>V j H p@@ ,H /d * % p  k< >V"ݒH 0     `?@ 㿘  @, >  N X$  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapdirremmkdirdiraddfreeblksfreefragallocindirindirdepallocdirectbmsafemapnewblkinodedeppagedepinvalid?" " " " "㿘 `&`2@   0] ` &@H 0  > "@``4 & @H 0  sema_release: not held㿘 >W> "@ `4 >WUM# &&2?& softdep_free: unknown type %dadd_to_worklist: already on list㿘  " >XU' H> 6 c c&"c& > V> V!`&" "& > b"ᘐ "b㿈> "@H /4> * %> #0> T"b@`""`"@"@H 0 ?` ->Y"*` €> "#> !> !> #> #h>  > "0>  !>  #> #H>  p> "0M 0>X (T H /d0* %0$"@"@H 0 > # > %` ""> cT  ݰ?"cT> 6`T   @#gT> $T x1 > `   @"`> $` x0 > %bb '' /> T  `@#CT> $T x0ޒ `  @"Ð`> $` x0ђ  " "'耢'А"@''耢 `"w?H /dX0* %Q0`""`"@"@H 0 ?` ->Y"p*` €> "#> !> !> #> #h>  > "0>  !>  #> #H>  p> "0L 0>X (S H /d0* %0$"@"@H 0 ℀   @D> ba`2_T?`> T> ?bb "T0 ddeeee e,e8eDePe\ehetaab`aaabbbb(b4b@bL%s_process_worklist: Unknown type %ssoftdep???㿘 H /> * %> >c""@ `     !`@).    2 2  b@H 0 V ?*@4 `"  "` "@> ?b@"H 0   "  " $  2   " @(" @ t!" @ " @>Y>Y"؀ c>!* >Y# S softdep_move_dependencies: need merge code㿘`p  >ZR!0H /d4>* %>""@ p$`p`""` "@`p "`p" &`p " "" ""  p2b@H 0 softflush㿘> #T` '> #>Z""`$" bh -y "T $"?$T&@!#  $@ &@` N C $T /Gsoftdep_flushfiles: looping㿐 <    2?  @ <@ >ZRF# 㿘 >  X <  @> % bt* @    @  2  @2  2 &G > B&> !b@ > H /d4$@* %$@#I< @/ @ 4 $  $ $ $ $ <  8"?H /d4$@* %$@@ $ @ "`$@$ |!& 㿘> cL> >  b\*  @  @2  2 &c > ^&> !l@    >  @R  > ٨ > !p%> @ H /d4"@* %"@!l> `$!l H!  ??4 $ $ 4 < 04 $ $ ,$ 8$ @$ <$ D D$ H$ L L$ PH /d4$@* %$@@ $ @ "`$@$ & 㿘> cx> > cܑ* @  @2 2 &  > & ܐ > !0Hg $ $ $ @ $@" $@$ & pagedepplinodedepplnewblkplbmsafemapplallocdirectplindirdepplallocindirplfreefragplfreeblksplfreefilepldiraddplmkdirpldirrempl㿐> "!P> "c> 0#>Ȓ @5ah, @ 8 > "!@,z >  N@" > %"bt> >W !b. ah>  OL" > "b\> >W !pb >  Px "z @> "c> >W ܒb  > >{ PbT4 !>נ#> >\#\#`ؒ @  F^ > >\#\!` X  FT > >\#\!0`   FJ > >\#\!a   F@ > >\#\#a <  F6 > >\#\#ha(   F, > >\#\ ܚa8 4  F" > >\#\"0aH   F > >\#\!aX p  F > >\#ah#\   F > >\#Hax#\   E > >\ pa    E#\> >\#\"0a   E 㿀Ӏ K d0G@-. , @;,@   d, 䰒 ,` H` $ '  '  ' @'P  "  " " $" &,@&=  softdep_setup_inomapdep: found inode㿐H /!>* %!>$"@`  ږ  b@H p@>]O"?" ,  @ @X2  "`$ $"`("" ("@H 0 softdep_setup_blkmapdep: found block㿐  >]Od#HH /d3>* %3>&b@@"  "` "`"" b@H 0 㿘 p  >  4 2 >b@H 0 > !Fb  6 6 & & & & & H /d4>* %>""@  @6  p & p"  p$ p& softdep_setup_allocdirect: lost blocksoftdep_setup_allocdirect: Bonk art in the head softdep_setup_allocdirect: non-zero indirsoftdep_setup_allocdirect: lost entry㿈\> Ò F #@+ <  4 $ 4 $ $ $ $ $$ 8@($ 8  ` >^N!8H /d4>* %>""@   ɖ$ 4` 2` $ 0 4  $ 0 `" "```"`$ ( ("`,"$ ,`" "`@`"> Gi!0`2 >^N`!`9 @4 `p $`p" $`p`p` $ ,>b@H 0 >^ND! <   쀢  2 `p "@`p"`$`p" L  @"$ 4L$   $  "@ # b@ @D b@H 0 0+ & 2 >b@H 0 >^M!$ $ ""b@ @ b@H 0 allocdirect_check: old %d != new %d || lbn %ld >= %d㿘`@ >`$ @>` $b@H 0 >_!` M`&`$&`$8`2`8 `8&`8&8@ newfreefrag: frag size㿘`"  8T@>  $> >_M|"ؒ D"0 2 ! ?* 2  "  `X"  " " " x ?' ! ` ''  ` * ' ''> "0FQ㿘>  D ܰ@*h 4  6 6 & & &  `0& softdep_setup_allocindir_page: Bonk art in the head 㿐\ԐH />* %>"b@  <   p –     2  p "@ p"`$ p"  2 >`L `  6  p`& p" $ p&b@H 0 @J㿘 H /d>* %>"@   2  p`" p"  p& p"@H 0 @setup_allocindir_phase2: not indir blksetup_allocindir: lost blocksetup_allocindir_phase2: blkno㿐 P  >`L" )>H /d4%"@* %%"@ p``` 2@`"@   4  p`$ p" & p p$ "@H 0 ` `  >`LI"H /d* %%"@ 2 &0 6  &0`"`  "@ &(("`,"&,`" "` "@> E!0` &$ `*    !  2  @" >b@H 0 >`K"ؐ &   & @" ` & ` "`$`&` H*`" "@H 0  ]$`` H /d * % > c0c0 $c0" "c0$H 0 `">  Bؐ#h  44 $$ T P@   \  Te  T  < ` $ H < H0softdep_setup_freeblocks: non-zero lengthsoftdep_setup_freeblockssoftdep_setup_freeblocks: inode busy㿐 >aKR#H>  B!@(p p 5 ! % , %   %   X 0%   = = !3>  % (@? #@` `  @ ?"@ "@ `  > &! ` @0 `@/`* `` @0@/`x``* `d`0, ? >a@#x`x@0}  H* @^ H /d4&b@* %&b@   ` " b@H p@>aJ͐#   5 `< % <"`"`< <% @@ D D`2b@H 0  H /d4&b@* %&b@@ޒ $ p  p'@d(0 "0b@H 0 H /d4&b@* %&b@@    b@@Vb@H 0 @deallocate_dependencies: already gonedeallocate_dependencies: not indirdeallocate_dependencies: Unexpected type %sdeallocate_dependencies: Unknown type %s㿘 p?`>d *` €` !" `>b@H 0 >bJ#ؐ!` 4`  @``  P >` TP@ >b@H 0 >cI H Ha <` ?*@4` @`"``"``@"@`  4` ``p $@`p" `"`p` p$` '> *`$   @ $ *`<@y`< ` "(`  ` "`  "``$ ` 2 n   4 `<`$`<" &`<`<$  2 ` ?*@4` @`"``"``@"@` `"``"``` "@H /d40* %00 $@0" $0$`H 0 4 p@ / p>b@H 0 `>c`  (>!*` >Y#I> >b@H 0 `>c`  X>!*` >Y#I(  p`2`44ȝ㿘` 2 ` `(`"`,`,"`,`,`("@` ``"`& `` "@` `2`8?*@6` @`"``"``@"@`8   2 `8`4`< "`4`8 <"`8`4"<`4`8`<"  H /d * % > c0c0 &@c0" "c0&`H 0 㿐 >  ?# 6 6 6 &  &  `X& H /d5>* %5>&@  Ȗ @2 "  b@H 0 @ 0  6 `@ & @"`"`@ @& @H 0 check_inode_unwritten: busy inode㿘 `2M  8 2I  < 2E  @ 2A  D 2=  L 29   ` 3 6  $` ("`( ( $"& ,  @ ?*@6 `"  "` "@  O& @   >b@H 0 >dH#    2H  82D  <2@  @2<  D28  L24  20  " * "     H(> 00"0  0" H > l  lhandle_workitem_freeblocks: block counthandle_workitem_freeblks`  ! `  +>  ' ''' `   ,'?x'''tŊ ?@ $ 0 : 'Ĭ ` 0 `d,@ @rĀ " 0>Đ'Ĩ? ,`# 40P* : x |20|8<0<D L ē<  'Ĥڑ, (Ā@>eH"(>e"P@ H /d * % c0c0 &c0" %c0& H 0 indir_trunc: lost indirdepindir_trunc: dangling dep㿐     '>t? H /d4$@* %$@   ['`p"X@ 2 > > a2 ?>b@H 0 >fFΐ Ȑ*@2 `""`"@H /d * % > c0c0 "c0" "c0"H 0  p` @>b@H 0 >fF H 0 @H 0  0? "/ H0t? !:` l , ` d.@ ^ 20*'?(0 "0㿘 2   (`" , ,"`, , ("@  @ ?*@6 `"  "` "@ `"  "`  "@ `2  0   2 `<`"`<" `<&`<"H /d * % > c0c0 &c0" "c0& H 0 㿐 2` `*0&`P@,9 e< @>  =!#H@#   5 5 % `%  5 H /d4>* %>""@ 1!>  p5 <   4 4$ <  44 $ $H /d4>* %>""@> aP aP$aP"`$aP$   4 `p`$`p" '`p`p$@H 0 uH /d4&@* %&@`  ` ` $aP ?# @5 H /d * % > c0c0 $c0" "c0$H 0 aP $aP"`$aP$   4 `< $ <"`"`< <$     2  p "@ p"` p& p" % > @'}*   $` %  @'s*   $ " @'j*  " $ @'c*  $@%  ` 2 @ @  5 `< % <"`"`< <% @H 0 㿐H /d4>* %>""@ e<  `Pk; X&&  @'<*  - $`"  "`  "@@' *   $` &  @&*   $ " @&*  " $ @&*  $@&   2 >` & @&ِ<@&Ւ 2   <  2 & Ŕ@H 0 free_diradd: unfound ref㿐 ?*@6 `"  "` "@ ` "`  " 2  `  "`  !` I  "  `0 P> > !P=#  4  *@6  @2 `""`"@`""`"@H /d40* %00 "#0" ##0"H 0 ` `0  >b@H 0 >iC H /d * % #0#0 &#0" ##0& H 0 㿐@T ` " `  "`"`  ">b@H 0 0"" `"  ` "" ` " >`"@H 0 @ې newdirrem: whiteoutnewdirrem: not ATTACHEDnewdirrem: inum %d should be %d㿐>iCD#> a!> 2  ": $" @ "> `$" :p"0@ R  6  @6 6  X& & 'H /d4>* %>""@` e< ` `PǓ;    2 `p "@`p"``p$`p" >`& @%a *   $2 2  <2 1 2 >b@H 0 >iBǐ#@>b@H 0 >i#B ?' c 2 "  `i6 㿐`  %<` >  9ِ#H@   4 4 $ $ A   2  2  "   "` & " A">"@H p@ 0v $  " $ ?# @4 $  %"`   `  <` `4 < $ < "`<&<$    4 `8 $ 8"`"`80 8 @$*  $` $  @$*  $ "`@$ * " $@$ *  $$    4 `< $ <"`"`< <$ >"@H p@ softdep_change_linkcnt: bad delta㿐H /d!>* %!>$"@   V  @  "@H p@>kAŐ!p "2`"@H 0 handle_workitem_remove: vgethandle_workitem_remove: lost inodedephandle_workitem_remove: bad file deltahandle_workitem_remove: bad dir deltahandle_workitem_remove: truncate㿐 >  b@   >k@)"P0 H /d4>* %>""@    2  b@H p@>kAW"p @C  ?* `:  $  4 b@H p@>kA@" "2`b@H 0 N> b?"bH /d * % > c0c0 &c0" "c0& H 0 0 ?* `:  $ 4 >kA" "2`b@H 0 !  @ >k@" $> b?"bH /d * % > c0c0 &c0" "c0& H 0 0@H /d4$b@* %$b@ 6  &   b@O  b@H 0 ̿0   6 `@ &`@" "`@ @& b@H 0 ̣handle_workitem_freefile 0!P  ` '<`  'D 'P'8N' >l@#H /d * % > c0c0 &c0" "c0& H 0 softdep_disk_io_initiation: readdisk_io_initiation: indirdep gonehandle_disk_io_initiation: Unexpected type %s㿘 0@" p>m@  ``?` u@>m"*` €@y@Tt` !"`>m@ 0 23 <`(0 "0M`` ?*@4` @`"``"``@"@H /d * % > c0c0 $@c0" "c0$`H 0 9 S $` H /d!>* %!>$"@` ?# @`4`  H <(` ``H <# H"@H 0 `>m`  X>!*` >Y#? `2y` initiate_write_filepage: already started %s: dir inum %d != new %dinitiate_write_filepage㿘 "">m@ې#0H6 H /d4>* %>""@ *` $)`?#>m>m`H @ >"@H p@ @H?5ch "#  #   2  2`H`ґ*`"@H 0 initiate_write_inodeblock: already startedinitiate_write_inodeblock: already doing I/Osoftdep_write_inodeblock: lbn order%s: direct pointer #%ld mismatch %d != %dsoftdep_write_inodeblock%s: indirect pointer #%ld mismatch %d != %dsoftdep_write_inodeblock: Unknown state 0x%xsoftdep_write_inodeblock: lost dep1softdep_write_inodeblock: lost dep2㿘 " >n> Ƞ" 6 x@$5 `H*  @  O>n>  o &   @ 0` D> 0H /d4>* %>""@ D d `(>n>n>n @  b@H p@>n>h!(  +    b@H 0  P*  >Qက ?* `X@   b@H 0  `X*@ a>7တ  * ` b@H p@>n >&!?# @ 4   D b  ` _ `( *``("  $`"M0@"I  $ : >`   `X*>>n@ < 2 "@@H 0 =b"@ `  >>n@ * 2 "@"@H 0 =ΐb("@`"@H 0 0E   ` $  *  0 `: 0  2 `  `(*   *`" : >`  `X ?* "@ 2 "@H 0 disk_write_complete: indirdep gonedisk_write_complete: not gonehandle_disk_write_complete: Unknown type %s㿐'?*@4` @``"``@"`` >q (*` €@ @   `  4` `$@" '$``"%> " "`"`"`2`"0 2 (`",,"`,,("@@ `2 `$ 0 4  (`" , ,"`, , ("@@ ` 2 ` 2 $`"(("`(($"@",`2 H /d40* %00 $@0" $0$`H 0 _ p@ Z p` `@4` S p` `@4` L p` !" H>o<#@`  <` j S` ?# @``4` $` %>o@`<h `   4` `$@" '$` 0 > 7`8 "`8 p`>o` #>!*` >Y#q< X  D 0    2 $ `  ` `  D 2` handle_allocindir_partdone: dangling dependency㿘 O 0 " $>q;!H " ` "`  "&  "`"1& `H  * " `"  "`  "@ H /d * % > c0c0 &c0" "c0& H 0 handle_written_inodeblock: not startedhandle_written_inodeblock: new entry%s: %s #%ld mismatch %d != %dhandle_written_inodeblockdirect pointer%s: %s #%ld allocated as %dindirect pointerhandle_written_inodeblock: bad sizehandle_written_inodeblock: filefreehandle_written_inodeblock: Unknown type %shandle_written_inodeblock: live inodedep㿘 b!?>q;."А! @  6 x@   * `H@   ޒ O& `0 > (`, "`,K  D2 #>q%>q'>q!>q>q  >q:" 4*`( " c@:` *`X@ "#pc@:#@  0 آ `"  0`0 2 0> ` "` 0?  4?2`>q:Ð#` 2 0`  4@? 0 8`??`> 0 D" < <>  ?*@2 `""`"@>r#* €`  >q:#А @q  < @8 <O  <>q` #>!*` >Y#:n  <2 ` W >r:` (0  L 2  D 000  2 "   < " < <"<"  2 `8"`8 `8"`8"handle_written_mkdir: bad type㿘 @" >s:  * 02  2  ` 2 `"  `"` " <"  < "` <# <" `"  "`  "@H /d * % > c0c0 &c0" "c0& H 0 handle_written_filepage: not startedhandle_written_filepage: attached㿘 b2?>s9"! @6  `"` " "j  2  <R  <   * $ ,?#>s  9|@`H   "    ` 3  ` "`  " <#  < "`& < <# `2 ϑ*`"  <`0 > c, "c, < 27  $    $`@ "2'  `"  "`  "@H /d * % > c0c0 &c0" "c0& H 0  㿐V & H /d!>* %!>$"@   -  "@H 0 0  `" & "@H 0 softdep_update_inodeblock: bad link countsoftdep_update_inodeblock: bad deltasoftdep_update_inodeblock: bwritesoftdep_update_inodeblock: update failed㿐H /d4>* %>""@   ֖ 2"@H 0  V @>t8! V "@ "  "@H p@>t8!?# @2  `  2` `p "@`p"``p&`p" @] D "; @%#  2 `""`" @ 2  <`" <"`" <`<" @2 ` 2"@ `,"@H 0 0@D "@H p@   `, >t@ǐ! `>t8" 㿘" D @6  ` "`& P  "$ $  "" 2 L  D( L 2 L` "`& P  "@$  H $  H"& H L 2 softdep_fsync: pending opssoftdep_fsync: Unexpected type %ssoftdep_fsync: dirty㿈>  "@H /d4>* %>""@ ͔  b@H 0 ̰ `@ 2>`< 2 >`D 2>`L "`8>b@H 0 >u7u!Î0"b@ >b@H 0 >u` ">!*` >Y#7V    $` ` `>b@H 0 >u7="@@!m b@H 0   `_ [  !     P`*  :   2 0   0 %<`%D  L ` @ ~ !H /d4&b@* %&b@   82bb@H 0  softdep_fsync_mountdev: vnode not a disksoftdep_fsync_mountdev: not dirty㿘̴ >v6" H /d4>* %>""@ p ? 0 7  0 $ 0 0`2  p>b@H 0 >v6"P    0 ?$ 0 b@H 0 H /d4$b@* %$b@ p  @b@H 0 softdep_sync_metadata: Unknown type %s㿐` E 2 X <@   0    <@H /d4>* %>""@@  b@H 0  p@"  2 pb@H 0  p   ?` >x#H*` € 2 0'@ b@H 0  f 02H /d4%b@* %%b@ 2 0'@֒ b@H 0  = 0 H /d4%b@* %%b@ `"` 2!` `0'@  b@H 0  H /d4%b@* %%b@`2`  @  }b@H 0 0¢ $ @  @” b@`c '@d Zb@H 0   0hH /d4D%b@* %=%b@ '@? 5b@H 0   0rCH /d4%b@* %%b@>b@H 0  >w`  >!*` >Y#4  2  @b@'H 0 H /d4* % %b@Ӭ@  2pb@ H 0 H /d4%b@* %%b@ b@H 0 . H 0 Ґ$H 0 ʞ   `#    ``  ߤpx㿐 %>@H 0 H /d4$@* %$@ ⃖ " + DH 0 `t0 H o4I$@*@ eB$@H /d4$@* %$@  2  0'@2 2@`" @, LH 0 `30 H o4$@*@ e$@1H /d4$@* %$@  2  0'@ 2@`" f@`c    flush_pagedep_deps: MKDIR_PARENTflush_pagedep_deps: MKDIR_BODYflush_pagedep_deps: lost inodeflush_pagedep_deps: flush failed㿈> "@ a ->ꀊ 1@H 0  ! -> H /d4%@* %%@2   H p@>y3["@ G@H 0 ``  `   `  Q @y KH /d4%@* %%@2 "   H p@>y3"h  ?  >b@H 0 >y3"` 2$@`,@ @H p@  `, _H /d4%@* %%@2L@H 0  `@`@`* `` @I@`x``?*  `d, `0 $@찒 H /d4%@* %%@2  H p@>y2"2 H /d4>* %>""@㿘> ! * * @" > 2: @ > > !l@ >  cD  "cDrequest_cleanup: unknown typesoftupdate㿘> "@> %bԀ1> a@  > b$` >"@H p@  ް  ޭ > `D` v"`DH /d4>* %>i""@f  c  `0> > 6 4> `T` p> # 4#`T"X> > #\> `` H> ##\#`"X" >z>"@H p@ >z1#` #>H /d4$b@* %$b@> > x`P  ` "x>"D`& Ȑ b@>z (ؐ x    x$b@` $ xH 0  㿘> #X!>  x`"1  x  >"D> `P  clear_remove: vgetclear_remove: fsync㿐H />  `@>{@6"0S* %> `@>   ?""@> %>H`@*  t  H H +!>{ !@H   ͖  " @"@ a0 2 `@  H@H 0 clear_inodedeps: vgetclear_inodedeps: fsync1clear_inodedeps: fsync2㿐H /4> * %> #L>  "b@> "\>L *   : @ `2 L **  L' "@H 0 0t>|@ h0p>   ฀@ `<@"@a 2@x  ?I  0A  9"@H 0 `` €   w >|@O 0 l ">|@C @ؒ H /d4%"@* %%"@ "@H 0 softdep_check_for_rollback: Unexpected type %s㿘 H /d4>* %>""@ p Y ?` 6>}!X*` € 2 D`G D ?`A<  "8`8 `/  $@ " `) ``2  >"@H p@  >|` #P>!*` >Y#0  2  >"@H p@  h4sdsdty㿘' #>%>}2  0@$ 0b@    $b@ "  0 퀦` 0   0  $ 0drain_output㿘`2 tH /d4>* %>""@ t `#>%>} L t`& Lb@ 0  z $b@ t 2 L` >"@H p@ softdep_deallocate_dependencies: dangling depssoftdep_deallocate_dependencies: unrecovered I/O error㿘 0(2 \>}/g#`X 4@ >}/`#8%s: got error %d while accessing filesystem 㿘>}#0Ŕdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapmfs_mountroot: can't setup bdevvp'smfsmfs_root㿐> "@> 7a> c`  >~> F`%> D >~0} 0W>~>~ `% O . ̐ $> 6X> a4> ܒ D" 8" " $ $ $`4$ $ Р  ?"웒 옒 .0%> " "฀@  #` "@`"`!  `Ԕ YY ʒ Dɒ@c:  㿘\F!T@2& 0@@4! eg8$ >~4> F> 6"# X> Va?c ?*`@   > > F"`#a"ܰmfs_mount: dup dev' t @<@>  NҀ ` @  : jNҀ a<@2].` !4  m| X!> V!?c |?# *`# <@ | I "!>~./#8 . $!  $|" |$  $  4$ $ $֒ &|x Ԑ!rx"`Ԓ" @ ,x Z Ycx Z`" @ Li t ?$ mfsidl㿘!   `?B`#+>$`@˒ ` 2 $%  Ö 2    耤  ,(" ? *@, &  >"ax  `?2` 㿘ѱ ``D@ P  D@ !La t -㿘Ӣdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapmfs_open not VBLK㿘  <`>-V#  mfs_strategy: bad dev㿐>   "@ D `D 2`>-9#`  ` T 0* @   H <0  H <]0" ` 42``@ 0& $"`  㿘 T 0* @ @ H <& 4 H <& 4 4 "& @ 0(& 00 "    "     2" mfs_close: ref count %d > 1 mfs_close: dirty buffers mfs_close㿘 `$` ` 2 $    > D`>.(!` >."!D >` "?>,!$` u mfs_inactive: not inactive (mfs_buflist %p)㿘  ``" >,"   I 㿘  . : $ tag VT_MFS, pid %d, base %p, size %ld 㿘 >`#h   - mfs_badop called㿘>,R#diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘 "   ` "      @  ufs_bmaparray: invalid argumentsufs_bmaparray: indirect block not in cache` X  a쀧 >` >+ Ѐ`'@`L@@?"Ȁ "Đ@ږ  6'Ę .`$*@ `&`" `` 4 @6 * .`( @ 2  @` ` '@6 ( "@ 0 * @ _   &`L ј  0"2`>+  0$ ,@ $ 0$ T> b@,`u",  H*Ķ `,`)`( @#@ė.` ?( @ @` '@ @ @ .` H ?( @ "@Đ? 'Ā`O   "$}$,@`&?& ufs_getlbns: Invalid indirect block %d specified ufs_getlbns: indirect block %d not found㿘 X!'`&   ` ?` > *_   &@`S  @  >`   2 ( % ""@ "&&& "  @   @@ &&:& @  `" `2   > * 2' diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘>ah> %  > > "c"`> % >   㠅(  222㿘> "@'> %%>  @*` "  @2 2  ` 0 2  㿘> "@     T> %c>  @ * @` `2 @`@2 @ T   `2`#@ c*   & " " &    2   "" diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapffs_inactive: pushing active㿘 > a    D >"T "1 V 4#  X <`2 @ ?@Z !   @? &  `!& 6     !`     `  ufs_reclaim: pushing active㿘>!`"   D > @ c $ @  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapmangled entryi_ffs_size too smallh' <  'Ȑ ' '  ''@ ` ?ǰ  ג @   X <`?  N [ 2@ T/  l  "Ѐ` `̔ Ѐ     F `Tj Ѐ    1`'@Ҝ S ''耦'䀦2 X "X   ?'X`L'`|  `:`   2$`` 8$`$`  *'$`Ԧ@  a:`     > 0'$`  `` "`ܒ'> ch` 'ܐ "`` aB 2` * @ `* ' ` "`F` a`:    ٦ `2 H?' H@   >#`@ ``>X@ɐ `"" @$`Q`( * 2   ?"@`@``2' 䀥 '`@2` "' "`  2` @   2`X @`$  "c $` z$`' @$`    `&r܀`| '$`  2L `   @ @ 2D  "@ ` ; L 4` `$`taB 2` * @ *  $` 耍$` $`tؐ% $`t $`@$`ta,c` ~ $`$`x А(% ْ ? @VT@U ܀ 2`> ch` "`` `   `8>`> h@ `  `  <`$`' ` >$`|G B ɒ `!$`t" $`t`` 2X'@  `" "'@a" '@!@ "'@  '@Ѐ`~ O x ,̀' $  g`` 2X`   Y '@ (Q% # L # X `` `~06Ѐ`( %s   L0&`` 2X'@  Ѐ  '@ @@` %s: bad dir ino %d at offset %d: %s bad dir㿘 >`X!  'k D`>%!0First bad Second bad 㿘  ""  @ > ? @ $>'D!     >':! @    J@ `@ &J@J   ufs_makedirentry: missing name㿘`(2 >%"x&`.``   X`@< 2 ..ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2㿈 t  ? `v " X>%c#! <@   #\:`  " "  X <@ :":   <@$"6 Xa`L`H @ X <@b`<@6 "`H2 b`<@&`H:  Xҗ X`<2  İ° : 82 t : <`:      X <@      ?t  @ ("`4  `  X ?` <"@  @  t t@   @  : 6>$#(66>$#@4  X <@ " : v]  )$x %:  8` ` x @:   ``t㿐` !`:    \ "@ * t !"@  :`   F t "  2`X <@ ` `&`Lq 0 ``?``&`&`6``X <`@  t  ]  $ 㿐`a`:  `  /" X`@ * `?&` X`< " `ὐ0 ` &`6` X <`@`` $``   2D ?` ܐ  #\#`#h#d#l  < 20 ܀ 2,     4 M  .`2M  "  M .2    D4 @8  checkpath: .. not a directory `` ` '= ; 9'܀6  ܀ 21 ?  (  @逢`# #ܔ`X 찒 <   #`#\ #d#h#l   ˿  2>$\ P܀ diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapundefinedgroupuser 2 㿘  X @`!! @ @  " D D 2 !  D@ݖ    chkdq㿘@C`I        @,2`,`  @ 2-``,  *`,` @   #> 4  c $     , @ 4 $ ,`ސ  ufs_quota_free_blocks2: vnode is not locked㿘̾  `>" `/?#  * $`*` @   " ,#> 4  c      , "$ ,$ ,   4 `ؐ  %s: write failed, %s disk limit reached %s: warning, %s %s disk quota exceeded %s: write failed, %s %s disk quota exceeded for too long㿘 @.  , $ `" (  2X E! 2S E >X# `>"!xC  ( C`"B  , > % . Xa ,⨒@ $ <! 20  >X#>>!`"# > %" < $   2 E! 2 E >X#. `>>!"h  4  E chkiq㿘@ `    @,2`,`   @ `-``,  *`,` @   #> 4  c      8 ` 4 $ 8`ސ  㿘ˣ  2?>! `#ߒ  * "`*` @   " 8#> 4  c ɘ     8 ?$ 8   4 `ڐ  %s: write failed, %s inode limit reached inode quota exceededinode quota exceeded for too long㿘 @.  8 0 `" 4  2X E! 2S E >X# `>!!C  4 C`"B  8 > % . Xa 4⨒@ $ @! 20  >X#>>!`!}# > %" @ $   2 E! 2 E >X#. `>>!!`  4  E chkdquot: vnode is not lockedchkdquot: missing dquotmissing dquot㿘  Xa쀢  <> 6#   >!> " @   @ `   㿘 <  H `   ]  0 quotaon: mount point not busyHa 2 @>!('أ.''''ܐ ˔ Z` ̨<` @Ȕ J @i <  *`< @ &`<@  &@$N" , " 4@#@&&  @ > < 4& @ 4&@ >`ĐȔ   -@(㿘 < @`  ` *@ @" 0 quotaoff: mount point not busy㿐a .>Y#   <0 @> ,@''c} @  $?$ @ ?,@   .`"`<*@&`<㿐! @i   $Д @j setquotap!  @IԀ   " ,3> 6  ` ɘ     ,' 8'   <' @'܀ " ,@  ( @ > %. ,@ " '耢 " 8@  4 @ ؙ. 4> %@  '& $& (& ,䀢 & 0& 4& 8& <& @ ?# @6  8 4@? #ߒ @6  4 2  ( 2  0 2   $ 2   6 ?# @6   6 @̐  setusep! \ @Ԁ S  " (3> 6  cp ,   2  (`" 4 ,   > %. ,@ " & < 4` 8  쀢 . 4> %@  & @& , ( & 8 ?# @6  8 4@:  ?#ߒ @6   6 @e  㿘>  <`"@`w   ,  @ `"  ` " @s  $  㿘! `@   *`">a   㿘>ah>   > "c> #"#"`dquotfree dquot isn'tp. @> @ < `> ' `<> c *  !> # 2 2    ` "` "  "@ΐ' 2 > #'> ` >>!h@*` ̐ "@    2 D@ D@ ($@ >E"@' D ?@" >F"H` "` "  "@` "` " ?$ @`g@ $@" $@$ q 4 $ $ 4 .  .`@  #@  $     $'?''''''' Fа  @ @@ @ɹ     4 `"  "` "@@2.' 4 2  ( 2   0 2   $ 2  4   "' < 2  @> % , $ < @ 2 ' 4> %@ $ @' 㿘`` ?6`` @`?* ` 6`> &`c``&` `""`dqsync: dquotdqsync: filedqsyncp> "@`>t#` 2`Z >h# `Ɵ` %>`6` 0 4 `   5 ` `* ` 6`  ?ؚ`$''''''''NJ ` " ` "``?# @6` 㿘   @`"?d&?  㿘  >`#&2  `   " ` !2> K``H   ؖ @ #1 %!" 2 &$ )# %ʒZD diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map 㿐 `   &@㿘!'`@  `0`4&& 㿘> Va  "ae 㿐 `` &` a`@"&/ & F diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘 >a* @  @  "   <  㿘 >@a* @`  @  "  "! `` "``D?2"`Ȱ " <$ `  2   `"` D=5"> %" > %H"@":H> %""> %" > %H"@":H> %"" 㿘  `<`> *` €X <`  2`   @"    ,`! 2 (!L`L0L0L`L`L0L`L`L`   6"> %" > %H"@":H> %""> %" > %H"@":H> %""""22" " "D:"$"(","0"4"8"@"< <( " 2 X@" L" : 0( @( :H < "H:P㿘     T ?2  ?2  ?2  ?߰  D? L? 7"`  @$`  @?c ? $` @ @$`` $` @`  ` @  2X ?" X <`   @ y ?2< ?"" $< "m  " X a "Xa <`^ a  @   R $?2X ,?"5 X <`2E a@1!2 " $ X 7  0 $?" ,` $` ,?"a` $`a` , $  ?#  X <`   @   㿘 !@ 2 "* "  < b"!  O! ’ 2 d"  < o @ @$ 4  @ b2 @ chown: lost quota㿘  a"a a@2!2@  !2a  ފ 2 a!2ޘ laa a " ^ #$a $a} 8 1Ĕ 0%f > #2`` $`  ` 74`  ` ;4`ې$a $a> !]/   㿘 `<  ` @2   ` "     `    I0ufs_link: no name㾐  $ >"< 2 X y X@q    0d`#T ` @J `` `$`4`$`X+<"XiX`<a2   ˜ "``?``$`4`$`X <@"> "   } ے (ufs_whiteout: missing nameufs_whiteout: old format filesystemufs_whiteout: unknown op㾐   >0=*>0:X`@ B @ -`(2X>Ր! @`4'>ΐ! `/``; / K X @`4`>! *  $` z !H`$`f ` ;$`ufs_rename: no nameufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entry㾈     ''$$2`X>\"X  " X ѐ耤 ^耢 X¾ڐ0 ` ް  ` ؒ@ , `< ϰ ž31 ? %>"ؐ % 쀢`_ [ 2 #@ ²   @ ` @ ¡  <  :      耢     ƒ g  @J`.@      f J $`  0   `$4$ X`< Ӓ`X< 2`   0`  j  %`2% # `" e   @2>;"V u  `2w``@>$#9 7`#S `` `$`4`$`X!<"X'X`<a2  "``?``$`4`$`X <@(` $`C m  ```?`$`4`$`X <@ "aa`   `# Ԑ`@>@>#`@2`>#(""`  `" `a@"`a Ͱ `<  ` ° B`  B X < 2  2 ` 2``?$`X`< "`t`?%``X < h#X <@  2 ```?`4`$`` ` 5`%`   !@ a` <萂  4 ? %>"ؐ)쀢   ">#@ 0^@">#@  >R#Ԕ$ & ﯖ ` %`쐂 `? ```m0,``` ?$  ? $4$ X`< 0Aufs_mkdir: no nameh`  `$`>"#@  !  ԰ 2   $a $a 2    "` ' a`  us04` $`Ԑ "`<4`$`!X <@" b @"` $` `$4$X <@"XJX`<2  2X @`>#>#'' '  '"''`''a #\  N `" <`$`Ԓ @"АH` X <@ Д"`<6 Ԗ"`H 2 Д`<&`HԐ`X< a2`  "XT  <@ Kа  ԔА; 2 "` `!"@!?`$4$X <@"`Ю`$` $`4` X`<С E 㿘  @  " @ 0v  j   f B`` 2`] B @X   @"`Q)$` ?$ X`<"`VT`  ` $` `$ X <@/?=) X <@```$`4`   ?4 $ X  <! @ @?` @ Ԑ\   㿀 (`  @ /  "C @A X @@ 6  B  <`$ <   #`#\  #d#h#l   ϐufs_readdir: lost in space㿘   !o $" "    2N  "J > >"h "@"  @ D  4@#@ #@<  6, "@ " @ "D @42 8$    @  2   @8" "㿘 X @@ 2   2  3   ` 㿘   2 T㿘   T '`㿘 `ì Tufs_strategy: spec㿘` \<? >!H T P@2 T   T "  T 0h$ 0$ 40?2 T H@ <$ @ T?> ` $ D!P8*` € 0 tag VT_UFS, ino %d, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %lld 㿘 ? > "P 2     > "xV  >!"!   <`ܐř T>"Ё 㿘 >`> `"`@#* @㿘 >`> `"`l#* @㿘 `D A`  `  ":>ڐ  # > %"#    > % H`B # ; H  "# ?> %"# ">ڐ  # > %"#    > % H`B # ; H  " ?> %"#   ?# >#> *` €㿘 >`> `"`@#T* @㿘 >`> `"`l#T* @㿘 `D A`  `  ":>ڐ  # > %"#    > % H`B # ; H  "# ?> %"# ">ڐ  # > %"#    > % H`B # ; H  " ?> %"#   ?# >#> T*` €`>|(`  `   ` $` "`     w(wpwpw8wDwPw\w\㿐   `P` #\  㿘< >`aX 2 @`!$ <> *` €$ 8`Q >  &  @㰐*$ @$ 8$ $`$ 8` 2`H @ $ @`H> " <`H" *` * " *  * " * <`H&xxxx$x$xxxxufs_makeinode: no name㾈$`>!'<& `  ̨ 0  $a  `-$a 2  z "`̐ a`  ܐ0q  >$`4`aX2 @  " <4`$` X`< "`Ɛ`$"a  2   "` ;4`@` $``X< a2`  2ؔ 2@/  &' {`$` $`4`X <@ nk P > 2 > 8> 8 8 < "   <  `2``"`<`@ 4$ " @  2 `@" "  2   , `@  " "  @  2  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapext2fs_alloc: missing credentialfile system full %s: write failed, file system is full 㿘' > " `"/ "  @"' : 2   (@|?& $@w&&> @ $ & :  `$ $   '>@0>$q"H mode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocout of inodes %s: create/symlink failed, no inodes free 㿘& ` L<@ 2@P`(@?`($ >"@ "2 X  @0- `"ಀ" >#d> #@' > > %⨐  ""  &>@># d 㿘& @В  ?&,    $    㿘` ` ` @& ?# ?*  *2` 2  & `.괆<.` (@?    㿘  "f. @@6&@  , f@   ݲ`f@"   ext2fs_alloccgblk: cg=%d bno=%d fs=%s ext2fs_alloccg: dup alloc㿐 .`&,  `R &?*  \&  0q H  $&@ 2 &@ &: * N& : .&@2  `2 "  @ 6  N "*``@ &N  @ 6 N "*``@ &N @ڒ - :`*N & :   ># U$> ڐ# * .  .`&,$ @` ?2` ,& $  cg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedfs = %s ext2fs_nodealloccg: block not in map㿐 .`f, `|  ?f*  f ߰ 0m H`(@  `(: * L& : 5" :`2  @Ɣ   @羔   >"( Жd> U"H" L*  .`@ *  >"p d> B":*  &+@, `<f,?$`  ?2 ,ff,@ ` 2``( bad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s blkfree: freeing free block㿐   $@&@ @ >  g > @0:&,*`?&*  & 00* H  $@_&@ `:`*L@ &@ :  @  >  :$> ! * +,@  &,`$   2 ,&ifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inode㿐 @` 8 (> "x $@n&,,  ?&*  ~& ư 08`H@ (6`L@ `: 6` >" Ԗ$L&`6`> U" @ ` +@*@,@  ,&,`$  <  @ 2&,@ `?2`,&- start = %d, len = %d, fs = %s ext2fs_alloccg: map corruptedext2fs_mapsearch: block not in map㿘 ``$@&`$2 `$ `2 " @e@  @]   > Xd o >  x" N@*   *   >"p ]d>  uid %d on %s: %s 㿘>a$  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapext2fs_balloc: ufs_getlbns returned indirect blockCould not unwind indirect block, error %d0 ?'T'P'X'`' ` S .` ?# -?* *@ 2 @2@ #?f?} R~0ҒP  *` +  2 2 % % $ `% f  'fX*@ `" TH@\<" @,  4> %"x  * ?c '?** @ 2 @?2@ '#?>' B PW m% 'Ė f ;'f*@ " TH@<" @}~ 2' @ @*`* @22` +   %   '`%  S `~!M,`  P ,`%% *  f ~f', <"TH@ʬ }4"`@ `'* @*`@ * ,  2 2` + $ X },`}t,`* f?| ~? H+`c **9? @ 2 @2 @ @ 5? E P XX %**` * , @ 2 @ 2 % @+ % `$ |f}#f ~k f'X, # T H@B <" @ T"@}j Xf?|- }\f ~B 'f, " T Tb#@}J}F@  @f`@  &D "@* * @f?{ ">ː"@*X H`$ |T|@,`* ' f }' 0`@" 0| @$4   " `% % diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘 "   ` "      @,  ext2fs_bmaparray: invalid argumentsext2fs_bmaparray: num=%d ext2fs_bmaparray: numext2fs_bmaparry: indirect block not in cache`X a쀧 >` >"#Ȁ`'@`L@@?"Ȁ "Đ   L'đ.` ?c ?* *2`  $2 * ?&`ܰ `` @ԑ.`   * *  @3`* @ ( 3  2( @ 2 @ `` '@&  ` *` ?# ?*  *2` 2?   >#> {0 k  { &`L |Ԙ  0"2`> ( 0$ ,@ $ 0$ T> b@,`x", ? H+`c *`*?  2Đ 2 `, `)`( `@#@ė.` ?( @ @` '@ @ @ .` H ?( @ "@Đ? 'Ā`|F   "${t$,@`&?& 㿘$?#? ** 2` 2 &@  ** 2` 2 &`  ** 2` 2 &` ** 2` 2 &`   ** 2` 2 &`  ** 2` 2 &`  ** 2` 2 &`  ** 2` 2 &` ** 2` 2 &`  $ ** 2` 2 &`$ ( ** 2` 2 &`( , ** 2` 2 &`, 0 **@ 2 @2@ &`0 4 2`*  6`4 6 @ `2 *`@6`6 8 2`*  6`8 : @ `2 *`@6`: < 2`*  6`< > @ `2 *`@6`> @ ** 2` 2 &`@ D ** 2` 2 &`D H ** 2` 2 &`H L **@ 2 @2@ &`L P 2`*  6`P R @ `2 *`@6`R T **@ 2 @2@ &`T X 2`*  6`X Z @ `2 *`@6`Z \ ** 2` 2 &`\ ` ** 2` 2 &`` d **2`  2 &`d Ș @ @ *`+  3` 2` &`ȁ㿘6 @E?5? ?`. (6`0& @. (6`0& (. 6`6 & 0(6  0(6 (06 Ķ 㿘? @ `2 *`@6@ ?  2`*  6` `( @ `2*`@ 6`  (  2* 6`  <+`( 3  0&` +`( 3  0&` +`( 3  0&`  +`( 3  0&` +`( 3  0&` +`( 3  0&` +`( 3  0&`  d+`( 3  0&`d h+`( 3  0&`h l(+`3   0&`l p  + (33  [&`pdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapext2fs_inactive: pushing active㿐 > a  ``D >" "5  21  $ `X <`2      @?> %"" *`" *  * '' $ $       @  ? `ǒ 㿈  X`< 2j > %"" *`" *  ' * ` '` % `"@%    " H`B % = H   ?%   ?%   2 7 ?%  `(? @f,* @@諐@ f$`?f@*@ fw7찒 " xf0 ?%  f$?@ H* @ w 0wext2fs_truncate: partial truncate of symlinkext2fs_truncate1ext2fs_truncate2ext2fs_truncate3 'T'H `<?   `X @@    >!P@א  `& B&       `&  7    24&(1&& &@ސD  T`T 2C& @#@`wT wT `&    ( `2&+& @譒  TT 2& &@@͐T$H@gTyK`vT&wiT&  : D&@}B??'&2`$ '&2 X$'D'&: 'L   Ȳ? О? ؆??  ? ?  ? ?'@ 6 "@ ."@ `&    D}Y <}U <&  (>  > "@ T U?'&2`" '& 2 ?"@'  8? @ @ *`* 2 2` &@, @tP 2HP@` 'H&H 'H@ $ն ?# ,+?@ @*` @* 2 2`  |&@&H: 'H> 0 D@"d>  D@"W2 & `l >`p >H!&   H "@ & & ext2fs_indirtrunc: bad buffer size㿈  ''X'P    2 ?P@Ò: ' wR `0" > "@`, ",`0`<@ `8$`0$$`T> 8uy PvEX" `H  |S,2" * @huh 2'2 ?~?)&@?#, ? @ @ *`* 2 2`  . ??| 2'?ݲ@ $P "`@ ,  ?c ? + *` 2 3  . ?N 2'`:  X`0 $`0uÐX"diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapext2fs: e2dir->e2d_namlen 㿘 !@ʐ?c ?*` * 2 2 &@   .`.`@ߐ``` `6`h     <`  f  2  ??? ?'''''Ŕ    4 . "@ @q' " 4?$c* @ ؔ @  E"@&@@: =`  * 2` 2ݠ =h   `   2  8#@ #@`  '@ L""@"@mangled entryi_size too smallh ? @' `'' `'    &'& g`  @ `X <`? Yxߔ [ 2 `T/ @   "Ԁ  @`] Ԁ`   @  ה TC Ԁ  @ ”`. -`& ''耦`'䀦`2 `X @"`X  ?'`X``L  |`"$  @@$   ' $  :`   @Y  ' ?@㟐| ' " s  :   @8 פ  ??'' H@   >#`@  >}0?  %  $ Z 3 ? 2`*  * 2`  ?"  2`''  쀢' '2`   " '耢"  2  @ۦ  "| ? 2` *  $   * 2` ' @j@܀  | '$ `s\``2D @"@ "<`X <`"1  *  ?@ѐ{ْ'$  $ t$  $ t؀&'ؐ@|{ƒ $ x`$ Ԑ($ ?@z`xx  ? ? + *2 @ @3 @ $   * 2 $ r  ?   >ח@   ?`$ $  @``  $ |`F` @A ? @"@$ t$ t  2`XC&   " "& " & @ "&b  &Ԁ`  y `,Ѐ' @$8 h   2`Xa   Z &(R$ܒ M @$ Ӑ`X ` `707Ԁ`) @&`+  0&   2`X&  Ԁ @ &@w rec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentry㿘? #`  `  * 2` ` >$"( >"H` ? >"` >"@? *` * 2 2 >"?@# ?*  *2` 2 >">8# direnter: missing nameext2fs_direnter: newblkext2fs_direnter: frag sizeext2fs_direnter: compact1ext2fs_direnter: compact2 %u %uext2fs_direnter: compact2` (&> X ?# ?*  *@2@ 2@ '/ L #` ` < 2 ?` >!@*` €           //w8t` < ??> p :2+    ?К'''Ȕ 7'''''`X`H  > ?@zy$`$Ě:   @ ? c 2` *   t @ &" `  *`@ @4 @   2 *  "@@ vt@  @@@?>: # @ `*`2 @76 ?> Ȓ>( #@`*2  *`@ @74 v` $x`@  :` & Ÿ㿐  t` :   @~ ("" :   @o ?  @ ` *`2@  * 2 3 L `$ 㿐 :   @H @`?# ?*  *@2@ 2@ "` `L %``  <` 2 ?` >#*` €           * *  `$ $T,T4T<TDTL`    2U P` ܐ  #\#`#h#d#l   2A ܀ 2=  $ "?  40 L .`L .2& ?c ?*` +  2 3  ?   *2 @   D 4 @8  checkpath: .. not a directory checkpath`` ` 'G E B ?*# 2< ?  3 ? *  *@2@ 2 @ @`$ ܒX  ܰ 2'< ߒ  #`#\ #d#h#l   v  2>!@>!` diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map%s: modeext2fs_read%s: short symlink%s: type %d㿀  ` `>>#pRc`<`X @@ 2 ഀ 2 >>#=c ( >>#5c   @ ; B?`  2`` (`0 2  `@  b   _'@b`    `$' <2@(*@@ ?$ ?'#\#`m"  ?l +%$`@$6`H `Hݐ n'` `  b   ` "`Xm`X  <@  %ext2fs_write%s: nonsync dir write%s: type㿐 `>>#pb 2`< "#  >%> %>" <  @  `а  >>"Qb>"Mb`,   : @@D B?2`<@  `< `` B    ſ  `    `_ @`   @"* $ ?  h D <  B 4       @|%@|e@"@@& H`la  l l  "  %`2@       35Ŗ%@ @ b $ <@ `  # diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿐  f@ݭ' f?kw l0 f H @ & 'Disk overlap start %d, end %d overlap start %d, end %ld Disk buffer overlap㿐> 8 > *" *  < Б*  T:` @  ;)>"4 t 0@2/ t \ *   2$ t` @2 t < " t T4 t: $ t>̐  < 0 T;  a?> ` t ˀdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘ۃext2fs_mountroot: can't setup bdevvp'sext2fsroot_device㿐> "@> 7a> c`  >> F`!> ~#D >"P>>"xb #D*#D0J@T  ?"< #D07> " "฀@  #` "@`" a "$@Ӏ !o  L`  @s @  ?o @y DY 0@*ɰ %s: file system not clean; please fsck(8) o l  `<@@"ia N #`@  @( @   :   6:@  ڐ .`<@0@0 N +`<@( `` @!  0 : .6: 6: . @ @&(&&$&&,{  < " K > 2 `& Ay `"`<`< !!`ː  0] K`<@@2@F   "a 0B !nĖ"d@~" L  ` ?n @"@ @op Z` Yn Z`@@_" N  : .> %"&0> @@   ext2fs_reload: dirty2㿐`D `E `` > ``   "`> @ (?@,* @@|@$`?` @ *@ i @  $?@f H* @R j*0ext2fs_reload: dirty1x`< 2a    <  >!`h ?. " (:  @$ܬ $h?  `< H `@ "ai0Y`  v" @l$, ? :<` 4 8 `$$$ $@V$4 ($ @O$$#$($* ?hu ܐ`HrA, ?@ui &>''''`j㿈` ?  > #D@     `<   ?  `h  ' $h  @QH 2  ! @t!  &0&0 @k% `H i*'  ,: 2 4:4: , " @ت$, ? :<` 4 8 `$$ $$@ؔ$4 ( $$@؍$ $(q m  $$,$* ?g .`Hqw, ?@h' &` &a&`d`< < &`@&`h&`<% %%  2 %  % (% $`&" , 쀢 "h`  <      &a㿘6` `@C >a` L& 2`@  2 ` : 2` 4 :@ ``< "``" ``FL&  `  ?`&,   `<*@$`<$a㿘!g  `    ext2fs_statfs㿘!; cS`8 "f>!f(p```L5@`d 1 f  f D/`D    @   +` + *@ " @ 􀢀 񀢀   2݀f f D`Dpt&`f&``@"&` ` &``"@&`@&`` &` `Tmܔ Z` mؔ Z `@  㿘 <  ` 2` p ` ``}  ` `` 2&@~V fs = %s update: rofs mod㿈! Lf   > Hd>" X>c''''N耢 2` K` ۖ 2 Β Lf  > %,f"$`0@ 2inode㿐a ɒ & > #L |  }& H! @! >` T o "$ $$ $$$ "(~] ΐ0Z@֠,* @8@֘$ ? @ *@ eØ }f<&@ $ H* @m f$> >  L`1 " }!& }Y$  > > %⨐  ""$X <` $ &㿐!`  2' F (oG& ` &`   ` ``@"&}M & F   2@ "`"` -㿘   $ g\ `Hl$` ef>㿘` f   + f`$f* *   g/ fnߐf, ? Hf`epf f &f  2Ext2 fs: unsupported revision number: %x Ext2 fs: bad block size: %d (expected <=2 for ext2 fs) Ext2 fs: unsupported inode size Ext2 fs: unsupported optionnal feature 㿘 8?c  * 2p cS " Le ? * *` 2 2 ?>!   *`*   2  2 `>"( 0A "?  T @*` @* 2 @  2`  > X  * 2` >"` ` @*` @* 2 @  2` ?>" 0`2  d @ @*`* @ 2 2` ?  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘 >a* @  @2 㿘 >a* @   @"  @`  #  D?c ?*` * 2 2 # @{ @" <~2@$@`฀  `   㿘   ` "` `` ` `  # > %#   > % H"@# ; H > %#  #  ?#` c#` ?3` 3` #` #`    (*` 20 #`D  ;` #`(#`$ #`0#`, #`8#`4 0#`@ 2#`@ #`<`<( #` 2`X@#` L#`   2`*  *` ;`H`<#@ H;`P㿘     T ?2а  ?2̰  ?2Ȱ  ?İ  D? L? "H< 2X%K X@C   Δ 06 #@( %  0"  ` 4 $     ` " `   $ 4 `! " yoext2fs_rename: no nameext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: EXDEVrename: same filerename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dir`` `  ` `'`'`$``$2`X>#X@  " X@ u؀ yy؀ xby~y|01  `0߰  ` ڀ ( < Ӱ Fxېxy^y\` ? %`>찐  %@ܔtȐܐ ޔ #`@ ^  ` 0   Q  `<  8     ؀   { ܔ4 t ` `J`.`   `  ܔ W $`  xب  ```4`$`  ˖  ܒ f   3ܒ  2%# R " x. ! N@2> (t @ب  2;  `@> H #@  ` 4 $   r   ˔   `4 $   Z  wِl` @>`@>벐 H `@2 >몐 X""   `"   @"  ԰  <   5 ư B € f_ Ȕ      $ 4 w ?5 ?*` 5 >_ p   聖   % wn` ? %`>I sc܀   "`>9 wٰ 0_ >. JH   4  $  #`#\ #d#h#l    1  >?  >  ?#?*  .@2@ 6@ '#`#\ #d#h#l    e 2    ?`5 %   ?%   v vwk`0 v v ` ?$`ܔ   `` $`4`v0wK܁ext2fs_mkdir: no nameext2fs_mkdir: blksize`` `$`>ꐐ" #@  !  <ܰ 2܄       4`` 4`$`4`# <4``4$    y@} `?# ?*  *@2@ 2@ , '7/` `L  .``  / ./? ?* +  2` 3  '   f? * 2 7/` `L  .`` 2/ .  /#`/#\ #d#h#l   ך 2 X ! @&H $`>"$` $` "` $4 " ``4` $`u"@ u㿘   ` viu9  . B a 2 % B "  0 `  $ d}4 u 4  濔 dn `uu㿀 (`  @ '@ X @@ 6   d  $  $   #`#\  #d#h#l  - us㿘 X @@ 2  ഀ 2  Y    㿐 `   #\   P j㿘< >`X 2 > b@'$ <>Đ!* €$ 8`t$ "`J Ӑ> # & $ 8u$ wd$``$ 8` 2`H @ $ @`H> " <`H" *` * " *  * " * <`H&TTTTTPText2fs_makeinode: no name㿐$`>!!<@& @ r u tɐ0M @ >X4  2     4 4 $  " < 4     ߒ  ;4     2t 2@6 t  &. t 4  $ t|㿘   |`?    `? ext2fs_reclaim: pushing active㿘>!`   D >Đ#x tc " t&   H$  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK Ndiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK/usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_amap_i.h(( offset) & (PAGE_SIZE - 1)) == 0amap_lookup: offset out of range㿘> cc?@  >>>Ő!ap研 B6@ & >篐!* @amap_lookups: offset out of range㿘> ##@   >>>Ő!apx ^ 6@@  & >煐".` b.amap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in use㿘> ##@   >>>Ő!ap= 6@ @ @ >L#8.` @`>B#X``"    > #P €   .`  >+#x  "  *`"   $  "amap_unadd: offset out of rangeamap_unadd: nothing there㿘> cc?@  >>>Ő!ap 6@`@ @ &` > .`@ 2"@ > `` @  *` ?.`# `@ `* "`?#`㿘  &   &  $    " $@1 $ ?   @U 0@P 㿘  ?@W0' &    ?&  $    " $@ $ ?   @%?0@ ?vm_map_lock_read: intrsafe mapamappl㿐>גc> >#\ dc` (  1 /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_amap.c(( sz) & (PAGE_SIZE - 1)) == 0(( padsz) & (PAGE_SIZE - 1)) == 0㿘> ##  >>>Ɛ!c   6>>>ǐ!c 뀠> @?2 `Z d ". ~* 2  * & & & && & $&  bڔ &  bӔ  & ̒ b  &   b  b`d    @u*amap->am_ref == 0 && amap->am_nused == 0㿘  >   >>>ǐ!c嬔!  b  b  b $ ?"> z b>  d޴(( entry->end - entry->start) & (PAGE_SIZE - 1)) == 0(( addsize) & (PAGE_SIZE - 1)) == 0amap->am_maxslot < slotneed㿘> cc ? $ P"@ @  L>>>ǐ!cpb!7 @ 2@ >>>ǐ!cV!86@ ` `$ ?@ 0` `$ ?@ 6`" @ `$ `$*  " * ? ""$`,2 `$  ?  b-  -`$ b?$`$- b  b  b ` & `>>>ǐ!c!% `*```v*` $``*`o`*  @`$` `*`b` * @@{`$#$``*`S`* @l `@ $`$" @t `$2* *  $ ?$" b$` $` b b ?x b(( (entry->end - entry->start)) & (PAGE_SIZE - 1)) == 0㿘> ## $ "   P>>>Ȑ!chv!2 L` @ .1> ` , @ "    #P€ &` 0 '> `,   L@  @6 `` *`  P€` &`amap_wipeout: corrupt amap㿘  #> ,  *` `@ ?:cЀ "@@k   & & X& 㿘`P 28 "*`$`$> ` c"2   , @b @b@"@* `$`$@@#`$` &`L"@ &`P`8 > `8 ?&`8`$ ` " ? >>>ǐ!cp㽔"v 2> @? ` d "- 3.2  * $ $ $$ $ $$ $  b $  b  $  b  $  l b i bܤ d W`P    `8 &`8 $ 0H@6! `L+` @ *`  "  @ `"`@ "@  "   *`"   $ `@&`L +` "   @* `&    ?&  $  ? c` `$" `?`L@2 `8&`P ?&`8&`Lamap_cow_now: non-resident wired page in anon %pcownowcownowpage㿐`P @V?#->-`@ - `2>ʐ  $?`0 2;`(   4`(P" @   #\   @E˚  `  ">@$>@Mz X@@- ?$ " `( @@@]6`(`@&amap_splitref: split at zero offsetamap_splitref: map size check failed㿘> cc? >>>Ő!c◔#\6 2 >⩐!" " 4$>⟐" 2 @   &` `" &@㿘  b* ^  & $?& $  @*  $  8"`"@amap_pp_adjref: overshot targetamap_pp_adjref: negative reference count㿘 `$@@- .`,``  8 @&@ $  $ "& $ $  @@ڑ,`-`  8 @@>#`S,@,``  8 @$ $  $ "&  $$& <>#@ `8  $$ & 8 $ $ "`2@@@@,`㿘 6@:  6   *  -* , @& ! *@"@  @  +`  ?+ "    *`"  ?& ` @ˀdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘> #  > 6: "`,> V"@"uvm_anon_add: can not allocate %d anons uvm_anon_add㿘> #`|`x@"@ 8$`|>`. @   b>ː#➒># (  " " > V`""`" " @`x `@$`$`x> 5#Ȓ$ `""`" > |  |> 5` >  "` "" " /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_anon.cpg->loan_count > 0㿘    0  @D !  " ( 0  ?>>>̐#0a $ 0$  ">  4 (#P €@E0@> 5`> & c`"` "`㿘  @Y   & > c`p?"`p   0    .2 ." 0㿘> V! "!   @6 ,`@  6  @ "   `@&  2  anon_pagein: uvmfault_anonget -> %d㿘  @Ô`"$ ``" `>> #  ` @YM $`  (> ?4# @4 (> cP€ @=:diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘 (>` $ * @ @ >` 2  2 > - "   &" $& > &   @K @uao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP object/usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_aobj.cslot == 0㿘`  >D "P>{"p` @7 @   `1 >>>͐!bK!\* @ "@   " ?" `"`"> -"F 0` .`@"@㿘  @0  ( &/>  $*@`> #+> - `,  " @XN p?$p  , @b  & $ $В c /> > # , @ " @X) `p?$`p  &   cuao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots failed㿘> # `  . 2@ >0 > V>ެ!!?$  $ $  "0` >0> V`!>ޘ!  "0> "ђ  $ $ $ ``*> 6` @ : ! 8  cH ( $ $>t!. D c $ >j"@ `  ?$ > $ $$  $ $ > V $ , ,"`0"$ 0uaoeltplaobjpl㿐> V쀢  "> V"!> V!>נ#"a> ->ϐ"` X   #\> >#\"` 4   㿘@ " 㿘@㿘 ` 4 1&  ,`" 0 0"`0 0 ,"@   > # ( ">  4 (  #P €@8 @`@Bt  2 (`  & uao_flush: strange, got an out of range flush (fixed) uao_flush: weird flags㿘 `  > c    * : : > 8    +@; 8D ;` @  2 (  >!` * :    :`@Аd2`*  *`  2 @ `  ` `" @9m  f   $` ` 2] $` W @ :E4 @9 C` "  49>π 6> 02> 0 21 , 2-> #P €@:H$  0 2 , 2 (  4 (> #P € @R @z@A"` ``4`` uao_getpageuao_get㿐'Td@h   @Z > ?#c?H@9D 1 @      @  ̔ `* `  .`@ `#\  @?m "@`(`. ` 4`(4`.@`( `! @ >  `4`(& > #` :D@T"   @ ?#  2|> @w> !> # @¬ `!  `4`(>Д" ,`4`(& @8 2`(#\  @? 2`.>@F! 4`. >>   "  @ 5 `* ` .`@`2@9ِ`(@U  `( ?ې?v@U `(? @ @@4`(0> a 4`(€&> #` :D@{ pg->flags & PG_RELEASEDaobj->u_obj.uo_refs == 0TAILQ_EMPTY(&aobj->u_obj.memq)㿘 (   >>>ѐ!bۢ$> #P €> #@ @,`&@@@;  "   "  >>>ѐ!bۀ%     >>>ѐ!br% P 㿘 @T 㿘> V!`Z@ "`,^0[  㿘  @,  ( &?  $+ @`"? `*6 ` *`@5@ " (&*@`2 ?< $ 6  , @ 6  @ 2  &  (pg->flags & PG_RELEASED) == 0㿀> #'.@  :`  #\'  #`#d ",  &  (` " >>>Ґ!b͔%\ @T ?(# @2(>  4 €> cP€ @7diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map> V > V udv_attach㿘 > 2* @*`"@ *`  `Z>#؀@U> @QO 1> @?E# :F #> Va`& (`2` ` (`` `&`>> V!"> a`` &``&`-` ?,&`   a``2` ` a > 8& &&  & &  & & & aa`&  "`$$a& $ " /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_device.cuobj->uo_npages == 0 && TAILQ_EMPTY(&uobj->memq)udv_detach㿘  ?1&   >   >>>Ӑ!`̔!9    & >> V0!"   ` $"`$ $ "   udv_fault㿘  8 ( \ ` >   b@ ђ X  `> 2*` * "  *      0&@ @ `B %-> @H `< @@  >   b@  >@D "() > # :`@ D @ ,> ,@@?   >  b@ z diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapfltamapcopy㿘 +> />3> & &   2*    )> '> $      "@`"*  M" >Ԑc@!  $  @  2  (  ` #`b@     $  " *&  `8 " `( ` `b@  &  `& , `8        8`  > ` b@` ϔ >@C6 p   b@   anonget1anonget2flt_noram1/usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_fault.cresult != VM_PAGER_PEND㿐> # `"   > "@a @  "@> "@a D "D> #    0  ѐ "1#\ ( `! `ݰ 4 (В`$     @ Z > А"  <   @ J >Ԕ" ,     @:    @ 0 >Ԓ`$@B"    @   `$ @Q  2   $ ` "`> P@    @@   ܢ  $܀ L` ( " ( (?# @` 4 (> #P €`   @ Ԕ ԰  C$Ԁ``2  >>>Ԑ#cH׃!&@P ?& @<'`   @  # > !@@5`  "  L ﯒"    @    $uvmadvice[ufi.entry->advice].advice == ufi.entry->advice(pages[lcv]->flags & PG_RELEASED) == 0uvm_fault: uvmfault_anonget -> %dflt_noram2uvmexp.swpgonly <= uvmexp.swpagesflt_noram3flt_pmfail1uobjpage != PGO_DONTCAREfltagain2uobj->pgops->pgo_releasepg != NULLflt_noram4uvm_fault: want to promote data, but no anonflt_noram5flt_pmfail2> > 'Lcc  `?'D'P# .@ '' +'ؑH/` /> aH @ H*L:H 0  ' 6 ؔ'<''` > >ֲ P`"@ Ҕ @[쀢  >  @ Ĕ   $" *'`8  `(> "@   ' `'耢M`< P  >  @   ` 3 H 'HL`H 'HH`2'P8 P (  > b@  p > ` "`P` ( D> "@  [  D`1T>* ``*  @  > >>>Ր#c"ѐ  @ #2 8 $@ " 2 ?.@ #  @  'D   `   L% T  T`2N'@`&$ #. @ "   "  ( 2  0 2  , 2  > #P €@2 &. > #`4` %  .@ `     `.`@> `.@ '@@S X ?@ > !HT `:&@`"7&@ X1&@@" +'@@ `"'> `0 2#> `( ! 2> @2 > #>  "ؖ@ ` 4`H   0`@> c``@@` P @#`#\` <LX `r 0u@ 2s'L> cX "` `0%`8B 'PPP P #\ @ T#`#d  P`I'L @E> # ->9>`21> `( @>ՖА#̔#"'L@2a > `$ؖ8 `4H   0 `@?`( 2`(> #`@Ǡ @'L@ - @<>`! ``>0>ԡ#P  ` 0`@ `2< 9`#\     @7Z 2 >  b@  >@?  @2P> #P € "  `0?"`0 ?"  . 2.$ .(  @ 6.6(&`Y>  U>  \$   #\   @7  2,` "p> "@  X ph@ >>>֐#c0 $@2̰  ">֒`$@> XX@1(?# @6( Lܖ 졒# @? $@c `"  HPܘ 4 0>   @ >  @  > #`h`p  >>>֐#c0ӹ$>@>^ hL  @0u(?# @6(1> @1=>  @) L?'L ? P>>>֐#cxӊ%.  `8 @ L > b@! @`"@> @ bD "bD   > #  "'PܞL` P`4" `8  P P #\  T#`#d` ` `>>>Ԑ#cH8%Wư > %>֐"x  ' > #`ؐ $`` "> >9 P"@ `Y @ > b@ N  `ܠ  $`L (`  `L M"  >  @ /  -L`( Lؐ L( > # Ԓ`" $  >>>֐#cϔ%€ (@0d L? (c 2 (c`> #! $!8`2L0 P`2#\Զ     @5  LL`( L L?(# @2(@0-L> b@  ʔ  >֒`$ @=. @0r(!?# > 6(cPL€ L`( Lc L#( 2(L  $@6q  @6l'L>t  L#\8@?    @54  =LL> `( - @/LL? (c 2 (>  @ j > #`p`h@ >>>֐#c0&M@`̰  &`a`>֒`&`@<!f؀?#> > a"a@/` > #P €LL`( L L? (c 2 (L@/ #a  "a  Lܖ ꎒ# HP`ؘ 4P 0>   @ *L( "((?# @6(> b@   > `h`p  >>>֐#c0Ѧ&>2 @ c @  (@/ ( "(r(?c 6(> @    㿘%>    @ 0  㿘 !> >f P "@  @Q"@ | (map->flags & VM_MAP_INTRSAFE) == 0start >= vm_map_min(map) && end <= vm_map_max(map)uvm_fault_unwire_locked: address not in mapuvm_fault_unwire_locked: unwiring non-wired memoryva >= entry->startentry->next != &map->header && entry->next->start <= entry->end㿈  >>>ې#c'2 H@ > L >>>ܐ#cה'@@ @> 8q>  %>'>> !H >֐ h` @:`$>ܐв'N@  (`@>` ('Т'Q H`> @:Ԓ> # >a0 `2 >  2`@: * * 2`` #  #@2`@: `2`? **`"  *  "c@-sc@@ > diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘  >  8  5>` !> >;#Ȑ`"@ [ @ `"@ O >`   >  8@ > 8` * @* 㿘  %> @  >#Ȑ ( >  8  @ |@  㿘> #@ 8  @ ^㿘> #@ 8  n@ uvm_fork: uvm_fault_wire failed: %d㿘a &` @ >@! &` >` 2  "" >ϴ!&`  @@   H`K"\@J㿘! #> @!/% ,` & ,(`@&!   :`0  :8 :`  > :(c``(   :`P㿘> ! @ H /m4N 1* .N 1  @ , & ,H p@> & c` "`schedulerschedpwait㿘> %"  J1 2, 2J ?* @ "@@ $  2J1` > > >ݐ    > %c``2 > > %@9 > %㿘> %"    . "-> ,  2#  2 L 1   (  4   @ @@$`(    2 ,`> @* 2@   " @㿘H /m * .  ,N 1 ?`& ,@pH 0> c& `> "`! *@  @9Y@diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapuvm_init: page size not set㿐> #`2> 5>_#p  @#> ("c<@,@ @@)Y@4@/ diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿐  'D @  =#@ " > # @  8   p 5>;>D@   b _ 4* *U T $@8 $`*   /> +> $   `   @`"֔  M" >>ߐ`0`@͋!  $ @)@` > "@ `   @   diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapuvm_km_init: could not reserve space for kernel㿈>'> "!>  "cl > V> V> 6b"`L""" ""> ##!L> V""Ȕ""?"" ""!> V#!P""@E > #@$"E#'& #`#\ ?@ Ӛ? >#>" uvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation failed㿐\`@> c#' *@ #`#\ ?@ ? "@>ʐ!&@)-  @@ 2 @>̹!8@Җ$@@  >̩!h/usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_km.cuobj->pgops == &aobj_pager㿘 > @ > >>># be!K#&2  *  @G   @(  ( " 4 ( ۓ6@ @0@@  0+  (      $8 2 $( ( "  4 (@`@0Ð 2 UVM_OBJ_IS_INTRSAFE_OBJECT(uobj)(pp->flags & PG_BUSY) == 0(pp->pqflags & PQ_ACTIVE) == 0(pp->pqflags & PQ_INACTIVE) == 0㿘 ? > >>># b!# &2@  *`@0@g!>#>)>'>%>   @(c c`( "`.# b ˿!  # b˷!# b˱!@0Z c@@ ܘ 0: `7 #>%>+>)>'>` *` `$@8% 2 `$(`( "`.c `˄!̀  c  |!c v!@0 `2` vm_map_pmap(map) == pmap_kernel()km_getwait2㿈> #@ > >>># bQ!#  H#'  @* '#`#\?@ ? G  >C@@>  `H6" ?#'> %>   #\ @. `( 2`(2 `@58?2 `4> "8 `4 c @ c&@2Ә 㿘> #@ 8 @R@ 㿐 +   #> &   ` ʘ  > "@`"~  M" >>>ߐ# c0xʹ!  & > # @ 8 @ @Q > "@  }ߔ  @- uvm_km_alloc1: non-released pagekm_allockm_alloc1w㿈> #@ >>># bw"> # > 5c H @ #'* '#`#\?@ 9? >O  ``HA" ?#+>->   @& " `(  >["h2`(  "b3 !`#\  @- `( 2`(2`4>@4ϐ" ` @ &@   `ɠ  @$㿘@ 㿈> #@ > >>># b"> 6#?`L H@ #'* '#`#\@ ?  vallocwait㿈> #@ > >>># bϔ## L@  H* "@ @  #> 5c  Hc''#`#\@   >@   c㿘?Ŗ?㿘H / * ' > #.`?H p@㿘H / * ' > #H 0diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapuvm_loan: intrsafe mapp " >U#  '> #-> '''''` "`>>#@ |_ @ 쀢   @ |R   $" *'`8  `(@  |> ' `'耢V L ( `6  8$   ؒ@P `ؒ@  8`ؒ@Ŕ ?  ? > # @ Π  @ { `@*@& @   { 2v' Ԑ": ` @> @c loanagain㿘".     > #P €  &@+"@ P   # !?> %>"x  W  0 20> #P €0`@%&0@ "@@ &@fltagain2uvm_loanuobj: object has no releasepg function㿀 `(` `P`   @& #\#d#`  '  '     Հ  >   b@ {E   ' `& #\#`#d      ?> %>"x  ߘ װ > # c ؐ $  ` 7> >#`@ {    @@ {   ܶ  $  (`   L "    >  b@ z  $`(   `( ` $ >Ǥ#€ y @% ? (c 2 (o `0   > #P € `0 "`0@$2@H"@   &@"@`@$&@`( ? 0;w `( 9 ? (c 2 ( >   b@ zv (?&"``0 2  > #P € `0 "`0@$@"@ &@(`  ? (c 2 ( loanzero1loanzero2㿐Q> #4#>   b@ z6 >@1 2 !  $  ` "`>#b@ z    @ > @ z   ܒ  $ ܀`"q #\     @) ?(# @6(@"@ `@#~&@ W&0#9%>   @ y "I?>@1I 2`!  $` ` "`>ƫ#@ y̔   @ > @ y  `ܒ  $`܀`"  Ɛ #\   @)W ?(# @6(@#@ "@@ &@㿘`@ ? "@埐 `uvm_unloanpage: page %p isn't loaneduvm_unloanpage: page %p unowned but PG_BUSY!㿘`-%>#> 0  ??$ 0@#3 0      ( "> c(#P €@* ٲdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘   Ĕ @&vmmaplk㿘& $ ( & & & @& D& >& H& L& & & &    xr & & & Ho o>  " "`"& H 0 㿐 +   #> &   ` |  > "@`"x  M" >>> `Жk!  & @  > "@  x  @   " 㿘 ?  &  H L@!X 㿘`N`"` "N$` 2$$ @ $@" @$` &`@2"`"@@$ &&@$@&`$  $ ` $`" @$` $`@2"`"@@$ &P$``" ` 2$` $ $ H2$$ ` $`" @e$` &`@2"`"@@W$ &&`$@P&`$  $ @ $@" @@$` $`@2"`"@@2$ &$@$@+$``" "X" 㿘 2 ` 2%& &` ` &`" @`&`` &`@@2"`"@`@$ &&&`@&`    ` "& `` 2'` 2" & ` &`" @͐&` $`@2"`"@@$ &$`&@$``` & &`  2" ` &`" @`&`` &`@@2"`"@`@$ &&`$" &` @ &@" @`&`` &`@@2"`"@`@w$ &&&`@p&@   "&  & U" 2(` `2$` & @ &@" @F&` $`@2"`"@@8$ &$@&@1$`@` & &`  2" @ &@" @`&`` &`@@2"`"@`@$ &&&`@ & " 2@2& 㿘@2`G` B @ 2``` $`" &@2$`$@@֐$``"&@&`&` &` `" &@2"`"@@$ "  2" `@$    0`` $`" &@2$`$@@$` y㿘@  `  ? @ `  2  &` &`&`  &@`6$ $@k$ $@  " `  @ ?@   2    "  20   " "  `/usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.cnext@`8`  8%s: %d/%d ownspace %x != %x %s (last)%s: space %d != %d %s: corrupt: %p >= %p %s: nentries: %d vs %d %s: lookup: %d: %p - %p: %p 㿐 $? `A >#x (!>'>)>` ( `$  L2`$ ⸖#  "@`   L2  ⸖# " > #X#\>##\ Æ 0W= $ 2` $Z?  w`< " ` (# ` @ >#]0. D` (@``@ >#A0>#В90 !>#5/?uvm_mapent_alloc: out of static map entries, check MAX_KMAPENT (currently %d)# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpl㿐>!P> >"""`"` "`"`> >"ࠐ""" ""> >"㤐""`"` "`"`> >"#"" "">  " >" #!Pc " " " > 64?"4> Vc" h#h"`"h``!>נ#> >!Țc8#\    > >#Dc@ `   #\> >" cH#\ `   㿘 > `$>H /f * ' > 5#`h  "`hH 0   >"`#, X  > > " !  , X#D , X@<`< `< `< ` < `(< (`0< 0`8< 8`@< @`H< H`P$ $< P `(`&`0@ B >`0&`  P  L`L  ( & `$ ` $ " "      L 2  >>> bz  $"@$ $  $u%>'>)>   L2 ⸖#b $"@&&2 "`8%>'>)>   L2 ⸖#C $"@&ѐ&2`8   (0 `( €㿘 > `$>H /f * ' > 5#`h  "`hH 0   >"`#, X  > > " J  , X#DC , X@<`< `< `< ` < `(< (`0< 0`8< 8`@< @`H< H`P< P&`$$ `  (`& 0@ B < 0`P `L L ( $%>'>)>   L2 ⸖# $"@&;&2  & $ `$ &` "     L2  >>> b  $"@$ $ %>'>)>   L2 ⸖#r $"@&&2 "`8%>'>)>   L2 ⸖#S $"@&&2`8   (0 `( €UVM_OBJ_IS_KERN_OBJECT(uobj)㿈`4 0  2`4 @      > "@` rN `?`   &  25@" ǰ  +   #> &   `   > "@`"r   M >>> `ЖԔ!  & @\#d#`#\@(  >  > "@  q  a "a  ?   >>>> b"  `H@" q (`$@@m@k`(f"`8` `0"@B[@Y`8 T`<P`@L`DH`TD`H @`P >   8> `  "` `"`P@`P Ғ`$$`$!>#>'>`   L2  b2 `$"@&`&```2` @& 2 `@"  @` @2 > c "c > `$>H /f * ' > 5#`h  "`hH 0   >"`#, X  > > " :  , X#D3 , X@@$ $< 0$ $ ( $ 8$ 8  8 $ 8 $ 8$ <$ @$ D$ T$ H> # *@  ׊ $ P$ L$ L$ P  & $ `$ $` "     L2  >>> b  $"@$ $  $7>9>;>`   L2 "cv `$"@&`&```2` " 7>9>;>`   L2 "cW `$"@&`&```2`  @& `$ @:&  > "@  px    (  >   @  "  $  >   /" 4 `  D` $ ("" @*$@   (  @* "#   2$"#  㿐@?\' @-  ?@ @ܐ:'&@ L@     (     (align & (align - 1)) == 0(flags & UVM_FLAG_FIXED) == 0 || align == 0tmp && tmp->space >= length㿀`'X'HXd  >>> b$F@  H>>> b$GH`H@ @ 'H`LH@0@`H@ ``(@ $'H, @  $'H@H`L@ڀ ؐ`( @"'`` :'`۰  H #\O 2'``$ '  H`$ `"``$:`$`:  `"* `$ * `(`@ `"*'􀢠H$@ *'H#\ 2r @:I`n`$'H`#\ "`\1>`'>>'  :`b($" * '*  $'H#\ * $'H?@+ʒ H?@9'HH`L@ `( @"'`` *ܰ '`H&1#d#`#\vm_map_pmap(map) == pmap_kernel()㿐 H@* L8@8  @I 2  &    @  ( &  ('&  $ $  H"  $ H& 8 "9 ( `2> # >>> b0%m2 >  € > `H $ "  ("@  8 @t@> `H $ "  (p"@  8$ ( ?$ 8 @b $ 2  &   $&   #   "d  `%>'>)>`   L2 ⸖# `$"@&`?&```2``" #>%>'>`   L2 ` `$"@&`!&```2` "& $ ' *W $& !VM_MAPENT_ISWIRED(first_entry)㿘 V> > 5#c%>'>)> H " P⸖"\%؀    $`"  L•2  8   (  X"  X ( `" X@  X  H /f4`h* '`h& $`hH 0  > " >> #D8 2 H㿐> # H@  .@ ' #` #\ؖ `?uvm_map_replace1tmpent->start=0x%lx, tmpent->end=0x%lx, end=0x%lx uvm_map_replace2uvm_map_replace3uvm_map_replace4uvm_map_replace5㿐 `  `$2t `( 2p `P j   $+ (>> @ $@ (2>!      >!8  >!P2 >!h"`&  @"& ""`  '>3>5>    L2 b]  $"@$ $   2 %>'>3>    L2 ⸖c@  $"@$ ΐ$   2   &"` ?& `+>->/>`   L2 ` `$"@&`&` 5>7>%>    L2 ⸖  $"@$ $   2 `%>5>7>    L2   $"@$ o$   2 \``2`X&  @2 `&  & "`"` T `%>5>7>    L2   $"@$ /$   2 `%>3>5>    L2 b  $"@$ $   2  X  H /f * ' > 5# h"" hH p@  > " t  > #Dn  (start & PAGE_MASK) == 0 && (len & PAGE_MASK) == 0(flags & UVM_EXTRACT_REMOVE) == 0 || (flags & (UVM_EXTRACT_CONTIG|UVM_EXTRACT_QREF)) == 0㿈> # @'L `>>> b& '耏`" H>>> b &H'L  Lr  @ '   `'+   )> #> &   ` ۘ  "@`"k  M" >>> `Ж˔!  &  ` &@ ` @ &   `  `'  (`` `$@u 8`      x`8 ဤ   "$ ऐ`"> `$>H /f * ' > 5#`h  "`hH 0   >"`k#/ X  > > "   / X#D / X " ' ' '  $"@ ' $ ' $ (`' (` "€ 0@B   ? 0``8' 8 @ <' < @' @ D' H' D P' P> c L4  ' L   $  " 2 1 ' L쀤' T' T$`$@: 0  "+ '`  @#`2&Lऀ    > "@`i਀`?` ଐ &ଐ  L @ Ȗ  ऀ > "@ iȔ  耢  `" '&  ` *'& ' h  (d耢 U $@ ' ?&   $ #   "   #>%>'>`   L2 `= `$"@&`ː&```2` !>#>%>`   L2  b  `$"@&`&```2`'  '` @" ऀ  > "@ i:   > "@  i/ 耢`{ [ ऀ + )> #> &ऐऒ ` ˘ऀ  "@`"i  M>>> `Ж!ଐ &L@ ऀ > "@ h      > "@  hה 7`% `L@ 㿐 +   #> &   ` p  > "@`"h  M" >>> `Ж_!  &  H@* L8@8 ` @L`$'`! ` 2 `$2 `( 2 `P 2 `8 2  "`8 "`( ; 0  > "@  hM 㿐  +   #> &   `   > "@`"h,  M" >>> `Ж!  &  H@* L8@8  ` @ ͐ ' (@` `8 2M `@2H `@ "= ` *`87 | `<&`<&`@&`<`<>  8 `` `$ ?` `H 2` 2` `$`  @  2 `@" ` *`$ > "@  g 㿐4l 6 g  + (   #> &   ` 9  > "@`"gt  M >>> `Ж(!  &  H@* L8@8   @  $ D "  * $ > "@  g.  㿐 +   #> &   ` Ҙ  > "@`"g   M" >>> `Ж!  &  H@* L8@8{   @  (  (v4 6 $ T > "@  fǔ   "  * $ > "@  f  map->flags & VM_MAP_PAGEABLEvm_map_upgrade: failed to upgrade lockuvm_map_pageable: stale map㿐   >>> bK)4 . 2, H   )> %> &    /  "@`"fk  M" >>> `Ж!  &  H@* L8@8ْ 2>  > "@  f= 3 K @ (   $  @ `  " * H􀦀 H "  ' H $֐  * $2   > "@ e   (a ] H 2  8 2 "  <  ( 2    ΁ @ $` H < ` ' H $# @ ` ( ?' H  $8 H2  > "@  e   "  * H   &  #> b@ e   @  H 2  $ < " B"@ eg >=#  瀊`&   @>/#H?' H " * H H? ' H ' H $  2 H2- "@ e- # 瀊`& Ր "@ e   e >#  瀊`&   uvm_map_pageable_all: stale map㿘  >>> b*2,`   )> #> &   `   "@`"dؔ  M" >>> `Ж!  & `!` D (@`H "`` &`H`$`@2`H `& > "@  d հ `  & 2  D > "@  d ð  (@ `< " ``H 2``$` " `@ 2`<> #  2  H@ @ (   > "@  dj  @ %)> `<`"``H  `8 2`H `2` `( 2 `H` `$  `H &`H`@2`<   & "@ d8  D @`H 2`` `$}`< "`G"@ d! >#  瀊`& ɐ  @@>!`< "``H?&`H`@ 2`< D@" `< " ``H? &`H` &`H`$߾`@2`< "@ c  瀊`&  "@ cԔ  (flags & (PGO_FREE|PGO_DEACTIVATE)) != (PGO_FREE|PGO_DEACTIVATE)start >= current->startpg->uobject == NULLpg->uanon == anonuvm_map_clean: wierd flags㿐` 2  >>> bX+ #> >l!( b@ c  H@ L8@8  > @ cq ˰   (8 > $ @> `  > "@ cV    *8  'P@ (>>>b+;m` k> `"h $&@"` L/>1>: "R> ` M` "5 4C> @> 0<> 0 ;>  , 8c . 2    "0c>"+y> >"+~#P €@ > 4 0 , > ȯ@? $@> #> c 4&@$@"      2 '  e@> @ b 㿐, @  (@" ` @*  `< 2 `$@ ` 㿘>  !Ȱ@ 㿘 @ݔ @ c`@  @  & & "`  ఄ ఝ㿘 `  @+@@b& @㿘 @$L` 2`` "`ۮ``( + ``)> %> $``  ۘ`  "@`"b  M`>>> `Ж˔!` $`` `$`> "@ `a `H%`L``2,`@`` `)> %> $``  `  "@`"a۔  M"`>>> `Ж!` $``@$`H$`L%>)>1>   `L2 "#v  $"@$ $   2 ` > "@ `a 0  @@& @㿐 ? J&  "  +   #> &   ` /  > "@`"aj  M >>> `Ж!  &    H L  @ "> !Ȓ#&fork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)㿘ऀ 2,ठ਀ #> %ऐऒ ` ʘऀ  > "@`"a  M">>> `Ж!ଐ %L nH )8 (D(5> 3>8`" ` > 2D> " 4 2`   x  > `$>H /f * ' > 5#`h``"`hH 0 ` >"`x#,`X  > > "   ,`X#D ,`X<< < <  < (< (0< 08< 8@< @H< HP< P P  $ H>  c $ L" 2 n  (`"  ` " €   ( @ & $` @`$`"`" `    L 2  >>`b `$"@$`$` $)>+>->    L2  b  $"@$ v$   2 `%#>)>+>    L2 `"cʔ  $"@$ X$   2   > `$>H /f * ' > 5#`h``"`hH 0 ` >"`#,`X  > > "   ,`X#D ,`X<@<`<`<` <` (<`(0<`08<`8@<`@H<`HP<`P`P  > ` c`$`L" 2 ũ `(`" `8` "`8€ `8$`H` $`8  @ & $` @ ( $`"`" `    L 2  >>`b7 `$"@$`$` $2)>+>->    L2  b  $"@$ 魐$   2 `"P)>+>->    L2  b  $"@$ 鎐$   2 P "H  H    ֚ H  P (Ő% "@8  @ <  $8 $8 @ `<`$ ` 28& ऀ > "@ ^ ഀ +MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%d, ref=%d, version=%d, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d 㿈 H> Lƀ"H > "`  ƀ !>"@kƀ`1 ( D@->"%>`0`P` `$`(#``L#dƀ#\`8  F T  F T  F T`D`<`@#\`H#``T#dƀ`@2`0OBJECT %p: locked=%d, pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%llx> 㿘>  X ƀ  ` 8>>ƀ `ƀ `">ƀ   #>3> ƀ`@^  2 ƀ`   @R  >ƀ ؁PAGE %p: %b flags=%s, pqflags=%s, vers=%d, wire_count=%d, pa=0x%lx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< 㾘>ƀ!!>x (!>   .>   *> , 4ƀ! >   0ƀ" >ƀ"X`g . 2 "  > >>" ƀ .ƀ" . >ƀ"  2  ">>ƀ" .ƀ# .  @> 5 (* cȀ    0 > 5 #> 5#> 5#ؠ >ƀ#8 2 >>ƀ#P0ƀ#pdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘> %b@!  2>> @#0>! > 2`@:` v 㿘> %"` J`1   2 ` a 8`` 8` ``2J`1>!$(  'n%@,` 'i4 $X=#` '\#\ @%` ` >"@*` €> 0 @ 0>  !T>#oĘ Ck> # X' & ^ \ ` _V S*$ X@ d$ LM > # \'  @ X `  _8 5*$ \@ d$ P/ > # `' ~ " X \  _ *$ `@z d$ T >! ~ -p<4X """" """"" "$"(",> %`8> `,/J`1+>(> a>2 `:`2 `:` "22``2`,> # ",   l  "  l "  " "(""" "$xTTdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map N N/usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_mmap.c!UVM_ET_ISSUBMAP(entry)start >= entry->start!UVM_OBJ_IS_KERN_OBJECT(entry->object.uvm_obj)㿐> #'D    *  8 2 ˔ D   `#> >А h b@ Z x *' (@` 1>3>`8 "` > ` :`$> `  `"d  ^  $8 "((`  8`> `j  $`2(::" #  /􀤀+P`   L$   @  `` `0$ B @Д 2 "i#  ٦@'` *`8> "@ Z\ DP `` @ ```'    > #  @8  e #@@  '@>@@ ð   В  @ *'t@ 20  $0T ` ( <    < @E  @ ` @`  0, $00; ` <22     X `@Q T @   0K =`B     # "  *   @ :c 2@ ( #\;` d#h@ '@ 0,?`$00㿐`@`   "> # @ @ @ $@ * @`/ "  '> > h @ Y8  @ $ "@ Y( "    x@㿐> #@`   L$ "_ >@D 8W   ,   %> &      > "@`"X  M" >>> `X!  & -   > "@  XÔ  $ `> "@  X     㿘> #@` @  `   #@  @  O     㿘> #@` @   ` #@   @   0   㿘> #@` @   ` #@  8 > * €  -@    @    @   X X X p x , 㿘> # @`   $ *  @:   2 H (  #!2kL "      㿘> #@`   $ * @:  !2k) "   ^   㿘@`"  !2k  2   d  2 #㿘  Δ  㿐\` ܢ >   :  2ٰ 2հ `2@@ *  &@@ ʰ #@є@@ `??C B < `?@#B ) %`@(!``   ?ɳ  ` ? ?ɢ `  <  ~ 2/ @/  -`  @#`#\ߖ ``"c  +   #> $   ` ~  > "@`"W$  M >>> `Xؔ!  $  "`` 6`H   > "@  W  @@@ c  " @@0 > "@  V  `@diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapH&(H> > 5Ș  3@X@P(H4(   2  2  $ 2 H,2D,.> " > 5  .? > 2.`"`. 0 2 > 5 䀠" > 5  .?2. "   ,2,,(2,> 5"# "  " > c`"`.2.` "` /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_page_i.hpg->wire_count == 0㿘 . " .`"  "`> 5"# "@ .?# > 6 .c`?"` .`6 ,  `0> > > "Hax ր "> 5> 5&#&# &  ""  .>  c6 .`> 4 "` (` >  @ ? (# @6 (`.!0 @2 ``> 5 䀠"`` > 5 `@ `.? > 2`. `,"`.@> 5` `# `@ > 2`.> 5 "@#"`" 㿘 (?#> @ 46 (㿘`(?# @> ) 6`( 4€`4lcv != -1㿘> > 4 c> 022: @*`  2  `2: 2? > > > "HaxҔ!;*`  /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_page.c(pg->flags & PG_TABLED) == 0pg->flags & PG_TABLEDuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_init㿐> 5#'D'H > 5> 5> 5> +`` "" ` +`"" "  "`> 5"# ""`T"`P""`X#"" > 6"`$>!0`> v"  >   "@  > c c* @O`8.`$, @Ɛ@} >0 @ R> >  +`" @ > $@@> @"p> @#,`"*+ >  `"@` $&@ " 4@4 @ > @8  `% '@>  `8>0@+`> #> "> 6@*@D"@> b  >*H "a4 "P $ 0> 6"    "(","`"\"T$ 4$` "X"Luvm_setpagesize: page size not a power of two㿘> c c"cc "> !Ȁ` "    `* 2`# uvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memory㿐> #)>!8 . #> !> b@Ò"  b%!8" 8  @ $b$" " b"> "> r"x * $b '> %> @ 8a⨐ c uvm_page_physget: called _after_ bootstrapvum_page_physget: out of memory!uvm_page_physget: out of memory!㿘>!0 > !> # (> 5#` > ##ؐ` > @~ ` @ 2:`  :5 `*& @ `   @ #@ a0 2?>   a0(>` !0@`#? @ #? #?#?  #? #? #?#?  ` ` 2:` @ 4 * &  ?@  @ i# a0 2?>  0 a0^(>` !0@`#? @ #? #?#?  #? #? #?#? I u?a0? A>  (>  #` @ ` (@@ :0*@&`@"$"a0 2?> { 0@ a0>!0`#? @ #? #?#?  #? #? #?#?  ʘ? 㿘      uvm_page_physload: page size not set!uvm_page_physload: bad free list %d uvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: tried to add RAM after vm_mem_init㿘> #` > > 8*>> `!0 >T >   L >I 0\ >   ` a0 (`"a0 `? >!       ( :a0 (@ +`? #  @ # $ # (# ,  # 0 # 4 # 8# <?   ?  a0   a0@uvm_page_physrehash: WARNING: could not grow page hash table 㿘>!0 `)> 5 ->>    "@    #ȡ,  &, #`T> `P# ,,   8  Ӛ  >#`0l ?  "" ` H /f * ' #Ȕ " X" PB" T*@9> 5> #Ȟc@` "` ` "@ $3XP *  X3 P *@ `"$2@ X P * @"`@2Ñ*H 0> "@Ҿrehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM BSEARCH BIGFIRST <>!!!! number of buckets = %d 㿈!>!0>"  !0 @ #>   ->-`      ;`   X#\a0`@  >ِ">֐"> 5>TА"Ёobj == NULL || anon == NULLoff == trunc_page(off)free_list >= 0 && free_list < VM_NFREELISTuvm_pagealloc_strat: bad strat %d㿘\`   > > > >"Ha#> # 8  :   > > >"Ha#r  <@ > 6 @@  D   > 6yΐ   ` c`  8` c``,4`(`( > "@> 6`> #      !> 5`> 53`2> #ț*+  @@ )@  %@  `  0 #> > >"Ha#ɑ+   *   ` ̀`> @` "`" "@c?" (a $?"$ (!  "  "ݐ * I > 6 (6 *& & & 86 .`4c # $X2 @ P* H /f * ' &  & ""H 0 &    &  "@ "  ( `6 ( "6 . ? (# @` 6 (> #@ 40 㿘  N` (  > > > > "Ha #> 5 $cȑ2 `X `P* H /f * '  ` "` "  "H  `"  "` "`   "@ (?#  6 (?" *& `6 *`F *>  ( 6 *` & > > > "Ha > #> 5 $cȑ2 `X@ `P* H /f * ' &  & ""H 0 &    &  "@ "  ( `6 ( "saved_loan_count == 0㿘 (`W 0`?# @6 ( (  > > > > "Ha@ #> 5 $ 2@ X P* @H / * '   " "`  "H  `"  "` "`   "@ (?#  6 (`?" *& `6 *0`" . .`?# @6 .z& `"  .> > >"HaP$ %> `"  "`> 5"# "@ .?# > 6 .c ?" .  0  `2   > 5 "#䀢`"  "`> 5"# "@ .?# @6 .?" , 6 ,` ?"`  (?" @!6 (&> 5cȑ*  & *  "@* "  6 .``$ "`>!4$ 4 㿘 @(?##,` "` (  wX ( "   `$€  ` 4 (`4 (`@ߑ,`㿘> '> 5#$@6% 4Ȓ  Ȑ`` @ ` 2% 4 00` "`$` " $> #@ 4 (!4 (` $`" $` `$`$ $` $$$ >  h`diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map/usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_pager_i.hrvpg != NULL㿐> !H> #  > >>> ax A#>a0 `2 >  2`@: +  * 2`` "  #@ 2`@: `2`?? > `+ `*" @ *   >>> axk C㿐#>!> 6 @` #\@ ̓ > 7"b0> > "aX`"H@> > "b"?$?"  >!@, @@` @ , emergva/usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_pager.cnpages <= MAXBSIZE >> PAGE_SHIFTpager_mappppp->flags & PG_BUSY㿈 /> )> 7 '"0.@ #`#\ ?՚? 3> > 6b@> " > >> "@":@  #"@ '>>> cؖ ڔ > 4  "c>> "0H!X"sŖ  $5>#>%> +>'>  cؖ`X  ( "0cؖ`  4@ @ 㿐> # > bb .@ > ""u 'J7> > 7"0   /> +7>    %> $    sq  > "@`"K  M" >>> aH`!  $ "0`"0uE%"0` > "@ `K  .@ @ʔ@  Β 㿈` 'X X `@ > 4 ??耢4 ?> (?>  @@~rb :  2  @ ( & s&@@~]b*`&   & `  <` B C`(Up "N . 2 ( "G ( 2 ( 2 (>  @ ? (# @4 ( ( 4 ( ( ` +> #P`4 (€ `2?&* & &D` 4 ``耢4"``㿈'XX```` ;`#\`  &'@ &  ` ``@   2 N L `E@I 0> `9@=!` `  `. > ` " #`@}`   ` `@X`@S`  '@&@!!uobj || obj_is_alive㿘 e?> c#c +>@@V`T 2`(`. !"`(` " " @` @}?`  b @`( "@s @(` $ @.  @2(> cP@€ @`% `$€  >>`cؖ" 2(>  4€@> a€@@`( 2`(`㿘>#$& X& > 6 8  &  "@" sp?ԁswap || pg->uobject == uobj!write || (pgs[i]->flags & PG_FAKE) == 0㿘> # 8:@ - 2  2 *  0#h` 4" 0  0 2   > #` H,@,$  H .`@@ "0U P />3>7> @`. 0@ `"`` `cؖ#@`(( " @@ (`@"@>cؖ#R`( @2>  >  4€ > a€@@?( 2(@`( 2`(`kH /d* %   0  >  \ "> )@> !H 0 $>$*         ]^^^^^^^^^^^^^^^^^^^^^]^^^^^^^^^^^^^^diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mappagedaemon: deadlock detected! 㿘 H /d * % > 5#> b@ <>Ԑ#@>aP: r0 8> #  @p/"H p@㿘> #` @p `: $`< : @ $`< `, @$`<$`<`< @pՑ, $`@ $`@` @p͒ $`Hpgdaemon㿘> "@> 6"`H > # Š> 6'> "ఖ o!` $! @"    @p @$ D `$ D  @@  D@#@#, `2ѐq͐aiodoned㿘> #+>H o$*@e%> 68 8?Ԓ"a o?8 $8$ H 0 )> '# 0@  8``:@ " $` X@  #`, > 6q` 0q[`0/usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_pdaemon.canon != NULLp->loan_count > 0uobj != NULLanon->an_swslot != 0uvmexp.swpgonly <= uvmexp.swpagesuvmexp.swpginuse <= uvmexp.swpagespagedaemon: pageout returned invalid 'unlock' codep>  c`@: * 6`2`*`# p'@# p'  ' `  ` c  @ *`   ` ' `c! >  $! @L@'耢 "`.x!, $!,`2``2+`(`  >>>"c(pƔ!2`(`0  ?>>>"c(!`$`04`.`( ca0 ["a0a$  "a$  !0 P$!0!( $!(`( #c`. 0 c`p "`p> #P €7ca  4"a 20% >>>"c(z"!@ * @4"hp@ $ `.>>>"c(f"C 0  @ c  c h l $ `.>>>"c(M"V `0  2`(`" `.` "`.@  `" `.  c @y` ` Ő `(> `.`P 04`(@  c` 7"` " `  @ ] % @y|` . c @:@ '@ Ò  2 `(?# @4`(.  &@ % c @y[`   `&''  "@@ !c6' 'c4 $4   ;`   #\;  `8` $8$`. "W@U@T'G 2`(>  "`(o`(?# @` 4`( % > #P €@'/ & `$€ @  '耤 >  >  4@ >  4€> a€`(`4`( '耢   . `@'耤`N L`p->uanon != NULL㿘> ca  $a``@6aa D$aa  a`d > 5 #`> 5#蒒 ##a 2 `d > 5## @@ D"" lh@ > 5p > 5 "# > 5j#؀ f .`2   2  (   >>>"c($2 ( 0  ?>>>"c(Ԕ$`$ 04 . ( 2>-` .    "  .@   ?"  (c 4 ( . # @x    =  `@   (?# @4 (` > #P €ݐ#a< "a< `4 (4 (diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map/usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_pglist.c(alignment & (alignment - 1)) == 0(boundary & (boundary - 1)) == 0㿐 'L>>>"c0x3 f? >>>"c0' g> # #   * @v (  풪8# ( , @ ͮ >  L Ơ#`>!04 ` >  2`@: * *2``# #@  2`@: `2`?Y#  a04 >  2: *  2  E2: 2? 2#@u,  @@) *" * @ .`!> #*" * @  4?@  @  '*" * @ .`*yŠ @<'> 5#ȡ*`$ , @n (2 @   $ **`  "  "@#?" (a" *$?"$ *  6 (6 *6 .& & &`& `"@'` @' #< @  > 6@@ D > 6m 촐(m->pqflags & (PQ_ACTIVE|PQ_INACTIVE)) == 0㿘 => 5> #Ȥc)>+>-> .  ""c0@! ` "`&  " 4 .$*  $ *  "@* " $ @$>!4$`4 2 .bdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map%s = %d 㿘>!P #>    b.  2 Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retrys)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern/kmem/mb)=%p/%p/%p 㿐>"p!> #>#   " > "    P> \# T X L `#\ 0> 4#@ 8 <> @#h D H > #   > #  >  > ̐ ( П  > ܐ X    >     >! !!! >! !$>!!@!! !(!<>!0!x!!,!4>!8! t d> x! |  l> h" p >"H> 6L>!P"`!Ldiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapswapsysuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vnd㿐> ""$> "ct> >"H@  @s > c`> 6c` " H> 7a ">>!H> !x#\ \ { > "b >!> >! a#\   q > >!Ta#\ x  g @ P㿘> "$``` $̀ 2$D$@ $D2$` `2`㿘`< ,  \ IF&$̔@i >`.`,  \ I9&$Д@i &$ԁ㿐> #  ,"    Ð 2     #\     ,  &  @ 㿘 ,   ,  $("@ ;  $̑* @(@ $̑* @(@ ("@   ( ": ̅( *@ @  㿘> "$ #>   4 "$ $  $  $   "` " $ $$ $ $ "`"$$ J \&  &$D &$H 2 $ "$D$ c`d "`d> $*> "! c$@2$D`$D $H" H$H $D D d # d" 2$@ 2 㿘> "$@  "$  "@ J) \ 2swapdrum_add㿀> b     #`#d#\}   "> G#&$,&$(> $```"` $(&$D$, $D 2$(` `2` minirootswapctl: miniroot copy failedswapctl: copystrH> `"H  ?-@  > #t  &26> "$ -`$`!> #$  :@r`* 2`  $ $ `$$  $Dd` 2&հ 2R АH``2@> #D 2 ° @ * >! $M " @>!    $ 2H  D''''' H@    ( 0 2 `< "` > F ~"` \ GC Ò   r h0Q` `  \ G&$ؠ \ G!  @gٔ$ؒ $ $$@`< 2?` $`< Q@$$ȒA \  G$$$$$ǖ ">!  @^ % q`< 2$Qz$$HӒ \HВ \0_ 2     @8 HH > swap0x%04xdisklabel regionswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap 0> d@ cD @ @5  <  2 4  > 1* "@0*` `" @?)  @5 DX + 3`    D DX> `L&dLP8   &dP&dP> <  2* &`#  @gg* <     `>e aXd4 "aX>" p #\  \ x  &d0 y  "D>"7!D(> !\`XD #:` c*  * :@ $d0>"!y  ">">"!!$@>""ΐ>ad `c ? &`&d`h  "`hD @4 /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_swap.csdp->swd_npginuse == sdp->swd_npgbadswap_off: swapdev not in list 㿘`d( d,&`D 2 `d(d,N "d `  ?&`d$@" d@>>#># a$m <`Pd<d@> d@#D   @4 d> # h d" " hd@ >#~! > b  d({d,x&d0G6 \㿘>#>o#! JN㿘>#>o#! JB swstrategy: vnode type 0x%x㿘 T> : 2* # @o*    2 d( 0 (& 0& 4q01$ @o< d@*  2` <  >##! H /d * %  J& TH 060@sw_reg_strategy: swap to sparse file㿈H /d * % > ! ) H 0 %`%`%` %@%``<>2`*   `H*` &`@$L$@: '@f! 5씒 ?>$! "$LH /d * % %`< @e~ `"@4H /d * % > !T͒ H 0`0 @$ 0$ <$ 8$ 4$ H=  $ T`,>%!P"(c!$ ,$ X$ $ \$ p`d > $ `$ d`<``""@$ ``<`d""@@8$ d`l 2`<$ h$ l`h""@$ h`<`l""@@8$ l T$ t$ @H /d4`* %` ! `  %` $Tr@=H 0 <`DSH /d  `T `* % `` ?`%```"> `0&`4(&`0> ! 6H 0㿘  & $$P & $x" !$&$x&$0\`t "`t5U $$P6 $x2$  ?& vnx->vx_pending == 0㿘 t H /d * %  < @`@" "@$`@ ?$  4 2$  \ > > !T  "`@`0($`0 $`4  2' 2#> !  2 "  >>#>% aY& 2 > ! ot$H 0㿀> #t`$\ > "$`O``F> #  "<$D$ $ 46$D$0   #`#d #\ w 2'$D$D@$H$`"dH$H@$D"dD$$D`$$H`@2`$`"$D$`$  $$  l % l$( $`` `2``` & 㿘$$@"$$uvmexp.nswapdev >= 1sdp != NULLsdp->swd_npginuse >= nslotswarning: resource shortage: %d pages of swap lost 㿘?j> # d` `>>#>& a`&2 d >>#>& ax&6 d(>>#>& a&d0& x  >&!d >"$d  lp"@ /$ l ' "d($: * @dГ*` 2d($: * @dГ*` ` 2@ ߠH 㿘@?@0 flags & PGO_SYNCIO㿘> # t'D` $ t>>#>& a+&2 p ?$ pD @    p $ p㿀> # @: *22*'H'P# `6'6:`'D@l߸  * 2` @?@ ' 'Dܒ   >!d` '>ap 耢  H d耢a   %~ 쮒  p  <@2'> # H(" : * @Г*`   2 @  4 ,` `.@2.`@. `. :  :D@ @ը ڒD'  ~ H /d * %   > > 6@ ` `> |!H 0 / d耢a  H(" :`*` Б* 2(":* Б*  ` @H쇒ݰ PP ?'PP   `> !P! % 0% ,% % H% T% pH /d * % > #`% \KH 0> #` .% 8%% <% ``>p.`% dHٔH /d * % > c`t "tH p@> 6`> "@ 0 2`@ @@>"% 0% X2On ΐ 0>p2` 5 ` 0@1 0(-  H'<`> # H ($ :* Б* -@ @\-@:  @ : D Ԓ 0@耢 WH /d4 \* % \  Y  >  \ "> > !}jH 0swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystr㿐> F ̀>(#0J$  \>(#0A @$آ \ @ $ؒ @` $`$d@ 0$@  \ ?$d $d>(d# !> >(#"@K ^ d@dAĒ \A \0"@ 0diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿐`*  >   -0 -03>ad'Y˜    &ad!h>!lYӐ㿘6  #>1 &  ah $ah㿘@>al&  && & & "al㿈>ap  "ap@| > 8 8''7` ''U!h耧`@ &` &`!h &` ?& ` swap_decrypt: key not initalized㿈>!p`>*7 @8 > 8 87`''''!h 耧`"@&`&`ah&` & ` @&&&& 㿘!>!`  > !h`> !h㲔 $!`㿘!>!`  > !h @_o!$!`diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapsbrk: %s %ld failed, return = %d growshrink㿈>  c` @   И* #   F'$8A   *  @ @*@'4 `##` #\?6? 2>*  ē6@   @  >*  ē4@ "  $ Ā`"H>*"p>*"x`& Y  㿘 Ԁ@> ' #>`*"@: ` " 2 ":`0 B ; @h4  @  $Ȱ  uvm_coredump: user process with submap?p   ( (  D \=> #c8 "<>+ "J E$>@ 8  Ԁ   ``* "* 4 ( #* @#@ aH ''' #\#`#d#h#l*  @ D #`#\#d#h#l*   @ D & (28diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapuvm_deallocate with null map㿘 >+z# > #@ 8 ’@  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapuvnsync㿘> ""(> > >,"b,"  3ݘ uvn_attach: blocked at 0x%p flags 0x%x uvn_attach0   #>,!>,`P ` & " x [  < 2  > 1 0*`" * `"  " <  ` ֐ ` q&  "m> (( & (( ("`,"(& , "_&  `!&  > 1 a0*" * ` @>   @`h@  `(  @b   > "@@+֒ "  >  "& ]& & !x& &  & &    & & > `& > (( & (( ("`,"(& , "&  g ]\ " uvn_deref: vnode VM object still has pages afer syncio/free flush㿘 ? <&  @  ?` & @    @  0+`&     @   `  & ""   (`" , ,"`, , ("@  " >,3#8 & ] ΐuvn_termuvm_vnp_terminate: io sync wanted bit set㿘  ?  ?&  `H&     @Ț  `" !>-  &  "  Z٘ `2     & >- " &  (`" , ,"`, , ("@&  \uvn_releasepg: page not released!uvn_releasepg: kill flag set on referenced object!uvn_releasepg: pages in object with npages == 0㿘 (  >-!> #P €`&@. `"&   " >-"  b"   (`" , ,"`, , ("@  " >-|"8 "$ \P$  uvn_flush: PGO_SYNCIO return 'try again' error (impossible)uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flush`> #@:@*`2` 2 * '#p '  '`''#' 8 ;    ;`D    ; @ecd2`*  *`'؀ ' @ `'܀`H  `C܀"& `<?#؀ 2`(` 4` `$ 4 `(2 ``$(``( 4`(``N ?`(# @4`(> c @ :E܀" / M'؀ `` 4B` `$ 4`28``$ `2`> c @ :E```(  `) ` & #' `" `(`. > #P €`(  >  @ ?`(# @4`(`(`2`  4`(26`(܀` ` ``Ŕ`?`, 2ޢ> P€ cբ`"Ң`(  4`(> #P €ⶐâ> P`4`(€ `*7ֲ2`'';`#\n` `"`>-~#``  ܀ ֑*``*2 @2 `ܒb{  .`@r `**2 @2 ` = Q ` ( ?Z (?c  4 ( ;m  `4 (> !@`?`, )> P€ ڴ ` (  4 (" > `>-` ~#>-~#'> #P €``@@ ܀``܀"   !>. &  "  X  ` !" Z   >& uvn_cluster: offset out of range㿘> @4 >0 $@>0} h@  > B?8 : :` @ B   @     8 ;  @ 8C  @ ?㿘@ uvn_getpageuvn_get㿈d @5    '  @?B '`( !   >  2`(&@ >  @ :D ޲`'s q   j ?## @ X> 򀦀 T'>01>0`( !  2`( "! W^@2`(&@@  '#\  8 '@@ ">   @- `(  Y' `( 2`(0> `( 2`(€&@>  @ :D ` uvn_iosyncp@6  `%>1&" !&  p V ` 4 2  $ @? Ք 2 2 }  & Œ> # 'Х. @ D 4 $>  $(> ">  "@ ?''쀊`@'''''  &! 8  b@`'  `'   @ b@(v 耤$` @   `. "@X  Ғ  ?`&  XZ `  㿘   "   `& M !> "@ & (2 "@%`  㿘   4  2>  $( >   > 㿘#> !> b@" .\ > b0" "b0> "(#  "X2( 2(   $"0"0 $00"`$b0(〦 b0#@     1`" (`,"`,,(" $0 @" . 㿘 8>  > #L  `@ p > ( 0`" 1 6 2  $ 2  ( 2  , 2  0 2    `  `` ``` `` ` /@n "` &`  `` 2 ``?#@"r 1` 2`  2 ",` 26`` 2 6`` 26`` ,`6`&`ǐ "R 1 ,`L 1,`2  #2@ 2>> aЖ4 Jٔ " ` 8R  2`, 0`& $` & (`& ,`& 0` 2 `` 2 ``?#@ ``<* @ & d`2 6 6 $@  L  㿐`8> ` 7 b@     `2`` `` >>!aހ 2@D  # "X   >>!a֓-`,`2 2`:  ,`l@_`$7$@,`2`" 4+>  ۰ 10\?* 2`@45: 4  F aД `$J6 ܐ96`6 ,`4@_($7@,`2`$ 49>   10$ * 2`@ 45( 4  Fp !Д `$I ܐ6`6K\ P` ` 'g'`   /`  1`  `  `?#@02)`$` 2%`$`?#@`$  `( 2 `$`, 2`$`0 "4`.`$ ذ `( ?`,#@"@0̀ 2 @`( 2 @`,?#@ @'`'`'` '`'`'`'@ђ "&` `$ 21``( 2-``,?#2'``0 2#`@V   //P `8R` `@JY @U 7 = `@``@`$@ 2 `@ h 1'd  @'@m,`k`$`` ``(  `$`,  `0 `$ `6I"  A 0`$ `(  ``, ``0 "`6`2 ``( 2``,?#@2``0 2``6 2 $`$ $`( $`, $`0`$``  $``$``$` `4`4`JD$`dHuh? Thought in6_pcbnotify() never got called with mapped! x``` 2 ` !` 2 `` 2`` 2`ΰ  `  `?#@>4y#耦>;''' '''""`'`''`` '`'`''܀ `>>;!x!x`  `'`'''耧` >}#0>! .6`!u`!/ $ / ( / , / 0 / @ " /  4  / L`@ZՔ  L/   `8 ?d*@ $@Z  4`@Z  228 ".4 `6 2& $䀢  $耢 $쀢 $@Z  26`4 22` 㿘`  @Tv&`  , ,`64 `$`$$ `( $ `, $ `0@e$ 㿘`  @TZ&`  , ,`44 `$ `$ `$ ` $  gif%d㿘. !> 6$ d  2*  d*>@ "!@T6*` d & >7 `>6>6!b#>6`x >cX% & <. 8& 6 4& & & & ( ޖ d !㿈@T  /H /f * '  ` ` & & "` ?& H 0 `  , « 0ٔ@  0Ձgif_output: recursively called too many times gif_output: attempt to use unconfigured interface %s 㾐'D   D@Y  _ ̑    C   DD`i"X   I`D <6`4` D ؀ >6 ܀ 2 (D>6bv 07   '''(i'D`P "`PD`` "` `  " 0D@ID@D>6bp "vP   2 D`T "`T㿘 !F@M  a@" a @a@ a1@ ~a2@.aI@"" w 0aH@"@  !J@' !F@! f aG0H!H@ ", !G@" W 0!K@"7 P L2J /I !F@", !F@"   ` !J@" ` `    " @" / @  2  `  "  /      !F@"   !F@> 6> 6 /> 6 d h'> ᠲ@] d`܀ "Z`؀T ` @Q d L d  `@G d @@B d @Xp 2 `ؒ@Xi @ "Ǥ 1      `` `" 1 ` $ d    d  d   d   d``  d`   d`  d` " 1 d ؀ " @2˒ @ 0֔  r ܀ & 2  0ǔ  c& ܑH /e * &  4`@6 4H 0Y " 2 &  ܀ "P2 K& ܀ E0!G@0H!G@> 1  47 - .0!H@0H!H@' 1  4  `" 1 ܀  @ @ 1 NULL pointer passed to ip_ecn_ingress㿘` >8th#@" @ @ .@NULL pointer passed to ip_ecn_egress㿘`?>8tH#   @  .NULL pointer passed to ip6_ecn_ingress㿐`2>9t% H@22`//@* * @&@NULL pointer passed to ip6_ecn_egress㿐`2@>9s 22`//* * @&㽸 ؀F ܀C  ? `; 4@@ːk 3@P! @P  /e/d<'h/I/H`'L'T"7 ``" 0 (0  ˆ  2B 7 @ *  6 /`' 4 * '      %     W 㿐  'L ,'P'T'X H'H> 6 d>a @1 3 ؀ ' ܀ #  2   2 4   2 2   2 @" ՘!`& `H`#`H`\   K#`\0*㽸 ب 䀤`N ܀K ` G C 4@@@P ! @P  /e/d`<'lc` `'p`'t`/I'x/H'P 'T'X'T'\"7 ``" 0 (0    2m 7 @ *  a /`' Q 2U  '# 2F @ > &&  @  @U  @O   - -%  % % %  `"  `8 ܐ?"`8&    v \  3   @OӚ 㿐   , b'> 6> d  H ؀@ d ܀`"=  8 d ` 4 d 4`/@ @US  2  ` 2 ` 2  ` 2  ` 2  ؒ @U8    d ܒ  @U0  " d!# H `$H !\ $\'@0 ! P'@Nے @Nג  >;/ >;/ bb' ''''''  ' ''Ā 'Ȥ@W   ` D@ "` ?W ` "` `  &` "`D``8?"`8㿘 x  @ 4`    8?$ 8㿘 > #L   0 @T_  2 ``$ `v  #>\ >??#d*` ??? 2  " 2?  @"   *  @   :@2㿘@N    . ``:` `*`?&@ #: . @ > % 0 @ !kb@ 0!j@@Drh0 W@")0!V@ "&!UL@N@0HaP@ aO@aM@ ai0J!J@ 1!K@  aiC @g=@ag@ ad@af@  !0!e@  !"$ @@ "!@ 0!@" @ #0H? ?  `"00@" 2 `0@ "@T0Ha"@a!@x Ha@".  !@'a @$0Ha"a@a@0H|a"aI@"]`a%@W0Hqa"aQ@QaR@S0Hha"` 1  /J`:   + @M `( $@,`),`(4 ``$`,`a,``$`@L > L`|$`` $` ` ``` 2`"`"L``  $` $`$`"@&`  $`  !@0Hh`0H^ 1`Y `? P ` ? I 0Ha"@"G4 H@"4  !@6 @0%@@0a!@0aQ@"` a%@1aI@=0 aS@"; aT@N0`(&`,&`0&`4&`8& `<&$`@&(  ``&`d&`h&`l&`p& `t&$`x&(`|&`&`&`&`& `&$`&(`&>! >0aȀ*`@L7 ǰ ꀔ ð >!Ā >0à*`@L! h! ?``'`d?'`h'`l'`p'`t'`x'$``$`d$`h @ $`l @ $`p$$`t( $`x`j`"00@ 4`j  a ` k$`  v``$` p _ &`&`&`V&$`$`$`$` $`$``?B$`@$`@. :$`| $`$`$` $`$$`(@K$`  //7'``0 '``4 @'``8 '``< @'$`D$`H$`L$`P$`T$`X$`\  `( &`,&`0&`4&`8& `<&$`@ &(`0@QW  " 4 " I-  ް /I  ذ /H @H $`|L$`P$`T$`X$`\$``$`4 D- @@``?'`d?'`h'`l'`p'`t',`x'$``0$`d4$`h8 @ $`l<@ $`p@$`tD$`x`j`"00@ذ $``$`d$`h$`l$`p$`t$`x4`j  @f  V4@ @J'$<0c'  7'/7'@ "d ?$`h$`l$`p$`t$` $`$``?$`$`@]8 #"` " ` 0 6  ``$`@p- a` "@@5 "@  - - Didn't unlink in6_ifaddr from list 㿈@p@ƒV`4 @1%> @JV  <<`0c'  77'/'` ` @ "`  2`` `   @P1  2 " @ʐ ` "`&`  "@  ?& L 2 `  $L̐L ` 2`` >@ "`0nO А "@@- " @ ?& invalid argument to in6_lifaddr_ioctlx2 >@l" !@ "!@"/ -0!@2* - @" 2!  2  `  2  @  " 8   !@ ^p!@"  -0!@Rp - @ @v " 1@ڤ ` Ԣ ` ܰ  @Iq x罔 繒' '  竒 ' '  //Ȑ> *@' a@IA  @$0* P烔 Pp T X'P\tx | 'T'X@O'\ 2  !@    P^   `W `pP @ d h'`ltx |  'd'h@N'l   ` 2۠`0D 1!@ (('4 ` ` 0@H̒!& *&@H’ x  (( 4   `` @H || H'<a㿘`  4   `  + ` & ` &`x H /f * ' `(&`('`,&`,'`0&`0 '`4&`4'`8`<&`8''&`<`@&`@`' a  " `8H 0&`(&`,&`0&`4&`8&`<M&`@ `8 " `  "`0 # `>!`>!a&`&`H 0&@w`(&@`@&`$`4  @  &``a     ` &`gT`4 @@lin6_savemkludge: no kludge space㿘  ,>  "   2  !>  J  ` }  ?"`   $ &  & " $ & `2 0.#     2  >Bjw"   ` L & ?"` &  & " $ & `2 >  2 ` "` @"  "@ " "`2"`" 2㿘> #    2   6% @GG $ $ cc $c" $c$ 㿘> #  2 @ `"  "` "@' 60 2 xH /e * & &` ` @ "`  2`` `   @L  2  ,  &  6%  2 @H 0% 7 & `& `& ` & & & `   "   2  2& '^ 6H 0 1&Q  `$  & " $  & ؐ@F ` `  @`/`/`''''  K0 a1@& `"  "` "@' 6 ?$ H 0  @V@H 0xH /e    "ؐ* &  ? /& @VS`"  "` "@ `` ?"` ؐ@F4      / /  '''' a2& 6H 0 ?? " 2  2  2 㿘 `"  ` 2 `@K  2 >> (@ 8*` >@ "Ἒ   :  2 23 *@(2  0 2  0*@`*@` *@`*@` 0 @*@ ` @*@ `0 @*@ ` @ *@`*@`$ŀ !b8(* *22 2 0 ? ?> ' L`"# `0`2``4`2``8`2 ` `<` ``2`0 㿘      0%>;   "    0 0  !@K(  2   ``   㿘̐ "  0   ?    @ `  (0  in6_are_prefix_equal: invalid prefix length(%d) 㿘>Eag   : . "@J͔ 2  @  "@ : `?in6_prefixlen2mask: invalid prefix length(%d) 㿐        ///////`/>Ebg 0@D ``: * @ &@ . `@ &.  ?. in6_ifawithscope: output interface is not specified 㿘# ? >Eh#0> '#Ȁ`{/> D@2n`` "j` ` `?` 2Z  2W  2T  D#6@ `6F   >!P`"?  ";  ") # " *  4&  4  $ 42 `  0  2`` 2 8蒂`B &:耥8,),*p B; 88p `B ; 8 `B ;㿐h ? ' 5' ` 2-  2)  2&  2#  >!P`2' F`2  2 0~y $   2 ' >!P `2  2  2   2  2'  2  " 㿐@  ' `2   @hڒ  2> 'Ȁ >42 0(@824 > Ё0 X@C@Cy> #(> `@C@C`W `   .` 㿘 `"s?@  2 ` "` `2 ``2@a? 8  #; %  ?0SD ``M?>aؐ@HΔ 7>a@Hǔ 0``` %`2#`  .`  .` .` .` .` .` .` .`` ?  `@B `   .`.``  ?  .`>` a@H  ? %s: got interface identifier from itself %s: got interface identifier from %s %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x 㿀? `>"`N>Gc e7 Hb,  > '>"`;>Gc> '#Ȁ`!>G@ 2`  >"`"#` e  b``耦@ >H fH `"?>"`>H`( d b >H`#l     #\ #`#h#ddې  %s: IPv6 not supported %s: SIOCSIFADDR error %d 㿀 2&` & & &` `&` "& ` > cL   &`   2 $ $L`  &`  `"'H /f * '   a 'H 0䀢1/ >H>H"e˒  `. "e’ ```"`& ``"@` ?&` `$ U?$L` ?&` M?>;b`@GH      8 >`!a&`&`!`(  `| ݚ `!`,&`V 4 @'@A$ `<< 0c'  7'/7' 8 " ` #  0 ` &` %s: no ifid available 㿘   @@  4(`$`$$`| $  @@$>;!` ! ` $`$$$ ,|@@,}( ,`@@,a<b 4 0`,(,)4042$4 $<$8{0 >"`>Ia c !L  ? @$$ ? 㿘  I @@  | ( `$   $$ @@$ >;"" `  ``$ $ $ $  , |@@|, }>;!!  , `, a$ h$ l$ p@@m$ t @$ $, (, )$ 0$ 4$ 8$ < ? bridgein6_ifattach: %s is not multicast capable, IPv6 not enabled %s: failed to add link-local address ia == NULL in in6_ifattach 8  5 >!4>쀢 >0>J P @I   >N  / 9z>!+>쀢`> '>aĀ \耢@ :\耢 * @:* " *  @? " =,  >*`"!%  @?ޒaĀ (,a u >%a"!uV 4 @>J`X b̐ 0$ 2 4  2 4>J d />쀊 *3>;@? a x    a' '''/@?/>;!!` '`'`''/x/y  (  , a  'ta'l 'h 4  'pxh  Ґ  2V 4>JbA  @/>@?[ >;!ؒ!` ` ` '''Đ '/@?I/>;!/ؐ!' /   0'''7 ` @ "`  2`` ` @E#  22 4 ( !  d 4 Aaa'h` `'t`'l'p h>;aa '''' ` @ "`  2`` ` @D  2Ѐ   (   ~ d < *% 0* `2 0  p  0 *#  0*@>  0ađ* `  \! 0!aė*#  0aĕ*@> @Q%s: didn't unlink in6ifaddr from list x@@Tw ؀`/>;@ ```2@ `h@ `2``? ? 2Y` )> ` ` `( S " ` 6, <   `|  ```"`& ``"@`  ?$` #L@ 2 ``%#L #L` 2``  >`"` "`>KcH a% ` ?$` `2@ې@S@> ᨔ  '    0/7/'''  @   0  4 lin6_cksum: mbuf len (%d) < off+len (%d+%d) in6_cksum: out of data 㿐 @ >L"`@=ʒ  ?/'?   ? ? "```?`` `  `  ?` `   ?? "``` `` ` ``       8 &   " `& + 2 3 ?c 4#  * @+ `  %@`` ` ``  `  `` ` `` ` `` ` ߚ` ,@`` ` `+ `"32 3 ?c 4# `@``+ 2 3 ?@ 4# +   @     ? @ * @ ?    @  ` *`& + 2 3 @4# @ * @+ `  %@`` ` ``  `  `` ` `` ` `` ` ߚ` ,@`` ` `+ `"12 3 @4# `@``+ 2 3 ?c 4# +   @     ? @ * @ 2l >L_*"H+ ?# + 2 3 ?c 4# *@ 㿘  `'@`           2  2  2  " ` >#d*` 00? ? " $` >#\@ } >#d* `  ? ?@ > " ΐ ```   @RC ŀ`@K "`D06 $@`I 1@ ` @A  " @@`8 ?"`8$@@ ` @ 2@`@;  .` ,`&` &`  &` &`&` `v $@`@   D  0@ D0 A 1'@  `  `>>0`0"(`#`  # `# `# `"? ?? ?9 '`` `>d(` 3 ` ` `` 0 3  >\  >d+`3 2" @# `?# `?# ` # # @ @ ? @?  >\ "# 0"#  3  ? @?? @?2 in6_prefix.c: bit_copy: invalid args: srcsize %d, tgtsize %d, off %d, len %d 㿘     >Ob] 05  8?  " @   :   +  @.:. `8`  * @.:㿘 Ԁ  ` 2  2 `O@4 in6_prefix.c: search_matched_prefix: addr %shas no pointer to prefix %s 㿘`Ӕ`, > `: @ ` 2```!`,4``+ ` 'Ԁ #!>P ` 2  2 @`  4  !>P@ p `] in6_prefix.c: mark_matched_prefixes:no back pointer to ifprefix for %s. ND autoconfigured addr? 㿘`Ԣ ,  !h ` 2"  2 `Ð0  8  *  4   P @ @$ P@$ P  2` `2 !h!>P@ ` 2(``0@ 4 ` &` 4`` @P @  "P@ "P@  \!``2@㿘 Ԁ ! `2  2   $ 2  P& P  2 Ԁ ??2   2  P  " P  2 <> % L " D" D 8" " @ L" @" @rr_are_ifid_equal: invalid ifid length(%d) 㿘 { >Qa\  : " *& @ "  @?` 2   @ * `?㿘    $@ Β  "㿐@} ".   0% " `  " H /e * &   "@ "` & " H  @GD ?D  `0  @ @H@8 > ! ".  ` @2% H /e * &  D "@ D"`D & D" H p@ D@4  2  ip6_prefix.c: addr %s/%d matched prefix already has another ia %p(%s) on its ifid list 㾐`0?  ? "z`0`  ؒ 2I @@85 T`    /'//Ē   /s  +*   ?/''''@ @90A @8 `7@H@, 3`  +  " ` "&`!>R ` 00Z 0$``  &` &`  "&`㿘` 9В`0 ".`H /e  r  * & ` "` "H  `` ?"` 6 ~`` @ 㿘 Ԁ `  2 @ 2in6_prefix.c: add_each_addr: addition of an addr %s/%d failed because there is already another addr %s/%d in6_prefix.c: add_each_addr: addition of an addr%s/%d failed because in6_control failed for error %d  x@7;` `@6̐`   ////Ȕ`$  v `  #@  n ` i` "= `"&` ?"` & %  & &!>R`"&` ?"` &  .% #`  0躐 Y 0 >  '> "@ `aٔ  !>S X` Yɐ in6_prefix.c: rrpr_update:%d: ENOBUFS for rr_prefix 㿘` Ԁ ` 2 2 ` 2 ``$ 2`` T `P`P@(`H˰ `,`H`L,`L`8$`8`<$`<`@`P$`@`D* $`D$`P` "`H``"  "` "@s   `` ?"`  ~!` H /e * &  $" $$ H p@ ` 2`Z`H }ޔ   >Sb Y."g 7o T$``>  ````"  "` "` $`" $`$ ` 2``$@ Ԁ`" " `` 2`"` ,` H /e * & !! $`!`"`#!$`H 0 `H@" ` "  `` ""` 2  㿘xCouldn't unlink rr_prefix from ifp 㿘H /e * &  Ԁ@2` "` 2`` >T "`Yݐ" ` "`  "H  }in6_prefix.c: init_newprefix:%d: ENOBUFSfor rp_addr 㿘  ~  &@5^  >Tc X^#3 7㿐@5O T . ` &`  . ..$    L `  "@ @ @    | ` ,# >  " "  " "   *  " "@"`&"    &8 &< @ "`H 2 H *`* &H @"`H 2  H*`* &H $ .L .P㿘 `"  "` "@ ` ` ?{ "` [ ~  2 @`԰  ` 2P @ E  > % "  2㿘 P`(, C @``"``@"H ` 2 "  ~   ` `` ?"`  ~  H /e`* &`ʖ H 0  㿘 Ԁ! `  2 P `2in6_prefix.c: link_stray_ia6s:addr %s/%d already linked to a prefixand it matches also %s/%d 㿘  "8 )>V ` 2.  $`4&`2    "@ "`$ 2  `   VВ!`2 in6_prefix_ioctl: preferred lifetime(%ld) is greater than valid lifetime(%ld) 8   . ah@ ag@ ad@Zaf@0ΐai@0!e@&0Ő J " 1 Ŕ   !g@=0) " 12 1 P. .8&<&H6J6L6 N6"&$ &($&,(&0,&40&84{&< >VbV@ p @34 T'/$/(','0'4'8'<''''7 7"77 B 0`"( ` 2$`?? 2 * #@   <  "@"`'" 2    1"00O 㿘> %"!>  >W 9~b>!P>ӊT9H /e * & > !``@  6 `D`  `D 6``H 0internet6m_pulldown malfunction㿐@     @:>WU@#   2 X!   *     @:>WU#   4? +> #8 @  $  `  ` `B =  `  " `   $@ @"?" ! $ ۢ@&@ ֐!㿘q> '>c"X"`8"`<m_pulldown malfunction%s:%d: ip6q already locked /usr/src/sys/arch/sparc/compile/GENERIC/../../../../netinet6/frag6.cip6q_lock㿐'D'H@'   6   @:>XT!    > (!, > #? %>  4   @7   ?`8 ?"`8> "# @1   , , $  $  $  $$ ` "  D 2  * @2  @ >0c\>!Ȁ >!`Б*@Ͱ!`B : ""@   @ >0c\>!Ȁ >!`*@!`B :> #8`B:`>#\0 >!Ȁ >!` *@" x`B :x H /f * ' > c   H 0    'cH 0    >X>X!bU9 >XS"`> '# 8"$#  *  *`@*   28 @6Ȕ  2 8 (@6  "#8#Ѐ2 #Ѐ2? >!<5> ) `'  D`& T  倦@0 D@$ $  x *  * *`@  $,, ?$ $ $  $$ $( $, $0 $$@$4 ? *@ #@2 ?$@ , ? * @@"@ # 5? @  H /f4'c* ''cH 0 !#@ ? @ H /f4'c* ''cH 0 !`1 $,?#@  @       $ ( , 0 4@ $2@ $   7@/ $ ` *  * *`@  $@  *` 4` ,` ,`  4` $`$`$`.$`" 4  " `@$ @ ```@"@  " `` " I ꀦ @n > "H /f4"* '"H 0 !  `"H /f4'c* ''cH 0 !5> )``@F"`@@ 2$ 2` ?ؑ* 2 2 - - % %  % $% (% ,% 0% 4% $     %%    @& ?U&p G@!1*@ ?` &   @%> #8h`B :h>0c\>!Ȁ >!` *@D`B :D"@H"H /f4'c* ''cH 0 7>0c\> >!Ȁ > >!`" > *@> `B :> c8 `B : lH /f4'c* ''cH 0 !%s:%d: ip6q lock not held ip6q lock check㿘> #` >[>X#bRĔ"S>[QI# @*'> )`@F``           $  (  ,  0  4@ $ @2`@Lݒ ?$㿘> #` >[>Xb#R"~>[Q#& `& `"` &`㿘> #` >[>Xb#Rj">[P#  "`  " 㿘> #` >[>Xb#RT">[Pِ#& <`8& 8`8"`<&`8㿘> #` >[>Xb#R>">[PÐ# 8 <"`8 < 8" <㿘H /e * & H /f * ' > c   H 0    %cH 0    >X>Xb!Q">XP"`> '#`8)> ) '>퀤 > #8 ?,  8 < ` `(`B <`( <2 !<@`< > #8 `0 <B<`0!<@ < 2`0H /f4%c* '%cH 0 H 0㿘H /f * ' > c   H 0    $H 0   $> '#8@ > #8 `  8B<`  82` H /f4$* '$H 0 㿘@<>uad>"a>px>"a`6 `` `"+(\`;`"SXV`R>]x*@L:@G:@B:@=: @8: @4:(" 8*`0@(:0@$:8"H"@`" P`@:@@:H@ :P@:X`@:`v4vHv\vpvicmp6_mtudisc_callback_register㿘>!` `@`2`   !  2"`>]OG#!! "@!" $!"`m_pulldown malfunctionENOBUFS in icmp6_error %d 㿐> b` B:b`> "L ' (   #    2  ``  2  2   2     ߐ?' ) @Ԗ 5 :23  @  v   @:>^NՐ @   `2 J@b` `B :    @`2  b``B :  @{ b``B : $$В"@) `` 0 8 0`  $"  ?ܐ?" 0  0    ?В`0& &  0       0&   0@ 0 2  >"`L>^`X N!0F? ?#  #  #  #  #  #  #  $# $  @ ? @? 2 , ,  ? ? ? ? 2+ (, , + ( (6* 6* 6b`* * * .`&  `B ;@  (0 ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) 㿐`'"` > 0c\>!̀ >!Ā` *@`B :  > ` `B : _ `@  [   @:>^M @  '2# > "`( B:( ` > 0c\>!̀ >!Ā`*@!`B : :ܖ 1>"` #>_ `M > "`((B:((` j> 0c\e>!̀ a>!Ā`]*@Z`B T:>  "`(@*` B; " " "s  +>" >"4  "ꀤ  "O } >""܀ 퀢 4>퀢 >   > 0c\>!̀ >!Ā` *@ `B : >d!,  €Ϡ   > 0c\>!̀ ~>!Ā`z*@ `B :    > 0c\>!̀ >!Ā` *@ 0`B :0 b`   > 0c\>!̀ >!Ā` *@  `B :  b`}o m   > 0c\>!̀ >!Ā` *@ (`B :( "P    b`Ub`QC A   > 0c\>!̀ >!Ā` *@ 8`B :8 0b`沔   "s   :m H /f * ' > ##Cf H 0 O 4 H /f * ' V > l*  2 H p@  $ $ 4 $$ $ $ ) #V @4   $$  $   $   ($  &  6 U$  LP   0 ("$ $ V$  (' @ , ,b`(8$ B`B ;$ ;(8@ *   k> 0c\f>!̀ b>!Ā`^*@[ @`B U:@   1> 0c\,>!̀ (>!Ā`$*@!p`B :p  > 0c\>!̀ >!Ā` *@x`B :x沔   @8K'@8C  > 0c\>!̀ >!Ā` *@ `B : "b`%>a      沔 Ė   b`@8   b`H /f * ' > ##B@ H 0 ' 4 H /f * ' > R l*  2 H p@  $ $ 4 $$ $ $ / 4 - H /f * ' >  A $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8   K " $   $ "  82 `"   0 $  " ? $  ̰?> #(4  (`( `0@' >  `4 #V @4   $  $  $  $ $  $$  4$ $  ,`(, Eb`(8$xB`B ;$x;(8@ (9 +b`4  > 0c\>!̀ >!Ā` *@ H`B :H  b` 沔 Ė  @O '@O  > 0c\>!̀ >!Ā` *@ P`B :P ڔb` 沔   @Pؔ'@PӔ  > 0c\>!̀ >!Ā` *@ X`B :X b` 沔 _  @E'@E  > 0c\>!̀ >!Ā` *@ ``B :` ub` x沔 ,  @Hs'@Hj  > 0c\>!̀ >!Ā` *@ h`B :h Bb` 'E沔   @ ɒA'@ Œ9+ 0b`3"`>_! ur `" `0IS L  @, "!b``B :b`0`B :0@]!!dlicmp6_notify_error: in6_embedscope failed / > ` `B :   `0@ 0r   0@:>^Hѐ @   2`>  Ҵ )>^ 33<+"< ,"  "   2  `@ 4   @:H @   `$3 ` *  * @ @  <`@     @:Hk @   >    `**   2'  @@ה   @:HG @   `>  ` 2 2  *  @ t@ `@ |  | @:H @   ?  * @@ 2 LB 0x  x 0@:>^G @   @%   / /`'`'` ' `$''' '̠ ޒ'А 頖 2>ؐ@$   //`'` '`'`' ' 郖  >"`H>da0GҐ 0C@?`* `*`*`@  * 'ܬ`'''''/'t** *  @'t'>  p >*` *  *   > ` ?`B : U?x >  * *`@ *   U!` >! @c>! `>! @Xؐ@$Y   //?' ?' ' ' ` 07@  .> 4 "  P  $ # P > @ <   T > ` @`B ;@# T > 8 ?# 8>!   @ 2 h`  8'̴ ``   eԔ   @:>^FĐ @   ϰ @#ے    /٬ /! [       * ` "@ |-     s-  ` "9>      c ` ``  `   `  ` " 07@)v  <0Z``*@#( > @c O K G ` @@`ȖД   @:>^F' @   ,  @! %  - 2   2 >!`>!`2 " <      <@b̓* @*``8h4(0 <H /f * ' > ##= H 0 &`6 H /f * ' T`> l*  2 H p@  $ & 6 && & & 2` #V @6 `& `& `& ` & &  $`,& hH /f * ' >  < & $H 0 $ (  & 6 & 0& (& ,& <& 8  n& & ` (  `(˔  "     T, - N,, , H, , , , 'Ȓ`8 ? ,  > , , * 8 8* * * (>  @E 1&@ -`   #& ,   8`&  & `  82̀"   $ 0  `8" ?8&̐@Ò 8& &  ,0  "  should not reach here㿘(`H /f * ' > ##< H 0  4 H /f * ' > l 2H p@  $ $$ 4  +* H /f * ' >  ;ג $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  } y $ $ * `s $      8 ``! $ 0@`\@@  J@ ."``@ *J@`  0@@, @  J@`N  .2  ) >& .@J@ ."`@*ڢ  .  &$   㿘@ @' c `_\@J?`2Y J? 2T GE& 4H & 4B N`&> N9`?48 ?45 `ˀ`ŀ`%#@ 2" 4 4  @&ƒ &&&& &  㿘   * @ `    B ?> '#Ȁ: .  `2& `  0`@&  " : " `  ` `   "   `@"    22&˨㿐2 > '# > % * b   d` bv Y `2P    `"ED ` 0 2>  0 "    1  - "+   @"% (4` ?'"''U `P  0? ? "4``  2 2 2 `* @`*`2`2`.`.`p 'В`   8Ԕ   @:>^B @   ǰ!@   //ْ   䦐> c c ~ `!"u  j :2q  $  $ (   $ ,  $ 0  $ @%  2[             @%j  2E  ؀   2`*  `* "8 3沔 ؖ  +`@Д@8А LZ 2 8 Ѐ "' 'V L8 "'  'Ф 2 `*`@@s8А L( 2 8ؐЀ !ҞT& L8 !   !Đ> 8PB?:P!sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/arch/sparc/compile/GENERIC/../../../../netinet6/icmp6.cassumption failed in icmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d  ''X>"`>k>kb"@  (A(0(آ  ( 0A 0  ؔ (  ` 0. 0   : `(.` `?`('` '`  '`$ '` ``&``&` `&`@Z&`$//`'`'` '`$'M   @C //'''' 5 ݖ > cL``0@$%  2`` 2```? ? `  @2`2'@`@     ɚ\```8 w?"`8`2@>"`!>k" Д\@ 0 `&`` :&` `&`` .@&`.`.`.`.`   > 0*` .`> !3.` : (--* 2 2 --  |6     @X X > 0c\>!̀ >!Ā` *@X`B :X > 0c\ >!̀ >!Ā` *@`B :`>n"*` €X  0\>!̀ >!Ā` *@`B :oX l 0\g>!̀ c>!Ā`_*@[`B V:X R 0\M>!̀ I>!Ā`E*@A`B <:X 8 0\3>!̀ />!Ā`+*@'`B ":X  0\>!̀ >!Ā`*@ `B :X  0\>!̀ >!Ā`*@`B :X  0\>!̀ >!Ā`ݑ*@Ȓ`B :X  0\>!̀ >!Ā`Ñ*@`B :X  0\>!̀ >!Ā`*@`B :X  0\>!̀ >!Ā`*@`B :X  0\}>!̀ y>!Ā`u*@qВ`B l:X h 0\c>!̀ _>!Ā`[*@Wؒ`B R:X N 0\I>!̀ E>!Ā`A*@=`B 8:X 4 0\/>!̀ +>!Ā`'*@#蒂`B :X  0\>!̀ >!Ā` *@ `B :P X(㿘@,(src=%s dst=%s tgt=%s)㿘#> !>oc @mjg?$ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s 㾘  ` `* `  '` '`'`'􀥠>!(`>!t`@ @   @:>^=R @   `2 `> ` `B {:  ?'` '`?'` '`'`'` '`$'07Ȑ 07  >"`G!>o W ` >"`:!>o J `=2 1>  @%  //l  >>0`"" ` >"` !>o!0= 8 !?`@  '>"`!>o!< 8 ?$8"`!>o!В4N8 ?$8Ȁ  >"`!>o"? ? ؠ`?@ `? `>"`!>o"PE< > `(@-I@-Ő >"`!>o"+< 0{` ``*  9 ?>"`r!>o"ӂ 9  @4 `?+>a.'>! @U`@? @@;  @7   /a/!/A/`H/ /@{ hw (s    a>t<b( @  //W  ѐ0~> z> ` `B ;assumption failed in %s:%d x> "  >!(`% >!8`!` ```4 ``@  @ƒ   //``'` '`'`Ӝ''@/ ` `  @J `H /f * ' > ##2 H 0`" 4`H /f * ' > l  2 H p@ `$ $`4`$@$`$`$` ``H /f * ' >  2v $`$H 0`$ (` $`4`$`0$`($`,$`<$`8``$`  $`  `8  `"``$`0` " ?$@8% 9 ? 0 k   g``0  0`4 ? ?  ` :  `,, , ,,P,`L  ,((,,,,,`4  70; `@7  `00 @, @.X %( 9&@ ? @&@4 $$&@0  &@"$`    ,(< .` *  9@&@$` j$`%  @ ? " p& &  >q    >q>k"b@:j*_? 6&   ?-  ` " `  8 "   $ 0  @ "  ?&      " "@ & &  " "@ & &   & @Q <  .@.``&@$`$` $@  $``? ? 2`-` -` ` 2-`-` 2, ,  2`,,` :?ؑ* 2 2 ,,,,  ( * @* 2 2 ,,    @Y  >#\ 0 >!̀ >!Ā` *@ `B : >#\ 0 >!̀ >!Ā` *@ `B : > 0c\>!̀ >!Ā` *@"> `B :> ```B  :``  ~㿘 `   : @  =9   242 * "  ( "  `؀` є  I2 *`؀   + ' $ `ؔ  㿘>!>> #a`?㿐D  "3  4 $> 0    " P"P T"T X"X \"\ `"` d"d h"h l"l p"p t"t>!>taH ⛐ icmp6_mtudisc_timeout: bad route to timeout㿘 2 4>t8!`  2  P     00  @ <& Ticmp6_redirect_timeout: bad route to timeout㿘 2 4>t8!       0diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘`h ?`b>u *` €>S!t>M!x> ` H>="x>7"|>1">+">%">!>!>"> !>!>"6 *H0ԄԄpԄӈӠӸԄ0H`ip6_init㿘  u  >>u8 ؔ#@ *"@ *`" *  *  * " * "> `p: `*@@ 6*@>   @/>!+ +`" " **"@ " *` * @  *`*  @ *`* " "@ *`* " #@ > p@``2 `4S```:* `4@ >a> #@'" F> "a`@ 㿘> b #>ԓ !> "@@Œ > `aP!>  ؒ @>Wbt aP㿘H /f * ' > 䀢` ` """`?"H 0 `@ 0܁ip6_input: packet to an unready address %s->%s m_pulldown malfunction㿈 (?'''D    > 8Ȫ `B 4:Ȕ8 `B -: "@> " > `0#8 * 0  > #8*  `B ;@ > 8 `B  :> 8 `B :D  > 0c\>!Ȁ >!` *@c8`B :c8`B =c8D` '#c8`  ( 'D``B g<`> 0c\a>!Ȁ ]>!`Y*@UiD` ` c8`B :` B> 0c\=>!Ȁ 9>!`5*@1`B ,:D` C $D`#c8`  * >ђ`0B 8 €    "     2  2  $ 2   `B < Dt      ?#@`c8     ?#@R         D  D D $ DD``4  S c8`B :.` `4)? ? ? ?  ?  * @c8? ? ? ? ?  * @c8`B :? ? ? ? 2  D`0* 2 2 . .  ? ? ? ?  DD`0* 2 2 . . D 4`?  ? 2    D  抖 0E    O> D  "D 0>c\>!Ȁ >!` *@D`B :D ` ` @ "`  2`` `    @  2 2 >!؀`2Dc8  @B`DB ; @; y`D   4 `  @x   `c8p`B (:p $`` c8x`B :x8 ?"8$`!>  @Z ?  , ,  $  $  $  $.$ `,>4  '>@ 8`">Dऀ D 2ऀ > 6 "`!>u#@ = 5% 0!(`2# c8 @B: @D` y> 0c\t>!Ȁ p>!`l*@h8`B c:8  * @'  @Y쀢 TD   *` 2G`  2C` c8`B :` > 0c\>!Ȁ >!` *@D8`B :8D  > 0c\>!Ȁ >!` *@D`B :D  N 0 ` ( )   (蔒   @:>u4d#  'Dc8`B :? >!(`2 DD`؀ `( ( ` "@ #` D ("`   >!؀`D@   c8`@DB:`@0 DD0D@ 0  `2   2   ?#@c8  1c8  2.P ?#@2(Pc8 B: D` ~> 0c\y>!Ȁ u>!`q*@m `B h: `B c:P`B :P>0c\!>!Ȁ !>!` !*@!@`B :@!C > > pa>!D D`@Δc8`  * @*`@*` !>0!c8`B :` > 0c\>!Ȁ >!` *@0`B :0eD㿐 )  (   @:>u3Y#   2 &>   (  ( * `(  (Ֆ   @:>u34#     > 8?`B :@% && ?length of router alert opt is inconsitent(%d)length of jumbopayload opt is inconsistent(%d) 㿐X?# @ "  0= 08A o> `< i> `>z`3 `H  *&W> `>za2    *`  `/  %(0>  '9֔$@ @@?9 &@4 > #8 ֚`C : $@  i &?> #8 Ԛ`C : $@  [ ?#8 Ԛ`C : $@  N  ?> 8`B :~d?㿘 @/ "- 0( > 0#> 8`B : % ?8`B :`   ` #   ?~,?x 8  `  `@    8 ) &@ `@@* ``  `   7…  "  0'    ) &@ `@ 'ܒ   ) &@ `@/ . `2( ` (@w >     *   0}> 8`B W:   Ζ ) &@} `@G (  3  <  +098@? ր 3 ` *  ` *  ƀ 3" @ <  + 0    ) &@}h0 @}c 3ip6_pullexthdr: invalid nxt=%d 㿐3 <+>{#2͒ {3 *  * H /f * ' > ##(y H 0  6 H /f * ' > l 2H p@  & && 6  . - H /f * ' >  (? & $H 0 $ (  & 6 & 0& (& ,& <& 8   | 2 (  &  8`"   $ 0  "    &  |i  ~& `(   (   ,3 ((    ip6_nexthdr: m == NULL` 2 >|0"؀ h? d3"9`<,"`Y2)`(+;?0P8?0M6`IlG;@ D (~Ѐ><&@ 8 ~}?#@2/?,*&@ & ~kȀ"&ɰ? * `@  ~YȀ&ɰ? *  @@60?㿐?' ?diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKOpenBSD-current㿘`f ?``>}#@*` €>Q!(>K!,>E!0>?!<>9!8>3!\>-!@>'!D>!!H>!L>!4>}l>!P>!T -44444440H`x4cannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_forward: outgoing interface is loopback. src %s, dst %s, nxt %d, rcvif %s, outif %s 㿐 > %  c`'D  "> 2-  2)  2%  2! >> @8@>a``B  (:@!>}#a`#=:D` `/ 0   D ؍ $> ?,D$  4  { > . `#> `4 `` `8 ?"`8> " ɐ`` ND> 8`B :  ߄ 0Q >  @ǔ  1#> ` #> `8 ?"`8> " @    ,,`$$  $$׌$` D> 8`B :  G 0D`v` @r@G> #8 @ B`B ; ; @ @ > 0c\>!Ȁ >!` *@>8`B :8>>!@`@ @ "`vsD>} @c #\`.S  I   0C @D< ">0c\>!Ȁ >!` *@ `B : # @`< ͒ 0 4`2 02 @2 @`02 @4 @"     ޱ yD0  @`4 D  ? ? ? ? 2, , ? ? ? ? 2 @,, @ :D DyDW S @@'[ ">  @ > 0c\>!Ȁ >!` *@"> X`B :X> 8@`B ,:@#8`8B:`8 @>0c\>!Ȁ >!` *@`H`B :H`8H`B :H  A > <- €` 0    0y2,,㿘 l>!؀@ ?* ?`%>"*` €@ג@@@@w @@ - 㿘>!؀@    w  k&xU -0@㿘0 !k 0!j  @ @\㿘H /e * &  >  >     $  ( ,  0 `H !X*` B ;`H    @  2  $ $@  2  2 `H`B :H 0`2``  < 8`h< @`p< H>䀢* > @*`  (: 0: 8 : :  >  H "@ > H  㿘V 28 - R `:`1 -"/ *` 2+ *``>$ *؀ > 0"a> "ؐ!X@ $> #@ !> >  L"H>` >!P`&`͓:` xH /e * & >!< `)> *#>;!x!x#,`2 * @*`@  ` `   / ''''   a2ؐ`* 2`@ ޢ#@> " H> 4 L> !X *````   w#= 8 2 `6 8`2``*`> !X@$>>>2!"a"ܑH 0 register_mifx`? *` > * c `~ 0>#\ >t #d*    !>!?#@> > >#І ` 4#Д#`* `""04004!> . T4 @K -H /e * & >;!x!x` `/` '''' a1ذH 0 $H /e * &   <`8,@$`<` <`(<`0H 0>䀢 `2 x>> *@ *`# @  C H /e4* &  >;!x!x` `/` '''' a2ؐ@ `a䐒?* @ *`2    ?* @*`@ ` 4aH 0 add_m6fc: %s o %s g %s p %x dbx %p multiple kernel entries㿐>  >  aX    $  ( ,  0  H `*B ; H     @ ]  2  $ $@ V  2  2 `H`B :'H /e * &  848 <$< @$@ D$D H$H L$L P$P T$T X$XH 0C H /e * &  aX      $  (  ,  0  , { > # 7>5>@   2l $$@   2d "``*`2    8#\ x)۔ $  $ $ $  $ $ $ $ $  $$$ ($( ,$, 0$0 4$4 848 <$< @$@ D$D H$H L$L P$P T$T X #   @ t  2B$ $@ m  2;$ $ $ $  $ $ $ $ $  $$$ ($( ,$, 0$0 4$4 848 <$< @$@ D$D H$H L$L P$P T$T Xx$X`<` (`!X@@  @   2  $@   2  2  $@. 8H 0  H 0 1㿘  L      t3?cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full 㿘 > %"?  ?@@ ?@ʐ `,.  (  $   >> @8@>a``B  :@!>#a` @/ ,  `(  H /e * & >  >  aX        # '  H *` B ; H     @ ڔ  2  $ @ Ӕ  2  2 ` H`B :` HH 0@L`B :  8^   沑H 09 7 t#     'vD ( 2  + 8H 0 7aX          #  '  .@ ` `@ j  2` `$@ c  2`` "``2`  8   8sH 0ܰ 7  (sǖ  >ݒ 8s ؒ 8H 0Ű 7 !"  >"   " ܄   d" l0   +`+`  ((䯒 8rܐ䪒 8H 0 >> !c  >*`2  `2`܀dl +`0ؒ ea耢  H>`x&  H``B :`q 8rl 8H 0Y 7`B :@   ,`,@  $` > $`  $` <,`,`$`# aX$`$ .$`( $`, $$`x$`0  *4`8 $`# !$` 8 8B: 8/r\H 0   `4 H ` "$$$H 0 㿘H /e * & > !X 5>  @ 1 - ,>  H `"!x ? $x@r`ݒ 8 2@@ @B=@?-@$Β 82 ˒H 0>  L>` ה >!P`&` :`㿘>8!   (> *  @" >  H 0B: 0p`C >p(> *   " >  H`"   @2   (rX      ' ty ( > 7!ܚ d l" 0   +` +` **q{ а >> # `>>퀤!!ܔ *`2  `  !2!܀ d l`H `+`"` " `" `2" " ""`H  ؔB<    ` 7`B < ` 08( @< B`C ::@h` B#>a䚃`C > >`>hZ > #8<  .`2 2 * @  * A> 8c* @*` @ 2(8* *  @`2!8`2 ਐ`" 8਒`B >਒@`( B`C <(<8 @`>* 2`@ `  㿈`H /e * & 沔 qK     'sl ( 2  H 00j"4 `>   //> '  @ H p@0P# ` @ "`  2`` ``` ` @{  2@`  ,`,@ $` $`  #$` $@ $` < d  ,@,` $` $`  #$` $$` 0pH 0㿘> 0`B :0H /f * ' > ##H H 0 " 4 H /f * ' > l  2 H p@  $ $ 4 $$ $ $ > #, ( $  $ 沐 py  $oU 7 ``"  82 ܀  $ "  "`  ?ܒ ܐ?""@@4r ܐ($  > > "c &@ *`"   *  "*   * "   :  > `H2**`>횃`aؘC <`(  `` 7`B <``m_pulldown malfunction㿐>  `B @: @" '`!`B ;`oI 0 /  0 @@vږ   @:>#9#`  ' 2 !`B : /!  gq  `!Bo :`0j<   `!Bn:`0[ !T '>>햂B!䀣 48 ?#/ @2@/4 !(`C B8(n804 ` ( ; `  !(Bn8(0" `0os  n!0qE`> *@ #*`@`><^A '@2Ő!ip6_output: IPv4 pcb is passedip6_output: tag of length %d (should be %dassumption failed: hdr not split''@ 'p`0 ``" ` `Ĕ@* '``" ` `Ȕ@* '``  `@* '`<`  `@ו* 'H /e * &  xR  `$" >""; $ < ( ?'x  #\  ( K H 0 K?"'0xd!    @  !@  @#  (xK 2 g  !H 0Ā  AȀ  ̀ Ѐ  AG'H 0Ȓ Ā     (  ('t  `   @  ' '?c? " @  '' '`@{ ',`,`, 2 2 ,`,`И` 2@>!s"Ж <"#@ ``*,`Ā 2 >!a" *@+@"@`#@Ȁ 2 >!N"Д < *@+@"@`#@̀ 2 >!:"Ж + *@+@"#@̀ ",` `'`'` '`$'   '  $`  $` $`  $`$ * ?* " " " " ` 2 `` 2 `` 2 `` 2 `2 `> #8  -B: `' > > #8  -B: T'~ *&8X`B :Xؐ@ `'p` 2`  4  `@ݔ  " `8 ؐ?"`8& `@Β   --`%`% ` %`$%`"L `H /e4 `* & `   > ,` !7,`` `?`,`:ג  H 0 Al^'؀  G  2 YԖ 'H 0 v 2O`2 `t> c8  AB: ' "`t4 `@0` < 2`>#\ 0 >!Ȁ >!` *@`P`B :P`3`` /` `+` 4 '` 0 "> #8`B :> 0c\>!Ȁ >!` *@ AX`B :X A['``?``,` ` >" 2` ,` 2`> !7,``"```" ```>#d*` `? ?@ +` &>  4 "> > c8ਔ 3`B :' 0>#\ >!Ȁ >!` *@ X`B :X" ` `? `,` 2Ȓ &`2 `t> c8  AB: '`@ "`t >#\ 0 >!Ȁ >!` *@ P`B :P >#\ 0 >!Ȁ >!` *@"V 4`B :V 4 @2# > #8`B :> 0c\>!Ȁ >!` *@ 3X`B :X 3'؀` @ "`  2`` `   `@  2    >@  `>!؀` 2 ` R ` N 4 `0Hr !p`2'@p@2p@ ` 4` p ` @ے  pp`8 ?"`8p"@p@ p@ɒ   , ,p$ $ $ Ǟ$ p> 0b* T  2  4P  "T 0b*  4 )?` @?  'x? ? 2` ` > ` @  @  x `> `*` d* 'xx`?'x`'x? ? ? ? 2`,` ,` `? ? ? ? ,`,`Ā`  `@3 #  `*`)  t'`"` ?2` +  Aj'ea  x@T'$ ( ` `* @>!X?c "!X t$ ? ?`̐ ( ['> 0c\U>!Ȁ Q>!`M*@Ih`B D:h  Ȁ 2 Ā " `  , *> #8> c8 ` 7B: `' ,,`tH /f * ' > ##ڒ 'H 0`' 2`H /f * ' > `l`  2` H p@  ""` $" 2" "`  #V @2> %,   ( #  (Đ"` |@3t 't& ?* |2 2 *@* %|  *`  * 2 2 **t@?* 2 2 .`.`i˖  "j> k{ "`4"|4*`|4* * * * |> c8*x`B :x>#\ 0 >!Ȁ >!` *@"p`B :pC >#\ 0 >!Ȁ >!` *@" ``B :` 'h'  `"`  @ux'h '  > #8p`B :p p؀`"p`8E @؀``8 ?B"`8hhhh~Фh{܀㿘4o 7H /f * ' > ## H 0  4 H /f * ' > l 2H p@  $ $$ 4  --`H /f * ' >  v $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  `gĐ  7$  & 㿐 ?H /f * ' > ##< H 0  3 H /f * ' > l 2H p@  # ## 3    # ,`&      8 `"     $@  0 "     ?# y (4 7H /f * ' > ##ْ H 0  4 H /f * ' > l 2H p@  $ $$ 4  -H /f * ' >   $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8   g; ' 7$   g,@& $ @ ,`,@  ` *` ,` ,``'` `  "`㿘( ؒ (g  ] 7&@ 2   &  &  & ``@&`H /f * ' > ##$ H 0 2H /f * ' > l 2H p@ """22 7 " && p> "@`` `  8)  `ߤ ) 2 8> * € @Ӱ`  2 `>#* €!8 $  ` $ ` ?$ ` ` $ ` ?$ ` ` $ ` ?$ `@+ ` `-@# ` `% ` ` ` `  ` ` $ Ԁ ` $ ` `*@$ ` @P`" `" ` "  `  ?$ ` ?ߐ $ ` ? $ `H /``* !` ` $"`   4L  @ H 0a``"^ ` 2Y `6R >750= <,08>!􀦀 63,  !2  2, *, ! 6&,  !2 2 , >! 6,  !2 2 , >" 6 ,  !2 ",   `@  <*@ * $  *`°e"`;>"*` € 沔 f ' dE '" ` `3>"D*` €,  `)  `2 % `2 ! ` `2  `2  `2  `2    `2  `  2   d '` $` `"@ @ZH /`4 * !  !   '  !'! '!'!'!'!'! ' c/' $$` `[ $H 0$ 6$` 75"  `<" ` ` "  *  `deOOOP PPPPPPPPPPPPP(PP8PHPXPPhPPPpRRROOOORPPPPPORRRROOROOOOpORRORRRRRRRRRRRRRRRRRRRRRRRQQQPRRRQK@KXK|KO0O0O0O0O0O0O0O0O0O0O0KKO0LL$LDO0LdO0O0LlK K K K O,LLLLLLO,O,O,O,K K O,JJK JK O,O,K O,O,O,O,O,O,O,O,O,O,O,O,O,O,O,O,O,O,O,O,O,O,O,MMMM O,O,O,M㿘> "@    " $c$ @ {є $` ` ` մ {` c a2`4 " @ƒ $ c|p@> "@'Ԓ 5 ӛ &@$> !7 ,,$?`3>#t*` €,  "& >\@   >#d.  V4@2$ 1     a? 2,> !7,    (,     2  2  2 2  !2ݫ  'Ԁ ̐ >#\ @ Ɛ )>? ?@ > "" ؐ @_'ؐ /ܒ , $  $  $  4$ ؀  1 @#d*  V4@2 1? ? 2 6  `2 `@$  2  u 0 6 ː Ԁ c$ $  "`$_$ [  W  2  2  2 2  !2 >= : >#\ @ 4 >#d*? @?@  6  `2 `@Ô  2  2  1`"  "`  "@RP 6 -' >!4 @     @7 5&@ԁVXVWWTY㿘 aH   &&   -0! ``"` @`2`0" `` "`  ` ``"` >!4"`"  -㿘  `"  "`  "@ " 6  2 ߒ 5x  ` @5 @?&``"&@ɰ  "Ű  @`"  @8 ` )2@`?퀢`> 0*` €@ $`&`  ?` ? 2`2`>#\@ 8      "x@@ `  //''' *'얒 "q 1`   0@ 2g 1ऀ 2c 1 2Q@] 1@ 2Y ``!E&`R "O @`"K  ` @*F `4&` @ v` &`@ (9 ` `&`&`< @*`` " ) @ \`&` @*  @2   2   2@  *@   ?@& @   ?"@`@&  ]x^^_$_<_㿘沔 aۖ  7   ' c ( * '8a 0"??  ? ? 2* * ? ? ? ?  ** P 㿘 (a H /f * ' > ## $ H 0" 0H /f * ' > l  2 H p@ $  0   2 `$ 7#V @0    (     (  &  6    ؖ(& &    & &@  2   ("("<(<(m_pulldown malfunction㿐@`   g   @: >K#   2 )>    2/   * @ gĖ   @: >##    > 8!`B  :@ !0 > #8 `C : $  Ӕ  !  * @&@ 㿈 `2˰ > #8 `C : &  IJ ?2  " > #8 `C : &  Ġ ?*  . 1  2  2   2 "">       ?#@"> 2`  2`  2`  " `> 8`B :_h?` 0> ` `  ` `$ " >  ` ` ?#@2`` 2`` 2``$  " `> 8`B :_D-?`?#`  ? # '` ' # '`$'# 3   &`&` &`$ &`  0*`2`2`.`.` ?㿐> !>  h"    , , , 7 , ,  >  p?" " 㿘H /e * &  > 0bX2` @  "& $  & $& ( @ y@m 2  & (& $> " H 0㿘 > 0bX3  >0"h4  $   @     @U m_pulldown malfunction㿐 `    f9   @:>"X   `2  > ` `B : ?? @@ "@^s0ˀ  " 0`4 ` ` 2 `` 2`` ?` ? @? 2 ` `0* 2 2 .` .` `   "   2  ``* @``*@2 >`0"X2  `r `"X@M  3 `  (/@` ``  `` `` `@3  2@2 `( @ $`($`$ ( @@ $`(> " @`Ơ`4` @9` 5?` ? 2 ` `0* 2 2 .` .` ` ` @ "`  2`` ``` ``@  2@`"`$`$$`(`? ? .` .` ]㿐> ` H H /e * & $> #L'' ` `` '' #  (  ? $ ( @ $ $$ 2 ` `` '' 2 (H 0㿀  'n SH /f * ' > ## H 0`#> # 4`H /f * ' > l  2 H p@ `$ $`4`$@$`$`$` `H /f * ' #Q H 0` 3`H /f * ' > l 2H p@ `#`#@#`3``2`\0ܒ @ ($`$` $@$`*+ + +   :  `*+ 0# 4# 8# < # # # #    #  #  #  # $` #` ........ ?& &  ?&  &. .  (  :* 2 2 ..@ >!> "` .` @ B8 /> '/`p  䀢 m> 0c\ >!̀ >!Ā` *@``B :`#`` 0M40JI 0\D>!̀ @>!Ā`<*@8`B 3: 0 0\+>!̀ '>!Ā`#*@`B :  0\>!̀ >!Ā` *@`B :nd6_init called more than once(ignored) 㿘>b̀  >a 0%>  * * >  +  (+cx"cx"  #b!>  >b >!P*"@ *`@ Ǔ*`㿘>"`>>\⼀@*" 0\⼀   * :* "b⼒ |*  ˀ@Β 4 e |$ 0*  `3>#d*  @ <#  00* *  0*` "  0#*  2 * * @f$  0#*` "` 0 * * 0*@ @"`㿘> 0"*`  8 # %"  < <"  < < <;  @%8 % "#܀8""  @ `">Ѐ *"0㿘@G (&`& & &ndopts == NULL in nd6_option uninitialized ndopts in nd6_option 㿘 2 > Ѐ2 > `"  2 `   `*  @ & @ ( 2  & &  ndopts == NULL in nd6_options uninitialized ndopts in nd6_options duplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt 㿘  >!  2 >!耢 e > ` `B ;@뮒 (W?   뀢0> `!> l*` € *  >"`>b >& * `"& & $>"`>b8{ >"  > "`@ `B :>  >bpe    {l{l{{l{lrt=0 in nd6_timer(ln=%p) rt_llinfo(%p) is not equal to ln(%p) dst=0 in nd6_timer(ln=%p) 㿘> %"H /e * & !> "@> `>!P>x-> >"1> " x ``@>0  *  ` u@`L`@ >  ͔ 2T >  ƒ`a>!D*` €>"  6  $ 0#* @@$  ? @`2"   s 8$ 8>" 40. >   4 $ #>" @ $ 4 >"   $ 0#* @^@ $  @  @b2v x "" `@:@`J`8 2@`< 2 @`@ 2@`D 2@ _`8`$` 6` "` 6`P`8 2@`< 2 @`@ 2@`D "`P@@Ւ`8`P  .6``@X`H 0~4~~~,p> #x`#>'> +>)>@`" x` @@ 2` x` b@ bĀ \  8   <    @   D  @ 8@ `2\ 0@a(@ a( ">!8` А@ɒ $@ @"` "@`@0` `  ` 0@@ސ  "2`nd6_lookup: failed to add route for a neighbor(%s), errno=%d nd6_lookup: failed to lookup %s (if = %s) unspecpؐ@}     / /ْ'''b'쒒 '`4$ Ԁ` `8 ?"`8'Ԁ 0Ԁ` !K 2 L ʐ '> $ > Ԣ  !>#@T < Ԁ "0  L`?2` 8" 84 $$`0 ` `"D @`>#*>#   ԁ㿘 ? ? 2`  `0@"& `   `2   0   ``    2R @ 㿈`    `L' ' ' Uk'>!(`2E>!8`"@H /e * & ` `@@ V  2`@ "> `@@耤 > 6 #x #x` "`" "@$x$ "@@P"@H 0 ` `   㿘> %"   3  . 4 $$) L % 0 !  S  2   >b  #   ` 3  @> 0*`  # nd6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed nd6_rtrequest: could not join solicited node multicast (errno=%d) 㿀`4> %`@`"`0`L "  e0"`40>` `0 `8,`04$  "`4  "$ `4!`4   > 8 `8`` ؐ 0,`04 ֐  v  &`L>a  ǐ 0> >  ฒ`# "@紒  $ 4  $ f 8 ?4 $ `4>$&`4bb$"b$ " ` `@` "'`4@ ͐ 4 $  $   ` `9֒ `9,>"`> " `D &`@ ʐ?"   & |&`D@x 4 $ $ T`4 @p<` # '  '''7`07'/:'䀢`V> !@0RQ@7%> T`4 @2<` #` '`  '`'`7'`0'7/'` ` @ "`  2`` `   @  2  ?$"` "$ `4&`L ;&`4 "Uǖ 㿘`4`2`@  "!` 0+a >` `0 8* 02@>!( ` ` `   @  ` `@̒` >"`> " &`@default router list contains a non-linklocal address(%s) a router(%s) advertises a prefix with non-link local address `0 W 4 0!V "> !Uܰ0ߐLN00HaPd aM&aO-00J!J1!KM0@f!(H /e4> * &> #x 2 /,"*  @'> ?&` &` ?&`  &`6`W  @ `.`  6`" &`$ `06`( ` $ H 0v@'H /e * & >"W1> * +@ "`$"`(" `,"X * `*!H L#@  020P \ +->` 4# ,`, @ 4  8  < ? @4?  06$@  ̒ ۢ`* * @2 2* " ,!) ',* * $ ( , 0  H( (!8 $< (`000@02 , P("Ā $$H 0װ>"#>" :Ͷ 0* &` &` &` &` &`  &`$ &`( &`,>">" *0 `$* " А@O $@ @0H /e4>* &>"Ā   8   < 2  @ 2 D @ǒ 8@R`2 8H 0qH /e4> * &> #x    @ @cxH 0N`?` @`?` ''''? @? € 07‘H /e * & O 2  L H 0R&`(&` R&`$&`,H 0 !\&`@t`ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdr㿘> %" >h# `2@>b#@ `  ` `   2  4  (2  "  4 $$" L  0`` `@ `  `` 9@A@ @    9`.`` 9@ 2 `2  `    ? 4 >b  $  @$ "$  "  0 ` 4  4  `  24   4 T   >!(`>!8`@㿘H /e * & !>  >b{ >!P *"@ *`@ ꅓ*`>c\# ">"@ ,` `\ 1 $ >"x$  #2 * * @V$ \` @>H 0nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) 㿘!> %"   8 "  #     :` 4 2`4C  `8`@?@$`8`4 &``0>  < "`x 4   A " `0`4  ``0 $`x " A`4$2`L    `L`2 4 4 \ > 0*`  S !># i   T  >"  4$T 2 T>"|  4$$T , ?"4 "Q$ >" 6@  $ 0>"*@ `@z#$ @И *  [  4  `" `|    "   | 2 ,`  QOnd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0 㿘"` 8 "  3 #  30)"/0&/ / / / / /  `0` >#`` @  >#Q m_pulldown malfunctionnd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s      ' ''''' '$'@   X l  l @:>l!   `2  > ` `B :  `'` '`'`' >"`W!>! i H耢 (쀢 $   ?#@>܀  > >䀢  >"`!>NaPȀ  >"`>Ba? ? ??   07ʠ`ДL  >"`>a 0`" ``*     ؀>"`Ԯ>a ☒Ȑ `?  .p@ْ Ȑ ̒ /p/q'x'|''  4@  0 `     0 `1`@' '''`   " 9 ?>"`{!>"  9 p☠@恔   !>"` 0Z耢 U쀢 R O L@^0H -쀢 * ' #>;!!` '`'`'' 0` 7ꀧ "->!(` @0  ` "->!(`0@ԚN0-☀  !>". ☀  !>"#ؔ  ☀  !>"Ȕ > ` `B ;Nnd6_ns_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) 㿀 ' 9>  c, ?  @g> "(0oH /f * ' > ##Ғ H 0" 4H /f * ' > l 2H p@ $ $4$$$$ 5`, -H /f * ' >   $$H 0$ ( $4$0$($,$<$8 M `"@  , "4/'/, @$@ $ $*@ ,,, @  :  `*@  , ` ,@$`$`$ ` $$  ,, 0 * 2 2 ,,,#,,,,, ,!,"  2,%,&,',$ ,   ` (`  }I  = 20M0$4$ 8$<$@  ,((.`.`.`.`.`?&` &` ?&` &`? ?  .` .` , @ ` 9  ?@$$ @޳ .`< ,` 9 |`, 2 2 ,, : (.`.`Ȑ* 2 2 .`.`@   䀢 1> 0c\ >!̀ >!Ā` *@`B :䀢 >  0\>!̀ >!Ā` *@"> `B :> `P`B :Pnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) H    ' ' ' $'  >"`!> h     >   @@TK   @@:>!  `2 `> ` `B e: ?'` '`?'`'``* `**``@  2 2 2   `? ? 07؀ >"`.!> ؔ &>   `>"`>` > `/  >"`>ar 0` ``* e  ` `@ 0 !>!0l U 0‥ 9 ?>"`!>!XW  9> >    L`0 T` * 9  , ` 9 {e `4``$`@> 0> %*` "  4`> %>⌐ $`2    ` 9@ @  ```T` u 4`> %>⌐ m$`` `2+T`  9 , ` 9{  `4``$`0>b* > %b    `  4`> %>⌐ $`T` )2(4`  H o *@ f @@ ">@ ,!(` >!8`@@ H 04`4 ?$4` $` $` K90 > `Ș `B ;K-nd6_na_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) 㿀 9>  c, ?  @g '>  P(0pH /f * ' > ##E H 0" 4H /f * ' > l 2H p@ $ $4$$$$ 2, -H /f * ' >   $$H 0$ ( $4$0$($,$<$8 JS @` ,"4/'/, @$ $ $* ,,,  :  `*  ,,@ ( ` 2$@` 2 @` 2@  ,, 0 * 2 2 ,,,'. ,,,,, ,!,",#,$,% ,&$`$`$ ` $$Ē 20JE0 $4($ 8?$<,($.`?&` &`  &` &`? ?  .` .` ` @`  ` 9@ ` @  ` 9  ?@$$ @/ .`< ,` 9 yv`, ., 2 2 ,,666.`.`.` :.` (.`.`9* 2 2 .`.`   R䀢 1> 0c\ >!̀ >!Ā` *@`B :䀢 >  0\>!̀ >!Ā` *@"> 蒂`B :> `X`B :X 8"  #  2  ؁> "  22 㿘 > `xar㿘ᥐ nd6_dad_start: called with non-tentative address %s(%s) ???nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_ ... . .. tmpc2_compiled.___gnu_compiled_c_open_countnetif_sun.ogcc2_compiled.___gnu_compiled_c_netif_prompromdev.ogcc2_compiled.___gnu_compiled_c_filestore.9_bootstore.10_prom0_fake_saveecho_pv_putchar_sun4_idprom.65_dtab_stringbuf.75_promdev_inuse_prom_mapin_prom_mapinfo_prom_mapinfo_cnt_prom_devmap_promvecstore.88version.ogcc2_compiled.___gnu_compiled_cufs.ostrncpy.obootparam.ocd9660.ogets.onfs.orpc.ostrerror.orarp.onet.oin_cksum.oether.oglobals.omemcmp.oexit.ocloseall.ocread.oalloc.omemcpy.omemset.oclose.olseek.oopen.oread.oprintf.oarp.osdiv.oashrdi3.ostrcmp.o__main.ostrlen.oudiv.oumul.ourem.obzero.orem.oinflate.oadler32.oinfblock.oinfcodes.oinffast.oinfutil.oinftrees.ocrc32.o @ a< < <+#k!<ׄ<ׄ<+nEbw!<'c<'c<.}n>ז̢a<)'<)'<.}? m!<*T<*T<.}n?=a<,<,<05kf!<-D<-D<05nF~Tam!<9<9<1xˀnEa<k <k <05"#!<4΀<4΀<1xˀnsm?a<<<05!< /< /<1xˀn#aa<'c<'c<3%r!<) <) <3%Kra<*T<*T<3%|D!<,<,<3%Ta<-D<-D<3%3WV!n!<-L<-L<6WDa<.}<.}<6d?!<0G<0G<6 a<1xˀ<1xˀ<6h)!<3B<3B<6Va<4s<4s<6 !<6=<6=<6bCa<7n<7n<6'F!<98p<98p<6}va<:i<:i<6+!<<<6{Na<bZ<bZ<6R1!<<<6q>a<]J<]J<63!<w<w<6xa<р<р<6NV!< S+< S+<6ya< < <6&!<沀<沀<6oٴa<I <I <98p z!<<<9 a<ܓ<ܓ<98p!j1!<><><9!)z*a<<<98p"x$!<t<t<9"fa<4΀<4΀<9#.!<<<9# Xva< U< U<9$A&!<#*<#*<9$Sa<$s<$s<9%4!<&6<&6<9%[^a<(<(<9&| !<*T<*T<9&_'a<,<,<9' !<.}<.}<9'Aa<05<05<9(!<2<2<9( a<4s<4s<9)D#!<6<6<9)ja<8ـ<8ـ<9*X!<:i<:i<9*; a<1-<1-<9+:1Q!<<<9+'a<Ĵ<Ĵ<9,Gy!<'<'<9,>"a<р<р<9-[!< < <9-wia< X< X<9.f#K!<N<N<9.hWa<߀<߀<9/!<z9<z9<9/a<C<C<04(!< < <0;$a<p<p<1q!<9<9<1ٱa<<<2dp!<e<e<2fv#a< /< /<3! 2  >  " "` " ``>#hk 0 ``>#M 0 '>H 2 x& 2 4># oz j 8 |ٔ  2>#= 0 ``># 0S@ 8 @ $> ``$""`>"` #> `  0  `H$ & $ $$$$@ >`0>* !Pz@ᩒ#90@  nG>@:P n@>P2`@ @0:`@@&@ 㿘>#`  `"  "`> "  "@G | ?[0& nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found 㿘H /e * &  > cP 2 >c? 0 >#K 0 `>2>>#> 0 ``>#  0`"@ >"`> `  `2@@ @6@ǐ >`0>* !Py@ฒ#H04@ `2   @d0(0%& >b  #> `H  0Ԑ `""`> " "@^ | ܐ?& H 0nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: %d NS, %d NA %s: DAD complete for %s - duplicate found %s: manual intervention required 㿘Ɛ 2  >c| 0<,09 0!>#0`k   `&  !>#p`rZ  >cT `""`> " "@ޒ | Ȑ?& 㿘 `  & 4  @   `& `0  J ifa == NULL in nd6_dad_ns_inputnd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) 㿘 2 >ސ!8 0J   4 (>"`>"`!>!X  0"   [0 "ifa == NULL in nd6_dad_na_input㿘 >"  ` "`;nd6_rs_input: invalid hlim (%d) from %s to %s on %s m_pulldown malfunctionnd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) X >   ' ''a8 '>!(` >"`|!>"| b n>  &`2  2  2 [ @@M   @@:>#    > ` `B G:  ۔W  >"`+>c8 0&`` ``* ` 9 ?>"`!>#h 9  >  \ E0 > `И `B ;End6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%d sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%d sent from %s; exceeds maxmtu %d, ignoring nd6_ra_input: mtu option mtu=%d sent from %s; maxmtu unknown, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d)  > >`0*' ''@ !8 ' >"`!>"@+(` > ? @? >"`!>"x >   @@LW,  , @@:>#   ` > ` `B u: `途 6 `>"`Y>bÐ 0T> %` * *` ` * ''''` /``*⨒@  '7' "8`  "` j%  #2 * * @R>b% % ` ` *`*`@ * ` 2% ` 2- @̀` %>5>3> 2   |> b ` t>c X o   ?  ?   "` X  ApX  20`@ "O G  /cF 0@" d  /=/<  'D 'H 'L 'P '0 2`* *` ' * 2` `*` ' /  +  * * @ 'x  +  *  * @ @'| 2 @I *  (w ԀL  I  * *`@ *   d>"`6!>#ڐ -  @ >"%x"`!> (  >"` !> x Ĕ ` ``*  `9 ?>"`!>  `9x  >   Ր@C50 > `ؘ `B ;C)8ؐ@S @O @K      / /''''////H /%+&  Ӑ H p@defrouter_addifreq: failed to find an ifaddr to install a route to interface %s defrouter_addifreq: failed to install a route to interface %s (errno = %d) Xؐ@ @   ////  2  4>"`>a8  0  > y  >"`>a ̐ 㿘> #x "  2  @ٳ  2 2  8ؐ@ӥ @ӡ @ӝ      / /''''////  / `! |㿘>!(`  >!8`>  @ > cxcx` "`" ">Ā  @ " @  @`@ |defrouter_select: there's no default router and no default interface pH /e * & > #x`,x` `雒 " @ L "@R  $@@``"`$`@"@#x#x $@x" "`$#x$``2` x` А@ $E 0>!(`@ $8 > #耢 ">"`>`ِ H 0㿘H /e * &      2 5 .  6  & H 00=   $H 03  |E   H 0% @҉ $  &  &  &  &  &  & & &> x`& ""`x>H 0 \   2㿘  |  @R $  \ $"  \$ @z& \㿘`"  "` "@ْ |㿘>"Ā @2  ` `2  A  " 㿘 d |ɔ  @ @ d dp\ ` `` @ * $``$`\`( ``N>`   ? @" H /e * & bĔbĀ`$``"`#b$`H 0 `~ 㿘H /e * &  `"  "`  "@ \ Y | 2H 0M |@prelist_update: failed to add a new address 㿘H /e * & Y k @" X 1, X H$ H L$ L T$ T P$ P X L` 8 2 < 2  @ 2 D 2 f 82 H ` @ 8 2  H>"`& 1>c T !`" L"  @ ` ਀@    " L"  L" @ `>Ē 9ɒ05 H 2 8@  X@$ `@  2 >"` 1>c     ` * * @ H& `" L " @H Ԓ 2H 0㿘 \    ]  " L "R  $㿘>"  "4b  -bĀ "7# ?#% Ԑ 2   `"  $ `@9  bĀ #  "   `2 @  0  #  `2 @  2 `nd6_detach_prefix: failed to delete route: %s/%d (errno = %d) Xؐ@q    //ؔ n@d / (/n     >"` !>#g `N  8 2 < 2  @ 2 D 2 7 8`` "`nd6_attach_prefix: failed to find any ifaddr to add route for a prefix(%s/%d) nd6_attach_prefix: failed to add route for a prefix(%s/%d), errno = %d x  >"`7!>! 8 ` . 8@  (  ,  0/ 4 /''''`@ > `  & `"` !>!h 8 `ɐ  8 2 < 2  @ 2 D 2  8  ऐ ?" `@  "in6_ifadd: wrong prefixlen for %s(prefix=%d ifid=%d) ENOBUFS in in6_ifadd %d in6_ifadd: in6_ifaddr is NULL (impossible!) in6_ifadd: failed to add an interface route for %s/%d on %s, errno = %d pTK  />"`!>#H`$ #N      >#$ְ @6 `4 (`& `& & !> #L |& `& `   0 `` 2` "`>i#$#L  0   & & `& "%` `  &  . (mO. )  0 4 @  8 <  @& 0& 4& 8& <0* @ & 04*& 48*& 8<*@& <. |m). } `8 >>!! & `@!& & $ h! >"`!>#א ` 0  &  0  4& 8& <&& U`4 $ؐ@Ξ  <<`0c'  7'/7ڐ'ܒz  & H /f4`* '`  a   H 0  H 0 㿈 ` 2V 4r?N @0%> @K < 0c '77'`< '/ ` @ "`  2`` ``` `@'  2@`"``   ` $````"`& ``"@` ?$` L2` $L` 2`` 2 ?  $` ?$  in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) 㿘 L> % H"  >"`>b0ǐ  @ & T& T H?@& P& P > %"` `"@"@ P" ` @&"@` "`"` T `&"`㿘> 7!ؑH /e * & ? ? " `0H 00>6  ( `XH p@㿘 0`" ` 2 `@K  2  4       0 㿘 >#\@>  a\  "a\>#d.  > "#> "#> #x`  㿘> #ג p '    2 ?#@    ?#@;!@   //ْ  > c c  `!"v  j 2p  $  $ (   $ ,  $ 0  $@Һ  2Z             @Ҥ  2D  Ԁ? @  Ė" 28 3沔 <  +`@Ԕ,@=8Ԑ LR 2 8;EԀ "';? 'Q L8 "'  'Ԧ 2 `*`@@=8Ԑ LRc 2 8;Ԁ @!; Qa L8 7!  2!;2@:%> O  > 0c\>!Ȁ >!` *@" (`B :( #   > 8PB?:P!㿐`>}`C#0@ ? =?     >! `/>; "  ? )> 2#\#`    j `?A#\#`# vU 0'T'X 'H'L'P @ '  'e '` R `:2   =?  2  7l'    ``" 8`  $"   ?ܐ" '  (?" '   ?ؒ`(& &  (:y  "    "   (&   &` `&` &`  &`$`$` H `@` $``$ 2    1'&`&` &` &``@ > @`0d* '`d<*2 2  ```2 .`.`.`.@ `j.`.` R `: `Ԁ?`:2`Ԑ '(7 ` (7 `*  'R` :@ > 0c\ >!̀ >!Ā` *@?`B :?`>!*` € ` 0\>!̀ >!Ā` *@``B :`l "j>  0\d>!̀ `>!Ā`\*@Y> `B S: "P>  0\J>!̀ F>!Ā`B*@?> `B 9: "6>  0\0>!̀ ,>!Ā`(*@%> `B : ">  0\>!̀ >!Ā`*@ > `B : ">  0\>!̀ >!Ā`*@> `B : ">  0\>!̀ >!Ā`ڑ*@> Ȓ`B : ">  0\>!̀ >!Ā`*@> `B : ">  0\>!̀ >!Ā`*@> `B : ">  0\>!̀ >!Ā`*@> `B : ">  0\z>!̀ v>!Ā`r*@o> В`B i: "f>  0\`>!̀ \>!Ā`X*@U> ؒ`B O: "L>  0\F>!̀ B>!Ā`>*@;> `B 5: "2>  0\,>!̀ (>!Ā`$*@!> 蒂`B : ">  0\>!̀ >!Ā` *@> `B :> "`-   B ;  @7@`  ```8 ?"`87Ӑ4l< tD㿘):$ 0'eilk  B 6ې 0  sy :   6rip6_attachrip6_detachrip6_usrreqp   @ `  'Ԑz-R`F.`>Ð" €`>  :'ԑH /e * & >>!lpM=  'ԑH 0> c  'ԑH 0H 0 ?$`,`j    $` 'Ԓ  * ``(* 񀦠  >;!x!x$``` $``$` $`  ?6 KҐ`2>>ꆐ !؀ 2``؀ ? $`ǀ  > '#Ȁ`S 1 O 1    ?#@A 1     - 1"ऀ ' 1$`$ $`($`,$`0 Q> '#Ȁ` 1 ^ /``@``$ Ԗ 2 Ԁ m 1i'Ԑ$`$$`($`, $`0$` $`$`K$` WLS   8J'Ԡؐ@   //ؐ`eb #2  97'Ԁ " 1'Ԡ''' '''ـ`' /'Ԑ6'   -'Ԑrd r{>鱐 5ԁ `  X( T(  ( ( \ ((4H(0 8  ` `@    'q '& "S     2 /  1   8  ܐ 8  ؐ 8 Ԑ 8'''  ''''      @ $. 2 6  1' 2`o  '` 2 4  2  4  2 4 2 4 9 $ ``  ` 0`8 0```$" `?ܐ?" 0  0  `` ?В`0&`&`  055 `_ 7` `` 0&`V 7`? 6 (2 (c 4 4 4 F4 H d<+2 `2  ```2  ..... @   @}.@&`& ` &`  (&&&&  &$* `4 <c4 > Ô,`",  @   ' /'4"& 4|㿘@` +>#*`   0@-$ 2@ * $㿘@! 2>#*`"  㿘 沔 4  2 H /` * !  L>cK}  4-H 0 7H 0Js    㿘 & ` 2` `@ (  J  2`  6/` >Rc* @ ``3㿘    $ 8 @  H /e * &    H 0 2  >#"` HÐ >`@ 4 R* @ 2  u 㿘` >Rc* @@H /e * &    s H 0 " 㿘  *`2`  >#:` `& +`0 | H /e * & 8H p@PF_KEY㿘>#  . `2  . ** *  *  J  '>#)>  @  #Tb 4@ 4  4?`>#(` "$`ڒ J$`$` 4 J  > #Tbz 4>#(  "$ ’ J$ $  㿘 >  0>c(" 0@ "`㿘  8 &   㿘  J  " @ >> "@$ $4 "$ 㿘>##" @@@ "@ 2@@"@>c?"c>c?"c a J 㿐  ,   *  ,   J[   a 5 4`     2 a*@* @  { `"6>``0s0 @q   5,,4$Z m>#`` " @`Ҕ @`2`9;0B#``  `  @`*  `@`2`1@+   5,,4$ '#``  2@` @`2`1>#` ` }@`2`1@ Jpؤ@  "  "  $  $  // h  //ؠ  J  ' &@ʒ`&`T&`Xـ    ( 2' 7 ( ,' 0' 4' J'7ڐԠ@ `&`D&`Hـ  0 X b' 7 X \' `' d' z'7ڐ@ `&`X&`Tـ  0 , 4' 7 8 <' @' D' L'7ڐ@ p`&`H&`Dـ  0 \ d' 7 h l' p' t' |'7ڐ@ QԐ &`P 2@ـ  "  x  ` " $ 0*` $ *` " $ H*` $* 㿐  0  @2  P  @2 P  Ԁ@"  P 2   @2    @2   ܀@"!% !%  !$  ?@!  !  ?@!A  !@  ?@!  R   ?@!  R   ?@!x  R   ?@!|  R   ?@!  R   ?@!  R   ?@!\     ?@!`     ?@ JV  ' &@&`@ &&`@ 6    @   Ԁ@  @"  &`@     @   ܀@  @" &` @  !$&`@ a&`@ \!!@ &`@ T!@! &`(@ E ! &`,@ < !x &`h@  !| &`l@ ڔ ! &`p@  ! &`t@  !\ &` @ M !` &`$@ D  @ `x! 2! x |@@'xƔt x" `   &t J  㿘@`! 4 >   -00  -0+>쀠$ 3#*@  "耠 2*@ " *@ "> l*@ " - ipsec policyH'D'H'''@ |># ' `D` 2@`>c ?  J  ' @b  -@ -`> "@45`4H%`^`B̀ '#       2 6'/@5Ғ J'H@ m' `?`e>А L*` €0@! `2 /4J T'ȢT@ 8@ (  2 A'(  J  '7 @ '''(@ y. H /` * ! `` ```   l 2 3 S `$ a, '@  ` ,!! >'@ @ !$@ !@ !@@  @  @  @ Ô  @  @  @  P@ Д T@ ̔ X@  \@  '' 'X`$    '`$ )'         ݐ  ِ @ @ U @ Q @ M H 0{ H /` * ! `` ```   l 2 3T   `  y'@   ` ,!!9 '@N@ !$@ !@ !@@ @ @ @   @  @ W @ S P@  T@  X@  \@  '' 'X`$ W 'Ȓ '@''H 0' H /` * ! `` ```   l 2 3Ȓ  H 0L%`   'Ȑ ' H /` * ! `` ```   l 2 3 ؐ" 'Ȓ 'H 0`> $``" 8 J  'q @- 8 2@>`#\t 0 '$ J͔  '\ H ` * @$`@  2@>`#\W  '  J  '> @  2@>#`\A 1'`' `` *>А $*` €H /` * ! >#,` d#,`H 0H /` * ! >ɐ"\`H p@D>' '! %'Ȁ  7' H /` * ! `` ```   l 2 3 4 DH`     l 2 3   "    `" ` ""`  `"$ ` ""`$ " H 0ȸ 8 ?  `  -`      < @,`  0 c` `` \ Ȳ@ 0@ 0h@ 04 2 }y  0////     QД 7  /' /'7 77/`''`7674/7  /' ''' ' ' ' /'7 77/`'` '`'`'' '''`77/А@ 4Z 0H o0  *@ aq Ѐ 0 8 ?"8@} 0 2  `0@v 0 2   `    H 0  'ȑH 0ȑH 0 58>cЀ  !>  "c>ɚc!L#\ Д   !LP 2 H 0l @( $``$` 0  /h/i7j 0Zj'l`0Zf 08 `>А *` €",` ,` ,` ,` ,` ,`> !LҒ0 H 0+    ` ,``|Z-  `|@ؒ  ,`} ,`| ``Z  ```@ɒ  ,`a ,`` `     l 2 3` ,`$`` $`"- n, ??N $` 2` n2`" `"```2R`">  0!LeH 0 7Y̒` + n, ??! $` 2` n2`" `"```2R`">  0!L8H 0 7Y` G h ( ('`" ````"`"``"@` "`c` "> ]> !LH 0`>#,#,`$`#,`"`̐`"$#,#,$`>c "c <`,`H 0@Ȁ"H 6'# "``" ` @2  _ )Ȁ  ``2`@  㔒`$`  $㔒 $`?$㔐 'Ȁ  7 5 73 *"@Ȁ &  -` `   *`+@ *>`h(@  >  @  D Ș ' "H JH J Ȑ 'ȑH 0ȁ9999992022>>>>2>2)H*,/03803822=443@/aes3desdesblowfishskipjackcast128deflatehmac-sha1hmac-ripemd160hmac-md5>>&#`" W @  ?``  ?@ p`h`  R   ?@`  R   ?@ J  x2 @ |@'x  7 .6.&` 2 . 3 l  ."@ '2 2@   X`@'2 2@   X`` 'R   ? 2 3`3 ` RW`` 'R   ? 2 3`3 ` RW`''tt  *2 'p >ᨀ 6` 6`` 2M l> ">В`@?  >А  @;!`@4  >В # `@*  >А @ 6` .`76``@ >А  (!`@ >В P .`6` 6``@  >   ( .`6`6` > > >А `@  >  .`6`6` > c>ВА@ >  `@ܔ  >А .@6`6``@Д >  6`.@6`>!>+>>>a>a!Ȧ;= >ᬙ=`+>a> ==&`&`>`>` >`(>`0>`8>`@t`Hp `@ M'px   @Ȑe J! 3 26 !  l"!P - J!$  ?  pX  't@ x@ |t@t `'t'x *@*`!>*`#4t"`2` t##'|@t'@" t.`2 $@ @t!$'@wt!'@r    @a J㿘#> `@V  >>>$`a$ $ $ 㿘>   㿐@< |` & * 2e     〢> "@ `4 2T   `K  J>#*`& `(C * @Ś * @ *`` >Ӑ"*` €2"  8 "  8  8  瀢   2  `` ? 2  `  !( w`u   4` ` 2 @ `@ [ [`2Ұ ` U+ 2    4` 6`E ( `@`?: *  2 5 (  8 + (  8 ! (  8  gJ?`@  ?(   *  "Ty (v  @ H @ H @ = 8a   8]  `@ * -(Q  ԑ+ 2    +`2 ? 6 @ 4; `  ` 2/ @8* &@* &`ߤ`2   > (*` 2      0 `  0  `  IJTJTJTJ\J\J\KKLLLpLM8M8MJ\J\JDJDJ\J\IJ\JLKKKKM8`8"0 ` ` * ` * ` *`" `*!` "`  $" $` "`  $@" $`  $" $`  $" $`  $" $ `  $" $ 2`" a*`$2* al2`` "* `"`>Ԅ܇(      * `"`$ >Ԅ(        * `$"`$ " `$@"`$ " `$"`$ " `$"`$ " `$" " "PPPPQQQQQQPPxPPPP㿐`H > %"" ''H 0 "@`"`0u"m`0r &  $  $ ?& $` >  $  $ ?& $` >  $ (  & $@ 'o` $ ?& $` >  $ B& $ $ ?>& $ &  $" $ =& $` >  $! $ >& $` >  $ X  & $@ 'oN` $ ?& $` >  $$ & $ $ ; & $& `> `> `> ȁ@  $3"$=@"39@"$# $"$; $"$; $ "$@ $# $"$; $"$; $" @# ; ; ; @ #@㿘```  `` 0 SP.㿘@  ? 2 2@`&S?@`*@  ?@&㿘`(!!@ n*   &@`*`2 22g n & "` n"`R`S ` 㿘`.!x!|@ n*  Z &@`*`2 "   2@ 2@5 n & "` n"`R`Rؒ` 㿘`/!!@ n*  (?&@`*` 2 022 n & "` n"`R`R` 㿘axa|R ` `2`2  "  2`&R R R`  ?@&㿘aaR ` `2`2  "  2`&R R\ R`  ?@&㿘aaR ` `2`2 "2  " 2 22`&R R. R`  ?@&` ``0"2 `0" 2 㿘`  ? 2 2`*`2`&a`R```  ? 2 2`*`2`&a\Q``  ?@&diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapiommu%s at %s㿘`> ׽# 㿘> ` `@`? unsupported cache-coherence?page-sizeiommu_attach: can't allocate memory for pagetablesbad iommu range: %d: version 0x%x/0x%x, page-size %d, range %dMB name@`> ""` >r X0 40@ &`0>ג`h@ L&`D> `"&`D`D> !> #"">ג`@ `0&`4@ 2 *@&`8 <* '' @#\#` ?Dp  >` @ >ջ  4 &`@%>  48` c @>`<  c`T    Ңc@`@* @ `8@* ? 5 >#?`@`0&cSz:  0$ Є&`@ :`@>`< `T  ?&`8&`< H `0" `0@* ?  "@`0 "`0" H 0 `0>@ `82`4 `2ֱ3 4  >@Ғc耢 2'4 ''@  %>#>֒@ ސ@" 'cQ @  > > > 2@ *` <c#@0 @("@ 0 p > `> < "0@("0 4@diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKobiovmelvmesvme㿘>    `@E`?%s at %s addr %p vec 0x%x㿘  >ؐ"& " 4> " 4>">`  >"؁ 㿘`> " ccccinterruptcountereeprom unsupported rangesobio: PROM ranges too large: %dcould not find %s amongst obio devices namezsP> `` 4>>զ#>۔!@>  ` >>Ք#0Ց#4  >@bH 2'4 ''>ئ#@  @ &`< ϒ  &`8>ؐ#@ }@ >#N`%#+>)>ؐ@ `Sِ@ڐ  @*1 '" N 4'> 1->+>)>ؐ@ w0@Q 2@ @B`8 2 $@) '"ϖ @ q Ԑvmesattach: can't allocate intrhand㿘` >> `>>ؐ b`@  >>#0#1> "l >ې$ 5  &"l>[#@~$>ےː!@ivmelattach: can't allocate intrhand㿘` >> `>>ؐ b`@Ȕ  >>ԩ#0Ԧ#1> "l >ې$   &"l>#@B$>ے!@-vme: PROM ranges too large: %d: version 0x%x P> `` $`>r#0R0`4 @ &`0`@< @ >شc&`4@ $`0@В &`<   &`8>ڐ ג@``0> %>"!C `a4  >@db` 2'a4 ''>ؐ"X!>ؠ#d' '>ؒbP'' vmebus: no ranges㿘 < 2`4>Ҙ"? ? -   =" @ <  8@  &`0  * * @ 2 &`0P>  ` q> `<2| > `<@"s `  '''   > $!ȓ. '䀢  ?@> #@5  ` '`'?'` '8` !'>@bX  >8@bP  2'>8@bH 2'8 ''@'   "'耢`">@Ȑ'>ؐr 㿘l 㿘d 㿘\ vme: spurious interruptvme: spurious interrupt 㿘>!ܱ. >*``  8@  >> %"`4 ќ"> >"0 "l*`  `" @   2vmeintr_establish: interrupt vector not allocatedvmeintr_establish: uninitialized vecvme_addirq㿘> "l`?>]#(2. >X#`@ 2"@> 7.`!> > 7 .`!>   2 &   >ے"L   2    2>+#@N "L&@& 㿘> `+> #@ %#?  `*    2 #? ҃@ @2  @ 2     @ 㿘> #?@> #@-R auxreg㿘> "`N> 8 ,`(Ho o> `> ( H?8` **HH 0 01> ( H?8`** H> ( H?8`** HHo o> `> ( H?8` **HH 0 > c0>PN(2 > ! auxiliary-ioauxioauxregmatch㿘>  "   >0>0 >#>ܐ#@`?d# 㿘?80 @^ >` ?8 >   >  > (*`H">ѿ#> >ܐ!a' > 8 ,`] no aux register㿘> "`>* PH > ( H@*@* H*H 0 > ( Hdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKoclockeepromclocktimer㿘> ` >`? >bt@   K 8@  delay constant %d%s [TOO SMALL?] oclock: calibration failing; clamped at %d 㿘 >""T   @0> " > *`* @ *#bD@ @ > #"#Ĥ L >"#bD *  bD *   N #  D`* >݀`!>!>ݔ! 0 ` >ݐ`&"㿘> ` V` >`? >b@   J 8@  㿘>Ɛ#  0@M%>>"b"㿘> `2>`? >b@ "   JV 8@ >@Ő!P`?mk48t02modelno prop: %s (eeprom) mk48t08㿘> ` >ޠ   >@` 2>> r >ސ@`Ѐ  0 @#> !> #b(  b(& @ 0 @ܖ(> b(> #   > > `>> "b" > # *  *`  *  > ##"aȁcounter-timercounter㿘>   >`? >@9!`   I 8@  >"p" >ސ"@!`?delay calibration delay constant %d 㿐!>    ?* *   @d ?   @_0? ?> > "#t"" `   ?0 @N ?` ` > >"b"#'>ސ $#'$@L d@`>/#8> :` @ d@##ϛP㿘Ho o  > `    "` `?"``?H 0 `> #> > Ȓ "( > #  > >g>  `* `*  `*  `*  `*  `* oclock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz statclock; using 100 Hz 㿘>"T`!!>!P`d>$! d> "aPВ d$!P@O"@!> >"aT"D *J "D *`J~ "D h*`%>P"@@  >ߒ! d$P@->"aT#> c cP$cc@ >" d$cc> "!P@>3  bP:  d@!>Ȕ :`@4:`"P   >!T> ct>  * "+ "@   >!T?`*`  "* " bP> :  #"bXJ  J 㿐Ho o>"T` > "D  'JI 0> > #t@'? 'H 0c >  `@:  > ` I 0Iѐ  oldclk statintr㿐>"T`>>ڐ!`  >  > b '  > #t ""  "`0"  ? 'd>"PJ> "X  @ >  * "  * ?"`  ;Zx0N㿘:(;`; :9 8` / /`+* *`(@ ( `.  .` . .`D @E ` ` 43   F,  * + 2!m!n >. P?@`4 * (&@& (.`& ' . (( 㿘> %"Ta@ڐ @ @ѐ* @ &  E& &    >`?"   ,R 4  6>"*`R $ `& & 4& Ta@_@.& @W.@ <& @O <&@ * @G & @|*  @>&  @s*  @5 &  @i* @+  &  @_* @!  &  @T* @ & WARNING: preposterous time in file system WARNING: bad date in battery clockWARNING: clock %s %d dayslostgained -- CHECK AND RESET THE DATE! 㿘> Y`?!aȀ  >" ư!@ >"T`@> %;   `@- `-,> %"b "  >̳"$"`$>@& >", "">ဢ@#># >#(Ta@Ő ̎>̋#0x>"T` > % -> "D`)@2> %"`!> !Ȁ Ԑ  ' `,',',',',',',',' ' `,'㿈@@㿈@H'@%> DH> D  *  *@`@ bD * H > DH> D  *  @`*@ bD * H 㿘!T!@)!@@"..`@.@ <.`@ݒ <.` @ْ .`'>2>>!m!lP`.`# "`#@   & # "  .`.` 9 5  1 '    2mn 8  >@* (@* (* ("@㿘>"T`HT0=H > %""& & H 0 >        >4>LL & "? & ?/a `&&   "㿘> ` >  : %"@8@s /1>"  ! %j `   , ℐ   @  : @`㿘>" 6 - >"`> "!>@N* :  .@>aP@ 2b  !P% @N* :  ٴ` ␀  㿘>"` #> %>$b"!P  $b" 2$b %"㿘>>"`""" power㿘> ` >@!`? 㿘  0@ > "` > >*`!P㿘>J#`">  `*GT"@ledleds㿘  >@g!`?  `@^  >  `? 㿘>&`0bܐ`<> ` > 880 @ &`4> 8 ,>"c@>"X㿘 H  8@ > 8,`& 8& 8>`  Ho o 8># ?c 4 2H 0 ` ,Ho o> 8# ֪@@H 0 ,  > c0>PFE(2  <D diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKsun4cpu㿘`@`?midsun4csun4mno%s @ %s MHz, %s FPU: %s%s, %s; %s  &`0>`@͔  &`LX:   @2`H &`H`H  >Cd 0>C`!x>   0 > > >"c@`H>倢` a0`@@S> !P`" `4`8`<@a`4!>`h@  Ȗ[>) > >> %`"O> JcȀ c>  > ``"`H@k`H >C!xH/ /aD@#H 0㾐'pDp:   &!>  "aP%s: %sphysical %s%dK instruction (%d b/l), %s%dK data (%d b/l)physical %dK combined cache (%d bytes/line)%dK byte write-%s, %d bytes/line, %cw flushthroughback%s%dK external (%d b/l) 㿘>c>  Ȟ# `"> `#>#Ȑ  $ > ,#ȇ: >c <0> D#|: (>   > `#c n:` > >怢` c l :` > H> P  s   hU >c T> \ X: J`>E pUnknown CPU type: cpu: impl %d, vers %d; mmu: impl %d, vers %d㿘> D" 8 <Ƴ @  ""`l0= . 08" >&"`"`"` "`"` "!X"!H"!L"!P+"!T "`l"   "` "`"`"`  ("`l"   "` "`"`"`  ("`!"!"`l"   "` "`"`"`  ("`㿘!> "><  "" 6y # !?00 $}0+!@  d !& & & & \!& d!0  "_^ @ !,! & & & & d& \b@ !$ @! & l& & & d& \& `& mmu-npmgmmu-nctxclock-frequency㿘@>`@ & h& d>` @ِ& \>`@Ӕ & vac-sizevac_hwflushvac-hwflushvac-linesizebad cache line size %dbuserr-type㿘`? >a@@$`& >a(@ >a8@ >aH $`@$` `  * & * "@>ż!X * $`l$`$`>$`ap@| ! &!cache chip bug - trap page uncached㿘!  >`0 @4 > >#8bcache-physical?ncachesicache-nlinesdcache-nlinesicache-line-sizebad icache line size %dicache-associativitydcache-line-sizebad dcache line size %ddcache-associativitycache-nlinescache-line-sizecache-associativityecache-nlinesecache-line-sizebad ecache line size %decache-associativitywarning: couldn't identify cache 㿘`  >b@& >c@  2&  & >#& @u > @nc {> v@є & 4>c( @ː& , `>!>%> )>瀤`   * `2 * `"& 0>#@& 0 @cX 4& 8BϐB 8& $@ & L #p@& D`  `   *@ `2 * `"& H>#ı& H @w& P LBB P 0& < H 8  ,&  D@ 8  $& 5 >c@[ & >cȔ @U&  `> )>瀤`   * `2 * `"& >!Xm&  @3cؠ B[BY&#@ 3@" & d>` @& \ ` >耤`   * `2 * `"& `> 5& ` @`0& h dB#B! h& T >ś H㿘@y Ā( Ƣ㿘@j@ [viking: PCR_TC is off]㿘 ւ>!  @ & T&!>f!  T &!>"ؒb&!H&!\ T   & [viking: turn on PCR_TC]㿘 >`T  #@2 >>!@, 㿘 &   Ң @㿘 H H:  < @&!\& 4& \& &! &!0&!,&!D&!4&!H&!L&!P&!T@&!X&ƀƠUnknownTI_4_4TI_4_3TI_MS2TMS390S10TMS390Z50 v1TMS390Z50 v0 or TMS390Z55RT620/625CY7C611CY7C601/605 (v.f)CY7C601/605 (v.c)CY7C601/605 (v.b)CY7C601/604MB86907MB86904W8601/8701 or MB86903CY7C601L64811MB86900/1A or L64801psr-implementationpsr-versionimplementationversionOut of CPUs㿘 H @>H` >`0@?`4 ` >`H@ޔ?>ȑ<  > ` ` >`X@ʔ?`4 ` >?`h@)>< % ?"?`0@?>> 8`H@?>> <`X@?>?`h@)>># @2  ?2  ?2  ?2   ?2 & 8& <& @& D ` 4 2 \ & 4 \ 2   & \ 2!  & ! 2   &!  ` €`"!0 2!0  > @8 & @@0 & !0 2!,  &!0!, 2!D  &!,!D 2!4  &!D!4 2!8  &!4!8 2!H  $&!8!H 2!L  (&!H!L 2!P  ,&!L!P 2!T  0&!P!T 2!X  4&!T!X 2!\  8&!X!\ 2!`  <&!\!` 2!d  @&!`!d 2!t  D&!d!t   H&!tB5010 or B5110/20 or B5210RT602 or WTL3171TMS390C602AL64814L64812 or ACT8847L64804on-chipWTL3170/2L64802 or ACT8847MB86911 or WTL1164/5MB86910 or WTL1164/5version 0x%x㿘>!`!`2``?2`` 2` `@ 2`>bN㿘>cP  "cPHo o># `  ="` H 0memregmemory-error㿘> `2    `>#(@ `?memregattach 㿘> ` >   2">T#`2 >  0 @ O > " >½#%ssync mem err: ser=%b sva=0x%x aWRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGaer=%b ava=0x%x WBINVALTIMEOUTDVMAERRparity error register = %b ERRMULTITESTENABLEBYTE0BYTE1BYTE2BYTE3memory error㿘>  > H> P>Xg >> `> ``>>@ V>ې! memory error:sfsr=%b sfva=0x%xCSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWafsr=%b afva=0x%xSYSERR UNCORR TIMEOUT BUSERRAFOhard memory error㿘>"!>>!>>" 8`>쀎"`HyperSPARC async cache memory failure at phys 0x%x%x 㿐>!8€` `>"2`>c># " > ?"#c##store buffer copy-back failure at 0x%x. Retrying... warning: got data fault with no faulting address. Ignoring. 㿘 + #`!> >c "c>#> + >c ""cЂ$ Т@ a 㿐>!8€ ''Ndiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKzs㿘.3>` >O ` " >H  㿘.3>` >< .` >5 slave㿘``@N 2, > `2  > > `>  >bP@a?V`@ @ې     #  :& 48@ zsattach: expected 1 interrupt, got %d pri %d, softpri %d broken zs interrupt schemeintr㿘`> - !@$@ 2 !0 "!0>K#0>#@0 >#` >  > > >c"@" >c@  >! ">>%#x`4ƒc> ``L&`L&`0&h&&l"- @V& &@&@ w?c @ *`l `>> # #`l#`#`Ѐ`&@##`>> #`bp@ݳ#` .7 @> >#؀@ >"#ܐ&`* z  &d>ΐ#0h`& @ &@&@ .?c @ *`l `>> # #`l#`#`Ѐ`&#$#`>>#` bp@#` @>֐ >#؀@ >"#ܐ&`* za  &d>#0zsconsole㿘`>{#> >`!*>`"#@ &> `"`">#>"c>"#Ԁ>"`&> "!㿘> ! H /k * ,  '>%> <  ܀` ` J`<  `<, *` ! >#Ԁ@ > >#؀@ > 2 n`2 n1 ?c* @ ` *`  $ l># $ @#$ $ $ k`> $ >`` a  `>!<  .8.:㿘 ܒ *  @\㿘 @*: (& p㿘P Ӑ& p㿘? 2  @># ` : 6 #*@ `* @*`@*``L L`: "` H /e4 p* & p #    #c %$ $ $ $ `@$ $  @ѐ p $ p ?$ p$ ` H 0   p   H 0 ,`=` w `= sH 0  `=] "$ p `= 2 @$ `> ``;w `2 pL`6 "  p $ p  @2 `= p > `= <>ؖ !   `=    " `= p  @  p }3$ p2,`= p =$ pH p@0#`2 p  @ p "H 0   h>ؒbX* @€ @ 㿘?2   * >c* .   *  L@ > h"X*`  €H /e * &  @ p "  @~ >!P>ؔ 5   " pH /k * ,  )   . )  v. H p@ p ?$ p. =H 0_ 㿘?2   *>#@ .  *`@ *`@`\> hX*` 㿘?2   *>#@ .  *`@ *`@`\> hX*`  ? 0  >*`㨄 *  ( (\㿘> " q  `   28.  \  @s  d* "@  @  d* "@  @  d* "@ $ \. p Ā  h@E  ̑* "@   h@  ̑* "@  @ h  ̑* "@ $ Ā" h  `@ "`@ h 2 `> ` 8f 8> ? 㿘> ``9Ð L7 > a$ *a$Ja$  *a$ ,  M  L  @ , ,  I 0.@`. 9  8.@``". 9 .   0.@`` 89  8.@`` 9{  㿘N < D  <.`. <1>   89i  8.@' `2 H (.@1>   89Y  8.@ ` 9Q  & D !>.`  `& H9C  8.@ ` 9;  㿘> @` 9.  .@`` 89&  8.@`` 9  @  @      . ɒ     ߔ.   ", N 8 ` 2  0 8 @ ` @ 0,  㿘>#`@9zs%d%c: %s overrun 㿘> %@⨀@ > &@c> au ringfifozs%d%c: bad ZRING_TYPE (0x%x) 㿘> "ɸ `X\> hbX* %@  @  >ƒP%@,$X d* @ ` 0  > y> <`` >T`@<`@`@^y2`@Zs€n 4 "? pH /k * , > ``8F ` ' ,'$55 @H 0L,4 p!2 pH$D @. `t$H8 0p p `% p % pH H PP" `@ 5<`@  4` `€ 2 ,5@,5` a =_ A$X2<`㿘?2   * >c* .   *  L@ > h"X*`  @ 6!: & ]@ "jN 6`y@`x@ `z@<`{@  k@ "  j@\@"S  l@ѐm@" H /k * ,  )  . )  0. H p@ǰ H /k * ,  )   . )  . H p@  #@ `2  2&!2 "    H /k* , N :  3  # ` . 6. 3  . #В  3. 6 #`. 3 . #    @$   3 #    . 3. # '    . '  .  @@$  3 # ߖ   . 3. # '   ߖ . '  .  @*@$ H 0" @h  @d  @  ) `  ``  2`@ 2` & 㿘 l? @2  `@ `*> * *` ` *  LH /e4 p* & pM V  H   H & pԐ* c H /k`* ,`  p  & p % P , %  ,  >*` 6L  $ D $ H %   , %  , H 0H 0l?0*`> #(( (LH4p(p" Dp"pH 㿘 l? @2  `@ `*> * *` ` * `( L `$ 2  ,@ | @, ? 4`s @& & & H /k * , <  c,`1,`%,`0"   "  @     @  `@@ ` `2 > `",`'5 ,`'?,`)d D L@" @2  `4  P  ,`(,`-,`/,`2,`3 ,`.` p` `D,`4$`L $`D``$2c `@?H 0 㿘` ? ?}H /k * ,  ) 4 `. )  p`  D. 4& L & D     . H 0㿘 0.!>  5      5     5    "`5  `Ē `  `  `  ` `  `  `  `  ` ` ` ` 㿘 ?2H /k * ,   l@ " )4 m k@"  )  4@" ) 4* } . ) 4   p`  D. 4& L& D )   R. H 0diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKfdc360KB/x720KB/x720KB360KB/PC360KB/AT1.2MB1.44MBfdSUNW,fdtwo㿘>Ȕ    "     2>>!!@]@ "    0ݒ ?   drive %d㿘`>"x 㿘@a  @2  " d@R @O w@L@I [version cmd] CFGLOCK: unexpected responseintr pri %d, softpri %d: chip 8207%c 㿈 2&`H80 @f &`H`h&`d &`h&`&`\`\&``>`x">@`>"@&`0 `0@&`4`H 7&`x&`|&`   7 *` @ " 2 7+ `h &`h`H&``&`|&`x@   X@  X`   X>#`" X>#  X&`tq`h  @Β @ >{#0>`cP>4 #Xp 8 7'> `>>!!@ *>  " #a` 04    >  <@ >@  >'>a``>`Вa> '5>' ``' @䄒 fdprobe: %d stati: %x 㿘$ hg   * @* Q 2 & @? @< !>` #@#2# x @ Ѐ 2`a2"@%   #@ # #  >"ƒ  >%> ȴ& >"Ѐ`   `? h   *@  : %s %d cyl, %d head, %d sec : density unknown 㿘  > 0   ?> ?&`&`ܐ L&`,`" @Ò  @ @>!`0`&`&`Xϐ2&>@#!>"t>ה Ґ"&`@/>bؐapafdstrategy: b_blkno %d b_bcount %ld blkno %d cylin %ld fdstrategy: controller inactive 㿘 D>ᔐ :  6) ᔑ* @ #  T  #`& @> <! H /d * % " !!8 2 $@0  d >А" @ʐH 00 0(& 0,㿘 $  \&!8&  ` &  `"# `@ 㿘 ` $   & &  "`  "@`$  &  `&  `"@$ `&!8 ̐&`@& `$,N&! >!P*!@ $ dfdc reset 㿘 h " x  *@ x *@1u  x* h`  *@>#`>b!㿘 h " L \  ߔ    L *` " ` + * ``*`*0  *` "` 2 ``*` ⃒ 0  㿘H /d * %   $ & H 0㿘 $H /d * %  ?& \@d @A H 0fdcresult: overrun fdcresult: timeout 㿘a " '> x `Ѐ``$  ` ? | , 0Ɛ 2 x> ocx?$ ?㿘 xa ``?0  x @  ? $? | *㿘>  :` 6J ᔑ* @   p2 ` ` *` *  >* c  2 ,  "  Ā " # ?  $ $ 䀢$ @! `  *@"     $  $     $ >ᔅ2 @  ( """ ( "( " "ࠝ㿘>>o"D! r㿘>>o"D! r fdcstart: not idle 㿘 d >"0@J%s: %s: state %d (st0 %s cyl %d) invldabnrmlseek_cmpltequ_chckdrive_notrdytop_head (st0 %b st1 %b st2 %b cyl %d head %d sec %d) end_of_cylbad_crcdata_overrunsec_not_fndwrite_protectno_amctrl_mrkbad_crcwrong_cylscn_eqscn_not_fndbad_cylno_dam fdcstatus: weird size: %d 㿈 $> #( d `>``>% P>! P>"0> #@ X0 >  >#\ >#` >#d ##hXs#0ptimeout㿘 \H /d * % >X ! "& d d & d@H p@㿘H o*@ e@ H p@㿘 "&  H /d * % @mH p@ fdc: spurious interrupt: state %d, istate=%d fdcintr: spurious interrupt can't be clearedfdcintr: block %d != blkno %d fdcintr: %s drive %d track %d head %d sec %d nblks %d readwriteseek failedread failedwrite failedblkno %d nblks %d nstat %d tc %d fdc: %d -> threshold soft errorrecalibrate failedstray interruptfdcintr: impossible㿐   d>" d`k& >+" \`2a & dʰ $````"`& ```"@$a80@2H d`>#ē*` €& l$`<a$`T0$``   & d* L`ܐ * @ " ` "`! ?$ ``$` h ` & d>!P`ap`͓:`w ` ?$` h " `0@2`@A$`@@=}  $`w  r   & k    `e 2  `@-( [ ? h& d$` & d& `p`0B<`p>!P |*`&  $`` `@`̪`$a:` @8> #  !: 8$`<- $`@-L%@ -H`-E`Ȓ@ >#@.`H>0@ & `&  x /*#`> #8>#p>#x `ܘ`#\  & d& $& ߒ M _, `ߒ@ `א X  ѐ R  ː L  Ő F >    怢 " `:  ŀ 25  `ߑ,@ ` ,  ` %   ` `               & d`0>!P *`U ߐ  h ` & d>aP @N 2D `0  > 2 >` ( ,@ @>#`>$`> ( H?8`* *H *0> `#> ( `H!?8  ,,`H, `H ,,`H0 <`0@Ғ"  2> 2 > D 2> t @2? l>c  0@>#>#  >`Ԑ#`     t 4 p# ?  & t># w& p p  & p & d l >`>! c!; ?/ >q"& l p??& p t ?> ?  & t>#Z A& p`Ѐ``Ȑ `$``Ԕ"  $` $`̀$`@w$@ \ݐ,= d>!P 2`@ & & d & :`W    & d& & i    `c  q& d>!P* @ 8   h ` & d>aP @1 }'   > >?  >#`>@ @(B \$`` " h >/  pt,Thtxt(hard error㿈 \a & p`耊   l   6 " h`   `耊   1& d/& d-& d ">`>! `!; ?G  >  > > > ##\#`#d#hXy#0 ($0$4Œ l & l? fdioctl: impossible㿘>a6   bA@ "@@"  `p@Jb@G 0z ">@Se e@ 0p !@"4V  `m@`q@ 0a )"=@, e g@W  (!Q N L   @)v " A> @)bD: 7 @3 2. n) @4% İ &&& & &&&& & $&$(&(,&,0&0 & $ fdformat: blkno %x count %ld fdform㿘>a4`  `Đ t h  2c 7  &, 2ܹ@O t $D$,$0 **``*`>c* $H$T$<># QH /d * % 3>#>0"aP*` * `Ϙ  #H 0 # %0(24&i floppy diskfictitious%s: %s 㿘>6 a !@@""$ (>a$ 8Ĕ  $ 0$ , @c$ 4 4 > a@\ !,4 HĘ  $  4$ < 84 J$ X)$ $   aW4 $ $, 4 >bD@' >"㿘>    $ @ )  ; 0   h  ? *@)ܐ   *@Insert filesystem floppy and press return.㿘 1>>#@  "Ё `p2```   *` ( >( />=%/> 㜬%/> 4$ 4   93   @2 $ _$ 6@  , ,2 @$ $ +>``-?8 -0-?8 - ?$ $` --00 $ 0& @-a! Ѐ2 @ , ?$ $ @-a Ѐ 2 @`  ,` @$ $ $ +>``+?P `-`0+-?P%/>@̀diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKsbusslave-only%s at %s %s slot %d offset 0x%x㿘`> # 3>a @6 !<: a>ې#0!@>!<֐#8 㿘> `2 2 ` D 2   & D @`? unsupported clock-frequency: clock = %s MHz burst-sizesrangessbus: PROM ranges too large: %dnameP`   "> (0i>_^@`8@ڐ!>&`0@Z H>``@͔ ?&`@ 2 4 H &`< L&`8*& D  >@c 2'4 ''> p@ߖ @˒ &`< e  &`8> xҒ@Z@ߢ 1>%> @߀@Ĕ  @ 'P @ߑ  relative sbus addressing not supported㿘 < 21`0`4=#  ?*@2`&a@Q&a<> `"`0>">* `  &`4&`0 &a<=&a@ `<"@"`   0. `4&a<` (&a@`0+  *  <    `4  8@  @ ` @  #@  8@ `# `ޑ+ sbus_establish: can't find sbus parent for %s㿘`$#>   c>` 8> h @  2 $& 4& $ 4reset %s:㿘>!ر. @> }  4 #> `"  @ oc0  2 %s: dma card found in non-dma sbus slot %d: not supported 㿘> c@ާ a<: 2` >J!h mii_attach: phyloc and offloc specified㿀 ?>!  ` @&`$ &` O'%>#>`$䀢 `48 " 028  3?@/@,?2( `4 '`4 '@'''b " `$ "0`$0"`4&`$`$"4"<`( &`(  'mii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failed 㿘" >:# / $ +#>!> 82 0` <2 0``  0c " 0     ۀmii_detach: phyloc and offloc specified㿘" >! ) $ % 0" 0 8@2" 0 <2 0`" 4 4"`4 4 0"@’  ߀OUI 0x%06x model 0x%04x rev %d at %s phy %d㿘`"  > : *` @ "2 # >"8 㿘`  "@ @`㿘 $ & 0 & , D  " 0 2 D 㿘 $   D  0 2 D㿘 $ & 0  & , D  0 2 D㿘 $   D  0 2 D!A  !@@mii_phy_setmedia㿘 L  `2  8  4 $ $@' 0 ` (*`> p> * @@   $  8 8 L 8  8 $miiaut㿘 P ` L? T"`8  $: 8  L 8 $  8`  L  4 8 $ 2/ %H# !$ L'  P`>!P`& P>X: P  @?`2?` d& P>b>!P2`@ :`?㿘 ( !H /e * &  P  ? L& P`4 $ 8 D  LH p@㿘 L 4`- 2* 4 8  $ L`4  $ 8 2  ` 2 \ & ` \ `   & \@ & \[ ?? ?㿘 P !!< L  8 $  8% `c$#``c   L 4 8 $ @   P $ L 8  8 $㿘 P  ?& P> d㿘 H@㿘 L | 0@2  <  ,@2 <`  <@ $@ 0& | ,& 㿘 L  ,` `    0 ;" D, ;  D@`$ D `H /e * & YEH 0㿘 P   L @*``" H  T( @*``# >  T)  @* `#  1  T' @*``& &  T%  @* `&    T#  @*``(   X<@4@   @*`& ``+   X  @*  `+ & `   X   @*`& ``0   X  @*  `0 & ` ז  T  @*``  ͖ 㿘 @ L`  -㿘 P K d   (""4# # & 0&  0 ! A !nsphy :` ( c  : %s, rev. %d DP83840 10/100 media interface㿘 >>a H! (>&`@> bt h&`8&`D&`H&`L  &`P@ &```L  4`8`$? b &`T㿘`( `u "`"6`0e^0```@2  [ 0_`@2   `L 4 `8`$`L$`8 `8`$0L` 4`B `L 4`8`$`L%b`8 `$`8C02`@2 4 1` 4`, `L 4`8`$`L`4 `$`82 `\``  $`\@$`\P ? 0 ) /3 㿘 L  $`,$`0 L `4 $ 8` L`4  $ 8 " L`, $`, L  4 8 $"`0$`,S `0 $`0H 2 L`0D   4 8 $ .  L 4 8 $ L`4  8 $ "!`0) `0    @`0 `0 @$`0 `0   L  4 8 $ @`0  $`0㿘o L  4 8 $ L`4  8 $?b  L: 8 8  $qsphy :` (Q c  : %s, rev. %d QS6612 10/100 media interface㿘 > > c( # (> &`@> c!(&`8&`H&`D&`L @&`P`L  4`8`$? b &`T㿘 ( `G "`"*`07002` @2  - 01 @2    L 4  8 $ L$`8  8 $0` 4`0 @2   ? 0   㿘 L  $`,$`0 L `4 $ 8` L`4  $ 8 " L`, $`, L  4 8 $"`0$`,? `0 $`04 2 L`00   4 8 $ L`4  8 $ ?`*`> " €`0 `0 `0 `0 @ $`0`0 `0 $`0*d****************p****㿘> L  8  8 $scxspl㿐> (   "(> > "HcP#\   1 getxscannot allocate scsi xs 㿘H /d * %  `%>  `6   }  ` > t"H  ?6 $ H 0 @ > #H 0㿘` > "H   ` 6 ?# @6 ~ݐ0  `@ could not get size p@ b  %h/#\#d#`  @]   . * *`  @> E!H 㿀@~  ##\#d/#`   @5 x@~֒ a" @ //#\#d#`   @ 㿀@~  #  ://#\#d#`  :@ 㿀@~ c /#\/#d#`   @ 㿀   @~  /`//!0 ##\#d#`   @Ϛ 㿘   @ ِ1 0@  ~09@ 2 0@ "    ' 0 0& ,  `" $ 4 0$ 4 <($ 0$ @ ($ @ `@  @scsi_execute_xs: NOSLEEP and POLLscsi_scsi_cmdscsi_execute_xs: invalid return codescsi_execute_xs: impossible㿘 & , $ ?& & (. X ` "A   > 0<+> 09   (> ! H /d* %  #>  aH {  ` H 0 0 ?@^ ?" & ,!Xscsi_scsi_cmd: buffer without nosleep㿘`d2> z"! `Y $` \$`$`$` $`$$`$`$`0$`T  , `  * @*`  s?;0 scbusyunknown error category from scsi driver 㿘 ,`<*`> !T €; @\?27 , 2  & ,  ?   "@  ! > %> "x  z  ??&  & , ?& ?  ? @ > r  4\4d5D5D444d505 DEFERRED ERROR, key = 0x%x Sense Error Code %d at block no. %d (decimal) 㿘 ``4@?  p q}@ > !x2 `  ` i> *` €($@"V$(U``?# @4` @%    $,c? ` ` ` "@W?U 05!N ` K +  )2` A?``?# @4` Ӓ` π` 0 0    ?  ` @ 0@/ > `! `   > *`* @ @ !> !а 6l6l677707\7777777%s(%s:%d:%d): probe㿘 >` `>     ReservedMiscompare ErrorVolume OverflowEqual ErrorAborted CommandCopy AbortedVendor UniqueBlank CheckWrite ProtectedUnit AttentionIllegal RequestHardware ErrorMedia ErrorNot ReadySoft ErrorNo Additional SenseXXXXhX@X(XWWWWhW@W(WVVVVV`V(UUUUpUHU TT T T T Tp TX TH T SSSSSSpS@S SRR R R Rx R@RQQQQQQhQHQ(PPPPPXP(OOOO`O0ONNNNhN@NNMMMMxMXM@M MLL L!Lx!L`"L($L%K&K&K&K&Kx'9(K@(K)J*J*J*J+Jh,JP,J0,J-I/I0I0Ih0I80I1I1H2H2H3H6Hh7HP9H0:H;H;G;G;Gp;G`;GP;G0;G;F; F; F; F; Fx; FX;F8=F>E?E?E?E?E`@E@AEBDCDDDEDFDGDhHD8ID JDKCLCNCPCPCpPCHQC8RC(SCSBSBTBUBWBhXBHYB0ZAZAZAZA[A[Ah[AP[A0\A\A\@`@a@a@a@b@pc@@d@ Illegal Mode For This TrackEnd Of User Area Encountered On This TrackScan Head Positioning ErrorOut Of FocusUnable To Acquire VideoVideo Acquisition ErrorLamp FailureSpindles Not SynchronizedSpindles SynchronizedRPL Status ChangeLog List Codes ExhaustedLog Counter At MaximumThreshold Condition MetLog ExceptionOperator Selected Write PermitOperator Selected Write ProtectOperator Medium Removal RequestedOperator Request or State Change Input (Unspecified)Updated Block ReadGeneration Does Not ExistUnable To Recover Table-Of-ContentsSystem Resource FailureSCSI To Host System Interface FailureMedium Removal PreventedUnload Tape FailureMedia Load or Eject FailedCartridge FaultErase FailurePosition Error Related To TimingWrite Append Position ErrorWrite Append ErrorOverlapped Commands AttemptedLogical Unit Failed Self-ConfigurationData Phase ErrorCommand Phase ErrorInvalid Message ErrorINITIATOR DETECTED ERROR Message ReceivedSCSI Parity ErrorUnsuccessful Soft ResetSelect Or Reselect FailureInternal Target FailureMessage ErrorPower-On or Self-Test FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)RAM FAILURE (Should Use 40 NN)INQUIRY Data Has ChangedChanged Operating DefinitionMicrocode Has ChangedTarget Operating Conditions Have ChangedLogical Unit Has Not Self-Configured YetInvalid Bits In IDENTFY MessageMedium Source Element EmptyMedium Destination Element FullPosition Past Beginning Of MediumPosition Past End Of MediumRead Past Begining Of MediumRead Past End Of MediumReposition ErrorFailed To Sense Bottom-Of-FormFailed To Sense Top-Of-FormPaper JamSlew FailureTape or Electronic Vertical Forms Unit Not ReadyTape Position Error At End-of-MediumTape Position Error At Beginning-of-MediumPositioning ErrorMedium Not PresentSaving Parameters Not SupportedRounded ParameterRibbon, Ink, or Toner FailureTape Length ErrorDefect List Update FailureNo Defect Spare Location AvailableFormat Command FailedMedium Format CorruptedCleaning Cartridge InstalledCannot Read Medium - Incompatible FormatCannot Read Medium - Unknown FormatIncompatible Medium InstalledCommands Cleared By Another InitiatorOverwrite Error On Update In PlaceInvalid Combination of Windows SpecifiedToo Many Windows SpecifiedCommand Sequence ErrorCopy Cannot Execute Since Host Cannot DisconnectLog Parameters ChangedMode Parameters ChangedParameters ChangedPower On, Reset, or Bus Device Reset OccurredImport Or Export Element AccessedNot Ready To Ready Transition (Medium May Have Changed)Threshold Parameters Not SupportedParameter Value InvalidParameter Not SupportedInvalid Field In Parameter ListLogical Unit Not SupportedIllegal Field in CDBIllegal Function (Should 20 00, 24 00, or 26 00)Invalid Element AddressLogical Block Address Out of RangeInvalid Command Operation CodeRecovered ID with ECCMiscompare During Verify OperationGrown Defect List Not FoundPrimary Defect List Not FoundDefect List Not FoundSynchronous Data Transfer ErrorParameter List Length ErrorDefect List Error in Grown ListDefect List Error in Primary ListDefect List Not AvailableDefect List ErrorRecovered Data - Recommend RewriteRecovered Data - Recommend ReassignmentRecovered Data With LECRecovered Data With CIRCRecovered Data - Data Auto-ReallocatedRecovered Data With Error Correction & Retries AppliedRecovered Data With Error Correction AppliedRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Using Previous Sector IDRecovered Data With Retries and/or CIRC AppliedRecovered Data With Negative Head OffsetRecovered Data With Positive Head OffsetRecovered Data With RetriesRecovered Data With No Error Correction AppliedData Synchronization Mark ErrorPositioning Error Detected By Read of MediumMechanical Positioning ErrorRandom Positioning ErrorBlock Sequence ErrorEnd-Of-Data Not FoundFilemark or Setmark Not FoundRecord Not FoundRecorded Entity Not FoundAddress Mark Not Found for Data FieldAddress Mark Not Found for ID FieldUncorrected Read Error - Recommend Rewrite the DataUncorrected Read Error - Recommend ReassignmentMiscorrected ErrorNo Gap FoundIncomplete Block FoundData Resynchronization ErrorCIRC Unrecovered ErrorL-EC Uncorrectable ErrorUnrecovered Read Error - Auto Reallocate FailedMultiple Read ErrorsError Too Long To CorrectRead Retried ExhaustedUnrecovered Read ErrorID CRC Or ECC ErrorWrite Error - Auto Reallocate FailedWrite Error Recovered with Auto ReallocationWrite ErrorError Log OverflowSpindle Servo FailureFocus Servo FailureTracking Servo FailureTrack Following ErrorLogical Unit Communication Parity ErrorLogical Unit Communication TimeoutLogical Unit Communication FailureMultiple Peripheral Devices SelectedNo Reference Position FoundLogical Unit Does Not Respond To SelectionLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Initialization Command RequiredLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Cause Not ReportableExcessive Write ErrorsNo Write CurrentPeripheral Device Write FaultNo Seek CompleteNo Index/Sector SignalNo Current Audio Status To ReturnAudio Play Operation Stopped Due to ErrorAudio Play Operation Successfully CompletedAudio Play Operation PausedAudio Play Operation In ProgressI/O Process TerminatedEnd-Of-Data DetectedBeginning-Of-Partition/Medium DetectedSetmark DetectedEnd-Of-Partition/Medium DetectedFilemark DetectedNo Additional Sense InformationDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xCheck Condition on opcode 0x%x SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %u COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d: %2d: 0x%02x㿘  >  4! !>!@ @ʐ L`` >!XL`` >!h  , ` @>! , ` "> >!> !Ж` ` * *`  *  >ې!L` m` ` * *`  *  >!Ȕ @  >!L``>" `@p  >" `B    L@     L@ "  ->"8 >"p  "p ? '> `)>%>2 @ "y @v?`   `lЁ%s, Error in %s, Offset %d, bit %dCDBParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d㿘` ```  ` `>"P*`1>  !0@|06`> !0  >$(` `  @ 2 @ 2`  @  >>`4 !0>a- !0@|` !02`>"P*` !> !0>ah   >$(` `  @ 2 @ 2`   @Ζ >>@|. T!0R  N  J`F>!@*` € > >!pa0 @ >!>!  * ̘ )!0>!a0 @ >!>!  * !0 1> *!0> a 1> *!0>a`a```<㿘  PĐ!@r!H /d * % > aXaX &" "aX& H 0 㿘H /d * % ` "` "H Ry H4> (> X  @2HUser command with no buf User command with no ioctl host adapter code inconsistency unknown error category from host adapter code 㿘 0`U >ߐ"0= 2!J >Ԑ"02 , [ X, Z ,`!*`>  € ( $" $ $, [ , Y X 4 ( , [( > #  , [  , [ >#8 , [ ecd d0d\dDdPuser_strat: No ioctl physio split the request.. cannot proceed cmdlen too big scistr㿈V  >x Z ` <  a >k M 2 G  ( `ѐ >[ = 2(  H #d `#\#`F "H /d * %  0" #> a n  0b H 00 0& 4(& 0 ېscsi_do_ioctl: impossible㿈  !"Z a avau ! "g  ![v0!pwה `& `   &&>&&&&>` `&& !` *T. &L&4&8&P&D5< `f0<?# @6  6   6   @6 "'   6 @+@& 'В"#\#d#`    ~  @㿘! @0!@ "@ !@ 3 09!@", !@.  ! ! @0!@!  """ 2 """ "    ` @scsibusscsibus at %s㿘`>"  : %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun links㿘> `2`>""`.&`0 2`0 6`06`: $`2`: *$`:>א"`: * N,  &`4>R"`: !>  N `4."@ `4 >#@oa `:  `?@g?㿘|s㿘|J㿘 : 6 4 4, @ " :Oْ  : & 4 4Oђ 㿘` @2 `  "@@"@ `㿘?>b   b.  @  b @㿘  >  6@ . @ 2 08    ?`&- @6)   $ ?  @4  @` @ 8: 2@@ 9 @ " "  " "` @ " " """    􀠠"A @  \    @"*   @2 @  *   *  \_ \* @ 00* @ 800* @ 0*  @Ò`*1.14UJDCD87301.25CD-ROM CDR-N161.70CD-ROM CDR-S11.08SANYO CRD-S54PSANYO CRD-254PSANYO CRD-256P4.21NEC CD-ROM DRIVE:2731.0gMemorex CRW-26421.02MATSHITA CR-5741.00GCD-R580Bq01FX320SAC101CREATIVECD3630E1.07CR-2801TEBCD-24XBCD-16XSW03DALPS ELECTRIC CO.,LTD. DC544CSENASUN V1.9SuperVista S-12 AT3 1.60 ULTIMA V2.9Astra 1200S UMAX 1R08IS60 RICOH 02.2Model 3200 01.7Model 2600 02.4Model 1300 WangDAT 5150ES SCSI5099ES SCSIWANGTEK Python 28454-XXX2.2GVIPER 1500 21247VIPER 150 21247ARCHIVE TDC 3600 TANDBERGSDT-5200 3.SDT-5000 2.09SDT-2000 EXB-8200 EXABYTE TK50 TZ30 CP150 CALIPER DCASC3725SHP0002ST150176LWSEAGATE4421-07MICROP0001SD120S-200 NEC FC-1TEACG0661467ZIP 250ZIP 100IOMEGAjaz 1GBiomega6027MK538FB ST34501FC ST19171FCST296N ST296 ST157N ST125N SEAGATE RO3000S RODIME PD210S SUN0207PD1225S P105S 910-10-94xLPS525S ELS85S QUANTUM C-OLYMPUS 0307D3847 SnapLink MST LXT-200S LXT-213S SUN0207LXT-213S XT-8760SXT-4170S MXT-1240S XT-4380S XT-3280 MAXTOR DFRSS2FKZ-CH3171-S20664IBM0663HIBM 0662SIBMRAID CP16CP15DK515CHITACHIA00MD21/S2 ESDIEMULEX RZ55 (C) DEC1588-15MBSUN0669MICROP 3.30MOS321 DELTIS 0800M2513AFUJITSU3.08OMD-5010 EPSON CD-ROM PX-40TSPLEXTORCyberDrv1.55R2626 JVC 1.04CD-ROM DM-3x1SShinaKen1755XM-4101TASUNSLCDTOSHIBA 1.10CD-ROM DM-XX24 KTEXEL 1.0BCD-ROM CD-56S 1.06CD-ROM TEAC CD-ROM CDU-8012 CD-ROM CDU-8003ACD-ROM CDU-561 CD-ROM CDU-55S CD-ROM CDU-541 SONY 1.01CD-ROM DR-124X PIONEER CD-ROM DRIVE:841CD-ROM DRIVE:5011.0CD-ROM DRIVE:210CD-ROM DRIVE:84 CD-ROM DRIVE:83 CD-ROM DRIVE:55 NEC 1.3CDR-H93MV MEDIAVISRENO CD-ROMX2A MEDAVIS 1.0bCD-ROM CR-5XX MATSHITA2.06CDD521/10 IMS C4324/C4325 HP VDRD-25X DENON RRD42 (C) DEC DEC CD-ROM CDS-535 CD-ROM CDS-525 Chinon CD-ROM CDS-431 CHINON %s offlinescsibusprint: impossible qualifiervendor-uniquedirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicesscsibusprint: impossible device typeunknown targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sremovablefixed`>ѐ"h      ` `@2  `  >> > >> "8>"p>7">"8b`0 `+> !,` €>%">"">">">">">">#> #> #># >#8>#`А ~  y p t  > ch#\#`#d>#>##h #lU  DECTZ30TK50 not configured 㿈 4.`@.` ( Hx  >  0$@ $`!>$` >$` b$`$`$`$` `$` $ "$`$$`4`4`4`a,`,`@i :"ؐ֒ Ð * $*  > ! * $*   2   > b@ @i >  bH@i 2 > b@ @h >  bP@h > ybܘ@      ?`# @4`  ?`# @4`  ?`# @4`쀢 ` 4` ` ` 2  4` ``,@ 8 *@6 8   8,`,`` 4` Ḑ @9  `  `0/`0 ` Ḑ   $Ḡ'>!'r? . 4.`" bؐa>sI0 V > ("XIr 㿘 2 '5 @ 2-`2)@o`` @n 2` @n `  @n 2`@n@` @n  @@'ϲ@x@h 6 U ///#\#d/.`.@#`Д x\@hp 6 Z(///#\#d/#`귔 diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapcdNEC CD-ROM DRIVE:260㿐>bx  W 㿘>&`` "h$``$` 4` >"d`0`&`&`XvƐ@`"  `2`` &``"">,>-"p#(&aT>"E!8 㿘H /d * %   $'> 2)> 7 $ $ $0"4h"0 $2$H 0  *`> 1>"#ta0@   `! > 2>"#t` @! Ӗ ! `, 㿘v 0㿘? 2  @>"Ptѓ4  0  w.   ` 9s 30m~!   Д! _\0.``4` 誔! 2F `  4`@1 4   @  `+ ,@ `$ "      *@$  *@$    @ v$ t|0`?# @4`   ]!`?# @4`vtf㿘?2  > "Pt:6   0> v tM05"      **@$  **@$    $  Ē !@ #?c 2 `!   &  Ēb 2vjt 㿘 D'? @2  `@>"Ps2` 2 Đ =& 4 `2  6& 4 <(@n  -& 4`". < D     @ @ $ $ p  2x 㿘  0` `@ 0`<u"@ 㿘 D? @2  `@>"Pr2`  "  ( <*`" 4& <`㿘>#>$## II㿘>#>$## I= 㿘? .!!@m7.@!@mѐ@m0 K.@mʒ K. *  ( ` (("  ?jX? @2  `@ `>"Pr2`    ` Z ! @"Mc@c@Cc@c @=.!,c# @"58" p ! `q@") !@"# # # @`m @0 @" !@ 0!@2@2    @"2Qc@/)c@"!Tc @"!T!@] `q c @c@ `h c@"E c@Cc@ `Z c@% c@ 9c@c@ `G c@ `p@`s@q `8  #@"!T2 #@ "!T# e e@ "e  r @ ` @Y #@ ` @ "!T# @j `  `m@T`q@ܐ `  e`g@`f@D  h@"8  #@q `퀢  !@ `怢 0#@"p 0#@0#@ `Հ 0 @2@Ȑ `ˀ   @ߘ 0 d!0Ȓ `& *`` & 0 s  $   @   $ s0` € @` € #\@#!T` € @} ,@@I oˑ*   8Ic   @U Y  d ?# @ `*`2 @7 0F#$ B> #D( 9 @+  '```"  !?#?*`@  &@  `$@   * 2` 2`*`  d ?@# @ `*`2 @6@@?8Ր>    A#$   @ؚ @ , `$`?# ` * 2` 2  d ?@# @ `*`2 @6@@  ` 8`&C 0!T@ !T    @     !T@     !T@     u@     k!T@     `@ \@  W   R   L  GV "A !=2 ݔ 8 ؔ 3 @ Д + 0(2?#ϒ @"2@!T`@W@    oATAPI CD-ROMSCSI CD-ROMfictitious㿐@b;!@b8"`Ƞ d &(&0&,`@i d &4&8`Ĥ  ?b  >(`@a  >(`@a  6>( `@a` !W  &&!,&<6H6J&X&&o<6 &6&.@a    @ "@``|`,    @  @ l`Ĩ  d   *   *` *   * *`  *    @>  `   d    *   *` *   * *`  *   2+` +`""#` "  ` 00  ?`@$`Ā ?,  @aq ? *  6B ? 2  @?`6 # @ `* * >#c@p(" & & h2; ̠ @a:  h %/#\#d#`  ペ  2% * *` *  aa(& * *` *    c8& "&  ́x @` Ô@6`6`6` E6////#\///#`#d   > h@& 4$ А@ " 4Ҳ@ &.`.   #\  @  x\ @`   G/#\//////#`#d    x @` Ē K'/#\/#`#d    㿈 Ē'Д"#\#d#`    Қ x@`s  B`/ / 7` @( //#\#d///#` Ⱊ x@`Q  C`/ / c7 (/#\#d///#` ␚ 㿘   ښ 2``#  +    ˚  㿘Β   ? `@` В @`@` >+!ȓ*` € a0  (//#\#d/#`  @   װ 2 .`` ē*``0  (///#\#d#`  #  ʰ `I ` ē*``0  (///#\#d#`     `-``* ě2`!0 2`2` ////#\(///#d#`     Ԓ`2 2  2  .` .` .`Ք ˰ 0{` ē*``0  (///#\#d#`  ὚  d װ _.`` *    ///ђ/`  a0#\#d#`  ᚚ  A $ ` *    ///ђ/`  a0#\#d#`  z   .@  .@ ` ĕ*?0 //#\#`#d  ^     L@` @^  T@^@ Ēa0`  T(///#\#d//#`  T-  M` @^̒ ??(*? ?(*` +`?*   ?@?+ *? `?*? @ ? ?3    ` 3@2 2`  23   ` ` .@.`.`.`.`.`.`.`.`&` &`&`.`  ` p@^  @^| `a0@  (///#\#d//#`  ྚ   .`.`p@^W (@^S` ē*`0@ ( (////#\/#d#` (  `( 㾸@^, ( @^( @a0  (///#\#d/#`  l  ()*  `&``V,  p@] (@] a0@  ((//#\#d//#` <  *  &``'  㿘@` >,#*` €Ӓ=a  Hdcd_scsibus_get_mode: Mode page %02x request bad size: %d bytes 㿀 >,#@ؔ @] @]} B b  (/#\#d//#` Ě cd_scsibus_set_mode: Set mode request bad size: %d bytes 㿀>-   @]J.@ b  //#\#d/#` ߎ P     ``/ɔ P    ////ʖ P t   Ű .@.`.`.`P  ^  ` `/`@/////˒  T p b #\  O    //// & p b #\ ؖ 5    .@.`.`.`P b #\    " N #\   ɒ@` `/` / ͔  Ę //ܘ  x @\c Ô@ /#\//#`#d   ޫ diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKch02009000SPECTRA㿐>b  V 㿘>&`0b >."2 !@f"@I%s: offline %s: %d slot%s, %d drive%s, %d picker%s, %d portal%s sx?>Б2 `  u Б* @ 2 00m` j  2` 0 2] 0 H  @ "@ `>"@ >.! F 0@     @"4/ 8 L>.! >. >.! T >.>. ! H#\ H`2>.>. !#` P#d P`2>.>. !#hؒ 8 $ 4? c 2 ? 0> А* @?0` 2`㿘? 2`>А * c  # #  ^  #"Q#"?8#"+8H0 #"(HA0 # #40 #"-0@0 ,@~ (@ $4"  "?@$8   44" "H"L"P" T "@Ӓx@ 4M `4I +  H`?@4A * ` ?@ X8  @ :  81   `` ` @Z@  4, ,``4 4` 24 4`//////`/ / 0ab#\#`#d    x@`4l `4h ` 4d +` H`?@4\ *` ?@4U + `?@ \L  @ : "G  @ :  8@ `  `` `@ @ZW  4, ,`,`4 4`4 24 4`4///////// /`  / 0ab#\#`#d   ܂ x@ * 0  H `  '  :` @Z  4, `4  +24 ////쀋 / / 0ab#\#`#d   K %s: warning, READ ELEMENT STATUS avail != count 㿘H.`  S   8$8 @I$ ;` ` ` *   :_   8j@0 "` ` `*  >0"}  8Q` -@ `@*`:- `:( x @Y 0a6`67  7 (////#\///#d/#` ۿ %s: could not sense element address page %s: could not sense capabilities page h@YH ؒ @YD#p 0` h//  //#\#`#d  ۆ  >1D 0ߧ, ,,`,  @  +((+`   @ % T% 8% H% <% L% @% P% D@X  @X  0`////#\#d#`  B  >1 `}7 0 X@Xߒ  \@Xے  ,@ , $  0 ` 2`㿐>c& d   `& ddiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapsd㿐>c`  ﻘ %s: %ldMB, %d cyl, %d head, %d sec, %d bytes/sec, %ld sec totaldrive offlineunformatted mediasdattach: unknown result from get_parms%s: WARNING: unable to establish shutdown hook 㿐>&`cP `0 .aT$`$``>L&`X`&`f@ `" >8 >8"&at`" >1 `2>1` &`>1|s#``   >"ؐ ف aU`@ a^`@ ao` @    at>bؐ`Ƞ`>1 |H# ">1  >20>20 !>1#@_@_#\|*0 |'#0>2|# 0z |#>>6", L &ax>2 H| 㿘H /d * %   $)> 2+> 7 $ $ $0"4h"0 $2$H 0   *`> 1>3 da0 `    a 6!x> 2>3 d` a`  a ,!x`>LT" 㿘fb 0㿘? 2  @>#8d2`  0  f | ` 5 p H! k` 2 ` ؖ! ```4` v! 2K `   4`!t@  Ȁ 2 4  @   `6+ . @ `# "      *@$  *@$    @ f$ dC0`?# @4`   $!`?# @4`f~d-㿘?2  > #8d6   0H f_ "A"      **@$  **@$    $$  "  !t €  Ē ۔!@ #?c 2 `!     Ēb 2f'c֐ 㿘 D'? @2  `@>#8c2` 2  B& 4 <(@^  9& 4    `  /& 4 ,& 4". < D     @ @L $ 4!y’  2k 㿘  ` @ ?"` 0 `0 @ <d"@ 㿘 D? @2  `@>#8b2`  "    ( <*`" 4& < `b㿘>4>5  d 8㿘>4>5  d 8 㽘? @2  `@ `>#8bY2`    ` .  !@"! !@"8  p !   q@ " m@  0!@2      `m@"e e@ ";  `p@`s@$0 r@& !@0 !@"vV `q@i  h@0 e`g@{`f@ x0  @ 0{@ 0t!0p `& *`` h&T 0d3 a $   @2 2  e g@2 ? @2  `@?`4`# @ `* * >4 `@U   d$ 05"4    -$ ?*$  @ ՛ " "  !22 @   kaSCSI opticalSCSI disk%s %s㿘@T!@T "`&(`&0`&,`&4 &8 d&8 6aT` >6>6aH@S aUaX@S aU@Z/a^@Z+   >6ahx^`ؒ@Sm `ؐ.( 6H2` 6J& &<&&X&&  aW6&&.a? 2`  ?6  +  *6 >4`@㿘  !t € x@S  @S 6`6`6`  //////#\#d/#`  Κ %s: ..is spinning up...waiting %s: removable disk stopped - not restarting %s: respinning up disk %s: respin of disk failed - %d 㿘  4`?  ` 4 ? ( ;?  7 3  >6 w##@%?$  ` ` >7>7 wp   wj @  ~  >7 Xw_ ? 㿘?2  @>#8`E4   /? `*@2 `Đ  2?` `, ` `"(? 2`    2?`3㿈)> "x ?>2  #8@2`  ` $#bx#8. @   (@[ R @Zk.` @Q%,    @ > ? = !`7@ @R 6` *6`6`4`///////@Ry  @&  #  &&& &&9&(& &,2&0&$ @€  %"x  _(*``  @*%s: strange capacity descriptor byte5 0x%x @ @R, Ģb  # /#d//#\#` s  M  `  " `  >8 `>8 `;  vT 6 *` `*  * `+ *  @ 3`  @ .&` &`&`&`&`&@ Ę#\  &h   ѓ*`@ * ̐ &@&`&`&`h漝㿀@Q’ , @Q cp   //#\/#d#`  , P"&`  ҍ  @Q cp  ? ///#\#d#`  ,   ʑ* ˓*`  &` &`  @ &@&`@Y=(&`&` %s: mode sense (%d) returned nonsense%s: could not mode sense (4/5); using fictitious geometry h.&`!T`Ȑ}  + ґ* ֓*`א ؕ*ӗ*ٔ   &``&@?&` < 2 Đ"&`   `&`@ @XL&` O " ґ* *`ܐ ӕ*ؐ &@ٔ &` &`  &``  &`` ' "$&`   `@` >9>9 u7 >9 (u2 >9u/ H ’ @ 6 "&`&@&`&`&`  %s: WARNING: cache synchronization failed x @  "`!@P aba 5/#\#d#`     >9"t 0  @& diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK????5150ES SCSI FA1501 AT4000s HP 263HEXB-8200 EXABYTE Model 1300 WangDAT 5525ES SCSI REV75150ES SCSI5099ES SCSIWANGTEK VIPER 150 21531VIPER 150 21247DMT780 ANRITSU CP525 SANKYO VIPER 2525 25462ARCHIVE TDC 3800 TDC 3600 TANDBERG st㿐>``  % %s: %srogue, drive empty density code 0x%x, %d-bytevariable blocks, write-%s protectedenabled㿘>&`L P $ $ 4 @L>:t"`X>:``">:">:!p t 5>ؐп`  >:ؐ@` "`d>:s"a>:s"(```>:>:s"@`0s"H`0>:`"X>:"p>:"s֐ a&a&a&a ?# @4 㿐> Lc 梘  & X& h& 4@& @㿘 X  l  @OW @ ,@ h@`" $ @ ,@   , @ ,@   %s: already open 㿘? 2  @> < 2 H  <*@ 2 L0@2` ` >; si 5   ! $` 4`%  D`2 0 @ܔ  0(`@\$ D`   0  $ 0 @ɔ `?# @4`㿘?2  >`<6 *  0 a`  @#   " L     L @  L  `2  L @  L @  L? c 2  %s: cannot set selected mode 㿘?2  >`<6 * 6  0 h Lf ,``@$ 0*  l@ h $ 4 @ T τ 4`"@6 I"@~ @@ ; @  *  t, < d, < 0 ?$ 0   @J  0*  p@$ 8$ 0@ >; σ!@ 0 h$ 0 4#@rt 㿐 0( L @ @ @ @ a!@` @ @ 0? 7& 0  @ 4 L" P0`"0"" <T2 <0"82><H(0`"0""8""8`"04 `20`0"0`"80"8"0 < 4 0&000"0 \\\\\\%s: bad request, must be multiple of %d %s: bad request, must be between %d and %d 㿘 D? 2`  >2 <*  < @@ 0 " P 8@R  8>< q#   T  >< q#Ȓ & 4H /d * % & $ `( $& (`("@"`(H 00 0(& 0 <8& @%s: not queued 㿀 L` ?## `  4`L0!  $` ("`(&! (" 0h"`` `` @4` 0$ 4 <$ 0$ @n` 4`"" 0 0@  @̖ " 0 0 <h$ 0$ @$ 4T`  0$ 4 < 7$ 0$ @ 0   0$ 4 <($ 0$ @ 0 & 0:` @L  0@  0 > /& 0% /( 0   / 8@K <2  <2 2 /// H <# #\#d#` ܚ >=!@pђ ` 2j`㿘? 2`  ><2 * @L><`# 0'㿘? 2`  ><2 * @L><`# 0 㿐? 2  >`<2* a2 8  <@   a@a@ 0 !@7  @i @L 8 6 8& <& p& |& &  &$ t&( &, &0 &4 0`" 0 6 0(" H 6 H6 J64 J4 HV`o>?!*` €@9   @_ &@  @   @O   @   0 @[  @U ~ @- v Д  0*@:$ 0 0 5$ 0@e c`2 P 0 ?`@  T  @ T  T@$ 0N  0 $ 0 0$ 8 $ 0`EC  , <  =  LL6@ >;#@o , <$ 8 0 %$ 0 0 ?!$ 0   V   ,`0,` 8*  p"@    <* * t  * ,HDd<P|㿀2 @K  0 `/ 8 `/@I: 22///66/// Lc #\#d#` A x`L  % @Jڒ a0h /#\#d#`  #   * *` *  $`T$`P0 @ L @J a0 h/#\#d/#`   &*`** *@  @  & \& `. d 0  0 ?& 0 @ ː  40 @ 4 ` L"7 @Jd  /@J]/   03 <//// 0 "  @ 82 2 /// @ 萒!0#\#d#` ̋ 㿀@J+  `/ 6/b /c  L #\#d#`  l 㿀"# 0 8`0B 0"0>`4 =9`     " 0I 0""' ? =  `4 ?߀`6 0 ?& 0 0  ?& 0 0"` =& 0 ` 0   ?& 0"  ?& 0` @IÐ L66`6` ///#\//#d#`     㿀`( `  0!"! ?& 0 0 =ϐ =& 0 @I L6`6` ///#\/#d#`   ך 㿘 0 %$"  %  & &` 2  N x`  ٖ 2" 4  `2 @  @I@ L6 /#\/#d#`   ˉ x   0 =& 0@I  L /`/!06"#\#d#`   b %s: block wrong size, %d blocks residual %s: %d-byte record too big %s: bad residual %d out of %d 㿘  4 4 0   7 7 * *`  *    $  p2? 0 "L $ 8靐& (  @ ` 0 $ 0 ($`@  ` 0 $ 0 ($`@   ` 0 $ 0 ($`@ "  4  2 4>A!l  4 "  (  2 ( 8>$ 8 ( $@*;  0 2T  3`2L$`@M & (  @2H  `C =`<     8 >A"!l 1  `   `>A! l$ & ($`@   2? 4 "  0  2 0 8>$ 8&2 ?"$ 0 $`& ($`@ ?㿘$ &  6 t '$$`8(`82`0`0    ?$`0   ٔ ( 0 2`8(   diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKgenericFujitsu M3096GM3096Gm FUJITSU UMAX UG-630UG630 UMAX UC-630UC630 UMAX IBM 24562456-001 IBM Ricoh IS-410IS410 Ricoh IS-50IS50 RICOH Ultima A6000CA6000C PLUS Ultima AT3 AT3 1.60 ULTIMA ssC7670A C6270A C7190A C5190A C6290A C5110A C1130A C2520A C2570A C2500A C1790A C1750A HP 㿐>b  MMUSTEK㿘>&`4bА "2 ">C a`@M  2@N d>C a @L  2@A d@  d$  `&`&`<.`N.`O.`L&`86`@6`B&`D&`H.`M&`&` %s: %s %s: generic scanner 㿐>`  @ >C`&  $ 2&  >C `"P. ^@k  0  k"`!> x@F , . ^& ԁ%s: already open 㿘?2  > 6  6& ⼑*@`2`4    >C# jْ`  !!Ǒ ? # @4    4 㿘?2  >b6 *   쀢`" 0@   0$ P ?$ 0 4? c 2  㿘 D? 2`  >2 * @ 4` 䀢€㿀? 2`  >2 * @`0 #>D`܀`@ "`00  @F  //`4c#\#`#d   ` `0 $`0>D>D!ؘ  )㿘 D? 2`  >2 * @ < P 8& < < H /d * % & $ ``( $& (`( "@"`(H 00& @%s: not queued x 4` C?a#b`  4`Ec06 3 $` ("`(&  (" 耢€` @E  (/ <(2`2`/// H <#d#`#\ ۚ >D"iВ ` 2`㿘? 2`  >2 * @# : #( 5  # # *  ` 8@ ( 8㕔 (0# ؀€ @0 쀢` -@  0 ? $ 0  -   4 0 4@E  $ 0///@E/ ` `2`// (// 2 2 2 2 2 Գ2`55`22222`2`////////////////////`   "` / `   8 ` " ` / ` @  " `/ i4/ g // %/ " / /  a  ' `"  ` * * @* @ ' $" 2`// 0  (c#\#d#` Ƹ 㿈 2 4`*2##\#d#`  3Ʀ 㿈 4 *0` h" @ i g  2 2  *1 2*2#\#d #`  6 h 4@D a" 4 (//#\#d/#` ؘ e >D"hZ * *` `<  &`<diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK %s: MFS-06000CXMustek 6000CX Flatbed 3-pass color scanner, 3 - 600 dpi MFS-12000CXMustek 12000CX Flatbed 3-pass color scanner, 6 - 1200 dpi 㿘>F . ^h"H`>F bP@I 2` >F. ^g"``>F b@I > >F. ^g">& & &  & & & & @& 㿘 0 " ` @N "`  @KԐ`$&`  @Kΐ@$@&` @KȐ`$&@@K’ $@ [&` #؀@U`S!@8Y `!,  @K* 2 $` 6`!,  @K* 2 $`* 2 "U06` *`2 26 ` @Hp?$? H!.`` @Hf?$? .`` @Kv$? P .``   i4  g6 ^   ^.`& 8G (@ 㿘 \ X`<2 @KP$&`<P 4@ؐ@Bޒ   //ܐ@B֒  D @J/Ȣ H@J  8@J @ <@J c4`4 42 ///#\#d//В///#`    2 @B  / /@B/ @ a,/ @J] /@Gܒ d / M @A? N/@A  / O @JH/㈐? p//#\#d/#`  ǚ  2B@Bh  @  /,/Đ / L " h" i g   # @ H PĐ X/##\#`#d   ď  2  <@v   㿀 P  4@B! # /#\/#`#d   j   %s: not queued 㿀 4@B  \  X/`<2 @I`H #44(//#\#d/#` >  >H!f3 0 T"& T`< P" & P mtkrdymustek: lines actual(%d) != computed(%ld) mustek: win-size actual(%d) != computed(%ld) x 4@A   #//)>H'>H(#d#\#`    2;耢 ` >!P "Дh?K ($* *` * T@  >H"pJ P !>H"Be 0 `  㿘 L "  i   6 \4 @ g 6 \ @! 8@I$ \ & X` ?` ?& X B <@I$ \& T  X2 & Pdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK %s: C1750AHP ScanJet IIcC1790AHP ScanJet IIpC2500AHP ScanJet IIcxC2570AHP ScanJet 3pC2520AHP ScanJet 3c/4c/6100CC1130AHP ScanJet 4pC5110AHP ScanJet 5pC6290AHP ScanJet 4100CC5190AHP ScanJet 5100CC7190AHP ScanJet 5200CC6270AHP ScanJet 6200CC7670AHP ScanJet 6300C set_window failed compute_sizes failed 㿘>I . ^e!``>I ah@F  2` >I. ^d!p`>I a@F  2` >I. ^d!`>I a@F  2` >I. ^dؐ!`>I a@F}  2` >I. ^dʐ!`>I a@Fo  2` >I. ^d!`>I a@Fa  2` >I. ^d!`>I b@FS  2` >I. ^d"`>I b@FE  2` >I. ^d" `>I b8@F7  2` >I. ^d"@`>I bX@F)  2` >I. ^dv"``>I bx@F  2` >I. ^dh"`>I b@F   > >I. ^dZ">  &  &   &  &  &  &  &  @$& >Id@"0 @   >I>Id6"0d3"%s: set_window failed %s: compute_sizes failed 㿘@(`  @ #؀@8< ``@ !@82 `?* 2 !,8+ ` c !8% `   " ^  ^.`& 8 (@͒ >J "H@ >J "`cj *f0S%s: trigger_scanner failed 㿀@ >J"H@ ">J>J"`##`7'@E@9 >J #c6`%s: not queued 㿀 4@?J `<a`H22b /(//#\ /#d#`   >K pc 0`< P" & P 㿀 @?# 4 a66 ///#\#d/#` f 㿀 @? 4a66 ///#\#d/#` K *f%ldP*f%ldQ*f%ldX*f%ldY*a%dR*a%dS*a0T*a0I*a3T*a4T*a1I*a5T*u2T*a%dG*a%dL*a%dK 8x>Kb2cI <>Kb2cB D>Kb2c; H>Kb2c4 @>Kb c.>K Bb(c( L`&``"   \4`"J } \6 \>K 00 `, `,  `,  `,  `, @D, >Kb8 X b86 \>K"@ ` "@, `,  `,  `,  `, @D, >Kb8 A b8 6 \>K HH `, `,  `,  `,  `, @D, >KbP ) bP6 \>K XX `, `,  `,  `,  `, @D, >KbP  bP, ,  ,  ,  , , @Dr>Kb`  b`, ,  ,  ,  , , @Da \>Kbhb M>Kbpb N>Kbxbx$ ݖ%s: interrogate write failed %s: interrogate read failed %s: bad data returned *s1025E*s1024E*s1026Eh`8`<` `L   ?$`8$`< 0 >L >L( (/?@D >O`8Ƞ   E>OJ@  d2`J@   I ?А  >LJ+  @ *`В@  `L $`X+ $`Xb8b8 ?@C/M > `8_  >`<aB`03OJ@  d2`J@   2 >`@ a+`0?А  J,  @*`В@ `\$`T`X 2 $`Puk  %s: unknown device 㿘>&`0`t >M"2 !aj">M! af`%s: already open 㿘?>`2 `   `* @`2`00  2>M 2 !a@` ? 0> `* @?0` 2`㿘? @2  `>`* 0diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKdmaledma[%s at %s] offset 0x%x㿘`"!@>M `# !@>M`#0 espdma㿘``@A  >M@@#x "   > # `z&`48l@ cable-selectiontpeauiburst-sizes: rev 0esc11+2unknown (0x%x) nameespP "8, 2  80 @ &  >M&`D @@c 2#>>N@ƒ`>N@@` >N@@`( 2 `D`D* "`D "i" >`   @ " >N`0@??&`T&`T`T &`T>N`M @`D<@ @ &`L `>N@">N!>N$@>N(@">N>N`/ H>N`+ P>N>N`& X>N`" ` >N` h>N`L` p>N` ` >@ >O>O>P"c>Q# c&`l&`x>O>O>O>P#8cP&`p&`t&`|&`` I&`P 28`0I8 >M@@cx  >M8@@c 8@@ 2'8 ''@1`P %>N#>M@@S   'c@E~ @  0>M@?גc  >N`@ &`<"#%s: line %d: CSR = 0x%lx /usr/src/sys/arch/sparc/compile/GENERIC/../../../../arch/sparc/dev/dma.cR_PEND㿘 D@$!@耊d! ?{  Dd ?   >O D@ >O`_d!P>O_a  D@ < "@ D Ȓ`"Y D @ ?"@ D " L@  `  D " L@(@2)& H D* " T   D " D D@0 "& H D " T`  D@ 7@("@& H㿘 㿘``@?, 2 @ 㿘t  D  D %s: start %d@%p,%d dma_setup: dmasize = %d dma: cannot allocate DVMA address㿘 D@#>Ѐ$ %>@耊d! ?ɐ  Dd ?   >O D@ >O`^!>O]7  D |` "& d& hbx  >O#`@@ ^  d?@@*" 8 & `'bx >O `^#x 2 d ``  d @֥& \ & X>O\# D"  L d D"` L@2 D>  d ` @  *  D"  D" >! "@  D  " H%s: intr: addr %p, csr %b INTERRDR1DR2IEN WRITEENCNTTCDMAON%s: error: csr=%b dmaintr: DMA wasn't activeDRAININGdmaintr: discarded %d bytes (tcl=%d, tcm=%d) dmaintr: empty esp FIFO of %d dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d 㿘`D`<>"x` >P>P!"`]>P`D>P }"`D"0` #] ?`H 2`D>P\_"H@$"!`L@耊d! ?ϐ `Dd ?   >O`D@ >O`]">O\= `L @`2`D`D@ @@ "@`D`  耊` ! ?ڞ `D`  ?   `D>O>O `]">P\ "h ="```($`Hbx "%>P  x€ @€  * @  € @€  ]Y   @€  bx >P"]E 2,``  € @€   * `@  @€  * 2 ````@@2`` @" ``,bx  >P @"Ȓ € @€   @ @€   \>`d!H> `2 `h`X "`h`\@```h ""`d@"@㿘 D >P }" D>P` " "0\  l@ diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKlebuffer[%s at %s] offset 0x%x㿘`"!@>R \ !@>R\  㿘``@< 2 "@ burst-sizes: %dK memory nameP "8, 2  80 @ &  &`H8&`L @ " >Ra8@??&`D&`D`D>R`L aH&`D \?: &`@ 28`08  ''@ %>R#>RX@j@   '`Aٖ @{ Xdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKqec%s at %s offset 0x%x㿘`"!@>R [#H!@>R[ݐ#X 㿘``@; 2 x@ #channels: no channels : invalid number of channels: %d burst-sizes: %dK memory %d channel%ss nameP 0 @+ &`<D&`H4&`\4 2&`L&`@@v @ " >Rc@ٔ?&`P>R[#0X >S[x 0Q>S`(@Ŕ??&`D&`D`D>S`H `8&`D`P: >S X>S `[Z &`@ 28`08 "' '>S[H h@@ #>S!>R`p@@Ŕ  @c '#h@ @ `pranges%s: PROM ranges too large: %d 㿘>S"x @@P m  & X>S" [ 05 @>z& T X @@ T (`< * *    X`8  @2 `   " `8 X@ ` "   T&`<㿘 0"!<.` X(   \ &@("!@ 0.`( T @` 4   X   & X @` @ޅ.`%s: reset failed. 㿘`< $`  ׋ ?   2`P>T Zy`0@4`H$  `P$```H@4*`$ `P *``H@4$`d$ $ `D @ 2  < $㿘 ` ` `L@`Đ㿐H /f * ' > ##O H 0 #)> # 4 H /f * ' > l 2H p@  $ $ 4 $$ $ $ 2$   0$ ) ܑH /f * ' >  O $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2(  $ '􀦠y>  l dܑH /f * ' #O H 0  4 H /f * '  4H p@  $ $$ 4    +*H /f * ' >  OH $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2(8  \$ $@&@be㿘`@9v`?: expected 1 interrupt, got %d board-versionchannel#burst-sizes pri %d: rev %x address %s 㿘4``H>UY(!0>Ub@t?&a`0  @ 4&aX<  @#`&aT H @ &a\&aL <@&aP>Ub@W??&ad&ad>Ub @N??&ah D&ah D>Wah`t &ah&`<`<&`@@.a @a0>[>Zd【 @ ?( #  ! #   #&a4 ! #   #&a4 & ܖ ! & ֖  &&a4 ! & ˖  &&a4  (   (&a4     &a4a4``\҅ >V>X>W?&`H!`<" $$$44$ $js.a`!>U"0sXh8 >Ua@8 `@"&㿘 4 $@ @]# ̀  l3     €  "E$ ̀  l    €  "  (  & & $  ?&  ( " `e `p* @ x8  ,`" X `"a"   $ 4$6 4$㿘!T"" !Tb " !T  !T" `?"# !Tc   ސ !T# `?㿘H /e * & ѐ@H 0%s: device timeout 㿘>W`( Va  `$ 㿘!P  !X``!T!`@}`@2``@` @Ȑ%s:%s qstat=%b unexpectedRXSRXPRXLRXSMALLRXDROPRXTXSTXPTXLTXDTX BE%s: resetting 㿘2      `  `>W  !  >W! >W!(>W!8W? >W!pW;j%s:%s stat=%b RXRCNTACNTCCNTLCNTRFIFOCVCNT TX TFIFO TMAXPKT NCNT ECNTLCCNTECNTDTIME㿘 @ >W"0  >W! >W!(>W"@W  >W W!p6㿐!T H@DH L `X @#`X"@"D"H"L! $!!x*( ' 2! `P #`P !?  &!!x*( ' "`P! "3`2!  &!`4$ ;3`4i  㿘!!x, @ # % @@  !x*  "@!`  !x@ &! 㿘 H /e * &  a2a1;a a H0!5=0 !69 = 4 6 4 ` @H H0; 4@  2 4e 4 ?/6 4  @Z@.0$qM Hr H`4@ !0 Hm $  H 00H 0㿘!T H!X!LH /f4!x* '!x  !x @8 &!|!p   !p @. &!t @ !x* !t + @" !x ("    !t !x*`   + " !x"  "   $!t&!&!&!@u&!@$ؐ!$(!%*  $c!"!#* $c! !!*`@ $c $c @pҸ  $b  $bP $@!|$ !|($ `%!d$ $ $>$  $_d  $ , ,$ ($a$ $ $ $ $b,$ 0b  $b c `$c 4 @ ;44H p@!\    ?#d ?#d#%s: rev %d PAL not supported. %s: no internal or external transceiver found. 㿐!\ؐ!``>Y!P UO0# $   '$   'G   &!l?$'0  ?&!l$'0>Y!pU, %s: invalid tcvr type 㿘!l      >YU"hM1? @ @ݒ @ڒ @ג ` < `@ѐ?< >@ `@ɐ?>@!l @U@S @P *?@@I@G@E@@ @ *?@@ @@㿐!l !\ $   '$   'Ѻ  2  >Y $   '$   'Ѩ  2 "hT 㿐!l !\ $   'ђ  $   `2`'0 >Y $   'р  $   `2`'0"hTq 㿘!l     >Y"hTb 00@. @+ @( @% `. <@ `@?<@ >@ `@?>@@ @  6 > `@?>l `\( \\( \  #d" \#d#%s: invalid packet size %d; dropping 㿘%  H>Z \T" L`$ L!p`*`   2 H L  $ L ( `$ H am㿘 a !"  0 2  & & #&`  `   ?&`%s: bmcr reset failed %s: bmcr unisolate failed 㿘!0 X  0 ,  # И ? m   >[ ; 0b ` ``*  !Tb " b ="b ?*   _ ? 4 $ >[   HSJ 㿐!T H 4!c  @$c 0Sc ?$c  4b?#$c@$cD$cH$cL0F?c$c@$cD$cH$cL 4=" 7777& @4Ȕ  ?;n #       @2?2 $ 22*  * @0 2  ؐ$c@$cD$cH$cL 4 =6 4qe㿘`@3 `?: no interrupt found on parent mace-versionchannel# pri %d: rev %x address %s 㿘 L`H>[R#0m>[c@ ?&aD0  @@ 8&a<<  @: &a8&a0 <@&a4>[c@?&a@ D>] &aH&`<`<&`@@ܐa -``\̏ >\>_&`H!Ȓ`>]?al `"$`$`>a>a$`4`4P<   # #ː $`` $`dm(aD!>[#m Rb8 >[ch@2 `@"&㿘 4 $@ @[d ̀  f/     €  "E$d ̀  f    €  "  (  & & $  ?&  ( " `_ `L*   T8 ' ,`" < `"a" \  $\ 4$6 4$d㿘!8 !<,    ?    $@@`  ِ ? @ 㿘ڐ@%s: device timeout 㿘>] `Pk   & H /e * & ސH 0㿘!4!@ *`2 2!< `#߀@?"  @  " @= 㿐!\ H $!`!T*( ' 2!\  P # P !\?  &!\!T*( ' " P!\ "3 2!`  &!` 4$ ;3 4  㿘!h !T,`@ 2&!h #  @ @ה` !T* `"@a   !T@&!h %s: excessive tx defers. %s: excessive tx retries %s: late tx transmission %s: tx fifo underflow %s: jabber seen %s: babble seen %s: tx descriptor is bad %s: tx late error %s: tx dma parity error %s: tx dma sbus error ack %s: rx fifo overflow %s: rx late collision %s: rx packet dropped %s: rx buffer too small %s: rx late error %s: rx dma parity error %s: rx dma sbus error ack %s: unexpected interrupt error: %08x %s: resetting... 㿘`H@   >]`P" T `$ T@ T  $ T@ >]`Pw" T `$ T @ >]`Pk" T `$ T @@ >]`P_" T `$ T  @>]#PS` @>]#(PK` @  X  Ta!$ X$ T@>]#@P8`  @ >]`P/#` T `$ T @ >]`P##x T `$ T @@ >]`P# T `$ T @ h X  La!$ X$ Ld L !$ Lb L !$ L `>]O# L `$ La >]`O# L  X` $ L$ X``@ L !$ L` L !$ L `>]OӐ# L `$ L` `>^Oɐ  L `$ L ` `>^O  L `$ L ` `>^O 8 L `$ L ` `>^O X L `$ L  >^ xO`>^`O ʐ?㿘 H /e * &  a2a1;a a L0!5A0 !6= A 4 6 4 ` @L H0? 4@  2 4` 4 ?36 4  @U@20(jD Hk H`4 4  @ !l Hf $  H 00H 0㿘!8 H!<!0H /f * ' !T !T @) &!X!T@*!L !L@ @ &!P!L@*@  !T* !P,  @ "   # !P !T*`   , " 4 !T"   $!P!X$`!X($` &!\&!d&!`&!h$`$`$`$`$`0$`4 `0!@$`$`$ `$` `$ \ d  $`,`, "$`(` , ,,,, , ,@ ,    d˔ ? $!  ! ,!!,!",!#,!$,!%,@H,4 `@  {a44 , H 0%s: invalid packet size %d; dropping 㿘%  H>` \NQ!x L`$ L!L`*`   2 H L  $ L ( `$ H [ߒgn㿐!8 H 4" , `  d' ?     ,?0R 4"6 4 7777```- `@/  ;n # ? @    @2?2 $ @22*  * @5 ``ڐ , `  d֐ ? $   @ , $ @ #"`8 @ ` "` "`p   hmeSUNW,hmeSUNW,qfe㿘``@- >a@-  >a@-  '@ : expected 1 interrupt, got %d : expected 5 registers, got %d hm-revburst-sizeslocal-mac-address pri %d: address %s rev %d qfe㿘4``>aMN! 0`>aMF!@08  @̐0&atD  @Ɛ<&axP  @H&a|\  @T&ah  @`&a>a&`Ha`@s? &a &aa  `!&a>aah@`??&a @&a @a @ @&a`0[>e &`<&`@@;`<ad>aax@  !>a}!>a!gaL>g>f xc>g`L"`&`&`>g>g&`8&`h<??? `p   "   "` ``ƴ >b>b>b?!c|D" $`$`$`4`4$`$@` $`^Ԑg]8`@>!@, >aa@, >a`@, &㿘 4 $@ @G# ̀  `_    €  "/$  & & $  ?& "#$ ( Y@ڐ8  ,`" x `"` "   $ 4$6 4$%s: stop failed 㿘!t "@!t    ' !t`   2 x>b"8L  x ?& x㿘H /e * & Ӑ@ސH 0%s: device timeout 㿘>bc0 J  `$ 㿘H /f * '  b   H 00[a2@a1@9a @a@"4F 0!5@;0 !6@7 0;4 44 ` @ =0-@  24h4 ?"44  @]@h0fg^ 4 @  LܖH 0㿘! 2 !! @Ò &!! 2 !p!@! @Ç &!!&!((&!&! @ ! #@  `&!  ! !*  #@ # %s: burst size unknown %s: setting rxreg->cfg failed. 㿘!! !t!x@}!|?#$!`"  ?$@@!h!i*` @  $bP!d !e*`@$c !f !g*$c!h!i*  $c$b,$b$b!%`!(% ! @  $  $ >c"HJԒ $!$ % ,   %  %@@">c"`J $c @&Ǽ b  $$b !`2"$@b  L`$b c $c 452`@ {54㿘!  !?#"`` Ȕ "`! ǒ&!%s: reset tx failed 㿘! $b0ǂ ? b  >d Jr %s: reset rx failed 㿘! $c0f ? c  >d!PJV %s: link status changed 㿘>d JG! 㿐! HLD @ `X @$`X"H"L"D"@! `P { 4`4 $`P !?&!!  , !(@  6`4&!! "4`2 㿐! @L $L@<!, ! '   " !, @ `2 &! %s: stat=%b, resetting. RXRCNTACNTCCNTLCNTRFIFOCVCNTSTST TX TFIFO MAXPKT NCNT ECNTLCCNTFCNTDTIMERXHOSTNORXDRXEEXLATERXPRXTEOPMIFTXHOSTTXALLTXETXLTXPTXTSLV SLVP㿘?? ؐ & ??" >d>d㠐#I  㿘at?a" ߒ >@@@o㿘.`* * !* @  >  '> )> # `2GH /f * ' V* 4ʒ  ""8@ <"`<<8"`8"($@ $0,x4&0 ?6@#ȑH 0K@H /f * ' V* 4  ""8@ <"`<<8"`8"($@x $0,.4&0 ?6@d#ȑH 02n %s: invalid packet size %d; dropping 㿘%  >e H# L`$ L!.` @ R  L $ L  H ( `$ H VBaђ㿐!  4!c  @$c 0]c ?$c  4b?c$c@$cD$cH$cLc ($c 0M?#$c@$cD$cH$cLc h$c  4"A6 4 7777& @*  ;n # ?      @2?2 $ 22*  * @0 2  ؐ$c@$cD$cH$cLc ($c  4 }6 4! ` !  ! 㿘!"" ``!  a2!!  b   &@ %s: mii_write failed 㿘!  #!*? .`c   $` ` @@  ` ?  3>f"Gے 0. $`       >@ `>@ > `> > `>$`%s: mii_read failed 㿘! ! % *`@ .` $` ` @@ ē ` ?  >g G `B ` 1?#=  $` J ?E B ? <  >@ `7?>@ > `/?>$`2 .*? &# 㿘 4  㿘Q L |&` x&` |!b b "b diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘``@'$ "  > # `&`48@ dma: expected 1 interrupt, got %d pri %dinitiator-idclock-frequency espattach: no dma foundintresp㿘>g cp @+ڔ >b &`4`?`>gF#x0 >g# F&c$ 2&c80 @2 &c&c  [ >gc@z &b>gc c@z?&b" &b&bb耢 6`$ 0&bb@ b@ &b&c& <`@~cp &c" <>gFr#>gD#b  ` .`.`.`   `@€ _ "`-&b .``  `.`   ` .``  `@€   `.` @`.``   &bb#@ [b`&b``>m >m @&b &b@&b@ C$&b@&b>m &c` > c`$[c>W>`c$&c c @7&c>gc/`0 "8 6>>gc@&  /> <@   #> `@2> @t7 > >>gc@% > ? > `@2> @t >>ab `&b@t #*` #*`( 㿘# t@㿘# l@㿘# x@㿘# |@㿘# @#D"#Haudioamd|QEB;632*+,%#"""-+2LCBCA;;=43422$1*{*+#+,B.#%$+$#""A"#"3J!2,b2q"4R#z5& *c  # 3   > L!|"3"B2'"R:31,#"bQB;32*,%#"!  C3@DA1U BA` Br!" audio㿘> `>i@$#`? : expected 1 interrupt, got %d pri %d, softpri %d intr㿘!0`>i#D05 >i #D 2  N 0 @0  N.`| .`&`.`~.`.`@ `> (" (>l@Wc@>l"(&`<`<&`@@ΐ >j`-`>"@X !* *  E** *  C*  *  H2   " H" " L" " " " "  㿘@ʐ@& H?    @" mulaw@ >j"`  2`"`"`"`   ~>ib(@P2 (@2& * ((0 >ib(a2$2"(@>ib2"2$  -*-H( i+ , c+ + ! f+   d0+ + ' e+ & j0+ + #+ "0+ + %+ $0+ + -+ H  `L @ ` !* *  #`L@ #`#`#`#` `L @ ` !* *  #`L@ #`#`#`#`   !*@ *`" L   !*@ *`" L 㿘>bd 0 @``& `" @>k( ` *~ ` * ` *`    `  ` * \hht@`` ` @>kx( ~ *`  *` *` "` "` 8DDP\d micvolumespeakerheadphonesmonitorsourceoutputinputsoutputsrecord  >l( # ? # $# # >k # 8# < # ? # # $# >k( # ? # # $# >k # >k# b3  # <+ b# (3 , + . # ? # # # $>k#  # # <>k# (3 ,m+ . # ? # $# # >k>k# 3 # (+ b# @X# , # ? # $# # >kД # >k3 >k+ # (⨆# ,# @# 0""# D # H 3 L # X4+ N # ?# # # $>k؄ ?# # # # $>k # ?# # # $>k# 3 +  ?# # # # $>k# #   LxH,T|㿘  H /d * %   @(  H 0  @ H /d * %     H 0  @ 0H 0 />%/> 㜬%/> (( %   ,%+>``+?P `-`0+-?P%  ,% +>``+?P `-`0+-?P%/>@̀audiocsSUNW,CS4231㿘``@! >m@!Đ `   : expected 1 interrupt, got %d : expected 1 register set, got %d burst-sizes pri %d, softpri %d intr㿘4`>mAr 0? >m Ai068  @0&`H>m&`d`@u??&`h @&`h @`0`h &`h>m"`&`<&`@@`<>m AC!>m`L*ka >#  .`.`.`.`%s: error interrupt 㿘 H@  @ $ >m"HA   @ " " @ $    , ` , ,  ,, ,  $ @    `  &   8    & $ 8$ < |` @   `  H *  * *   *  * * * %s: can't find speed 㿘>@#̚#̀ ? `p8  `@@    "@ " ? `  &@#>m#@  #̗*  & &  &@ %s: waited too long to reset iar %s: waited too long to reset errinit 㿘 Ho d ,@ @W` #?e d @  ??  >n!@R  ,@ `W`  #?L d `  ?? >n!(@: 㿘 l ; H & l& p& t& x& |& $`-  $`)` ` $`#` $` @ @,@ L,@ @,`,@ ,@ ` I ,`,@ `,@ `,`,@@  H *@ ` *`*@ `@*` "J  0 J" *@ `J  *@0 *@ `*` *@ ` *` `0?*`*@ `*` `0?*`㿘 H@@v ,  , & lmulawalawslinear_leulinearslinear_beslinearulinear_leulinear_beadpcm e >o(>o"R >o"  K*>o >o"  =">o " "2  "*"2">o "  """%">o >oД " "2   "*"">o"  2"""  0ThX㿘 ` ` `"" >!  >"   >"  `>p ,*` €     "        ? 8   2 &' $  $ $$| %s: timeout committing fspb %s: timeout committing cdf 㿐 a HH /d * %    *  @ ` H,,  a/ /  "  \>p X>j H p@0*,,  a/ /  ">pn H 0 &  x>@ H p@ H?`"` *@ ` *@*`"pH?ۄ"` *@ ` *`"p㿘>c 0 㿘@`ݘ >q"L*` €`2԰ `   H *(` 2ɰ  H*@`  H * H*@` ` 2 `   H *` 2  H *`   H `*  H*`  H *` `  `   ` 2 `   H *`   H `*  2  H *`   H `*  H *`  H *`q ` 2m ` 2i  H *`   H*`* _ ` 2[ `  ` . ` 2Q ` . ` . G`? (` D =. ` 2= ` @ 6. ` 23 ` @ ,. ` 2) ` @ ". ` 2 ` @ . ` 2 ` @ . ` 2  ` @ . ?  PĈHpŘ@@ Invalid kind! 㿘@`ؠ >r"*` €``` ` H * H ` 9.`  H* H ` .`  H*@ H  *.` ` `   H * H ` .`   H*@ H   .`  H*@ H   .` ` `  ` `   H *@ H  {.` y  H*@ H   .`  H*@ H  j.` ` f` b  H*@ H 2 Z.` ` V`   .` M .`  .` ` DN ` >N ` 8N ` 2 N ` ,N ` &N  @  &`` `  .` .` ` &``    &`>qt( #  ? # $# # >rX # @# < #  ? # $# # >rh # 2# < #  ? # # $# >rpp#  !+  #  ? # # $# >rxx3  +  #  ? # # $# >r#  # # <>r``# (3 ,+ . #  ? # # # $>r # H  ?# # $# #   ?# # # # $              ?# # # $# >r#  + # (>r3 ,>r+ .# @⠄ # X# D #  ? # # # $>r # 3 >r+ # <"`"`# ( 3 , + . #   ?# $# # >r # >r3 # (+ x>r3 ,x# @+ .bX>r# D# X"h # \# p>rpp# t# a+ x # ? # # $# >r # >r3 # (+ ⸒ # ,>r# @# 0p # Dp>r# X+ H # \# `3 d # p3+ f # ?# # # $>r"Є ?# # # # $>r ؄ ?# # # # $>r# #  # ?# # # $>r# 3 +   D| ˼`̸̘|ΐHpϘ㿘   @Ж $ ` $ $$`ߒ %s: attempt to free rogue pointer 㿘   2 @ @Ԕ $@0 @ 2 >t :k   cs4231_trigger_output: already running cs4231_trigger_output: bad addr: %x 㿘 p  H>t:H!x=   & p& |&  2& >t:4!) & & Ā@& &  "8"<  ?# @"D " * * ** * * *  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKbwtwo㿘> `V` 25 ``@ 2. ` &``2 %  ?  2  2 @Us  E"`4 @" `4  ?倢  `@ &` bwtwo/p4model: %s, %d x %d (console) cgfourcgeightunknown%s: %s overlay plane 㿘>`< t $`$`$$`(` @     $`,0  @ $`0 &`0 @ &`$`0 &`   64>t />:02/>60> `+`,@@  `0>u2  E``2   E @ E"  &a&`&`&a>t #X#X  />>u`p@mk0 &`4$&`8#&`&`$`@S ` `>u` ` x$`9$``>`,b * J  >!̀ @ ?  > 5#  >!̀ @   $` `@i $`@  ">u>u8Ӑ `,@@a  `@S`8Đ ``0`,@@a   >u >u >u >u 8` > 5# `,@@ a @R` 0@R]>`? 0    `(    㿘?2 > `. "@@"@ 0 "@ 0@&D&H&L& P&T &@D &@Z   㿘@Q bwtwommap㿘> ?# >2   `;`.  >v6"?T> @ * @ @ 㿘> `2  2  h@@"1@S̐ <@6  6  㿘> `` ` h@@ <@S0`Њ@@ Ъ@@0 Њ@@ ?Ъ@@0  ` ` ` *`diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKcgtwo㿘` &`` ``@  > `V` e4> # 0@~?@> 8@ cgtwoattach: impossible bustype: %s, %d x %d (console) 㿘>  ` &`T&`4&`X&`\` >w H>w5  &`@`0 #$@QØ !&`D> c A"* &`H>w`<`87H!>`  >" ">J   >!̀ @ 0 &`4&`8&`&`&` ` &`L``ܒ @} &`L0  $ @}&`  @@}#` &`>w7! @R9> 5>w7!0> 5#  @PȒ>? 0    (    㿘?2 > . "@+@ "@F"@ 0O "@ "8 " "@: 0B@( 0>4&8&<&@& D&H1&4?&&4&8& <&@&D&H& &4&(&$4&L&H @@h `  &  `  *   (㼘@` ( B , @  @+  ` b@  @+  ` d@  @+  `` ` z  `r  㼘@`aC `W 2< ` @N 23`F " ), @ 2@ ` " @ 2@ ` $@ 2@ ` cgtwommap㿘> ?# >2   ࠑ;`.  >x4G#?H> `ܑ*  ܐ diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKcgthreecgRDI㿘` `&``@  >y@ ؀ "   > #  & 48@  model: %s, %d x %d setting video ctrl (console) 㿘> ` &``&`d` &`h&`@     6>y    &`L  &`L> ` >y>yap@it   Ц  >yap@ih &`L`< $#@O>y @: 2`D &``D `\> c! * &`P>y`H!x4&`T> 5c >!̀ @  0  &`X  @{r &`X @{l `a )&` ` 2&0> !  >y  p 4Ȑ!> !   @*    , 0`  0&`4 &`8&``&`$* " @  $ s$  $ $   >y>y4!@O`4!``0㈀@NK>? 0    (    㿘?2 > . "@+@ "@O"@ 0S "@ "9" "@B 0F@( 0B @& D& H& L&  P& T5& @?&& @& D&  H& L& P& T& & @&(&$ @&L&H!@ !!@ ! @&  @&@   㿘@ ` @( 2  @ :`:(* * # #  cgthreemmap㿘> ?# >2   ;`.  >z29##? #?  T >?` @* @ @ diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKcgfour㿘``@ 2 `>` &` 2   ?"  @O  @"` @ &` %s: ignoring; not a pfour : cgfour/p4, %d x %d 㿘>`0!T $`$$`($``  $`, >{@@0>{!3`0P   @y$`0$`$# @M| !$`` >{`$`3"> ` >" ">J   >!̀ @  ? @y|&`0 &`4&`8&`&`"2 *`"""?">{2Ґ"0@L>@? 0    @(    㿘?2 > @. "@+@ "@O"@ 0S "@ "9" "@B 0F@( 0B 4& 8& <& @&  D& H5& 4?&& 4& 8&  <& @& D& H& & 4&(&$ 4&L&H @ Ӕ! @ ! @w  @h&@h  cgfourmap㿘> ?# 2>   @;`.   @ >|0!耤 (#@?@ <)>8@ @@#@ #@ H@ ?ܲ@)>  .@ @ 㿘@  㿘@M 0㿘 0@M@ :`:(*  *`* # # (# (# (# diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKcgsix㿘``@ * ` &`>!  ` _,> # 0@x?@5 ?"  @M0 ` `@ &` cgsix/p4modelcgsix on mainbus? : %s, %d x %d, rev %d (console) 㿘>`<! $`($`$$`` 0 $`,0 &`4 &`8 &`@w&`&`   @wǐ&`  *@w&a @w &a  `* >~!*` €`,@@  >}!8>} h> `2 >} h   >}aH@eK>}1!P0| $`$`0$#@Kb ` r`!$`>}` `!h0$`>`  `,@> b  `>J`  >!̀ @  ? 8 `> 5#  >!̀ @ `>}@!x:  06a@$ 2 *b$a h$"h">}>}0!>a  0 @w( &`X@KƐ`<0!`0  > 5# `<@JQ>? 0    (   㿘?2  >a. @: 㿐?2 > . @ b@""@"0 @ b@^b@ 0"@-b@"V   @";"$ b@@8  "@0 "@S  & D& H& L&  P& T& @?&& @& D&  H& L& P& T& & @&(&$ @&L&H@ a!ʰ"$@ ! 2İ@ V! & "V! @8 2  6! !> 8 0` " 6! 6!6!6!6!6 !6 !$6"V! * ! 2(! 2   "@   w0v &r& V   "'" '@ 1  2e  8^ "* 2 ` : V $] (]  G    6!  6!6!6! 6!@T &"@&" `&! 6!"6!V"!@ *(=$9!@L !6! 66!@*6!  66 ?? "" " R 4 @ @"@" " R R?R#RR (??#(R!?28!!!  @ # @#@ `@ :`:(*  *`* $# # (# (# (#  @"@""` *"` *"` "@*"` " *"` "` R! !2!  cgsixmmap㿘> ?# 2>   ထ;`.  >-  >!` ">  * `  T ` @ * @   @  *?diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKcgeight㿘``@\ 2 `>` &` 2  Ւ ?"  @I  E"` @ &` %s: ignoring; not a pfour : cgeight/p4, %d x %d 㿘>`0"< $`$$`$`(`  $`, >@@0>"-`0Q   @ts $`0$` $@HJ#!&`D&`H` >`-Ր"> ` >" ">J  >!̀ @  ?@tJ &`0`&`4`0&`8 &`&`"*#  " s" " ">-"@Gh>(? 0    ((    㿘?2 > (. "@+@ "@O"@ 0S "@ "9" "@B 0F@( 0B 4& 8& <& @&  D& H5& 4?&& 4& 8&  <& @& D& H& & 4&(&$ 4&L&H @! @ϔ! @  @&@  cgeightmap㿘> #?  2>   (;`.   @ >+" X#@?@ <5>8j*  @ c* @@ >@#@1@#@ )@H@"@#@  @ ?@ @*`   @  !@$@  ܒ@5> ?  .`@ @ 㿘@  㿘@H[ 0㿘 0@HZ@ :`:(* * # #  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKtcxSUNW,tcx㿘>@ la؀   ` &`` `?tcx: oopsTCX on bus 0x%x? tcx-24-bittcx-8-bit: %s, %d x %d, id %d, rev %d, sense %d (console) 㿘>`<"|$ $$ (`   $ $ , >*"( 0?"4"8"  a@ aX""p&a@&aX  @rw &a  @rp*&a  >>+א"80\>bP@` 2 >b`@` $ $#@F/  > $  ! >>$ a+"p> 5c@ >!̀ @ a>"2`22 + @ϐ$ 2  "*aah$"h">>+" +"  `0ݒ#@`<@EG>h? 0    h(   㿘?2  >bh. @ 㿘?2 > h. "@+@ "@Q"@ 0l "@ ";" "@C 0_@* 0[ @& D& H& L&  P& TN& @?&& @ & D&  H& L& P& T& & @&(&$ @&P&H4&L!@q!/!@! )@0# T!& "T!@D  ! 4! ;"!@ "!h "h  !"@`"`@ :`:(*!  *`* # # (# (# (# R2h("h@(("( tcxmmap㿘> ?# >2h   ;`.   >) *>" %>   *   " T@ * @*`@` `*   `  *?diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKcgfourteen㿘`` &``@ M   > `   warning: can't find all cgfourteen registers... cgfourteen with only one register set; can't find framebuffer: cgthree emulated at %dx%dx8bpp (console) 㿘>` #d&`T&`X` &`\&`4 &`@`0$#@DB `PR`8> c! * &`D&`H8?#@48>)Ð"@&88  @pH0 <    "0&k&k &k&k&k&k&k &k 4<>((">&`@#(&`D#> 5`<&`)`8 @ k`  @ "@ `c >!̀ @ ">>){#Pc)w#`c`0@C=㿘>?cP2  cP`.  ` H >x `"xH 0   @  㿘?2 > P. @H >x? "x"x H 0 `@  㿐?2 > P. @ b@""@"0 4 b@^b@ 0"@-b@"W  @";  b@@8  "@v0 "@A  & 8& <& @&  D& H& && 4?& 8&  <& @& D& H& & 4&(&$ 4&L&H@b! @! 2@ @M&@. 6$6$6$6$6$6 $6 $$6"V$ * %xʔ 2(Ð$ 2   %@#  {0z &v& V   %'%'@C  2i  8b "* 2 ` : Z $V (V  K    6$ 6$6$6$ 6$@P &%@q&%`*$ 6$"6$V" @ų*%x@ ( $ @@ $6$ 66$@"6$  66 㿘@ cgfourteenmmap㿘> ?# 2>   P;`.   @ >&\#P #@? @ #@?@   H? @ & : @ >?  ` ܑ*   ܐ *  * @ @ + `` A(+* +& A*+ + *a++@ # @ *  ` +  A  @   *+2  㿘@ @( ( U  U  U ,`  @` * ` * ` *  ` 㿘@ @( ) U  U  Uz ,`  @  .` .`  .@.` ` *`+` "@ `R$耠+` *a$$+ 2a$$+ 0R$򀠠?38+%x$  @ " @#@ `%+ %+ diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘@ @( ) T  T  T ,`  @@ * ` * ` *  ` 㿘@ @( ) T  T  T ,`  @  .@ .`  .` ` diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKpnozzp9100㿘>@/"Ѐ`?cmsize: rev %x, %d x %d, depth %d (console) 㿘>` #&``&`d`  &`h&`@H0&`L &`P &`8@li &`D <@lc &`> 5c@ >!̀ @ ,  &`X" ``X 2 `PH @lG &`X` &c <  ``"   ``"    &`L`<`L"X# @@ z`0>!c@Y&`P`\`D&`T>`H `D#`L% `*`*``P.` ` *`*`*@`P ` @ϔ!@ "!>>%j#(`T  `XJ`*"*`T &`X @ @@}%L#8㈀@@?>? 0    (    㿘?2 > . "@+@ "@O"@ 0S "@ "9" "@B 0F@( 0B @& D& H& L&  P& T5& @?&& @& D&  H& L& P& T& & @&(&$ @&L&H J! y! @+  @"&@   㿘@ 㿘 `a&#a8" ߔ  "a8@ 82  `*`ᄐ #cᄅ*#c *`#c  "@` !#c!#c"#c @(""`p9100mmap㿘> ?# 2>   㘑;`.  >"!? #@?>Ȇ  쀢  *  ?㿘!D > "co 0>#`   8  ?! D@ א>!2 23f#!0㿘 #%! D@" ! D@?2!㿘?# %#! D @"! D@?2!㿘!H `  `1  " >  >' >#  `2 -! " -  `2 -!    - `2  ! "  !>! 2  %D # %"`㿘> `!!``D `l@ !?!D "` ! p@! D@ @" "w㿘> `! !L  `` ``0 Z0A0>%s: lost carrier on UTP port, switching to AUI portAUI port, switching to UTP port %s: lost carrier 㿘> `2>! -> #!!!D@ ">>#!!H``2>>#!>#"!H``>>"" >""80>"@" 㿘``@ " "` 8x@ sbuslebufferledma: expected 1 interrupt, got %d pri %dbusmaster-regvalif_le: Lance buffer crosses 16MB boundary㿘 >c @Ȑ> c`? @>`?c@ 4`? ">#"0>"#&a@&a0  @i &a  7>ȬaaDa7>ȬaaDa 4 c`@  2 `P 2   H&ahL>&ap&al$Pc@V %6ad    ah   ah @{?* @ @* > Ɛ &al&ap6ad&a& @&a '8>#&aaw wa &>"@F   <@    ` >"@. ` @$ R> `>>`>>⤔"p>>aHT&a(&a,>&a0&a8>>ଔ#p`X&a &a$&a<&a4&a&a]   # ] ^' #0# a   #]  % ]   ] ^  0  % ]ؖ ^ %N>` &aa ">!&a@a&adiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKUnknown3e/vmeonboardmultibus/vmeie㿘``@ 2 4 6  2    ? 0 ?  㿘 H 4(@N d4(@ Hh@?Ȅ2h@h@(2h@ Hh@2h@㿘 H d,3 , H ( ( H(ie_mapie kmem_allocunaligned dvmamalloc breaksie pmap_extractunknown : RAM CONFIG FAILED! pri %d address %s, type %s 㿐`L􀠠"r>>>>>>("8b`>!@&a4&a8&a<&a@  &aH&aD&`D0@ga `D> c&`H!?Y\ > 6" `>K" `DT &`@>A"#> c`D  @@2 c`@  @ "`D>0"&`<aD`@> !H&a\ &aX 2 >"> 8   @ ?&aTca$`@ &a`c`D" K&ad>>>!̒a4>0!@&a4&a8&a<&a@  &aD&`D&aH(H@f&`Hh@?4  @ * " `D@f &`<&`@hD?! 4hDa$* 4@ * 4gaD`@€`D`@`D$|# &aT&a\&a`&ad&aX 6"0UPʐ@H `> +"0J$ >#d>>?`"$$$44$2I:Ґ!>#:aH>c*@    > (&`0&`4@`A`08 4 8> (&`0&`4M`08  >a@@ ` @"$ %s: device timeout 㿘>c   `@Y$ %s: parity error (ctrl 0x%x @ 0x%02x%04x) %s: receiver not ready 㿘!\!H` ` H(@""!\(D>(D (F# (Da4(D!\ ` @ @i `P``@``@` >   `@& !\ `` ` 㿘"8!\ X@k`!h,` @ ; >`?& -# $ 2` ( @ 2 +    2 +` *`*2(2`2* 2 @ @* 2@  & 4  4  4  4 #@ @ B&" *!h*2 3 !j  B #@+`3 +` 4 @ietint: command still busy! %s: send aborted %s: no carrier %s: lost CTS %s: DMA underrun %s: too many collisions 㿘# bl {bH6 6 ~*    >ِ"Ȁ  4   @& +& > "而 >  # > #  > #  `&  > #8  ` & & !L  "l "X* @$&!Ll d` 2`@ ?"@& `& & @ L%s: receive descriptors out of sync at %d 㾀!h.`!''2"<"8 2?*`  2`X @S &`@N &@J   #& 䀢 !> " "h$"    t'''+֒ $" L7i㿘 ?"D`\"@&+>*@`@a Ô @0  `2 * @2@@ &*`@  2@  &%s: tbuf overflow 㿐 4`@%d 8Pd6 4` lt`XP*  2*` *@ +52* <# 2H*` 2 $* < "@ 'X  h I   $$$ ?$耤 = *  e    @  *  2  %(  >#Ptg,2  @*+ *` 3  2`2`@ ?"@$$%d`h` dlt`XP*  2*` *@ *2* <# 2H*` 2 $* < "@ ' +  ( ( +  3`+  3`+  3@( B#+ + 3`@ 0+  B#@+`3 +`\ 0@  $4~㿐H /e * & !T !D€!X !D€!\ !D€, <$@' ,  * *,@ B`$ , 2 , 4` < @"@ ' `,` `* `*!4@!8€ d @ !\  @l `H p@  H 0 %s: reset %s: abort commands timed out %s: disable commands timed out 㿘H /e * &  >f   L ;6 '  @` @& > Q ` @ >!E `6 @ H p@ "x!\`' 4 !!8@>b4>aP @N*  Ȑ0@   %s: TDR command failed %s: transceiver problem %s: TDR detected an open %d clocks away %s: TDR detected a short %d clocks away %s: TDR returned unknown status 0x%x 㿘<%6`6`6@ B&@ *!\*2`@ 26`  23@@ 2`3@!\  ~ ``$@@>#`@># 0` ?>@ #8`>@ #h 0># ie: bogus buffer calc㿐!`# !d!D€`X!d 3@#< &> !,!,&*@ `\"H&  !h&, "     X 6  , "    ?  X 6 ,  @0*   B" *2 * 4` ,   X*`@ P  2 , "      \ 6  , "    ?  \ 6 ,  @*   B" *2 * 4` ,   \*` X  2 , "     \bd & blbh& b` & &  (  2` < $' `* `* `*    B \!j X" !\b<&bD?&*b8&*b@2&  3 B&"@ *`2 *`!h 2%s: multicast address setup command failed 㿘6@#6`<#! 6` T*` !@"p`** ** 2`@ 6` B &@ **2!\ 3  >@ 2 > C! %s: configure command failed %s: individual address setup command failed 㿘!`< B#$ *`!\*`2  4`4"4 4 !P ,  ,  @,  ., ,  `, ,  , @ , , ,  ,  ϖ > 2 B> "0J!$ *`*`2  4`44 4 !@!$    > > Ր"00*!\   `J B!j " * @*!\2 6 3`  !\ ` !<`@ 㿘  r 㿘 H /e * &  a@" 4a @"  4C a2@>a1@ ; (!1 6 4 ` L L0,@ #$!P 4 @ @2 4 4 ?6 4  @00@4[ L5- L`4@   H 0㿘!,  T&   +"p  4   @Ӕ  "   "6 a L~  *@ *`@    &  2 &!L㿐b@'    \ *@@@>+ @  2*` @ݰ   8?a `?"@`(* @ @ P"" t#!"0tt"tt@ &`є  $@$ @  @  @   @  @  @  x "& & $@$ @  @  @   @      " x 2 &q  T  6q 8"p   @  @  @  @   @  @   "  2A&E ה?   x "& &`2  $@$ @  @  @   @  @    x   &   @ &  ??6$?H /f * ' > ##  &@H 0@`(+> # 2`H /f * ' > l 2H p@ @ "@@" @$"@2`@" @"` @  q?b ?j0L&` &` &`>  l' 9ܑH /f * ' c 6 H 0` 6`H /f * '  4H p@ `&`&@&`6`` &` (.` H /f * ' >    &`$H 0`$ (` &`6`&`0&`(&`,&`<&`8` (8&`  2 &` > #, @ 8&` ` &`&` ` $@&@ U  ( `\ D,`  2 *` ` !"" `@@@@& / @`@@& `@@@@& `2@ `2@$*` ?c 2@ $ diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKxdcxdxddummystrat㿘 <""> > b"r H 0"& 0 0 & 0%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) 㿘`> """"(`?*   *  `>`a@) >!X:`+ `6"@`4`>*!``>`F!`6 *24``  64` F4` 3,` / ,`4`Ґ"$ (㿘``@. 2# 2   ` ?  .` ` Ѐ` "@ ? $  `     pri %dxdc malloc: couldn't read controller params : %s: : doesn't identify as a 753/7053 : Xylogics 753/7053, PROM=0x%x.%02x.%02x %s: controller config error: %s intrx  0@\3 & &`T>!ܕ*` &`h>#&`l `d"??`t  @#&`x&`t@7#`t &`x&L ޔ  &`p>#@'&L`` =  `t+ `p "@ ( `t  `4 *`t @ *``t`o * $`t .a.&`.a/.a0.a3.a2.a1&`&` 0#\#`    @ `2`t>B#0Г,` S,,`* `p* @` " >!>@#Ȓ+>(#a1 ` .a1a1a.`.a. `, `p" a.`sa.0> #  a1 ` .a1ca1a.,`.a. , * `p* @"`a. 2#`Pa.#`#\    @ `2a1 ? `.a1:a1,`@*``p@*`a.  .a. , `p " a.`$a. !> (`@0F>"4&`0&`4`0A>`<ג`P  "@֖ 8 0 ?耦'?2 '`@2' @B 'a4 M ``'@ے" @B >a>!P*@ `    xdattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: write format parameters failed: %s %s: read drive parameters failed: %s %s: write drive parameters failed: %s %s: reading disk label failed: %s %s: <%s>, pcyl %d, hw_spt %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: write real drive parameters failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! 㿐`0@ > x`&`&`X  6`6`&` X&` * "`2%`ȑH /d4`Ɛ* %`ƀ  !>`ƒ ! #  `ƀ ``>!``Ȑ 6`#\#`   @X   ! !1? `.!1!1, @*` p@*`!. .!. +  p " !.``B!.`B`>x!6`!>!>m!`Ȑ#\#`   @  2!1  ? `.!1!1, @*` p@*`!. .!. +  p " !.``!.`!>!`Ȑ#\#`   @  ,  t  2!1  ? `.!1!1, @*` p@*`!. .!. +  p " !.``h!.`!>z" 6`6`6`.`.`Ր<#6`Ζ``  }2 2 ? `Ȑ#\#`   @  2!1  ? `.!1:!1, @*` p@*`!. .!. +  p " !.``#!.`!>5"8`Ȓ #` #\ @f  2!1  ? `.!1!1, @*` p@*`!. .!. +  p " !.``!.` !>"``@ S6`Ɛ`0.`%  `>`И n"```Ԓ &`̒"`>`Օ: #\Z"`Ȑ#\#`   @  2!1  ? `.!1!1, @*` p@*`!. .!. +  p " !.``펐!.`!>F"`ή ``Ԡ`ՠ?`Ȓ #\#` @  2!1  ? `.!1`!1, @*` p@*`!. .!. +  p " !.``I!.` !>#@ ޒO6`?#   2 " `̀@ ~`ԑ2  `Հ  ~  } ~>#0H 00)`"  @@   > @’ ` @"$ @"6`  `ƑH 0? 0 > d2 * " ` `` ( ("` ( ("`` `"`%s%c: crash dump not supported (yet) 㿘?2  >d 6   d* >!`>a 㿘? 2  @>d 2@  d,`@  e`f@"N  m@"We e@3 0  h@3 0  n@"`g@O 00 e@t 0}| H /d4 * %  "H 0e  !_  & *`` &!  @6 M ƀ I G4 E  "  Đ 4 ?# @4 Ā2 3  @ , ƀ ,` 4 ?`4# @ `*  *  > c @9$   @ $  !2d @ɔ㿀?2  >d 6  6M d*@"G ƀ  Ȣ'  @" ?'p@"ƀ  )  `6! . @ ` "   *@$ *@$  $㿘>>o#! Ϗ㿘>>o#! σ 㿘?2  @> d 2 60? d*@    *@2   r " ?,` `?( a2` 2  Z ?㿀 D? @2 > `@ d2`  d*@   T &   (@ <  u& 4ƀ  Ȣ'  @א" ?'@"ƀ  "  < D  " < O& 4 O @G $H ` > ` .` 0t.` 0r 02 .`  k.`  `Ր?.``.` .`  `А?6`   `Ԑ?.` 0Y 02 .`  k.` .` .`  .`  .` "6` .` .`0B` .`  ``0   k` `  .` &6`   2 6` .` ` .`  (@.`  @ @.`  @ Դ6`  (@`  &` $@`*   = .`xdnfreexdsubwaitxdcmd nfree㿘` \ 02r !. = @  2g !. 1 `!.  ` 2!1!>!. ! 玘 2Q !. !.!1 (!.!>!1 ! | 2? !1 !1!.  `א ` ` > !.!. ` J , *  p* @@. X     #`#` #`$#`(#`#` #`#`,#`#`#`#`0@xdc_startbuf freexdc_startbuf bp%s: warning: out of DVMA space 㿘!. 2?> A#.!. J@  ,`*  p* @@ 2$> +#؀("(& (?"D X 2`  2 * D T`*    H @< 2#<>  z#!.,`.!. , *  p* @"`!.  |Ȑ!. |&$($&(( "@%"(&:   $ $ $$ $ $ ($ $ $ $ $ $ ,$ 00@   &`0@  xdc_submit_iorq addingxdc_submit_iorq wrap upxdc_submit_iorq㿘.` T*  p * `)P2!3[ !* !3 @  !0.!3`  .!005>0?>0 p  `@;  |"0 * T2 *` T2 * T2 *` T =*  T * !/  .!/0>0P> ?  `@  @  E"H㿘!0 @ T B B  a ?  B   `  ? @Ҙ ? ``?  @Ø 2!0- @ʐ!/ 8!0" @{ !0 !/ .`*  p* @`!. "    "!.%s: off-line: %s xdc_resetx t G  t@  t @@  *@ t =  `ː ` * x T*  T2`* T2`*  T2`* T*  T*`   T' ? $  t T `  t @ "% T `!>!@ܢ   T *`  T ` "@ ?  T ` 4 t> y! *`  t %s: soft reset %s: diag: xdc_reset miscount (%d should be %d)! %s: diag: lots of done jobs (%d) RESET DONE 㿘!.` >#h   T *`  T ` "@ ` T `` ? V   p` ``0` `2j !/?.!/"V!2&` t/   + 2`*`  +  p  `` 8`0`"`0G "2!1C  "`4`00("0`$`0*` " @`0`,<@qH p@`0`@ 0<W"@ `0!. `.!. `*  p" !.`2 樐!. 椐!1 .!1` `@ &` ?  .!2!*@ !0 .!0   4@+ `2 !0!. "!0恐!.!0!/!. !1  ` >#x    > >#  > #؁xdc_start㿘`)!0 % T ` #>!2!J@ @ !0.!2.!0 P " hc !0  T `"!2%s: fatal error 0x%02x: %s %s: soft reset failed! xdc_remove_iorq: controller DEAD㿘 T ` @ ` !> #@}  ?ݘ ># > $# `  *`     p  Đ @-  t @ !/?.!/ 2  ` `$ $  @ "   "    @  N2M  H  $  (`"$ $ ($ <$ $,`$ $  @ ,@ @ @*` `  ,@ &$ 4`  @l 4`   @g  @* ,`  ` a >"@,`  (@$`!2 ?  `.!2!*@!0.!0 J   ` "6 ?`0`> 6 ?:   0`0 ($`4$`0 $*` $`@$`@ ,`H@`<`< `@ 0" !. `.!. `*  p" !.`?!.  @$ !1`4.!1  @$ !1`.!1 4 5`4 %s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries] 㿘 > `#`     0  D> `  `a@  @  @>  `> > `  ` `  u@@ pc !> @7 ( g >  2>>  ] H> Z h㿘` ``?` ?`@&`!1 .!1`?}&`!1?.!1? X` V `$ + ` `("  @ &`$&` &`(``   @Z զ@U@ Ԡ@@?- ` &`  `.2 *  `@.2  .6```̐ ?6 ` Ԡ" @'. `@ . !2 0?. `  `` 7 `&`@2( ``4$ `&` .2`*`  .2  .&`!2 ? .!2 !* !0`.!0  %s: diag: IOPB miscount (got w/f/r/d %d/%d/%d/%d, wanted %d) FREE: %d WAIT: MARK: running %d: mode %d done %d errs %d errno 0x%x ttl %d buf %p %s: watchdog timeout 0  H /d4 * % !0!/!!. h!1 d H 0@ Zؒ #\> P P@ >I `!47>Ȣ?)>  > - ?>5 `)>  @- @- @! ? >! h  %>  2  t,  @@ @2 p   3 #\0#`  `40 !47>># H /d * %    p `  @" ?` ?"`  p@ ` " ?4` > ѐ  ?  H 0P*B@ 㿈 ` {'> p*` €     Q Ұ  Α* R  ǰ     `ְ 6?`!?>#*` € ` @ `Հ   * @ %6   @g `Հ 2   0  @X `Հ y  2s   @f ``  g @~0X `H /d * % `Ȑ #`#\`,`0 *  p* @ `. p . !1? `,!1R!1 !. `,!. `*  p"  !.`2C!.   H 0 @&4H  Software fatal errorSuccessful completionIllegal cylinder addressIllegal head addressIllgal sector addressCount zeroUnimplemented commandIllegal field length 1Illegal field length 2Illegal field length 3Illegal field length 4Illegal field length 5Illegal field length 6Illegal field length 7Illegal scatter/gather lengthNot enough sectors per trackNext IOPB address alignment errorScatter/gather address alignment errorScatter/gather with auto-ECCSoft ECC correctedECC ignoredAuto-seek retry recoveredSoft retry recoveredHard data ECCHeader not foundDrive not readyOperation timeoutVMEDMA timeoutDisk sequencer errorHeader ECC errorRead verifyFatail VMEDMA errorVMEbus errorDrive faultedHeader error/cylinerHeader error/headDrive not on-cylinderSeek errorIllegal sector sizeSoft ECCWrite-protect errorIRAM self test failureMaintenance test 3 failure (DSKCEL RAM)Maintenance test 4 failure (header shift reg)Maintenance test 5 failure (VMEDMA regs)Maintenance test 6 failure (REGCEL chip)Maintenance test 7 failure (buffer parity)Maintenance test 8 failure (disk FIFO)IOPB checksum miscompareIOPB DMA fatalIOPB address alignment errorFirmware errorIllegal maintenance mode test numberACFAIL assertedUnknown error >* > > > > >!>!>!(>!@>!X>!p>!>!>!>|!>y!>v">s"(>p"P>m"x>j">g">d">a">^">[#>X# >U#0>R#H>O#X>L#p>I#>F#>C#>@#>=#>:#>7 >4 >1 (>. @>+ P>( h>% >" > >!>!8>!h>!>!> !> !>!>">"(dp| $0<HT`lx ,8DP\htX㿘\ `& & 0& & & & & $& (& & & & ,diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKxycxyxydummystrat㿘 <""> >Ӑ!b"}D H 0"& 0 0 & 0%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) 㿘`> """"(`?*   *  `>`a@} >" `+ `6"@`4`>"`>`F"@`6 *24``  64` F4` 3,` / c,`4`֐"$ (㿘``@ 2 2   | ? А@b@ @   pri %d%s: can't alloc IOPB mem in 64K xyc malloc: %s: : doesn't identify as a 450/451 : Xylogics 450/451 [OLS disabled] %s: error: %s %s: 24 bit addressing turned off please set hardware jumpers JM1-JM2=in, JM3-JM4=out to enable 24 bit mode and this driver intrp  0@H & &`T>!ܕ*` &``> ^&`d&` `\"??  H@z #?ܒ H @  'ؒ  @zt H H@zؐ H  @> 4`0@ݒ H&`p&`l    &`h> 8@͒ `   +  `l `h@ " `l`4  * `l @  *@ `l  * `l@ ` *``l  @*`l@ `  *`ڑ+ `h&`|`l`h 0&`t&`x 0 #\#`   @Q `x `2  `t " 7`t !> H@ kː>Ȑ P0m>Đ x``">> > " `T!> `@ O0S ` >>` > >!0D"&`0&`4`0.>`<꿒a@ " @y 8''쀦'?2 '`@2' @/ '` 6 ``'@yĒ" @/А >cȐϔ>!P*ݒ@ `    xyattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: reading disk label failed: %s (drive type %d) %s: <%s>, pcyl %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: %s and %s must be the same size! xy drive size mismatch%s: write drive size failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! 㿐`0@܌ > ؒ`&`&`X  a&a6`6`&`&a&a* *  h * @&` X&` * "`$ H /d4`Ɛ* %`ƀ  !>`ƒ !ؖ   :`ƀ ``>!``Ƞ 6`#\#`   @   t "  t``>!76`"!>"8>t"(<#a\a^6`6`6`6`.`.`ِ  }2 2 ? &`̐ &``̀  `#` #\ @  2` t " ۫ t`2`̀` !>"@`@ ;6``>5"h`0.`  `>`Ԧ $"``|`ؒ| &`ؒ"`>`ٕ: #\"> + @`Ԁ``ـ" `̀@2  ـ Ԁ@ ؀ В `>t"  ݑ+  |b,`2?|[|Y`Ș@#\#`  @@  t " * t`!>)#`Ҭ ``٠`ؠ?|9|6|2 `Ȕ #\#`@   t"` t`` !>#8@ 8O6`?#   2 " `Ѐ@ ~`ؑ2  `ـ  ~  } ~>#XmH 00)aTy]"  @-Ē  >!@{ ` @"$ @yے6`  ڣ`ƑH 0? 0 > đ2 * " ` `` ( ("` ( ("`` `"`%s%c: crash dump not supported (yet) 㿘?2  > 6   đ* >"`a 㿘? 2  @> 2@  đ,`@  e`f@"N  m@"We e@3 0  h@3 0  n@"`g@O 00 e@t 0}| H /d4 * % !Tx"H 0e  x!_  & *`` &!  @y M ƀ I G4 E  "  Đ 4 ?# @4 Ā2 3  @y͔ , ƀ ,` 4 ?`4# @ `*  *  > ` @y$   @ $  !2 @㿀?2  > 6  6M đ*@"G ƀ  Ȣ'  @vL" ?'2@vj"ƀ  )  `6! . @ ` "   *@$ *@$  $㿘>>o ! G㿘>>o ! ; 㿘?2  @>  2 60? đ*@    *@2   r " ?,` `?( z2` 2  Y ?㿀 D? @2 > `@ 2`  đ*@   T &   (@ <  K& 4ƀ  Ȣ'  @u" ?'u@u"ƀ  "  < D  " < %& 4 % @x $ @ٴ.` @6 ش6` &6`  (`@ 6` 6`02 6` 6`.`㿘y    `  xyc_cmd%s: stole control iopb 㿘` t  x\`   >   ` *  y{"@> $ r . X   $ $ $ $ $$ ($ $ ,$ $ $ $ N$ 0@~ xyc_startbuf null buf%s: warning: out of DVMA space 㿘`܀>Ð!D T`*    H @tS< 2<> $!! &:   $ $ $$ $ $ $ ($ $ $ $ $ ,$ 00@   ې`0 xyc_submit_iorq: stuck xyc%s: stole controller xyc_submit_iorq addingxyc_submit_iorq: xyc_chain failed!xyc_submit_iorq wrap upxyc_submit_iorq㿘 T  ,P d "@0K>0 >05 @ `P` А  b@ >>8##( 1#@@= 2  T#P"3 >##X@* T2 *` T2 * T2 *@ T * "@0>0P>  @ ` `@d#㿘 @ ` hx 0 ` l 3`"h`"  |& @ ` *`>@ @C & |  ?, *@ h*`  !  l*  ,` "@ `  *" @@ ` *2    ` @ Ѡ` @㿘@ `4  TBXa     ? @ '   ?  @ 2@ @;@ ` 2@@@ `" T`@ %s: off-line: %s xyc_reset㿀 x t  x @ *  2`  *   `*` ߐ * x ` *` x   * x`   `@* x T *` T2 * T2 *` T2 * T*`  Tw ? $ x T ` $ x x `" T x!> ` @#Дn T b@ 2 x># *` xtZ %s: soft reset 㿘` >!O  T b@  ? }     h` ``0` `2J4"E4&` l  *  2`  *` `` -`0`"`0-4"'`)4 "`4`00("0`$`0*` " @`0`,<@sH`0` $"a h0@ 0<"@ q`0&`P` ? @&`4`? 4@ 㿘`  X, @" "   `2    ,  P%s: DOUBLE ERROR! %s: soft reset failed! xyc_remove_iorq: controller DEAD㿘 T `  >  ? E > (> @ ` @ @*` `  *`  ``  @" @  "   2`  $`$` @ " ` " `` @ `B2A` < `$` `(`"$` $`($`0$`$, $`$`  ,    `*`  , `&$`4 ` @_` 4 ` @Z` `@ , ` ` a >"@, `(2 `4 4 9 ` ` "+ ?`0`- ( ?)  `0 0 ($ 4$ 0`$*` $ @$ @`, H@r <` $"a` < 0 @" $`p   @$`A  @$`  - @`2V` %s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries]㿘 > `#`    0  D> `#`a`  `  `>  c>#>#` ``@~cȀ !> @#u >  2>> k >h 㿘`@_``` ?`@&`` ?&` R` P  `$ + ` `("  @ &`$&` &`(`` !T @l ٦@g@+ ؠ@'@uƒ?' ` &`  `. 2  `@. .6 ```А ?6` ؠ" @:.`@ .0'`  ``` A ``&``@ `` `&` .2 `@ . .&`%s: watchdog timeout 㿘 H /d * %     h `  @" ` ?"`  h@ ` " 4  > # ? K H 0>!P*@ 㿈  ' 6  0{&  v r  j  0d b  ^*  Z  T   @o `  o @o0= H /d * % Ȑ #`#\ 2 t   . t . t"  t  o[H 0@oeSoftware fatal errorDOUBLE ERRORSuccessful completionInterrupt pendingBusy conflictOperation timeoutHeader not foundHard ECC errorIllegal cylinder addressIllegal sector addressLast sector too smallSlave ACK error (non-existent memory)Cylinder and head/header errorAuto-seek retry successfulWrite-protect errorUnimplemented commandDrive not readySector count zeroDrive faultedIllegal sector sizeSelf test ASelf test BSelf test CSoft ECC errorSoft ECC error recoveredIllegal headDisk sequencer errorSeek errorUnknown error [>* >U">R#>O#>L#0>I#H>F#X>C#p>@#>=#>:#>7#>4#>1 >. 0>+ P>( h>% >" > > > > > >!> !> !0>!@>!X>!h(4@LXdp|ᘀ "F   "A   "< 4: @ 4 5   &/ . ", 04* " 0%"$ @ ! " `    " ` %   "  @ $   @ 0 㿘\ `& & 0& & & & & $& (& & & & ,diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKsisw㿘``@ԭ 2E > `2@  ?2 &   24 >@ԕ`Ѐ 2- > `2 & >@ԇ`؀ 2 > `2   n ?2` >@r`Ѐ 2    m(?   si_attach: impossible bus type 0x%xsi: dma handle malloc failed pri %d %s: options=%b RESELECTDMA_INTRDMAsi: Set TheSoftC=%p TheRegs=%p 㿘` `   2>>  &e   (@: ,>>>>>>>a tܘ!c  6`6&`L&`D6`:&`\&``&`d&`h&`l&`p&`t&`x&`|&`&`&`&`P&`X``'>>>>et a&`&`&`&`>> l`&`&`>>>>>!#8c &`&`&`&`&`&`2"e &` &`e  ` &` &`&et!@&e   &e>"@`0  e" &et>#$&e&ex&e|  "    @3ex  ex   !@&e >f"`e>>"p]`> `>"T>  `>@ @6`>SSȐ!4 >@h > ?  `@2 @! >  @! si_minphys len = 0x%x. 㿘  `>"p@q& <si_intr: DMA conflict si_intr: DMA bus error si_intr: spurious from SBC 㿘% %t  `` "> " >@ "` #  & ! # Sf  >̐#>` @psi_reset_adapter 㿘> `%t> %``2" t 4 o 4 o 4 4 4 4 4 %4 4  t $ o$ $  $ o  $  t si_dma_alloc: already have DMA handlesi_dma_alloc: misaligned. si_dma_alloc: xlen=0x%xsi: no free DMA handles.si_dma_alloc: can't remap %p/0x%x, doing PIO 㿘  >ސ % ? `  >H!034%>!(ɒ   @  `>!@ &  $ $ $ /@   &   @jH  $  > !`&$ si_dma_free: no DMA handlesi_dma_free: free while in progress㿘 ` 2 >" ">{" " $`   @j $$ $` %s: DMA timeout (while polling) si_dma_poll: done, csr=0x%x 㿘  '%t0#cP+>nː d% `` `> #p`$` >#㿘@%t  4 %t? 0%t?`#2``#2``2`` 2`2`2` 2` 2`2` 2`si_dma_start: bad pa=0x%lxsi_dma_start: dh=%p, pa=0x%lx, xlen=%d si_dma_start: Fifo_count=0x%x, xlen=0x%x si_dma_start: started, flags=0x%x 㿘 `  %t>!Ӓ>  `&%>!0= ? @4   4 `    4   4 4 ?#ߒ @4 44 4 <`4 4 4 4  "  > !X@o   d*@ t \ *@ `  * l d * t \ @* `  * t*@  4   ` & >!si_dma_stop: dma not running si: DMA error, csr=0x%x, reset si_dma_stop: resid=0x%x ntrans=0x%x si: fifo count: 0x%x si_dma_stop: excess transfersi_dma_stop: ntrans=0x%x si: Got Left-over bytes! 㿘   %t>#0 ?& `?# @4``" `># ", `&  o``%  & '> ">#ؒj4  >c  `O& $ > "@& & > 8N :` 5> B X`` `'?`  @0`? 2 ,?`,?` 2 ,?`?c 2 ,?`,?`?# @2`,?4`4` 4` 4`4` 4` ` `* \*㿘@ %t  $ %t %t   si_dma_start: adjusted up %d bytes %s: bad outgoing adj, %d != %d %s: bad incoming adj, %d != %d 㿘 `  %t>!N>  `&%>!0︖     ?%   `  >#X <$ % $% `` d* O, >#  t  @ \* `  * l d *@` Oi >#k  t \ *@ `  * t*@  %  `` & >U!sw: DMA error, csr=0x%x, reset sw: short transfer 㿘   ` `%t>9#0 &   ?$  @ "  >*!@ ", `f&  W)>   $@ > 84  >! `C& $ >판 "& &  5 `   ">)a|&> ?2 + 2+` > @ 2`+`p "p >2`+ 2 +`t` "t >2 +x`"xa| "a|$ $  ` * \*@ > 8diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKPolled Mailbox Command (0x%x) Timeoutisp_mboxcmdInterrupting Mailbox Command (0x%x) Timeout%s index %d=> %s %02x%s:0x%08x:%sPTI,ptispptispSUNW,ispQLGC,isp㿘`` @Έ >@΂!8 >@|!H >@v!P >@p!` ` `2  > #  g& 48@  : expected 1 interrupt, got %d clock-frequencyispPTI,isp㿘4` >"H0>"h>&b0&b4&b8&b< &b@&bD&bH&bL&bP &bT$&bX(&b\ 2&b(80 @4| &b(>&b, @";bp ! А@b@6b^8 *> <@%> @@ >>"@ " >!`@ " >"@ "  >!H@ޒ 2> >@֐!8 >@А!H 2`&bX` @b4aP &`&`.` &`@E >Òa< "$b0&b6bb6bdb6bf6b`6bh@-&b `? 0 &`c`  &`&`H /d * % `  &`&`H 0 ``k&`a2   "``?`Z&``&`H 0 0P  `ؐ` 0`   pa2   ``?`1&``&`H 0 0' >"g  @ ,a2   `` @s `?` &``&`H 0 ISR 0x%x SEMA 0x%x㿐V"`>"(` ?` 7  (7h    ` `7 7`  6@*` 6"b* "(: * 6 2` "`R ` "(2` "`P ` "( 0 %s: cannot allocate request queue %s: could not mapin request queue %s: cannot allocate result queue %s: could not mapin result queue 㿘!D 2E   * ϒ &!8@  * Œ @&"l!   &!<>’ # x@d~ &!D>’  !   &!@>’   Ȓ@dh &!H >’  6 %s: kdma handle already allocated %s: Request Queue Overflow++ 㿘!`$* `!< ` d6>   `  @d3 2&`,f e` "l?* `"`>"@ꀒ  /  !< `2* @ 6>’ "h` ` @d`$ &`,< f "l?* "`h   @`6   @6&$@q&  ,`,@`$ `$` `$`,`,`,@,``$ &$& 6..  g. ...e @%s: kdma handle not already allocated 㿘`(>!H`$`(` " .2 "l?@2"@>Ð  > ` `$@d` 㿐!B À:,`! _ 9@` ` !`" H 0` 2 4`*@.u@@ ``$#$@  `0H 0 #H 00 4`N.$@㿘H /e`* &` `0 @ H 0 - 0 H 0  H 0 > #stdin-pathconsinit: increase buffer size and recompile consinit: bogus stdin path %s. keyboarddevice_typeserialstdout-pathconsinit: bogus stdout path %s. displayunknown console input source %d; using rom unknown console output sink %d; using rom > #> >! > > 2a(" $%%%l%` (`L`@5?>Ħa8 € ?`>!H.'>Ĥx  @ " >`@ >>Đ!x'> a€ >  a@%>@a Ox?'>5>  '>5> `J@ 2`J@ :J` ` z$?@ € >鶐!HJx  @ " >@ >>Đ!鞒0ݤ!@ސ>@ɽa > 5"#$ @Ґ>@ɱa ?Ox `J@ 2`J@ :?J` ` z$?5> `HJ@J >  >     )`  `@`>"`"M` ``>>  )? 0>>ǐ#|`|>%& "+"0>ƒb`%&㿘#>a> `##$ *X $ *T ($ *P H$Ӑ> >ǐ"`w>!̀`" $a@>@"a>"a$a p  $"% h`" h%  #c %˘ ( $ $ $ $  $ p@">>!a4 4 h>ؒbX* @€㿘!> # h>ؐ"X*`   €v㿘> # h>ؒbX*`@ 㿘>!Ȁ  p ( (" h> # h>ؒbX* ` @ 㿘  b@> 1>!Ȁ    ] 2 &! > # h>ؐ"X*`  @ 6   㿘6  * U㿘6  . > 2* "` *  $@ @  ( €. 㿐 H /e4 p* & p!  H 00;> !`$`T`` H   ) HHo o /@ 0@ H 0 H  p  ?& pW HH 0㿘> "€ 㿘H /%4 p*& p H 00)V  H   & p$ Hz  H   p  & pH 0!@(0> ". H 0H( p" pH  㿘H /e4 p* & p   ?& pH 0 0 h ?& pH p@  P H )Z?  @  *@`> ! `    `€) h` >ؐ"X *` €0V㿐>a܀  > ! `      0  X  &!ܰ 㿘H /i * * >ܒ?"ܑH 0  ,> #` c">@@ >ؐ!8 J `@   ?!8 J `@  ?> `h"X*`   € 㿐> !` Ho o a    aH 0% H/` /1>  a> 1 `$ *a`P `> 1 `$*H 0 " 㿐  Ho o> ! ` /   0 T@H 0㿘> "  $@ (%s: /dev/fb already full %s: forcefully replacing %s %s: replacing %s %s: attached to /dev/fb 㿘> "`!> " 20 ($b , " "   ( (>Ȑ!` > $b$","b` " >  ( (>Ȑ"` >  "b> b  " ""b (>Ȑ!`0" " $" ( (>Ȑ"`$"">("`㿘> "``$` 㿘> "`$㿘> "`$ @㿘> "`$   ?widthheightlinebytesfb_setsize: inappropriate bustype㿐```s>>> `k`& &  (\ `2Y >"@ , 4 0`"N @'2  E"G 2  E"A 2  E2  `"6 2  `/>ɐ#*` €$!##$%$"!" J "$   $   %  #&@%& & %& &  a & : & >ɒ`p@l& >ɔ`x@f& >ɴ  a &@Y:& >㉐ &T%%%&h%J   J* (J А 㿘   @8 screen-#columnsscreen-#rows㿘  4$` $`   & 4$` $`aF 4Ԓc 4> +>  ` p$`\`\@@$` @`>` $`>" P P 2` 8 $` " Q 2` 8 $`  !> > <@Вc P` 8  <>ɒc@$` "` 8 $`  " $`$` @`$ ">$`$$` >ɐ#t$`@p>: >"c>  H>  L@#``#dd"@@d`?"@0 d0E Ed0# 02   0`#dd2 #>    "! mouse input parity or framing error (0x%x) ms_rint㿘#> `   >ʐ b⯔?4`? 2   4`4` * : `1*`>ː"P €8  8  , 4 . : @ $ 4 . : @ $ 4 . :  4 $  . : ?4$ >="   8*L @L ) > 0>#> % bb  ?"FI*`@ `@ 3# b#  #   8     "   ?"!#3 > %# "# " #   8  $     ?"#3 > %# ""#  #   $  $, $ L 4 "L 5, 4 L 5  0X .H+++++, 㿘>   0`  $ 0> `2  $"`"`  @  $ 㿘!>   $   @ $ 0㿘> ! - ~@-  @}@" "  v@ @ 0> @ *!- > (  @  "  㿘> !>  xkeyboard-click?true㿘> > bx$ $ $ > `<>@`0 >@Ē`@  , ,kbdattachkbd: reset failed kbd: type = %d, layout = 0x%x 㿘'>P @> "c( @> b> ">͒aߐ>  %"cH@ Ò & > @P>ߔ! >N @> 2 G 1Unknown keyboard type %d 㿘 2 > 0> 0> 0> 0!a& & & & &. 6   " N   >! >! 2.  N   @g .  `. kbd_translate`2  - >̈́ć(*`*`2`*` *` *` *`*`?<2`R`"@`"`J`"J`` }?`"`2 `u?& '> 0? 2  ? 2  耠 ?*``F?> 0 #    2    2`! ? #  2 "2` 2  2 `2` 3|3H3P3p3X3h3x3x3x3x3x3x3㿘H /e4 X* & X   T  ` > ê \H 0keyboard input parity or framing error (0x%x) keyboard event queue overflow 㿘> #H#> `}bx X $ X÷ \>͒"   0   , 0, 1    D  ̟@\?0U?, 2 8, 00N 8 J, 0  ʒ  Abx`>  > $ X($ T> \032 8 P*@ ? 4" 6 >͒b[ 0 `3@ `# > %""#  #  <$ 8PL L "L M, L 4L M  H (0 > *`05 ~1 (0, ' #     * 0       * 2 * 01#-!)!%!!#! $$$ $$$"# * 2 㿘> "xH`; x"H @ H /ex* &x`$  C ̟@>!P>ߐ`!?  #" H 0 x> " " H㿘!> "x 4& "x 2& H @ & H 㿘> " -㿘 ~> @ R"x c @" 1 Z#@Րc@A 0 Z#@" 1c@ 0Ր}@ư 0  v@" H #@ "s8# #@ 0@m 00#@" # @ 00# @8 0  -  & v - . "> 0 0  0 "  0> 0  !> 0"> 0!?c 6 t.@ "> 0 0  0i "  0d> 0  !> 0"> 0! @ U6@] Q  M$  2 I& ", 3 H /e4 H* & H x  > %>ؐ"x0  D H 0  4 6  ., 3:  , &  @ 3 . @ , Ma @ 㿘> "㿘> "x`  F " `1 4?  `0" `17     *`, "/ *`,+ `H /e4 H* & H x  > %>ؐ"x0  Ә H 0 Ò   ̟@ fpu_cleanup 1 fpu ieee trap, but no exceptionfpu_cleanup 2fpu sequence errorfpu hardware error (%s[%d]) %s[%d]: fpu hardware error fsr=0x%x fpu errorbogus fpu queuefpu_cleanup 3 `!$: ``> >ѐ ȓ*` €>!:`2> 1>ܒ! h> 1  ' ˘(`` % >!>|!!  4>А bܡ 4>А" t' ? N&`>А"@ے >`"P @B'> 1> 1 h`,``@2`>Б2` ??̀ >I"`'@5 " `  >0>0 ?*  ' q `'  h `!"p``@Ǒ,`&`BBCCC0C<㿈@>ѥ6`  J6``86`  ` ?`< @ & 4& >Ґ , €, @,@  ,@ * - %@  %` @A@ @9 ,@4 @. ,@) 0`& 0@i @ ,@@3\ @ ,@ @O @ ,@@P   @ ,@@B   `  p. %`W "S%``O  @Ӕ@Β ,@`6` 6` 6`  @ @ ` >  @ > 1 HJ p. @ %` *`@%`- `%@ * ` %@ * %@ *`%@  EdEpEGdGdGdGdGdGdGdEGdGdGdGdGdEEF@FtFFGdGdGdGdGXGXGdGdGdGdGdGdGdGdGdGdGdGdGdGdGdGdGdGdGdGdGdGGGGfpu_add㿘  ,@,``2   @@t ` 2    z&   v&  r "L   L$`$` 6  $`  @" $`  $`  @2    $`  @$`   $`  B #@$` @``9$`?  @    @  b #   `?$`$@  @>` `" Y!$`@ @ @ b@ #$`$`$`$`@` ` `,`,` #`< 2"7 2 - ) &`` b`     `   `( #`㿘  `,, `,@80`2  @@   $ ,  " 2  " "        @`    " $     ?" $  @ @@`&1  @1  $  @ @@`&1  @1  $  @ @@`&1  @1  $  @ @@`&1  @1     $ $ 㿘`   &  & & & @&  㿘?.@6`2 `*  ?  & & & & @x&  `2  2&  & & &  ?& & & & &  㿘?.@*626`@.g<  & & & & @G&  g 2&  & & &  ?|& & & & &  㿘?#@#6*@6/ 6`..7 @ ?#  & & & & & @  @ ?2&  & & &  ? @ & & & & &  fpu_explode㿘.2`&`&` >0 >0:Hp  q"2 &@` 2&@  &`& ?&@㿘````) `+` (`1 36`@20```0+"`"` "  ` `'`  '``2'` @ @@'`'`'`'` '`'`'`'`  0    `?㿘@ ` "`` 4` r"@@ "`` $``  2 0`1 ? #$`fpu_ftos㿘@`* @ǒ [N E2`M`4 Y Z"@@V  `@2 9   @& `,@`@2>ו!4 @`@"` ` & q "11 #`,`1?*@㿘@`* @h >M'@2`&J  ="@@S  `@2 @ 5&  @& ! @8 <ؒ `@"' ` &  ?1@&1 & 4@`, &`1?@*㿘@`*  @Qc@2`&<#@  "@@ @`@2 %@   @& $ y `@" # ` &  1@&& &?1 &4@& &`?&`, &`& `@ fpu_implode㿘 >>& &&u&ւ"㿘   ,@ ,    2 @   " 2  $          `   *`2` (`) 30` @ 1 @@A*`   *`2` (`) 30` @ 1 @@A*`    *`2` (`) 30` @ 1 @@A*` *`2` (`) 30` @ 1 @@A(*`#*`2` (`) 30` @ 1 `$ $ $ $ $ $ $ 㿘 `   `@]       B : "! 1 B  (" @ B 0!    b`    B @ b`(  @@ B 0@!    b`  ` B  b`(  @ B 0!    b B `&    b`(  @ B 0  ! ! fpu_rightshift 1fpu_rightshift 2㿘`  & >  `r     >!! ! ! ! ! 1 `_  @   `?@   `$`  ` "2@+(@*@0@(0  3! ! ! ! ! 㿘`      8"  @ 0`  6` (@+32*@@(` .   132+*@)"@"""""?   LL     diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKWARNING: matchbyname not valid on sun4!%s 㿘> ` >`@ `?Տ h`>Պ     9F (fɀ  ( 4("@/obio/interruptinterruptbootstrap: could not get interrupt node from prombootstrap: could not get interrupt propertiesbootstrap: less than 2 interrupt regs. availablebootstrap: cannot support capability of > 4 CPUsbootstrap: PROM has invalid mapping for processor interrupt register %dbootstrap: PROM has invalid mapping for system interrupt register/obio/countercounterbootstrap: could not find counter in OPENPROMbootstrap: could not find counter properties`>` ) !> #@!> 1 > ("a$ H,$ L$ T\$ `$ X$ $ P`$ d$ l$! $ $ tऀ`>А "@>@h!x!> $ H  \ d@* `@Sj_ v >@ r!`  !>@@ !p 2>!!@"!p 2>!  >!$?> "  )>'>#?P,  p҂@` ` X@ `? @ ,  p҂@` ` `>"@?pO ?p ">@ "蔒  @q@ƒ" 2>ϐ#@Ғ" 2>ǐ#0> ?* > "#t"`  > "8=@?P` ?P*㿘!> "@ϒ!> !` `@ @@S! @ L -~#> #V ` @bL /<b'> ) L @`  L` @ / 2*@*@L @? [`L , : S`L :  L?$` $`  $L /ˠ b@,@! @ ` .L - #> # L c"c d a"c4c  L sc  $c $c$$c@Q L $ctwas brillig.. vmelvmesx%cc%c%cobiosiswespbootpath_fake: unknown system type %dfdsbuslecd㿀> `>Y 0N`' (''ʐ`J@ , `’J@ , `  N@ x>@N` d2>>!> )&!!> )&!  . ?& & & `" N`>ےaG@{?& & &  $N@>N` a5@i& & & .  i l&`sN` e"`s>! #> )&! ?. a& & &  $aN`>N@ a @?a& & `& $aN` d t r> ">  >U 7 2P>>!> )&! ?. >& & & !(`" 6!(>! > )&! ?. >& & & !0`" 6!0  . &  & & "! >! > )&! ?. !>& & & !8#! && & & #!   >!@> 1 `LJ 1 :  : N`>N@a҂@& & & |  f@N` d`l>!h> )6!h . ! & & & e#!`l#`sN` e`s>!p> )&!p ?. >& & & ax " 6ax `. & `& & A"?N` d t r7>!p> )&!p ?. !>& & & !8#! && & & #!N` r  >ےa N@>ےa@;& &  & $bootpath: /%s%x/%s@%x,%x:%c 㿘>Ѽ#N`>%>#>!> 2  ѭ cѨ ``aѢ  N 2 >њ >  ⰁWARNING: %s map is bogus, using default 㿘> `,> !`'> `<@ ">@d  >ݐ l `"?@` &` &@L *?Ѐ &@ $L 0` &@sd-targets㿘#> 1` !> >ݐ!" $`". @st-targets㿘#> 1` !> >ݐ"("Ԑ $`"ԑ. @cpu_configure: no memreg found!cpu_configure: ROM hasn't mapped memreg!device_typecpuPROM root device type = %s (need CPU)mainbusmainbus not configured@ > ""> ##d>> -> `)>+>ݢ/>[1>>ɚ ` `=>#p!<`/`$` *> @$ @`$``$R >> a0*: * @*` " R    2`2 >""x' > c' '> "`>"  @>@ĒbȠ>@b؀ >ݐ" @"L xc"@'K' 2># K  K H o@@@%༡H/ / @'H@>H 0PROM sync command㿘>δ"8%d㿘#@Y> >ް"b`#@QH@#耢  #@; .,%s at %s %saddr 0x%xio㿘`> " 4  0>ހ`">#>ޒ#  no PROM root device㿘> #( 2 &#(@? 2&#(>Y#xname㿘 " !>ޒ#@ @ @& #а reghierarchical%s "reg" %s = %d (need multiple of %d) warning: %s "reg" %s %d > %d, excess ignored address%s "address" %s = %d (need multiple of 4) intr%s "intr" %s = %d (need multiple of 8) WARNING: %s interrupt %d has nonzero vector 㾘@!>ߔ`0@!?>ݢ"Ȑ@F  @>@`8 " @e  >> 1 HH ]  > 1>ߐ p< & &@ &  ,I/>ߒ` @A ? &   >> 1  <  & (>ߐ`ؔ@( @?"  >> 1  <  &!0>> ,   2? " ? @ a 㿘`@ `?mmled`XH8{0virtual-memorypackagesoptionsopenprommemoryinterrupt-enablealiasesauxiliary-iocounter-timereeprommemory-errorm {0eccmemctlSUNW,sxSUN-4/%d series: %s obio missingfbno options in OPENPROMcould not find %s in OPENPROM audiozsP> ` > !> %>`Ι" >>@c!> %@"> ]" 8 @!D!>>ݐ"ئ'# @!D> >ې"a ''' >̽ ># #''  2'0>> p# )@v 9> -> 1>77> >ݤ"ؠ)>'>ޒ"@N@.  @!D'''' @_ " 9> -> 1>7> Ġ@!D>ݐ">''''  ` >`@% > 5"c@-# &<>M "'L &)>'>ސ !Ͳ8'8  h 2'L `Q'> >>ݠ"Ȑ@s  @͐>@b؀ 8>ޒc@Ð @ 2 & >a @>a(@ > 1` "``  H 0+' @ findzs: unknown zs device %dfindzs: no obio nodeslavefindzs: cannot find zs%d㿈> `$ "<  "<@ >"8> '''!˙> # ' 'r耢 26 ? )>!@\ ` >+a >y"@N #>b0@;?>@Ka( >  "8_`@& pre_panic: makememarrmakememarrmakememarr: hope version %d PROM is like version 2 makememarr: limited to %d makememarr: cannot find "memory" nodeavailablemakememarr: no memory foundmakememarr: WARNING: lost some memory 8> `>0 > 1 $> 1 $$ u#r > !  " & 4%>ဦ !`0$" > #耢M O> $$  @ >#C`> 0= Ȳ \@>j` >ʷ P>0> x> 0ʪ# )`@3@   >  $$   >ʍ  WARNING: getprop not valid on sun4! %s node 0x%x property %s length %d > %d 㿘> `># > !` €> 0#0ʘ 㿘> !`€㿘> #ʖ ?" ,㿈  㿘> !`€㿘> !@€search_prom: null nodeiommu㿘 >!>ߠ 8bÐ@  Ր >> Ȣ#'>%>@ #>ݠ"Ȑ@G @8  @z ƒ 2 ے WARNING: opennode not valid on sun4! %s 㿘!> !` >," `@ !@ 㿘> !`€8@ 㿘> !  8 |@ |€0@' line# >body >user %lx ! ' column# >body >user %lx !stdout @ is my-self addr line# %lx ! addr column# %lx !0> !` `  @ >c >cP&@&  @  PROM exit failed㿘>`? >  x"@ t@PROM boot failed㿘>`? >  x"@`d€> 㿘> !`l€㿘> F ̀% > 1> !Dc *`" * `@?" ` `@$`$ ` : * $  ?2 @Wraidrdstxdsdxy㿘> 1   @@5@Y ``?> 1     use one of: %s[a-p] %s㿘@(  >"x> )`؀ >5>3>    2 b   2> parsedisk㿘`A   ,`: ?.2&> ) ؀ -?#3>  @  2  Lc@*   `*` @*@ & 2  @ڒ  Ԑ?  2,no memory for mountroot_hook㿘    2> h@A $ $ > bb $" $ "b%s%dsetroot: device name too longroot device (default %s%c): swap device root on %s%c can't figure root, hope your kernel is right > )!?'p> *"@   > F Į% ? 2  @2!> x2` ` d  >Ƿ  'p1> F)> F > F `> # " ">!>>倢`!(  a  >!8x@  @Y@ t?L *  ,ɔ  t    > 1> F G)> F#> p @ :?8'pȾa@ >`!(  bȲȰa8@͒ ߒݐ`>#X*` €?'pt? @2  `@?`v# @* ` * 'ptp%& Ȑ >% ̀ 214 "? ,`# ** ? 2`   2 *+  > F'p%" > F?'p "`p> F"   O> >!P`aIH>   >>Ӑ#> %M"c? 2  >bP2 >% !P`a2(?$!`05@02 > 2 2? 2`  2 @2 % "? Ȁb & b  2ē2` `  @  %c㿘 '>  "+  @   #@ @"   #  @ @Ǹ, >#p?ǯ0Ҥǫ0>怤 >>Ǣ#x0Ő#Ǟ,config_attach: device name too longx> ) ؤ>ޒb`dz@t@q >  @ِ@&```@ 2`㿐ےdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKcache enabled 㿘> <x> "!`@>   >  "c Т@ Њ@@ Ъ@@ >">"㿘> > c?* > > "a`" Ԃ Ң  Ң Ң> >"""㿘!> @! Ģ @ ܖ*> #* > "!`> " ւ   Ң  Ԣ   Ң  Ԣ Ң>T "`"  pК@ `к@>  "">Ʈ"cache_enable: can't handle 4M with hw-flush cache㿘>   @> #?*@ > > > 9"!`""`8!#> @   ֢A@ ֢AЂA   @Z :>! `!$ >` "`> `  fb㿘!> @ Ģ @ ܖ*> #* > "!`> " ԂԢ>`Ā` > @ 6>ТA@ @ > ܀  @   آA@ آAЂA    >"`#㿘> > #> *@ > "!`" ւ  > @6 آA@ آAЂA    ֢ >"`DVMA coherent 㿘%>@@*> #* > "!`> " Ԃ̘ !> @ 6>ТA@ @> ܄  @   ֢A@ ֢AЂA    Ģ&҂@@" >ũ#@ >"`Ť">  >ਆ  > cࠅ: c Т0 ࠅ8 ଐ Т> ``>"`* * 8>8  Ģ@@ > >"* *`* 8*`>਀> cࠅ: c Т0 ࠅ8 ଐ Т> >ਆ Ȁ` Ģ0 > ఑:? ଆ Ƣ?㿘#>a ='> > Ȕ `2 @5"@`  . # Ң0`" .@ ` Ң0c  2 `6 6 z `?07> > ఖ  ࠄଓ:@  "  Ģ` > ``>"`* * 8>8  ĢB@@ > >"* *`* 8*`>8  ĢB @ > > >`ȑ:`? "Ȅ Ģ? 㿘㿘> c  >   Ȕ  #>`c2@# @`.$.@ "` ԢB@0c  2 `?6 6  `?0c  2 `u6 0^  Ơ  Ơ Р㿘M?>>ࠇ8   > 020>τ 00 o ??  Ģdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map> 72`  ? @0 `( > 72`  ? @0 ` `?> 7*  > 72`6?|> 7(? @ `2 ?@ (@* @?> 22`?0 @ `2 ?@  (@* @> 7 *"?{*?㿘@2  ?`" ` @&?&` <* & 2` fp align without being the FP owning process㿀`;k   2` 2`> 7 ?c  @` ;u 2  ' 4`H*   '* ?@ ;D  2` *`: '2`  ` '쀢 4`H*   '* ?@ ;!   4   '>! >T"W=!(`2 !( * ='* 8$  2  ' 4`H*   '* ?@:ߔ  `` 2    $  4`H*   $ * ?@ :”  m`  :a`:  W"7 *  6 7?7: E`2 !( | "2    * !("@=!(002   * *  " `H  :v ` 2    * *   " `H  :[  㿈 :K  2 2  2| :]2   ' 4`H*   '* ?@ :+` 2` *`: '2` `  '쀢 4`H*   '* ?@ :  `7 2  ?`; *> H€( % H  2   * *  " `H  9Ԑ `  㿘    `? @ &@6   . ??'  $(,048< ?ݶ@        6 .  `2j ?6 . ?6 8&diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKstray interrupt ipl 0x%x pc=0x%x npc=0x%x psr=%b EC EFSPSETcrazy interrupts㿘 > >  0`h> %> 8"  > c<   "c<> x > "8"<㿘>  ` > )C > )_> )a 9 L! /!H > b"bH 0 ,!}y @@J !K^!J` t*` Async registers (mid %d): afsr=%b; afva=0x%x%x SYSERR UNCORR TIMEOUT BUSERRAFONMI: system interrupts: %b fVMEfSBUSbKbSbEbAbSCbTbVIbMIbFbVbMbIbMEbMAnmi㿐!>!8''€ 2  H>>  L"@p3  H  ?p>>">f#intr_establish: level %d interrupt tied to fast vectorintr_establish(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%x㿈H > c@:  >#6  >> `6>`0. !`>"!L>"!x" : ?.) 2   @2  (R@"> 7 ?) .   >(R#\#`#d#ؒ> 7. #@@2"&`H 0 intr_fasttrap: already handling level %d interruptsintr_fasttrap(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%xx>`0. !6` cH > c@:  >> 7#ܓ.  >!> `2>">"!L!x" : # )@ 2   @2  (R"  ?) .   >(R#\#`#d!v  q8  '''  N@.ݐ   `H 0setrunqueue㿘! `2 >O#> h * > c+ "h & & " "@remrunqueue㿘!> h2 8 2 >. 8> c"  +` "&   * ( hdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapreal mem = %d startup: no room for tablesstartup: table size inconsistencycpu_startup: cannot allocate VM for bufferscpu_startup: not enough RAM for buffer cacheunable to create DVMA mapunable to allocate from DVMA mapdvmamapunable to allocate extent for dvmaavail mem = %ld using %d buffers containing %d bytes of memory 㿀 ?H@? >` ?H?L c> > > F"a @> > "tc >* !H@֐ >@ *@ Ӕ >l!X@ǐ""> 8>c!x >* >  * #` #\`8 ?? "8>K!> 8'`$ @@@ :@  :2> 8"`$> 8$  @ݒ@'쀤3> .5> `8,@  :  )> '>#\     ۚ 2 4Д "8@ *8>`#\   >> 8"`??&b?0 &p> # > 8`" >֐" pb" b@p>ɐ" >"H#\   > "cx>"P>"x,*@ > 8!>$9" !/㿘>Ȅ>ȓ* "@᜘ᜠ>  " *` > %""**  >> )"aԑ* >   > %" 9w >a ?a`> $` " ` > )"!̕*+` > (+  " *@  > 8*`"@ > $" |*`   > 8 (> 9Pt@ d$$> 8`  $ &  &   &   ̓*`#3@( $3&  > c* @$@@ے$$ > * &. . "bЁ㿘!  !$" ! `@ " ?   ? !,   $`!, ?&!,!(  `#>a7$ax *&!(@ P$a= #$H$$$$,&㿘`    -> 8 03> 8`,ژ`,  `,  >2ć> "@$$  `H @` *@   $  'H'L> A?Pc   'P'L'T'X'\'`` 'd`*'h@'l`'p`0't @   0'L'Dx0D4L?@/ H4- ?5b  , *@ >&>&`=" #" $``$`H$`$`㿘4 @/d  @`23  * ", ` ` !$$ `< @ * #` # `# `# `# 0`# H@  $a  a ?"a `?" @& ?WARNING: not updating battery clock attempting to power down... WARNING: powerdown failed! halted rebooting 㿘> `' > # "#> 88 > b@ >  "b@L`"8(>D H/` /!">@>"` " >>,!@>%!8>"!Xp>!h  > H s*`  @H d*@  -*HH*@ *HiH㿘> F Ȁ"2 > 1* "@0*` `@ @)> c> t *@  * $ $> 8> 8"`D"@>   P dumping to dev(%d,%d), at offset %ld blocks dump area unavailable mmu memory @%p:%d device bad device not ready area improper i/o error succeeded error %d 㿘>3`@> F`Ȁ?> 8 @`%> 8D > F ? 2 2 > ` #> F`> 12  *0"@ *`` >p#?> F>j#0Ȕ`2` `*`" * D>] @)p@)S> c`>* O> b> ? H H`F`` > #< >9 ? /#-> 7>5> "@ 8>   "4@P @N> FȒP@P@@`2 4  ڨ `>#-` €> 0> 00> H0 > X0 > h0> x`ppppP ppppppp0ppppppp@Frame pointer is at %p Call traceback: pc = 0x%x args = (0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp = %p 㿈1>#> `'> %> 0 <  $ ( ,#\ 4#` 8#d 8#h 8  4@ 4 @ " 0mapdev: zero sizemapiodev㿘> L > ?x"L c`8 `>! @ L? "L>!(  >Ȓ@ @  *@ . 3> b8` &㿘@p  curproc = %p, pid %d no curproc uvm: swtch %d, trap %d, sys %d, intr %d, soft %d, faults %d stack trace with sp = 0x%lx stop at 0x%lx 0x%x(0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp %p end of stack trace 㿈> "@`">>`4"H!> "`!> # > "p #>   #\14>֐" > *@ "ϒ  * @> 0b <  $ ( ,#\ 4#` 8#d 8#h 8 2>#g0 panicw: case 4 w: unknown case %ld w: arg not allowed 㿘N@  t>0``>0> P> `0  p0 0~ warning: ldcontrolb called in sun4m 㿘> `>i!  H/` /> b@`2a > ` 2($` H p@` * ( 22$  *@ `   `" *`0*@2@  `  *@diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘!$1 P 㿘!(> 8 x 1ٔ! 㿘!$!<@ P*1ϐ@<!$ " `  !$ !$`  㿘!(`1!  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK? 0        mmrwmmrw: out of space in kernel_map㿘? @2  `@- > cX  #>#X#X`$#X!a Ƙ #X #X!> "X `$X>`> $"X"X 2`>ΐ! ` `   ?` ?&@ &`>! @2 ` >! *` €` @C > > `,#> c bX>    @`  `"@ @ 8 bX bX@@ g`` ?G#@> #?H@ @   8 %>  耤@ `> "8@  2   "@ @8  @ 8  @?  E (` > &`; > `" 놐` #> `؀  '>  q @O$` @8`7 `  "Q@? @2  !> #X #X $#Xl$ D? ->   㿘> ! `"  @ " @  㿘#  p &.y, ?㿐#@2>  < &`> c`@ >  <@ > Ho o8H p@  $`> !0`''@   #@N@ܰ 0c@c@m 0Ҁ` Ho o€H 0 @` &  p  'Ho o H p@Um`o^  W xHo o H 0 @2_ ^A`C2 2SHo o€H 0@U @ $&  -2"< Ho o€H 0> `% ! Ho o€H 0> "#`& "qn  qh diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘> !\@㿘>`> 6L!> #  #>!`@##ސ#` @"[2 㿘>> `DVA2PA: Asked to translate unmapped VA %p㿘 `#҂@   ?.  %$Ң` ` `? 1?` `?1?** ` `>?.      2( $(@2  ?(:  㿘> #0 Ҧ`z㿘 @*`   `  6"@ @:"@  *.$ @$> > ""@pmap_page_upload: no memory?㿘!> > )"! H  癐> "  H  >"0> @ "t> #     ,` ` 2 @  t @> > #`H* @  2@2~ `@ > )@ 7 > >2@!0d > `08*`@* 0@ " "`080?>   *`d (  #mmu_reservemon4_4c called on Sun4M machine㿘>   > > %?> /?"`""82 > %?> /?"`""8K> #1> 4*` $* ``⌀`@Д`> 8`p @&> \?  +> )> !a? 4!b@2 4  ,  2" @ *`"? > #Є Ф? *4&'mmu_reservemon4m: no existing L0 mapping! (How are we running?mmu_reservemon4m: can't handle ROM 4G page sizemmu_reservemon4m: unknown pagetable entry type㿘 !Ђ* >`<  `T   Т@Ђ ```>0 >0> p>"@b"h>_"@>Y"`< `T  mmu_setup4m_L1: unknown pagetable entry type㿘?. # , `$* @҆ ` (  .  )>? @ ` `*@*    * ` `+` {?  ?*  @  # Ǒ, mmu_setup4m_L2: unknown pagetable entry type㿘?.  #>@,  ҆ `   "  ? @ ` `*   `+  z?  @&   a8 ?$@mmu_setup4m_L3: PTD found in L3 page tablemmu_setup4m_L3: unknown pagetable entry type㿘?.  >>ֆ     + `@`.`z @bp  ? me_alloc: all pmegs goneme_alloc: LRU entry has no pmapme_alloc: stealing from kernelme_alloc: LRU entry's pmap has no segmentsme_alloc: LRU entry's pmap has no ptes㿈> ""耤 8'P` "`" "@$ $  "@& $ ` $ `"&`>  ,> !",0 "04 "4.`$* P*  @ 2`P$ )4 > #( #(>#( 2> >#H#2>#h` "`" "@$ $  "@> ! & >   4 0`" 0" 4 * @$*` `2 >ِ#* @'@`1 >ϐ#@ ) >)>` 2"Ң>Ю@>!P € > 2   *`* #@ * : *` >)q>`   "Ң>Ю@>   Ҫ`  Ҳ` > c??"c> P .*` ''/> +> Ɔ#  7`>!0` >  2`@: * *2`@`# #@  2`@: `2`??*  *` 8 @" $@  >    * : *` bԪ`bb  *`* @  * : *` Բ`b 2  ` "` $  "@ 誀@$ `$ `"@&``$@*  @ 2`P$ 4 4 me_free: no segments in pmap㿐> .`"* @ *  $* `> `2  ** @*: *` > `  Ҫ`  Ҳ` > "> c %> #> -> ހ@#  7>!0 ` >  `2`@: *@@ *2`@#@   2`@: `2`??*  *` ; @"  ‚@ ` "` &   "@@2> >^!"  *`>  #2``"  "`> "! "@`0?"0`"  "`> "#, "@`4?"4# ## "@"``, "`,㿘 0 6`+   $* 6` `?*> `> "  `6 І@ "1?0/?@H /f * ' >  #( > `Ԯ@`> Զ@`> > #bЦ@`@ H 0 㿘> `   0 4H /f>* '>x`  t @#@"x+: |@\@"|??""|`> ""|>`|`t,` "a  @ `   `0&`44#@& F&  @>!X@>   $  >Ȅ   ?> `   Ъ`  в``? 2 >Ȁ,,: $*` *  ӰH 00 !>!`@ ,,` p:   z"@>!X@ "Ԣ@`H 0ctx_free㿘#>> ` &"#>a` "aX&"aX "Ң` Ԣ6>% @>! `  "!X&` ">@>!X@   "Ң> Ҫ@>>&`   "Ң>Ь@>`x$"`xpv_changepte: pm == NULLpv_changepte: no segmentspv_changepte: pte == NULL㿘&oH /f4 * '    H 00 @  ->Ȩ 2>z"P4`*` $* 4`  `?>m"p*` > "`@  2>_" 2<` <`  | *d$ % > 5# x@ * |@ S2 ?#@?#@(H Ҫ@@>!L@  @ >`Э```е``> `#<`  <` ?* @  <  @& *@  2<` <`  | "@    $ " ?$ 2n @@H 0pv_syncflags: no segments㿘%H /f4* '   H 0b  @ S> ??#c  4`*` $* 4` `?>!*  > b"3 Э@@@@>!L@@@>`  Ԭ`Դ` <`  <` ?* @ 6<   @2%  @@H 0pv_unlink0pv_unlink㿘  >P#- *> `   "> & "$ &   & &    4& *  "&  " &  ?@& !> >  `  "` ># 2  2 $"       > !`    2  `"`  & G㿘 ` ` > `` "` & & @& =& >  `` "` #> "  ! #  `&   > a`    "! ސb$""" " " &pv_changepte4m: pmap == NULLpv_changepte: invalid PTE for 0x%x㿘$MH /f4 * '    H 00[" O??#c``>W"L  > 5# x ` |*/@`((@"Ԣ>aL€ 0Ң`  " >#*: ` & *|``  $` "@` ?$` @`2`"@H 0pv_syncflags4m: no pte pmap: 0x%x, va: 0x%x 㿘#̬H /f4* '   H 0B " 3 3>ϒ 2Ha " Т@ pꢀ`  2 `<    @>!L@ p` ?|2% "@H 0㿘  >#- *> `   "> & "$ &   & &    ~& *  "&  " &  ?@& !> >  `  "` >_# 2  2 $"U      > !`    2  `"`  &  pv_link4m: pv changed during sleep! 㿘` '>   > ` "` & & I& F& "$I   2 >y x  `"  ` 2" `  $ `&  i > a` " 2 $$ $  $ $ &㿘"H /f4 * ' * >`  "" @"' %>  ` ХLЬ@L@  2 `  "0@H 0㿘> (!> $##> `: > "b@ߞ@pmap_bootstrap: unsuitable number of segments (%d) 㿈> 'D'H`'L`2 L>  "#|> `>  "c|L> 8"`p>`D5> &!>#L> "aL#>cL> "b8%>t> "`'> > "cP)>#> "`+>`t> "c-> > "b(/> H> ("`@1> !|> 'L"c> >>>>>> "c"Pa\἞@7> 9> );> > > > ?&4' '` aH! " " 'L " "> > Da `kHL*+> -> /> 3> "$ ,` ,`@* @ # ?2 ,` > > 8 aL> *" * "b@!>$ t> "㈦b" %b(" %(" %> c  *  '> &cc"`?> "c> ?> "#% \  @  $ x  % \`@ & > !%>?"> "|ca ? @ '@ 2`<  < ? > > b $>  a'>   `? D4   D @  `'D`@$ $ "@& $`$ `"@&`> `0>  "`0$44``? ?%@4* @ 2` > " *  ` - > c > "* L   > #"  Ҥ@ >> > "`4$$"@",L ", > \ @ 60 > #| + @@ > >b  ` <   '8   ?Ь` д`  怠 @  Ԫ@>>Ȗ` 0+  c> # Є Ф rp->rg_segmap == NULL! 㿐> #>bh>3> &`4 \1> &!>c7> >&9> #'!H>;> aX>'`> #d)> aL#> +> "b(c> (-> " @> '>>!>#>%>'>"c> ؞8! > > > > bDԦ5> )> & ##!"8 P#`"# " > aX/> Ḑ "$","( `@m!>  @i> X  ;> )> 9> 5> * * * @#%a ?"?*> > 8 a#>`\$`t* 'c%@>> #$ `\* > c "a , @#$`p!l <%"@%' @%& @% *  '"> )" $(: $,``pz(  $` -@-*``$k`(-@ 2 @ cz@% @ 2 ->6"> - @$@-  , - q 2 ,@  z@$@?a c> c> ""`/> "c?> "#>&\  "x  &\ & &>?#>"`@>"`|> >#`Б4`* `$@*` 4` ! >`*@2 ` > a@ > )`@ >Ȕ> 0@ @ >Ȕ> `<`  |<` z> @@ ˑ4`#>a  > !> )`> !" @p㿘 "Ң!,   $Ң` p2  ?!Т@ $Ԣ`㿘> `  > #>`$+  p+ 2   #   g! 2   @  ^! 2  ,"@  & & ppmap_init: no memory for pv_listpvplL1 pagetableL2/L3 pagetable㿐>!0`  >   "@  > # >+ @ *@   !0>! >  "" *  > >"$  a#\ ^ >  > 8" l!> 8 H> >#a$$  K#\> >#\ da!! A 㿘> `> ! Ԃ@`>!`  > ) > "@ 2@ @` 㿘> @ ##> b8@@ 㿘  "` @@d @@㿘  "` ++& >  & & $&  & & >  b#& ( ( & ,   z@`> c @z` & 4㿘   ? & @a "pmap_release: segment list not emptypmap_release: releasing kernel㿘H /f * ' >`    "> ː!X    > !H 0 "`ay "`   >   > !>  (#& ,& (  " 㿘 V> #> ( @Y> '#>`  "0 @H /f@* '@'  6` ?`6` * ** :`* @ **  $* @ ` @@  H 0   "0@㿐. $* @@ / ` ` ' Ԫ@>  c`&2  >!P €@>a  @ @[> #`@ cO@F 2>>!L@>!0 ` >  2`@: * *2``# #@  2`@: `2`??*  *`  <  @"  f Ц@c@ @ `(,> `../ @: /  > \ > > b Ԫ@@Ю@`ж@` ?- 㿐. $* @@ / `   "Ԣ>  c`&2  >a   aP€@a  @ @e>   >`  ?* `cT@<?Ep>!L@>!0?6 `p>  2`@: * *2``# #@  2`@: `2`??*  *`  > @"  g` ?* zc@ @ >` ,pmap_rmu: no segmentspmap_rmu: no pages㿐. $*  ` Q /`> ې!P `E > > ϐ!hb2f> `2>` >`  | @I> #` ;5>!0 ` >  2`@: * *2``# #@  2`@: `2`??*  *` )$> c@@ `-_6 "% ` ? -` @_- "%@ > #&2@   ֪@` >!P €>a  @   Ԫ@>`  `>`>> ` >`  >` ?* d ]> J  2>>!L@>!0# ` >  2`@: * *2``# #@  2`@: `2`??>  * *`  <  @"   Ф> `2< <  | "> c@@ `9-> `./`.: /`   > > > bЮ@`ж@`^r "%Ȓ ` ? -` @^f "%@>`   0@"& 0 4"& 4㿐'P.$*  ɺ / > ~!P ` `2> r!h "Т@> > #'@2@ ` PP€@  @f` >`  ?* @  V/> <G  >!L@>!04  `/> >  2`@: * *2``# #@  2`@: `2`??>  * *`  <  @"  c p` ?* z@@ >` `4.> `/ /  P* ! Ң`/   z> dڒ& ? ,  " Ң`P(*@z@] "$pmap_remove_all: empty vregpmap_remove_all: empty vsegpmap_page_protect !PG_V: ctx %d, va 0x%x, pte 0x%x㿈> # > 42 0` >  2`@: * * 2`` #  #@2`@: `2`?>   `*`@ *  `4` 0H /f4'* ''   H 0쁊 0Ԋ@' 7>Ȑ ? '4- $*  4  `?> -"@*`@ ``2> #"`,`> `@2`  @< O |L< @\Ӓ "&@ ? - \ʒ "$    Ԫ@>aL€0@ >`Я@`> `з@`> `` <  < ?* ֆ>  "ؔ: @`'@`W 2> >  | @M"> #2> \ `> > b Ԫ@@Ь`д`Œ ?,-   > > Ю`@bж`@\W "`$@ ? - \K "%   0@"$ 0 4"$ 4> "$t 2  ' ' 'Ъ@@H 0쁊 pmap_protect: last segment㿐 0 Ҋ@'H /f@* '@ 9> +>Ȯ -/6`+ @  $*``6`  ?`+ + `:`* @ >#8 "o+` ` 2`f> b `  >`  |>` @U>  "@ @J@ "  Ҫ@@A@>  '%@`$ @ $`$`(>aL $`(€Ц@#@@퀦@0%@``+`2 Э`> 2 е`> ` >`  >` ?@ * > #Ђ@ Т@@ @@ @ t6`H 0 Ҫ@pmap_changeprot: no segments in %d pmap_changeprot: no segments in %d! 㿘R> # > c .@  !!`  @6` ?6`H /f * ' +   $*  `2 >"Ѐ> >"Ē 0x +` " > b   > ` >`  |>` @ @Q*@F&@@@   Ъ@@@ @= 2+>!L@%Ъ@@>`    Ҫ`  Ҳ`` >`  >` ?* @ @.@ @H 00  `" H pmap_page_protect4m: empty vregpmap_page_protect4m: empty vsegpmap_page_protect4m: !TEPTE㿈> c> 402` >  2`@: * * 2`` #  #@2`@: `2`?>   `*`@ * `Q`  0H /f4'* ''` "H 0 0҂'쀦v  6 -``$*  6 ` ?>J!,`  2?>@", @` "`Ԣ>aL€0`>    ":>("( @@ z@ 1> #@,@ -`,` !`,` z> `d  % ? , @ "`("``(-`@z@Y "%> "$ 2` ?& &&"Т@H 0 㿘 ~:0w"H /f@* '@_ > c>ș6``+   $* 6`@ ?+ + :`* @ >#8 ` *@ 22 " Ң`$: > `"`$@$-> <>  ` >`  @ ( $(`>!L@p`@z@@>` @ >ȑH 0"㿘!> #> c .@     > ` "`H /f * ' $ " Ң<  2p>!L@p Ң`"⢀  ?` "`~H 0pmap_enter4_4c: can't fail, but did㿐> #|`>`  > 8t > 8`l*   >; > c>  06  `%>  >  2`@: * * 2`@` #  #@2`@: `2`?>  `*`@ *  #> %>  c ?6 *@   @   @@ʚ  >w!8@㿐6`,` $6`*  `?6,@ H /f * ' >  " ^@6[ #@  H 00I >!0?. 􀢠 >  2: * * 2` #  #@2: 2?>   `*`@ *     Ԫ@>aL€  ,  @  @b  (> 钐! >4  >Ȑ - \ `?Ԫ@` Ю@`ж@`> #?> "@  Ң @H 0 㿐66`+   $* 6` `?H /f * ' >`   0 4" 2  :  & & 4    & 0 2" "UU  "/> %-  ?4, @@> " "*U9   ʐ$@ , />  - > "   ` 2>` >`  | &    Ҫ@@>a  @   Ъ@@`2 ֪`> ֲ`> ``#>`  >` ?* 6a #@  H 0 < ?& <L >!0?, 􀢠 >  2: * * 2` #  #@2: 2?>   `*`@ *  t` >!L@  , < & < @ Δ@!`   Ҫ@0  Ъ@@`2 ֪`> ֲ`> ``#>`  >` ?* @` 2>` >`  | $H 0 㿘> #~ 㿘>  6@ `  #> # ϐc#㿐@?x*  `@` <@>> 8 l`9> c>  06  `%>  >  2`@: * * 2` #  2`@: `2`?>  `*`@ *  > %>  #``6* @`"  `@/@˜`  >!8    $ "  $ "pmap_enk4m: can't enter va 0x%lx below KERNBASE㿐=6#@>!6`* @ $*` 6` !H /f * ' >`  ?*  `2W  <H 0B0_Fp>!02 ` >  2`@: * * 2`` #  #@2`@: `2`?>   `*`@ *    "Ԣ>aL€ p ,   7` /@ Ц` ?*`@z@H 0 㿐6`,  $6* 6` `?H /f4* '  " "R  /z"$, $ 2>  dC , $   ? z@`㹐  (2   z@- @#@>  d& 2$@  , -  , >`    ? z@`㔐 2   z@n >` ?*` `] ?<H 0a < ?k& <K >!02` >  2`@: * * 2`` #  #@2`@: `2`?>   `*`@ *  є  >!L@  , < & <  7` 4/@ " Ңp Т` `?*`@z@H 0 㿐`x* `  ``> #>6@ !0.`@ 􀢠 >  2: *@ * 2@  &@  #2: 2?>   `*`@ * "> #, >`  "0@㿘> #S@>   㿘 p6`*`  $* 6`g `?*` > " @ B# @@  > `2  "Ң0Ь@@؆@' 1>}    "Ң Ь@@    Ҫ`  Ҳ` > `#>`  >` ?* ؂ @  > `2>` >`  |   > # ? + + @ @ &     $ 3 ((  3 ;  >  > 2( ?+ /" 㿐> c> 40 `2>  2`@: * * 2`` #  #@2`@: `2`?>   `*`@ *  " ) ?$  㿐> c> 40 `2>  2`@: * * 2`` #  #@2`@: `2`?>   `*`@ * 2      㿐> c> 40 `2>  2`@: * * 2`` #  #@2`@: `2`?>   `*`@ *  " 覐 ?$  㿐> c> 40 `2>  2`@: * * 2`` #  #@2`@: `2`?>   `*`@ * 2    b  㿐> c> 40 `2>  2`@: * * 2`` #  #@2`@: `2`?>   `*`@ *  "  ?$  㿐> c> 40 `2>  2`@: * * 2`` #  #@2`@: `2`?>   `*`@ * 2    鼐  㿐> c> 40 `2>  2`@: * * 2`` #  #@2`@: `2`?>   `*`@ *  " } ?$  㿐> c> 40 `2>  2`@: * * 2`` #  #@2`@: `2`?>   `*`@ * 2    9  㿐> 8 l!> `9#> #> a06 ` >  2`@: * * 2`` #  #@2`@: `2`?>   `*`@ *  #+#`?6* < cԤ> #O Ф㿐> > # 06  %> >  2: * * 2` #  #@2: 2?>   `*`@ * >! `ِ  ?6@ 6 *@ a0(  >  3 : *@ * 3 @  #@  $?3 :  3 ?>   `*`@ *  >! `隐 `?6@* <  Ԥ@> # >!L@ Ф Ҥ@㿐> #h` !> > #> # .$#l$h> 8 l`=#> c> a06 ` >  2`@: * * 2`` #  #@2`@: `2`?>   `*`@ * >! `c0 c`>6* `  #l 0Ԣ`hz@!> #l Kc#l 0Ԣ`> ch z㿐> #p`%> +> '> !> ##> c$x#޻ %p ޵$|%ct> # >6 0  `>  2`@: * * 2`` #  #@2`@: `2`?>   `*`@ * >! `c踐 c` 6@6!0*  >  `2: *@ * 2  #  $2: 2?>   `*`@ * >! `c| c`>6@* `  x 0Ԣ`pz@| 0Ԣ`ctz@> #|!> c #x>!L@#x#x 0Ԣ`> cp z> c| 0Ԣ`> ct zkvm_uncache: table entry not ptekvm_uncache !pg_v㿐> `2j" Ң `>  > #@  ">>!!04  `0'> >  2`@: * *2``# #@  2`@: `2`??*  @*`   .  ) " ?  Ф`|@<2>!L@`"0^ ]> #`# &>>!(!0  `'> >  2`@: * *2``# #@  2`@: `2`??*  *`    㥔 ,2>!L@`kvm_iocache: 4m iocache not implementedkvm_iocache !pg_v㿘> `2> p  > > І    Цc> 2$$  ` *` (`"8> |@:88> " "@㿘>   >ג 0 >Ң㿘 H /f * ' > "@   >ܐ0!`@> ` "Ң0 Ҫ@H 0㿘> ">` * > b>  u * > #  > 㽀> `  "Ң"  Ҫ@"#ʠ'> c`> * >`?$  ' # # > "`  * # # >  #'> F$  Ȓ" ``4  ?'> F' @$  `Ȓ" `4@  ?2' (>>  H/> F   ?? @$  `Ȓ" Y`4@ >` A> " 1>`  `> `> "7> FЄ' @$  `Ȓ" &`4@> c? b>>` b Ҫ` Ҳ`> F`Ȕ"㿘H /f * ' > #>. H >`  " @  "Ң Ҫ@ > #U   H 00/ 0Ң`{. 0Ң`{ 8>ք H 00Ф.֤>!H €  "0@H 0 diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKsvr4 gethrestimesvr4 gethrvtimesvr4 gethrtimesvr4 setpsrsvr4 getpsrsvr4 setccsvr4 getcckgdb exec4.4 syscallsvr4 syscallinteger overflowfix alignrange checkclean windowsflush windowszero dividebreakpointsyscallv8 store errorv8 idiv by zerov8 data errorv8 cp exceptionv8 unimp flushv8 cp disabledv8 text errorv8 r-reg errorlevel 15 intlevel 14 intlevel 13 intlevel 12 intlevel 11 intlevel 10 intlevel 9 intlevel 8 intlevel 7 intlevel 6 intlevel 5 intlevel 4 intlevel 3 intlevel 2 intlevel 1 inttag overflowdata faultfp exceptionalignment faultwindow underflowwindow overflowfp disabledprivileged instructionillegal instructiontext faultasttrap type 0x%x: pc=0x%x npc=0x%x psr=%b EC EFSPSET%s[%d]: unimplemented software trap 0x%x trap T_RWRET 1trap T_RWRET 2trap T_WINUFfpe without being the FP usercoprocessor instruction T_CLEANWIN T_RANGECHECK T_INTOF 㿐> c``@ 3"`   e @  퀦   [ 2 > `"`&&> >  x`4 > 8!.  > 8!> "@ 2 >   $!$ ! #  "t' e 0; q  05 "' ؀ 倦 0+ $ * 0% (>  >    0   0 0  0(??"q` 8 4> 9 (`> >  xǚ`'   4> !  ' ږ @Dڒ #> 91> ˚ Ԑ'  Ȗ   Ö !(  >  * G!> 8`x!$!(> !P`2 '    q#>a !(͐$a &@ [ #> 9 > ` >  H`  @ [| ` "$`> א @  H`  @ [e `X``y @ [\ ` ?> !k$`!,  "Q'  C #>a> !C!($a!(N#> 9  / > !8'  & '     `'&&  Iw!X> r!h `'&&  X#> 9!, $!,`&&[!x `'&&  X#> 91> 3> ZI 耢`  ,( @ Y  ! ,!`,`   ,@ $`,*@ $ ,Ԑj D " ,h&  Z 耢`  ,( @ Yn  ,  >  "A !.` >!@*&㿘! ` ` 2 x  x @ 2??  @$` 㿘! " text fault: pc=0x%x ser=%b WRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGkernel faultdata fault: pc=0x%x addr=0x%x ser=%b 㿐> #> "@` ">   д> #|`>  o @ @   @.1 2! H/` />">""(>"l"h "> >( p@L> `2I! =# >`W :! $!$  @   " &)`P`=  Ԁ   > " ȑ2 8&  "   ` ,`` !   ``H/` />">""x{"(>""h'`n'`@'    W6`a1> 9#> %> X 耢`  ,( @ XA  ! ,! ,`   ,@ & ,*@ $ ,Ԑ`D " ,fː  X 耢`  ,( @ X  ,  >  " !,@ >!@*'@text fault: pc=0x%x sfsr=%b sfva=0x%x CSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWdata fault: pc=0x%x sfva=0x%x sfsr=%b 㿐> # > @` " >   Ѐ + `` `>!t @ @`  `  z` #> 9`0p @"`0$Ђ`  i`#Ђ` `@.  @`  @`2Z! `3 2! H/` />#>#">""h "> >( p@8> `25! =# >` &! $!$   Ԁ   #> " ȑ2 8&  "  (``"'!   ``H/` />#>##P(#>""h&j&  U`a#> 9%> '> W 耢`  ,( @ V  ! ,!`,`   ,@ $`,*@ $ ,ԐD " ,e|  Wq 耢`  ,( @ VĐ  ,  >  J" !, >!@*&syscall cpcb/ppcbsyscall trapframesyscall nargsp> c`>  "`@ @@> "@> ! ">% 0#@" >% H$!$, `0 Ъ 3   0`0`4  >Ԑ"X  `8  .  `* )T2`؀$`H>%ߐ `"-`@  \*    @`2D T8= *    @`2`4T7`4''Ш??, 2 Ѐ&`0 &`4  `    @*@`&@&`  `- @`@@&@&`&`0&`#> 9%> '> V} 耢`  ,( @ UА  ! ,!`,`   ,@ $`,*@ $ ,ԐD " ,dZ  VO 耢`  ,( @ U  ,  >  ("u !, ` 2@В7@>!@*&@㿘!$ !> 9#> '> V  耢`  ,( @ U_ ! .! ,`   ,@ $ ,*@ & ,Ԑ-`D " ,c  U 耢`  ,( @ U1  ,  > # Ԕ!, `   ,   B 7 diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mappagemove 2㿐+> )> !> %> '>&#> aH #q €b8 #@㿘>`@N 㿘> #` . B"  > "耢`2&@`4 H &@>` @- "C  㿘> #`@ .@ @> "耢``6@   Cܒ dvma_mapin: null page frame㿀> 9 8`)> ##`8#  @ @8    :@ @ Ho o `8> ?#x@ #\ #`#`#d ?0> #x? @#\ #`#`#d vH 0`; ??-'> %> 9> 7>'5> H # >* `'   @ ?#? 'ܲ@ >a 2aH€dvma_mapout: extent_free failed 㿘> #.  >Ȱ  . 0> #ԔH/` /> cxw >'̐# H 0>a aH€vmapbufvallocwaitvmapbuf: null page frame㿈 0@2 ,>(- > `  H& L#8 @ "@ %>(  _  Hc''#`#\  Ț >(`&& H)> 1> '> %>(#> !H >8!` 'c  @   @ 'vunmapbuf㿘 0@2> >(ѐ!#> H8 " @  `ʔ  L>& H& L   @ <H"@ cpu_fork: curproc㿘> "@! a {H $`>  " >("P" !(>!  *6  * @`!&a(!(!%&a(% @ &a$ P& H $  & & 4& 0P$  " >(  $ $ $$ 㿘!(  #>a2$aB *1"!G 8 !\&66&(!$ P! !(`'>! 2!(ؐ !(!@aN!"(H ''   '#\#`#d#h#l , !\ #\ #`#d#l#h,Ր   &sdcd㿘 ֒ ?`>)!@@j}   >)!H@jv  0> `$```N` s  4@     2 4N` s24 4*,   "$`disk label read errordisk label corruptedno disk label㿘< 2 #&< 6   " "    #" @&& W&X(' D' T' @( ' 0' <@r 2 Hݔ" ' 0 >#1>)7"h#@2 = ", 6"@2@@ؒ! !W@@nI 1>)"!  @`Q"1>)" 㿘`8 "; `( !25 @, !W@2- ` 2) n "  `* @ .*  @   2  @   n ?[! 㿘@  ( HL"$ D$ T$ @($ <$ 0@ϐ㿘D <*  a@c`8 *: `( 4 T @`2 0@22 $$44 `< $@,`  $4$<`(  ~2` T`8@gp$@0?($0SunOS disk label, bad checksum㿘"  @`@ *  1>*#@!W&`&@"&`  &` &`  &`(&`$!&`,!&`0!&`4!A!&`8=!&`<!6`B! &`D!> 96`H!@6`J6`&`&`!`($ @ $ ,  , $  $ , 4 ` a " "*   gG#ꀢ@216`   @  @`@  2#6`> 9 @  a?$  $,  @ `, $  $ , 4   6`l6` 㿘 ("2  , "  0 x  &@ &` &` $&`  H6a F 6 6a B6a J6a 66a F6a 26a .*`*2 2`6aa `@g/ O@f$@$`6"6a    `     `@ @ "4(&`gG#&`! ` @f @fV$@$` ```Ȗ @ b@`@ &` b``  " "  &` @ 6a@`@ 6a 㿘 @- @"+ >?  @29?@^H &  66  F6  26  .6   J6   B6  H6 F6 6@^+   8 . ` @f " 8 "@e&& **`@ @   }4??(@  ?diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK`   * 㿘`=>#`Ѐ :N.   i7i6i5i4i3i2i1i0l7l6l5l4l3l2l1l0o7o6o5o4o3o2o1o0g7g6g5g4g3g2g1g0wimynpcpcpsr kernel: keyboard interrupt 㿘> 9"` > ##`@>- (@?kernel: %s trapFaulted in DDB; continuing... 㿘3? #> 7>#` 3 > 8!* >-} > at #> 7>- #> 7b@ Pi`H`P `d!> 9" `$"  "`H$"R `N P 㿘> !`l€prom㿘> 9."diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK?%s(0x%x, 0x%x) at 㿐N `?#> 7" ? <=#9 85>-"p+>- [y  "'bx #>- %>-)>-.``אb`.`ѐ ̐"  <=# 8Ҕdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKi7fpi5i4i3i2i1i0l7l6l5l4l3l2l1l0o7spo5o4o3o2o1o0g7g6g5g4g3g2g1g0fqwstateotherwincleanwincanrestorecansavecwppiltlpstatetbaticktttstatetnpctpcillegalasrfprspcasiccryxcciccfcc3fcc2fcc1fcc0pageone_writen_writesone_readn_readsfqtoifdtoifstoifdtoqfstoqfitoqfqtodfstodfitodfqtosfdtosfitosfxtoqfxtodfxtosfqtoxfdtoxfstoxfdmulqfsmuldfdivqfdivdfdivsfmulqfmuldfmulsfsubqfsubdfsubsfaddqfaddd34efaddsfsqrtqfsqrtdfsqrtsfabsqfabsdfabssfnegqfnegdfnegsfmovqfmovd4efmovsswapaswapcasxastwa8r7rprefetchaqrprprefetchldstubaldstubt2ds2dcasaldxaldshaldshldsbaldsbldswaldswstdastdstqastqsthasth6q6pstx5q5pstbastbe8e7eqepd8d7stadqdpstlddalddldqaldqlduhalduhq6p6ldxq5p5ldubaldub8e7eldfaqepeldf8d7dldaldmovrgezmovrgzmovrnzmovrlzmovrlez1jdmovrzsdivccsdivretrydoneid2dpopcudivccudivrestoresdivxudivxsavemovomovulemovugemovuemovlgmovulmovugmovuojdmovvsmovvcmovnegmovposmovcsmovccmovleumovgumovlmovgemovlemovgmovemovnemovn0jdmovasubcccsubcflushTdsmulccsmultvstvctnegtpostcstcctleutgutgetletgtetnetn0F12FtaWdumulccumulqpreturnPdUNDEFINEDmulxqdpdjmplYdrdaddcccaddcimpdep2sraxsraxornccxornimpdep1srlxsrlornccornFPop21Edsllx1DdsllandnccandnFPop1mulsccsubccsub1iT12Ttsubcctvxorccxor1iW12Wtaddcctvorccor1iP12Ptsubccandccand1iY12Ywrtaddccaddcc1id12daddfbofbulefblefbugefbgefbuefbefbnefblgfbulfblfbugfbgfbufbnap,mfbabrgezbrgzbrnzbrlzbrlexap,1lbrzap,ubvsbvcbnegbposbcsbccbleubgublbgeblebgbebnebna,mbaCdsethimilltrapncallnop undefined %s,a,pt,pn %%%s%%f%ld0x%lx%%asi0x%-2.2lx%%fcc%ld[%%%s + %%%s] %ld[%%%s + 0x%lx] %%asi%%fsr0x%lxl#%s%%hi(0x%lx)%%psr%%tbr%%wim%%y(UNKNOWN), 㿘> 9#  @ >0}m#` ` , 0~#0p70~@2 8   2  2 @  @ 2 @ 2 ? 42 @ @  2` @" ` ` 2@2`>0*#>0}4#`L .L@ ,2&`!/->0+)>0'>1L a p "} }#} *LL@ ؀ ,>1} L` Б* : `Eٓ*`>2" €> 94 "8> 9 "8*> 94 "8>14 >1 >14  |ْ `>1? |Ғ, >1 |̒ '?4 , >1@ | ??,* m , g >1| (>14  0>14  @| `> 9 8* 4 | >1| PL`72x>14  `| `q> 94 8 |>1? h|, L`82c>1|y x^>1|t Y4  `>1  |k P> 94 #- > 94 #ܔ | >1|\ A> 94 "> 94 >1 |O, 4>1 |I .>1 |C ?(> 94 "> 94 #8 | >1|5 >1|0 >1|+ >1|&  >1|! >1| ȤL >1| L  >1 |  0  D P T Ȭ X X X X X X X l | Ɉ ɠ ɸ ɸ X X X X X X X  X X X  X X 0 X D X X X X X X X X X X 4 \ X X X x ǔ X Ǭ 8 T Ȭ D  ( ܝ㿈\`d @> > `#8*` 66  4"@ 4"@`    @ 4"@  4"@& $#\#`#d@&"`?  @ 4"@  4"@  @J㿀\` ` d  ; ې  * @ Ր & : *  ̐ * @ Ɛ``` `;`+` ; ":`+ *`" "" #\#d#h#`#l#p ?` " ,`,`@,` @@   * @   : *  *  * @{ & : * ˦> >9> ? ``0` `?K?k/`cx +`? 8+ ` * @  `   +`H G/`cx +`  + ` * @  `   +`$ $/`cx +`  + ` * @  `   +`  /`,  F   " @?  * @ ސ & : *  Ր * @ ϐ &``.( *`;`+` ; ":`+ *`" "" #\#d#h#`#l#p @ 㿘  Ǣ`  * @    `@ : /`"@"@< ,  ` * `.> >#.` > ?.`x@ e8 `"``"\?" X?  *   $ * 値`F > >> ?.``x.@ 898 /```"``"(?" $?  *   $ `"@``@?@ ?#@`@2#@@8#@`@2@  ?#@`@2#@`"@``"@?" @߰?  + @#@ #@ * /`̰  ؒ * @ Ґ & : * ?``" `..`  : , , /` " , "  * `-> >#.` > ?.`x@ 8 `"``"?" ?  *   * 怤`u > >> ?.``x.@ 8h8 /``"``"W?" S?  *  `"@``@??@;?#@`@2#@@8#@`@2@`@2#@`"@``"@?" @?  #@ + @#@ * /` 㿘`'L &l \'Pdp` * @*   / @ @@ h*@ @%h/ *? ?@   @@ @ @,?&@̐* @ǒ*   `Bh 3> >#-` > ?`x.@ @޸8 --" ?0?0@ / @  @ @$@   $@ @  > ?#`x-`. @ 8 8@ h*`?`!" "@?"@? / @  @ @$   $` "@ @w?@s?8#@`@@ #@`@ #@`@2"@ ?0J?0G@ ,    @ #@@  @#@-@-@ . @+ h*$` !" "@?"@? , @   @ $  @$?"@ @?@?`8#@@``@ #@@ `#@@2`"@ ?0?0@ /   @ @#@@   #@-@-@   c"h `> >> >c-`@> ?.x L@*8 @--" ?0?0@* @  /@ *@* @ @$@ @ q @m--" ?0c?0`@2 @  /@ 2@2 @ @$@ @ I > >> ?#`x-`. @ 8 8@: h*L@`* 2?`)" "?"?0 @  /0  @ @ $0  $( "@ @?(@?'08#@`(@@0 #@`(@ 0#@`(@2$" ?0?0@2, @ #@@2 @2  @ #@-@-@i  @ hP*`$@2 `2 +" "?"|?(, @ $(   @  $(  $0?"@ @V?(@R?'`(8#@0@``@( #@0@ `(#@0@2`"" ?0 ?0@* @ /@* @* @ @#@-@-@i  㿐@W?#\@㿈   \%`@ 8%`,= `  45    0 .  +@*` *   `, `,  4    $`  ` `  ܦ 0@*` *    ``  #\#` #d 6`? #\#`f#d & ?` `  Ԧ  㿐 > ap >:@``0ap/@Z 0H /e * &  pa `H 00=& pH 0 HF d> ap@/H /e * &  p H ?`& p & p V V  H   p  ?& pOǐ H 0㿈 (   P   #\#`#dz ?< PH/` / 0`` & 0` & 0H 0 0& ,H 0  € >aP `@NV V㿘H/` / ,`  0& , & 0H 0  @ >aP@N2 V~ `0& ,H 0  € >aP@N  Vl `rcons_init: linebytes assumption botched (0x%x) 㿘> P& P"P > " "p" `:`>:sǐ#p0i"  " \& X @M  @4&  \@M @4& >!̨ `2` 2 2 2 \  $2  :  ?& H   "@2`@:`& L  & @  ?@$& @ \   `& D $ 2 (> > hl& & $"h"l@ @>: & (>:b `UД!>: H"`́㿘 ( 2.    @ "   "? `   &  ( @ې@`,H (@   ( # 3& (& 88& < @Ő2` ?@? ^ $ $ "@ @4  6` 6 @ ^( 8 @?&@@M`<@ ( @㿐 $ \@T H  N    (  L2   "  P " P  P  \s#\ $@"@ $  & " @ "@   @Ӓ 㿘`;><!*` € $3" $ .?,&  '?%&  $"@@f"0  "  @@ 00  $` "  $ & X d $  ĝ㿘`[`; ( 73$2 ( ;-(   ($! >& (& 8 8*` * ?А& 8(" =& (& < <*` * ?А & < @ΐ@ ( ?& (㿘`3>= *` €@ 80  8" "  $ 8 "  $ $ 8" " $ &i&0g $"  8 "   [Y& < $?"@ $@6 "@?"@ 8 ?"@ @6 ?"@<?:"@@06@֐03@ 80/@Y 80+@ 80' (!2& 8 8  ( & ( ?& (@l 0@h 0 (!2& 8 8 & 4 (& 4 `& (@W  P  H  ( 8 H 㿈 \ $@͒ H   ƒ L P  #\#`#dj  (` & (㿈 ( `2 P0` P   #\#`#dO  X (8 ` & (& X㿈 $` `   P  X #\#`1#d0@  \@x  L D  X  P H @#\#`#d㿈 $ \@c@ ` HZ P L  @ X"#\#`#d㿈 @4 "@" @ &"@ \: L P  H  @ D#d##\#` D L#\ X" P H @#`#d㿈 $ @" @4 \@@ $@  `@ H L  P@ @#` " #d#\ \ @ H"@ L@ X@  P#\#`#d㿈  @" @4 \`ђ @̒Ȑ L H  P@  @ D #d##`h#\ D L" X P H @#\#`[#d㿈 $ @" @4 \@@윒 $@엒 `@쑒 H L  P@ @#`"  #\0#d H \ L@ w P \` X#\#`#d㿈  @" @4 \`] @X L P  H@  @#d D ##\#` \ L  P H? @ X#\#`#ddiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘~  㿐N > ?P @VV $皖 + > ?"\&a&   /diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map >?*            ? @ H P X ` h p x h ` ` ` ``  @2 `@2 `2 @2 a2"b2$d2(h2  ` `2 @2 2!2"2$ 2(R "  "2@?? 2@ 2` "` "` "` "`S  " 2 ??2  2 2  ::  :: "R "  "2@?? 2@ 2` "` 2` "` 2`S  " 2 ??2  2 2  ::  ::S "(`f 2T J  (< 2 0A  $ 0`@ ږ 2/ 0V     $ 0    0  B@ B  B 2?@ (?  0'E 0 ,?`$ 0I\ 0㿀@U '`" '> ?@P@TŚ  `> ?@P@T `@''ؔ / @2+ ! `2%  , 2!   2`0  &`0V` `2 `0` `a `0`,?`&`0I`0 㿘㿀@U4 '@> ?P@Tl `&@'''㿘㿀``  8`  @ @ '?' g㿈@U '@> ?P@T8 `@'' 㿀` ``: @'?''㿀```@'?''㿀` ``: @'?''"㿀```@'?''@`' ` '>B"*` €`''`'  & '4 4` `@'44'''4~` 1@Th'00@Tl `  |P  r @?'X谒 h  b`0 @T9',,@T= `'Д $ L̔  B,谒 <쀢 9䷔  3` $*`   N0"`@'|'xx | &P`䑔 $  8@ N! X!!!! !X! ! !!!diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿐  `b{&& bbb 0:" 5 b~1b| .  @ '*@ @ ?"*@ )  2 "| "{    diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘` @ "Q   ?K # @b ,>B"#>a<#>Y/ ! * 0" ">F!>R 2 >c P # #"!!  `@ 0 ,?`$ 0F 0diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK "`"` "`  "@ "` 2` 2` "` "@ "`"` "`  "` "`㿘 &`, 6`0 &`4 $&`8 (&`< ,&`@㿘Β ,&` 06` 4&`  8&`$ <&`( @&`,@R ` 'L``` 'r'>D!*` €` `"b'``]`XU'` "O'` "H'` "A' ' @@RdL"@q耢 9P@ @ 20` T& ''L@RA @"`Ԕ T 2PΔ @ 2 : !`!`!`!!`!!!!|!㿈` `'`''㿈` `'`''&㿘@ 0  0 M 㿘  &`, &`0 &`4 $&`8 (&`< ,&`@ 0&`D 4&`H 8&`L <&`P @&`T D&`X H&`\ L6`` N6`b㿘ؒ ,&` 0&` 4&`  8&`$ <&`( @&`, D&`0 H&`4 L&`8 P&`< T&`@ X&`D \&`H `6`L b6`N㿈``'`'` ''K㿀``'`'` '`''㿐``''o㾰@Qc `'`'' \@Qc`` *'C` ` 2@  '耢 7 \ 2/xe`  p%`  x' p`  px' 2nŔ \ 2  㿘@ 0 o z 㿘! 6`4&`, &`8 &`< 4&`0V $&`D&`@ (&`L&`H ,&`T&`P 0&`\&`X㿘 ,&` 8&` <&`  0&`4 B6`$ H&`( P&`, X&`0㿈` `'`''㿐`'㿈` `'`''Ւ@P `'<` &' 8@P<`` '`` 4`` &`@`   p 2R 8 "`E'`?` >>F ؓ*` € 'R耢 0` *  8 #@[`  p '쀢" ' "'  2  '$ !!!!!!!!!t!㿘@ N0   N0O X ]fdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿈 "``h耢 //77m  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿀@'` '@O '@O ''?' $ 㿀@O} '@> ?P@N `@''' Ԓ㿀@Of @'> ?P@N `'`@'' 㿐<@`  &㽈` ` ?@ @`''7@B"@Ҕ  @ `@"$`$@㽀` ` ?@ @`  ??7@Bf"@߭  @ `@"$`$@㿈  @ #>G``''`0 "`0`x @Q`0?"`0`,  B`0 ` " &㿈  @ #>G``''`0 "`0` @Q`0?"`0`,  Bq`0 ` " &x`2) `2`#  `  `: ( @> ?'''''`@*@ `@*'ؐ6ذx`?2' ``2` ! >   `( `@'#'''?'`@*@ *'ؐ ذ㿐 !2 + D@ D >`0 "`0(`X`<`   @ @ؒ   0" 0`, Aؐ`00ې` "$` $`  0" 0`,  AÐ`0 x @M'L'> ?LܔPL@M/ < @ L'''0''㿘`?* `@֒㿘` 2`# @ `+  * ``Ò @!<>H( 6">d2">l."„*"> &" #" < " ">">">""  "> "> $"  !#d!"!"!"!"!#!#!#!#!#!#(!#(!#!#d!#d!#d!#d!#4!#d!#d!#D!#T!#d!#d!#d!#!#!#!#!#!#!#l!#x!#㿐@   2@ &@@ 2` &@`@''@V㿐@   2@ &@@ 2` &@`@''@Vsbrk: grow failed, return = %d 㿈>  c`@   Є*   >` '$@( 7  `* `  * `'##`#\ ?? >I!dʒ0``@ đ: @$  7``@  ē:@ " $ İ (@L '@L H'', [L H T#>'aPaP@?6@@?3'zaPaP@?*@@?'?'', 2$ H ,_aPaP@?@@? 'SaPaP@?@@?'TEaPaP@>@@>&@ x@    0D7 = 0?   . aF . 6`  &3 @L4 'ܒ @L8`*   :? ?˔  2 ''*”   `&   $`А &  `&㿘% > !䀦 "   4  2 4 㿈@`B>J"*` €''' "&!3` "! "* !   `4#&' ` " ! 2! !`  &``''' !*!)!*!*\!*t!*㿀` "`   N0!2  NА"@&  ` q`@'''  N㿘@ 0   0 Nx@?e  'x 'N 1 4`'!4  ''``>` ''|2 > ?>`> ?b* @'    "*` `'  '|ɔ svr4_wait㿘@ " !  " T ? ` &`&` T ^ `" L 1 4  ! @ 2N LL 1 + 1` '&!0` 2g` 2c  X " `$ H ` $ `@ 8 & `4!0 !4* H 0H*`:  2 L , 2 L(` ` " L`2& $ ,&!0*``U`+ 2`2` # @2&>K!  P  ` .  㿘  D&@ &` `$&`  &`  &` &` &` &` &` &`4  &`4  `4 &`4&`8`<ܶ `\@>c @㿘  D&@ &` `<  >`    >`  :>`   >`   >`(   >`0 ܍&`8&`L  &`L  `L &`L&`P`T{ `t@>( @@@J '!@J@> ? P@IE@'' Hڗ!  r`ړ @@I '!@I@'' Ht!  O`p (@I '!@Iǐ@''ْ HQ!  [`M p@I 'Ԓ @I@I @''''4  2'ܐ''B      ' &㿐@   S@ 㿘"` N 0  0`  㿘 㿈`'`@''㿈@''''C 2 &  㿘%㿘 0  0diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map 㿈\ ?^  2`  ?倢` >M#*` €                   7 -h 0찒  u0! 2` 2 > ?"""`(@1&\, ?",`0?"`0`,   ?""` 1    ?`" "" $ diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘@<4 > ? #8 ?: *` + +@   `+@@ &@ ?㿘@< > ? " ?+ +@@   :` `* +@ @  &@ ?㿘 `&@ &`  &`  ` &` "` &`@"` &`@@"` &` "` &` ` @&`㿘`&` &@   &@   @ &@  " @ &@  " @ &@  @ &@  @@ &@  @@ &@"@ "`"`  "` `"`"@ "`"`  "` `"`P@ P @GH `` '@GH  @G@ آԔ 25ȐDϔ "@( @> ?c8* @'''(n 2 Ȑ׭ ؐWר  h@F `@ '̐@F  `@F ׃ 2/ؐe~ "'" 'А')Ѐ 2ؐb W]  H@F @  '! ?& > ?,#8 b"Q  h`a"` NVdFv N@"i q N   *@';' @Fz@Fv `'А'''@:u 'ؐ 2N ' ?&D  = а 9&*@'' *@ ''(ݒ)@F=  ''''@:< 'Δ 2 'x     *@* '(㿀`  ``֩  :` 4 ֗  .˒H/` /@`"```  ?`b  $`*@$`?" @$`H o@㿀@   0'` 2 "   '`@9   : * +@& `? x@ 0  dܐ'(^㿐``> ?#8*` @''(  &@   N $a  @`!x`!x "@㿐 '(diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKsvr4 socket cookie mismatch㿘`(> ?   > !x"!x"` ""> !x " >Q 2 | t2 | x2  |   "& [ߐ&   2 㿘`(> ?  > !x"!x"` "!x!x2| 2||`"`"|"@ t 02㿐> ?   > !x"!x"` "  m $ x$ t$$   h L 0 ` , , > !x!x`$ | |"` |"x$ "x 㿘`?`>Q#*` € &`  &`  &` &` &` !G!G!G!G!G!Gdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK 2 2 2  2 @2 @2 2!2" 2(H 0 a G&!W  0P0!J > '#'  2``2 ' ԍ 2*ؒ @7@ W7Ȑ {n  2 @  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKunknown㿘@7 ?  2`  ?**&@ <&` 0   &` ?&` ?&` >R&`  b  2  * *`@ &`$ 4&`0 &`8 &`< &`@ $&`D (&`H ,&`L @&`P <&`Tb&`X&`\㿘@7g ?  2`  ?**&@ < >` 0 @  &` ?&` ?&`  >R&`$   2  * * &`( 0>`8 &`@ &`D &`H $&`L (&`P ,&`T @&`X 8>``b>`h㿈` @'''@㿈` @'''@M㿈` @'''@|㾠@B ' `@B`> ?' ` P@B`'ǒ 2" p ` '< 0 2```_  㾠@B ' `@B`> ?' ` P@A`' 2" 4 ` < 0 2``Ĕ`#  㾠@Br `''@Bt `'    ` 2`  㾐@BK @''@BM `'1 2"ڔ ` ؒ< 0 2`@j`ɔ  㾐@B @''@B `'# 2"ҧ ` < 0 2`@7`Җ  㾐@A @''@A `'- t ` 2s`o  㿀@5͒ ``   㺐%@5> F`!@5O> `/@5I!> F` !/@5C> FJ @/ @>J(2  J J* ) * JJ#2 J J* :  c*@5!@/%0unsupported㿈@ 2`! "'> F  +  N0n"!>4>> F"<  ! "> !"! \ N">UE" N0T> 9 7 5 @3#>U0 > F- +"@>(#& !2L 29` '#\  + -!2: 2'` '#\  +w @;A `& ( `` 6` ~㿐` N@' `@'' Np@@ 'Ԓ @@'> ?@P@? `@`'ؐ >  ''''7  "0'ܐ-؁㿐@@ '@> ? @?P? >V4(             ?!W!W!W!W!W!X!X!X!X!X !X !X 㿐@@C '@> ? P@?{`?&` & & c㿘`?&` & & diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map @? '@:< @?' `@?'Ё $ 2 k ` 2 <  2 2  '耢    `2`2`" ` ` 2  (*  2 㿘` @@3 .`. `6 `& 㿘` i@@3 j` `. @* *``2@".㿘   (&@R@ "      &`   &` &`&` &`&`&`h  0   ۔ 2(˒Ȁ   N '؀ 'ܐ  '' @''' ' '''Ϲ'㿈 ϭ 㾈 "8   Ϙ 2.  ( ''쀢 " &  '   N  ( ''x'|'ts  h ,0   \ , 2)L耢    N ''̀'Ȑ '' 'В @''''' '''9 ,㿈   &  2'㿘?"@` &>X T*` €"ՔZI  !_!_!`!`H!`H!`H!`H!`H!`!`0hȐ@2L ,,8(  ֒ "  2   ?  ?'' ,''''&'''''ν ,     x Τ 2Ux "O   J N耢 1 Z0x ( jaOz !z 20'@='dd@=ڒu  'h'l'phG` `2 @1˒!  '|'  'xX  㿘``  `` T ) [ 'p@   N'Pؐ j'Ph@=t`T'TP@=w@=s P  2h`"'X`" 'X\ N`W`T N0S'\'`vX  PI'\'`X ے 2;LԔ  4LP@-  Ɣ &@    NhiL 'hkhL 'pͰL  ͩ  㿐 `b'    &&͊ ` 2 % ?  r $ 2 ''̒툔 2 ' 2?& & 㿈''˒㿐'В㿈 =  2%?c @ @    0 Ք  㿀? `]&>Z!L*` €fQJ ' '\䀢 2?` @ ?'@ ` ''F 2)`  `4''9  &Ag j !g!i@!i@!i@!i@!i@!i@!h!h$!h!h!i@!i@!i@!i@!h!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i@!i!i$㽸`@ 2`0  $`0`  ˩ 2}`0`?'` ˜ 2p`00?' ܀b ˉ 2]`0  V N܀ 2S`0ȒD ܀ E&    2 jX> j@:`'@:\ 2*`0؀ %   N!`0@'L'H'PEH`   '0'4'$@'(',' '8'@({&`0`,?`$`0.G`0㽨@.!@ 2 0u  % 0`    2c 0`?''`  2U 00?'' I ?Ȁ?C N@  =  j@:; ' @:>@:: 'Ӕ  2% 0``"@4 ``  @ R @D   ? '''''$`'''t 2 0ʛ 2 0     '''''@  2 N'3 ('5 (?'''$`   ?'''''$`@''ؐ'ܒ 2 0$`X 2 0   ( ''''''@  2 N' '=6@" '''''Ȑ (?''̒`'_$` $ #! $'!!' 2r 0@  k NА’ДȐ ''''@'''' 2O 0 2H 0 '@  2? N' '0 N''$`)$`` "`ː 2 0`Ĕ 2 0``ɻ 2  0` `ɲ  2 0& 0 ,?`% 0,Ð 0diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK!,"^ ! n"Z  2"V  S`Q K< L` "H  5 C` 2 >`)`": $"6 "X' 1`'$ ,` "&  `% `           * `2`` 2``2  (>^\(# ! 2 K n   !,"X$' )` "#%" !!w!w!w!w!w!w!w!x!x!x!x!x !x(!xL!x4!x@㿘  " .`  " .`  " .`  " .` !   " .`  " .`.`  .`!  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`"  " .` @  ?&@ @  ?&@ @  ?&@ @  ?&@ @  ?&@ @ ?&@ @@ @ ?&@ @ ?&@!@! >&@$@" =&@(@( 7&@@@$ ;&@ "@@ *@&@  `  ?&`  `  ?&`  `  ?&`  `&`( |&`  0 " a  0c b&`  @`$ ;&`  `( 7&` !` `*@&` "` `*@&` $` `*@&` ("``   *@&` n&`$ `  ?&`  ` ! >&`  `   ?&`  `   ?&`  `   ?&`  @`   ?&`   `  `  *@&`  !`  ` *@&`  "`  @ ?&`  $`  ?&`  (`   ?&`  @ `  `  *@&`  @`  ` *@&`   @` $ ;&` 㿘  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.` !"   ` 2.`.`  ` 2.`.`.` !.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.` @  ?&@ @  ?&@ @  ?&@ @  ?&@ @  ?&@ @ ?&@ @@ @ ?&@ @ ?&@!@! >&@"@$ ;&@(@( 7&@$@ @*@&@ "@@ *@&@  `  ?&`  `  ?&`  ` `*@&``  ?&` (`@ &`  #!" ` "#`0 ` &` $` @ ?&` (` ?&` @`! >&` @`" =&` @`$ ;&`  @`( 7&``*@&` $H`@&` `   ?&`  !`   ?&`  `   ?&`  `   ?&`  `  ?&`  `  @ ?&`  `  ?&`  @` ! >&`  @` " =&`  ` $ ;&`  ` ( 7&`   @`  ` *@&`  @`  ` *@&`  $ `  `  *@&`  "@ `"`  ("` "` * $   2@ ` 2`  2` *`2` * $   ` " ` ` `gx`,Ȑ`hx `@ @([ $   {ޔ $v  `@ 2m` %``` Ļ $ 2X ı  2Na C Ȓ?#`>b"*` €      @&`h@  s  2 `g@:!!!!!!!!!!!!!!!diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK *@ *` *` *` *` *` *@ *` *` *` *` *` *@ *` *` *` 2` *@ *` *` *`R "` *@ *` *` *` *` *` *@ *` *` *` *` *`  ?`#`w&>c#*` €`w@ 2ð֔  2Ȕ  2 `vu`c`@ l ؐä  2     {`@ vȐ[B z  2f> `X`t@ Sh W  2CK `u5@ 1 C* 6  ~ " 8  }    }   ~@ !!`!`!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!L!!!!!!!!!!!diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘!$`(`•'Lِ Z @%ޒ!x?&`( $` L$` `$`  $` $` $` $` $$`  ($`$ ,$`( 0$`, 4$`0 8$`4 <$`8 @$`< D$`@ H$`D L $`H&`$$ &@pc or npc are not multiples of 4! 㿐 $`(!H`   @ 9!$   >dIې#@ `(< @ * # #  #  #  #  #  #  #  # $ $# ( (# , ,# 0 0# 4 4# 8 8# < <# @ @# D D# H H# L@ Β@  `?" @& ?> ?*` "@"` "`"`@"`>e*5 "` . "`  0%   0 "`"`>e܇(   "` "`    "`"`!!!!!!!!L!,!!!t!!!㽐> "@`$a$a aH @  a*@ aa#a  = ?xՖx! ?''f'l ?G"  ?| >& >&>&!="c"@ `$H$$$T_SVR4_GETCC T_SVR4_SETCC T_SVR4_SETPSR 㿈> ?`"\@a$5 ?``81 >f *` €>eHQ#p" >eHL# $ 0>eHD# }?$ 0*`" *  * $ 4}3$ 0$ 4  `$ $ !!!! !4!4!!d(sparc) svr4_sysarch(%d) 㿘@>fH  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿘diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘` `   `!" ! ! 0  v  l > A#&adiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map       @  " $ "@  2 "` 0"! @0 0@0 "#@2$2(  @ > C"`X("`$"`( (!   2 @2 2 2 @2 2  "` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` ! " ` *`"  `*`   `*`!㿘       @     &@  &`  !"   0 "#0   02@2222 2@ &` 2  2 2@&2@2 22 &` > C (aȒ & ` &`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`.`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  " `   .`! !2.` .` !.`.`㿘 6@  6` ` 6`  6` .`㿘&@  &` `&`  &`  .` @ 20Ȱ  $0`2 )  `!" -!!"C`f`a "` a^j R`$`d"` !L w "<`k  /d% %"Ԡ# %  "8  !0FMe"`!uB<` `!&03!0!'p.!,' -!" !!!)!( `  ` !2!1  -0 !%0"   -@"_8Ґܒi֒/ -Ðǒ0 !0!! &`L`   20L "'LL  @H D'D  '@ `b@@`h@ 20`ٔ  20g77@u`h@࢒ 2m0'`' bvZ&`<`w@ `T(`"R0`< 2N0` `"H G0` @9&`<  `@ 2309` @2 `h<`| w $h`j  208 `@ 20)`` @`D $ 20``  @ݢ`/  20 f4`%  20`_@0` 20@ 20`  x` 20@ 20` X` 20!@`۔ 20~@ 2{0`Ҕ t`Ŕ 2m0#@ 2e0` ^` 2W0!@O` 2I0@ 2A0` :` 240!@,`} 2%0@ 20`t x`g 20!@`Y  20@ 20`P a@袒 20 '`'d'h'l'p't'| '''' '$'(','0''P'4'<''@D'H''``T'x'//''''''' `P 20P?T'X'\'`'d'h'l'p't'x'|'''' ''''\''L' '$'('P','0'4'T`'8'<'@'D `/2   /` `/@2   /@0"a؟@ 2>0K"a@ 4` '00 ,`` ',``"', 2 ', `@,   '( - b}@(U}0,?`$0s0R "  "2@?? 2@ 2` "` "` 2`2` S  " 2 ??2  2 2  ::  ::S "X`?` O>m!`*` €> C"` 0 @ ?*@ @9&`@)S'`@''@)S `'Ȓ  :А  0B *Ā '͔  !}`ʔ  -(``> C" 0  ?. !!!!(!(!(!!!!diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘@ ?"@̐㿀@( '@> A@( `&@'''㿐@( '@> A @']㿐@( '@> A @'ڔ@,w㿐@( '@> A @'Ȕ@,㿀@(~ @'> A@' `'`@''Ԓ㿀@(f '@> A@' `@'''潒㿐@''#4.2ffsnfs`@(> '4    ` @@&`@ y 2~>n``@%  >n4@("  &@>n h  "eg`p@%  \`  8 2Y  2Q8 T 4/8 X@'&`  'H @'  > CbИ  ?P'L'X'\'``p'd d 'd'hd`'l@'d'pĐ't'xL'`  2` HY X 2Ŕ㿐 ''Wϒ㿐    @<'㾈`` ?@ @ '7`'7@ڔ!@!  @ `@"$`$@㿈 p@ (( <`# ``''0 "0>n4 @*Z`0?"`0`,   `0 ` " &x`?2* ` ` $ @*@'䀊`'؀  > c В@*@ *'`` `:'`?''ϒذ㿘`  㿐 @L b`0 "`0`2`    "$ (`? 2 ``> C#H*` &``  0" 0`, 6 `02 `   `  [`  0" 0`, q`0>0`$ `(``1`0?"`0`, Y`0㿐 !2  C@䍔 =`(`0 "`0`碔`<`   @g @"   0" 0`, "`00%` "$` $`  0" 0`,   `0  10@N e> F  >   > F/  >p p ># @ǔ e㿘`  @ 40㿐@& '> A@@%= `    K`2`2` 2`&`J 2. 2+! `2% , 2!S  2`0  &`0V` `2 `0` `a `0`,?`&`0{`0 N㿀@ `P    㿘!  ` ` `|`x    r   " & /   "&  &  X @@ $ ' ' ' ' '  @' ''В'H@%[ '@> A @$@ @'''''  X  D    <>*@$ D`㿐2@ $`( X D`0 "`0 `0?"`0`,  Ԑ`0  > <*@$ D` 㿐@$ '> A@@$6 `< @@ ڒ0@>q(">d" <" ">l " "„"  !!!,!8!D!T!T!`㿘@   "@@.*㿘@   "@@.<㿈@> C# 6 > C#\* " ` '`'`''X 㿘 !2 > Cc @  c@@"```@ @Z 㿈@`> $` ;`"B ` ',`  '@ $ $  !* 2$ ! "!  $ ! "   $  * `$ ϔ 2`  " ?!   $ є  @h % * @,`@@,`@*` ,  ', @ '`H* , `H`@x, '`* , ` @m, @'x Magma 2+1HS SpMAGMA 2+1HS SpMagma P2 SpMAGMA,P2_SpMagma P1 SpMAGMA,P1_SpMagma 8+2 SpMAGMA,82_SpMagma 4+1 SpMAGMA,41_SpMagma 2+1 SpMAGMA,21HS_SpMagma LC 2+1 SpMAGMA,21_SpMagma Fast 16 SpMAGMA,16HS_SpMAGMA,16_Sp_2Magma 16 SpMAGMA,16_SpMagma 12 SpMAGMA,12_SpMagma 8 Sp - 422MAGMA,_8SP_422Magma Fast 8 SpMAGMA,_8HS_SpMagma 8 SpMAGMA,8_SpMagma 4 SpMAGMA,4_SpMAGMA_Spmagmamttymbpp㿘!?΀@.`  && "@*`" * *   2 @@ ,`h H( h(  * H 㿘> C#`" @  @ magma_prom %s (unsupported) clock pri %d softpri %d: %s h>s aoQ '" > C, #` @U@ 2`@`@O 2`@` >s>s!;0o^a@`'̒`'Ȁ  >s%>s,7>v9>y;>tL  -`*` :`*  L?Ѐ  :`:&``&`0`4 &`4u ` &`t` &`x`  &`|`6J`4 @ K ~`$+  + 4 &@ @ $ @   `@$ @ *@@ے    @א  `@  *"@ *`" *  *  &!: !@ڒ#,` " ``4 2` * $ ``$`4 `8`+   "`4༔  C #ؐ  > a`&`&`z>ub<&`&`z 㿘0    4 g@ ` `d `t %3 *` *  4 `??P `? b?*`?"@" 2  8"*` *  4@ @  b? ? `$ `  `* `b* " 2 ?"  " `  "$  `*@ `! | 2`*` *  4 `m    "" "  `*@  x `(2`* *  4`  c *@  "`b"  ] *   T"* *  4@ 8@   c*  *    ?#     c*  *  ` ?#  ,` 4 , c (   # ,`# (`*`* ,` $ ( , "  "     *   ? #  `*@  > ` ڒ 0 %s%x: fifo overflow %s%x: ring buffer overflow 㿘  u 0q >ز"t,*  4 `p _  $@)>ت"l)>u     @    $ @   "7 `h*`@ €  $@ݖ Ho o ?$ H 0   `h*`@ €   >ub  7  `H (`P{ " `p `h $`p* @ 0,$ 0 4  "0Ho o ?$ H 0  "0 0 P >v    `? : %d tty%s s㿘&    +>vt;>x>y"`$ $ $`$ Ȕ  &$`$$``  ?@"   ,- * 4 4 &@ `@" t@$` &`0`>r"X>v! 89mttydcd㿘> E  `2`  `* @` `0, *  4@` p b$ l"$ pl֐#  c$ $ $ `  $ ` @  $ `   $  !%$ $ $ `$`$$` H /e * & @ h `,`*  @   @  *@@Dq  * ` `2 p`  p &$ p ?#$ p$`I H /e `H 0 p =8$ p* & ``   p " #>v$ p !b0s(   p "H 0 h>ؐ"X*` €㿘> E   *`6  . *  4@ > h"X*`  €H /e * &  @ p  @: H 0b 㿘  > E 6 . *@ *`@`<> hX*` 㿘  > E 6 . *@ *`@`<> hX*`   > E 2 * *` (<㿘> E   *`6  . *  4 > `h"X*`  @ ifK a ]@ P `y@3`x@0P `z@!`{@" G  k@ "+  j@*\@"0 8 l@m@"/    $   0%    @ 0@ 0@ 0 @~ &  &!2J "  $ l> E* 0(@(4H4p(p 2 "p " H 㿘 l> E `  `*2` *` *  4H /e4 p* & p V  H   & pw HK͐  H   x H$ , P$ ( p & p H 0 H(  h(";`"' 0TDQ l2 m2`@2` 2` "a`@6 "2`@00@22` m*2` l(0! @ ` m *` l *0` @ ` m(` l(H  㿈 l> E ` *2 @ * *``4`(      Ŗ 2 `$   耢  H /e * & `(    S`(`  v r* * `$   | x* * @J   @G `@ @ @ @ "`$2 #!"  " "" *@`@  " *@  * @   @  N *@ *`@@2  "`` *@ * ! * H 0 >y؀    `? : %d port%s 㿘 &   !>z`l`T `4->{+>{  4$ $ c   P P` P>z&`0  >r"X>v! 4㿘> E@  6  ` @* @ "[  06W * *  4H /e4 * &    H 0<  & H p@$& @C?& @@  '& H /e * &  h*@@H    @D  * H 0 &   > E@ 2 * *` ( < 㿘@f㿘@`㿘> E  @ *`6  . * ` 4@ #  @&=   @28 #83  &/ $$ + @$ @$$  &@ &@ &H /e * &  h@* @ o&H 0  mbppdelay㿘> E  @ *`6  . * ` 4@   @ 8     `$ $    S5>{ @@` 2   PK  G  $$`H /e * &   8 $ !p   H 0 "` 2 `% ` @8`    2`H /e4 * &      ?$    8  ?$ H 0`  %` &`2 㿘  >& 㿘  6& mbpp_send㿘& & H /e * & 3>{ h*@ r * @ʒ   @ǔ   * c!    h*@ *@   @ @   @ H 0 &mbpp_recv㿐& & H /e * & 13>| h*@a"  | x* `  * *@ @d   @a H@Z   @W   * a!    h*@ *@>   @; H 0 &㿘  . "* >ȐP@ ?* 㿘  1>!P@ 3#耢 !P@ .#㿘@   `@  ( spifsttysbppSUNW,spif㿘``@ >|@#   : expected 2 interrupts, got %d : expected %d registers, got %d revlevverosc: rev %x chiprev %x osc %sMhz stcpri %d ppcpri %d softpri %d 㿐4`>|1#0􀢠>} 1 080 x &`x>}&`h `8eՔ &``>}`h`@eϔ &`d 2%&%"%&`d`x  &`p&`l k &`t*@`x@(`x`H`t`<`T`0 h@  hk  *p`x *hq`x *(a`x *hb`x*(c`x*h@`x*(A`x*hB`x*(Ca`d`` `t#\>}15 H>}bД  >  `>a&`H&`Lqe>!(&`<q^&`@>"H&`T qW&`Xm>}Ѐ |`?: %d tty%s s㿘& | )>}l>> `D$ $ &@$`$`$ D  $` $$` l,* *  4@,`0 x $*l &`0#>}#>}# 0’sttycd㿘> E  2`  `> E`p  6 *`p @ 0+   *  *  4 p W$ l"$ peU#  c$ $ $ `$  $ `$ @  $ `$   $  !%$ $ $ ` $`$`H /e * & x ` *dx@( `  x*d@jjx P*`$`2 p`(  p %$ p ?"$ p$`H H /e `H 0 p =7$ p* & `   p " #>~$ p !`k   p "H 0 h>ؐ"X*` €㿘  , > E`* 6 . *  4@@ h>ؐ"X*`  `€H /e * &  @  p   @x *hdx*(H 0[m 㿘  * > E`* 6  . *  4@@ `h>ؐ"X*`   @ m_  e ]@ T `y@7`x@4T `z@!`{@" ,K  k@ "+  j@*\@"4 < l@m@"$3   , $ ,x *(dx  *0%  @  0@ 0 @ &@ 0 $ &!2 "  $ $ H(x (d"5``0O?LK 0  x(2a@2`@ 2` 29`07  + 0x ( `+ 0x  (`#x("`+ 0x (`@ x(` + 0x (`x(((H  㿐 l> E ` `* * 2` *` *  4`(    d@ 2 `$   d@  H /e * & `(    X x  *hd`@ @ @ @ "`$2 #!"  "  x"" x B*( x@ (`@@  " x D*( x@( x *h x H@( x *(  x *h  x *(  x G*h  x @* x*( x*h x*(`(` x*h9 x*:`$ "  x x*h1 x*2 x @ʐ( x h( @$ (H p@ 㿘  *@ > E *`6 @ . *``4 > hX*` 㿘  *@ > E *`6 @ . *``4 > hX*`   *`> E (2 *  (4l> E* `(0((4H4p(p 2 ,"p , " ,H 㿘 l> E ` `* * 2` *` *  4 H /e4 p* & p" V  H   & pʐ HC   H  oV H$  P$  p & px *(dx  *H 0 x A0(( |( z4* xx*" 2  x ",", x`( "@" `x A0(((`|46`x*`xzx*" 2  ",",`x ( "@"  x (A0(( |(4, .  *({ x *({, ",,  x({ x({,",? `" " x({ x({ $ " x, "  x x  (*(,߆",#@ x (x A0(( (|4 @ , " ,"@x (x(㿐'   x ,w ```P@2?@?< x  x lv  2?o@? x  lu  2?@?< x  > ` ϒ 0 %s-%x: ring overflow 㿘`|   0 >خ"t,* *  4`p` n  @!>ؤ"l    @ $  $  @  `h *` €  @ Ho o , $ ,H 0  H /e * & `x*(d`x (H 0  `@$ ( `h* € >b0 *q  `H `Pm" `p `h $`p*@ @  0,CCR: timeout 㿘.`@. 2 2?#@2..  >耢 `?: %d port%s 㿘 p @& >&`0`!>}#>}#+b    㿘@ 㿘@   㿘a"  ``>+8 x. bppSUNW,bpp㿘>@ Rb@`?: Zebra : DMA2 : Unknown type 㿘8 0q &`@@% `@< @ @ (@>0 >+"p0>+"0*"@;%s: draining still active (0x%08x) 㿐 @'    @`@'   >#(*В !` @ " @@ ?"@ @ ( @ *`㿘?> E2 `   * @ 2N <  2  $& 4 . <& 0 㿘?2 > E . @ 0 @Ɛ d  d 4X , <㿘 0 "B   @ `  ` i#   @ ` 2-  ` " 8'   & 8*` @ ` *` @ `2  @K#  $ @ @ ` "  `` *`2 0? & 0㿘?2 > E . @ H $ 8$ 0 ` 0@&` $ 0`$8$ 2 4  xboxSUNW,xbox㿘>@ $" 2 @ model: model %schild-presentfalse: no devices write0-key P>c@^>)ӐH>cX^>@ ch 0>)Ɛ#p0  pM &`P<  pG &`TH  pA &`XT  p; &`\`  p5 &``l  p/ &`dx  p) &`h  p# &`l  p &`p  p &`t  p &`x  p  &`|  p &`a4 " '>@ b 2'8 '>?c]@`P* `&`@&`< "`<@`P`8*  "Y d@)`0~>)L#A!D8 `'` ''> ranges%s: PROM ranges too large: %d 㿘>"8 @]` }  & L>"@ )05 @ & H L @]$ H (`< * *    L`8  @2 `   " `8 L@ ` "   H&`<%s at %s㿘`> (א# diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKexternal battery discharginginternal battery dischargingexternal battery charginginternal battery charginglid downexternal mouse attachedexternal keyboard attachedexternal VGA attachedexternal battery attachedinternal battery attachedmain power availabletctrluctrl㿘>@!``?: expected 1 interrupt, got %d : expected 1 register, got %d pri %d intr%s: %s%s, 㿘4`>(9!0m >!(00d8  n0&`0>&`@(#!`0.`u  `4`|#`    * >`0  > &`4 hH&`8>a-`L &`L@Z`P``H `>'!`H>! > E!@%>#>"6, 'ߐb6 >'א"`L &`L@1`P` D`0*@%s: (op=0x%02x): unexpected data (0x%02x) %s: (op=0x%02x): unexpected ack value (0x%02x) %s: (op=0x%02x): unexpected data (0x%02x) in state %d 㿘  0 *  w x@  ? ?   L " P  H @  P "  >5 v ">0 v> L & L v#'l  0" z> v 'c  z. y? . z  & P y d . y * y z@2 0& P@ 0 H P'E  0 P 28 w L. w  . x ? & L. T. x!. z   ?    ? & L. T. z. x   ?& L@@   x ?& L@8  x "  w 0 `"* 0  w x `:f 0 b`. w T @  w x2 P z ` & P T. v 0 @ *@J 0 2G 0 T . vA& P`  !   *z*T*U*x*VH@  u2*V *V !   *z*T*U*x%s: SHUTDOWN REQUEST! %s: VERY LOW POWER WARNING! %s: LOW POWER WARNING! %s: main power %s removedrestored㿘 v "  d ! "  d0="7 d0: e*  6& H e*  > &  > 0&|  > P&v > L H `h& L > > &c   L & L U V @. t㿘> E!#!  `Ho oL  c"L`; ?H 0㿘> E!1!  -) Ho o u  "H  H @ *uH 00 L `\"LH 0 0 c 0" 0(㿘 0a b      0 `  * @@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&   &    "    (+  2 2 " 2+J " ?  $*0 ` + +    "* 2"* @(*`  *02 @"@ @b 㿐  `   ` @`>ȁ b    ?2    *2@ 2  &  4 @     `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*㿘  `   `  @   ` " @ ` ?  2  H;j&. cv" "" " " " 㿘 . 2  ?&   &  6 @"@   & @@7  ?@3 @ ? @  &@l@㿐 @6``2  ?7 x 8" > Ea   @   @V XP    @'@"'5ک/@ @  x@@ 0`(` @/@:1@ #V@@ 7`/`  @)@@   ے@  7 /  Ĕ(@0os@ "@ 1 )  /@ @ =_#@ @ 0`(` @̔/@@ "*@@ 7`/`  @Д)@* @ "@ 7 /  Ԕ(@?Q@ !@ 1 )  ؔ/@ `&@  ؐ@@ 0`(` @ܔ/@"=@ #@@ 7`/`  @)@?֒@ #@ 7 /  (@"W5@ #@ 1 )  /@ @ !"@@ 0`(` @/@?f@ !@@ 7`/`  @8 @)P@ #@  7 /  8 m@  !@ 1 )    =@ !b@@ 0`(` @ @0,@ #@@@ 7`/`  @(@@ @ "Q@ 7 /  /@:m@ #@ 1 )  / 5Ē@  ]@@ 0`(` @)@@  S@@ 7`/`  @(@@6(y@ "@ 7 /  /@@ 9#Ȓ@  1 )  / xs@ !@@ 0`(` @)@0@ #֐@@  7`/`  @(@@=5C@ !@ 7 /  /@V@  @ 1 )  / *x@ !@@ 0`(` @)@@ ?;#@ @ 7`/`  @(@@@ "ِ@ 7 /  /@#J@  @ 1 )  ?@!B@@ 0`(` @@!}@"@@ 7`/`  @@gX@!"@ 7 /  ?yN@ @  1 )  )/@"D@@ 0`(` @Ȓ@@#@ @ 7`/`  @@=Ғ@#`@ 7 /  /@ p@ 1 )   &ߒ@"Ɛ@@ 0`(` @@:I@#@@ 7`/`  @@5;̒@ @ 7 /  "@!@ 1 )  6u4@ 9@@ 0`(` @@9@!@@ 7`/`  @@蟒@ @ 7 /  1+@"e@  1 )  1= H "D@@ 0`(` @0@ʿ #@@ 7`/`  @7@*@ #@  7 /  7?$@  9@ 1 )  1V֒ !Ð@@ 0`(` @0@#3  @@ 7`/`  @7@?@  }@ 7 /  7!a@ !ѐ@ 1 )  1 "O@@ 0`(` @0@?9 "@@ 7`/`  @7@(P@ #@ 7 /  7@ !@ 1 )  Ȓ1=ߒ "@ @ 0`(` @0@/N "5@@ 7`/`  @7@ "@ @  7 /  :ᴐ7c@ @1 )     @& & & & @> @  `*@ 0* @*  @* `      +` *`  (*  ! `   @* * @ * ** 8  %c㿘 '>9Q    &&@"  @ @ `.$>"h?٤!>"h?0Р @> >>"p0Ő"x. J@   J@J`  ?*  8 B  ?*@    2@* *@ 㿘  `  `  @/# @*   & &@&&``"   ` 㿘?#@6 6`Ғ ` @ & $ @$@&@ 2   *  , "@@ 4 "  "  , @@ 4    -`@@ 5`  @@*  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  'D'H'L'P'T'X2J  J@ `2J 㿐@Q㿘 J J 2" 2N@@  @` *N &* J " "  `  ?2  㿘@  H 'T> E!@\ T ;9?T2 7耦(7耢 2: - 4`44`44`4`ؤ45 5 ȕ4'5 5  A'7' `@$`@`*  @@`*  @@`*  @T  @T :-`-2 ,`- ֓2`    `" ` '``? '8  đ. ?2@ Đ"  * c'Ā@ '.` @ '   @ @?  7 /`@  `7@', @@9`'*2 -2, @  ?#   * ?9@#.  ?$$6`6'  @"6``4@  * . ?  @26`@4@2@@ /`T$   . " @?* :@ @2. 4@*  *`@ T:@̑* Τ Г*`@  +    ?( 8 2 + ( 2@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  ?* J" @ J2  @(*`   * 4 ?: :  *2@ :    4  * *  @    2J@ "J`  2J@   88 @@ @   `@ @ "`"  ?*@    2@* *@  @( *` @ (* + @ @ ` ``z  @Z( 2 "" 2 @  &diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapH/ / ?"@  " H  H/ / ?"@" H  㿐 $!'! ` `'>  @  -  !  $!$!$!! @$! 㿈@` $` `2`C  .,`  '@ $ $  !* 2$ ! "!  $ ! " ,  $  , "   $  * `$  2` ڔ "  `$  㿘``@䇖  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿀@ '?'''@ '  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map@  {$'*`  , `*` ,@$@$`" . |L@ /w `@J?`/?N /2 @ '''. '' ] /3. @ ''''' N''l'h''h Af 7^x /@ `@`$ `'@ "@@B  ' ?ِ 'ے ` x0x̒    @ 2  *@  22"  0= 4 > @` 0= 4   8 # CLGET: returning %x 0 t@ ݔ )c@ "O |  b@ ":  @"? N?@ "" hI?@ .!> E |@ >?@ 9? ` @` @5 `@"  (`@%`}@*%? `@y`u@"?  Q#,?" . Q#,?" .`.`@.6  ' ' ' ' ' ' ' ' ' N'쀢'> E#ē* 'N4 '> E#ē* '/@/V?c?  & t@;  @     . . . . . . ** * * . *N  * * * **** . . . . . y. ' ' ' ' ' ' ' ' ' '@i'  ~@ "8  }@ @ ?# *` * * *& t@4 `#@=: &> E#(`/>! +  $& '`& `bFo &     2 40&? getflags: %x 㿘` @ ````  "  @ ! 2  $2 "   " `t # ` 2@@` 2 `2, @ @  @(0(0> E c( >#e t@``` ` `" ? `"  l" `@ @** ߀` * , :`$ >! `@"    * * @?  @#  @" <" @ "`"@"`"`  t@`` ` " "*@*" " @2 wh @@` (0*   `  @`*  `` ` @@"`"@"`"` diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapreaddir_with_callback: bad reclen'H`@ 'P'l'd'h `(<  > b@ `p v@8*  ϓ@` V@`@ ''''''''?ؖlhd ;蠤7d 2  )$3>"@ap @ P  "  @$  ``‎  l "` @H:@+ d "  diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map 2@ "` 2` 2`  2`  2` 2` 0? 4"`"` "` "`  ("`( @"`0 <"`4 D"`8 H"`<㾰@ D'8''4''<T  s  X’` @㾰@ '8''4''<2  Q  X` @ Z@ 2 0  $ 0 ` 0 ,?`$ 0 0Xz `_ @㿈`@: '?N㿈`@: '?x`ؖ`: @?'' &㿈`&@''' N {@ 'x` 2`0ʰ  "`0`('|| <  'x`` '''`' '''u' |?X`@ 't ؖ  'x@: `%@8؄????'''  ' | _ 'x :` Ȕ$    *  'x'xϪ | x`G`耢@x>"d`ؐ????|@x 2v|x )`耢@2` | @ "`  X`< "` ` '| | "(E:` T|tZ `'x"@& 0" 0`, xg`0x㿈@ `  '`?'9'l㿈@ `  '`?'ֻ'diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKh@``` 0& 0#``'`'` ''7O` `'`''8 ` `'`''9L`@``` 0-`  0(` `'`'';l` `'`'';`';3 ` `'`''=X@``` 05`$ 00` `'`''25&``''2ǒ``'`'` ''3z``'`'` '`''4㿈@ '''s㿈` @'''j;diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘`  6`>!26&& & &&&& ֊  &$&   (D&(,<&,0 &0TL Z ZP@ @'''''e  X``D`  `!㾐 @ (`0 "`0( X``D``0?"`0`,  쮐`0  ~`!㾘> ` ` @2` 9 /> $  `(!6  D ` DK! a฀ΐ` $ &&0& diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map>  "x`> F  `J `@'` ''''`  '`   '` ! '` ( '``: '?g؁diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿈` ''@#\  ≚ 㿈 @8!2   ` '@#\ v sparcX> F` 닰> `x놔 > F`  끐> FJ @ז @>J(2  J J* ) * JJ#2 J J* :  a*H @E 㿈ua ` .   `7*   㿈z `  2 `7   㿈z `  2 `7   p` ` `'''@''Ԙ'''xp 㿘`  "` x8`   7#3 (`*` ϔ ` @'* `@x6'쀢`   `` ˕ p`` ` ''@''Ԙ''''v؁8` h  (#$ (`*` y Q*  ` '@v'N diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCK㿐@`$  *`  '#'@ * @` '#'`  㿀`    : :`?@?diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map >l8" > #Đ "㿈` ''@#\   p`   @?# @c"?`ea"` b`+ -0% -0"4`fd, -07!@? -03`` ` ` ''''#\' ܘ VO o` ` `` ?'#\  `  '#\ ܘ c0 R` '#\ ܘ ' F#> `P骒 `> #饒 P `& > F`W  `& $> F` Mא $ `$`P>cB̐ `$` `' ܀8'ܐ  ܀ ````?  &`` 㿘 @҅!2 @> #"#İ 㿈 @w!2   ` '@#\ ߵ #sun4c compatible0 0 f8000000 15c6a0 map-pages#spurlev1lev2lev3lev4lev5lev6lev7lev8lev9clocklev11lev12lev13profd'(4B"  <<d d@@((1v@E@HFGHID @-|5wu  0 0   xpD<=>?@mnoABCDefgh&'(234#$&'jk2367+;68w5ps#J#K#!#$6$$#!#$4##0#!#$###!#$#D#\#!#$#p##!#$# #8#!#$# #8#"p#$|###!#$###"p#$|###"#$|#X#p## #$|#X#p#"h#$|###!#$###"p#$|###"x#$|###"#$|###"#$|#X#p#"p#$|###!#$###"p#$|###!#$#X#p#!#$#X#p#"p#$|#X#p#"#$|#X#p#"#$|#Ð#è#!#$#Ð#è#"p#$|#Ð#è#"#$|#Ð#è#"#$|#Ð#è#!#$#Ð#è#"p#$|#Ð#è#"#$|#Ð#è#"#$|#Ð#è#"#$|###!#$###"p#$|#|#Ŕ#!#$Z###!#$###!#$###!#$####$#$# #8##$#$#Ơ#Ƹ#!#$$#8#P#"p#$x#Ҹ##"p#$x# #8#"p#$x#$#<#"p#$x#ڤ#ڼ#"p#$x#H#`#"p#$x#܈#ܠ#"#$|#܈#ܠ#"p#$` #܈#ܠ#"p#$J #ܴ##"p#$` ###"p#$` ###"p#$J ##(#"p#$J #T#@#!#$#݄#p#!#$#ݠ#ݸ#"p#$J ##B#"#$|##B#"p#$` ##B#!#$l##B#"p#$J ##B#!#$R#8#P#!#$#8#P#"p#$|#8#P#"p#$` #p#߈#"p#$` #H#`#"p#$` #H#`#"#$|#H#`#"#$|#H#`###$|#H#`#"p#$J ###!#$###"p#$J ###"p#$J #(#@#"#$|#(#@###$|#h##"p#$J #h####$|#h####$|#h##"p#$J ##(#"#$|##(###$|#P#h#"p#$J #P#h#"p#$J #8#P#"p#$|###"p#$J ##B#!#$##B#!#$##B#"p#$` ##B#"#$|##B#!#$r##B#"p#$J ###"#$|###"#$|###"\#$###!#$###"P#$###"D#$# #8#",#$# #8#!#$# #8#"#$# #8#"#$#L#d##$#$@###!#$###" #$####$#$f"##0#"8#$#D#\###$|##BP#"p#$J %%#"p#$J %%#!#$%%(%@#!#$%%X%p#"p#$J %%#!#$%%%#!#$%%%#"p#$J %%(#"p#$J %%#"p#$|PH@0( Up x 8 l  x .x  X L . @Ռd4,5ؠ0Target %d Loop ID 0x%x (Port 0x%x) => Loop 0x%x (Port 0x%x)Target %d duplicates Target %d- killing off bothRetaining Loop ID 0x%x for Target %d (Port 0x%x)Retained login of Target %d (Loop ID 0x%x) Port 0x%xLogging out Target %d at Loop ID 0x%x (Port 0x%x)Command Error in PLOGI for Port 0x%x (0x%x)Could not get PDB for Device @ Port 0x%xPDB Loop ID info for Device @ Port 0x%x does not match up (0x%x)PDB Port info for Device @ Port 0x%x does not match up (0x%x)Target %d (Loop ID 0x%x) Port 0x%x dumped after login info mismatchNot RESPONSE in RESPONSE Queue (type 0x%x) @ idx %d (next %d) nlooked %dHBA attempted queued transaction with disconnect not set for %d.%d.%dHBA attempted queued transaction to target routine %d on target %d bus %dHBA attempted queued cmd for %d.%d.%d when queueing disabledSCSI phase skipped for target %d.%d.%dLoop ID %d, AL_PA 0x%x, Port ID 0x%x, Loop State 0x%x, Topology '%s'(%d.%d.%d): FIN dl%d resid %d STS 0x%x SKEY %c XS_ERR=0x%x%s CHAN %d FTHRSH %d IID %d RESETD %d RETRYC %d RETRYD %d ASD 0x%x%s RAAN 0x%x DLAN 0x%x DDMAB 0x%x CDMAB 0x%x SELTIME %d MQD %d%s CHAN %d TGT %d FLAGS 0x%x 0x%x/0x%xGeneratedNVRAMbus %d is in %s Modeݨݠ݀?????OOOO?WWWWWWxW`WPW@W0WWVVVVVVVVVVhVXV@V(VUUUUUUUxU`UHU0UUTTTTTTxT`THT0TTSSSSSSxS`SPS@S SRRRRRxRhRXO/!OO1OOWWWWWWxW`WPW@WWW0WWVVVVVVVVVVhVXV@V(ZxUZ`ZHTZ0ZZYYYYRYxYhYXY@Y(YYXXXXXXXXXpX`XPX@X(XXWWWXpPH@0 xQ-Z<< << #B#B#B#B#B#B#B#B#B#B#C#C#C#C #C#C('TFFG )))h  efhhijk\l(+ y0/y(Ky#Dyslyxyxxhypxyhxy`xyXxyH,y@y y8y}ly}xy}y}y}y}zz<z~z~zxzzx$zp$zhs$z`s$zXs@zPzHz@z8z(z z z`z`z y| y/y(Ky#Dy#EyzyTxx((P#D(#H#J#H#Hx#H#JD(p 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-|2`XPxhX@ψ8Pπ9h9`9X9P9H9@9890-Pah(''PXTFPPNlRR8CExST NM@CLh0PLh0RE@RR8CExST SLRR8CExST ERTCExST tdl,4#j0#j#k #k8#kdǴ#kǼ#k#k#l#l@t#ll#l#l#lH#mHp#mt#m#m#n #n8#nh#n(#nD#n|#o#oD#opx#oP#ox#o`#qP#p #j#pL#px#qxx'P#M(#j0#j #k L#k8 L#kd #k h#k#k#l#l@ #ll 8#l#l \#l X#mHp#mt d#m L#m L#n L#n8 L#nh L#n L#n L#n L#o L#oD#opx#oP#ox#o #qP #p #j#pL `#px #qxx(UH#NX#j0#j @#k l#k8 l#kd P#k #k#k#l#l@ 8#ll h#l#l #l #mHp#mt#m l#m l#n l#n8 l#nh l#n l#n l#n l#o l#oD#opx#oP#ox#o h#qP l#p #j#pL #px P#qxx(L#O@4 84 native$#RX@ȘxCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2002 OpenBSD. All rights reserved. http://www.OpenBSD.org native$#RX^\Ș(`pj0 p ` ' &e`"k\ 2 6( % $x 0 = ? "v "k  ʤ@*< ]| Xh\ P gD f( 8L ;p < 0"h"iȨz, ȀlϤ@ L P 4 : S P %"j "X"w"s(j`"w`   @͐Ʉ =x"U"r<"""  P I  N T "{Ј"}"|l ObP  "S"R@"R"R "| "~H8٨d  9H Bx >"|"op"o I"j"j5L 1X blU L\ MX D: "{""H"x""T, "k "{4"k"t"uP *0 | Q S, ˨ 98& 9 :`'p  N\ l 6 G$ H4 ! 50 E$pppppppppp S V, =@E _ ^ fT4556< j  X Aǔ 8M aL ;$ " !8 !e * .| /4 Rl SD#k ?4#l @p#l@ Al#ll B#l C#l C#l D#mt D`#m E8#m F#n Ht#n8 J8#nh K@#n L#n M #n M#mH T#o ND#oD O #op OT#o O#o Q\#o R$#qP U|#p S,#j S#pL S#px T'#H!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ l  e . .. #j0#j H#k #k8 #kd #k #k #k P#l #l@ #ll `#l#l P#l X#mt `#m Ơ#m #n #n8 Π#nh t#n L#n ӄ#n #o#oD r#op r$#o #o 4#o |#qP #p |#j `#pL L#px #p #qxx&T# 20123456789abcdef^^3333 -h - - .4#$%&'()*+;,-.;/;0;1B@C= D$E= F$cdeB@LK@B@#(#`#0123456789abcdef#2F$We6tHZl~3"VG,ud>ɍ@ۮRdv!0g&vD4UJÎXn|1 wf.TE<ˬBُPftBSap '26L^׈hzRC q`(7&:DV`rcr@Q%"40N\թjxsbPA5$*8FTbp,ӥ>@+R:Nd_mv|ҭ$6 H;*Z^Ol}l~ .<ѵ)B8 Pof~Lt]&н49(J Xnn\M| ׅ(:JD[iVx `/r>֍ 2ZKLyh^ h?.zՕ*8kFzHTY-b<pԝ"0{jNXI\=,jxiiiiiiiiiiiiiiii0123456789abcdef  p   D t  p   +L ' t 4 5 5 6d 6 =X = > > ?| ? F =X 4 5 5 6d 6 =X = > > ?| ? F =X                @ p X H  #0 R t T r@ R  p W ##0,2#E/p0A# \<#,ܐ\٬P#p|rxtv#rxtvx#rxtvz#)rxv# Ơrxtv (#34rxtv#2rx,tvP#a{8rxtv8#l@rxtv#/rxtv0#7$rxtv#p|rxtvp`## Ol dX}E#(D<8Q @X,2(@AAA==(A* d @@@@@@@@@$#,#4xzzz(zXsh (XXP\|׸# H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*Fp  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||  ( 0$,6666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\8(89909h80999:8888:`:|::8H;;$;@;8X ;;;< 8h <<<= 8 8 X"+H=\",@8 \t=|u8 `8=<9 8X"+H=\",@ 8\t=|u 8X"+H=\",@8\t=|u8Z==' @v|p0#5 ~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@####2GC`GEE|G,HKTKMMHl )#j0#j#k I#pYd#k8I#kdJ#kJ#kK#kL#lN#l@P|#llT#l#lU#lU#m{#mHp#mtZ#mU#mV#n [\#n8f#nhk<#nmt#nn#npl#o#oD#op]l#op#oq#op#qPq\#p r#jq,#pLv#pxw#p#qxx'8#(#j0#j #k L#k8 L#kd #ks#kK#kL#lN#l@st#lls#l#l \#l X#m #mHp#mtZ#m L#m L#n L#n8 L#nh L#n L#n L#n L#o L#oD#op]l#op#oq#o #qP #p r#jq,#pL `#px #p L#qxx&#p#j0#j @#k l#k8 l#kd P#ku#kK#kL#lN#l@u8#llu|#l#l #l #m |#mHp#mtZ#m l#m l#n l#n8 l#nh l#n l#n l#n l#o l#oD#op]l#op#oq#o h#qP l#p r#jq,#pL #px P#p l#qxx&޼#^^^^^^^^p^`^P^H^@^8pi\LC`GEG,HKTKM #j0#j#k #k8#kd#k#k#k#l#l@#ll#l#l#mHp#mt d#m#m#n #n8#nh#n#n#n#o#oD#op@#o#o#o`#qP#p #j#pL#px#qxx'4#*`*X*H ... ...|p||p}|p}4###lG\GElh|8H#j0#jT#k #k8L#kd #kJ#kH#k#lP#l@ϴ#ll#l#lU#lU#m,#mt#m#m`#n #n8 #nh #n#n#n#o#oD8#op#op#oq#oh#qPq\#p r#jq,#pLv#px@#qxx'L#x#j0#j #k L#k8 L#kd #ks#kH#k#lP#l@st#lls#l#l \#l X#m #mt#m L#m L#n L#n8 L#nh L#n L#n L#n L#o L#oD8#op#op#oq#o #qP #p r#jq,#pL `#px #qxx'L##j0#j @#k l#k8 l#kd P#ku#kH#k#lP#l@u8#llu|#l#l #l #m |#mt#m l#m l#n l#n8 l#nh l#n l#n l#n l#o l#oD8#op#op#oq#o h#qP l#p r#jq,#pL #px P#qxx&`#<<>0AFJLM<N4NvmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVELAUNDRYANONAOBJ\##8#x(|$Sh0123456789abcdef#)r@th#JdT<#,LX٬P#|#:}8u,#<_#+c#,bl#3#2P#l#)##g'x#|`_## Ol@@2Xx Xd$`2(@AAA==(A*gQ ##  Ol0#( R T@@@@@(@(@PP @`"KP08 ޭޭX@ݴ|P$lP @ݘTP `ݐ #P(݀ *P(p *PPh #PP` *P(XݠDD    !X!  !P&'H  &::999999999p9`9P9@9(9<jk8lltlj0~X~@~8~(~~8~X}~8}}~8}}}}}x~8}h}P}H}8} }}|~8|||||~8||~8||h~8||P|H||0~8||~8|{{{{~8{{~8{{~8{{x~8{{`~8{P{8{0{P{{{{8{0{zzzzzzzzzxz`zXzH~8~8z@z0{z zzyyy@yyy@z zzyyy@yyy@yy~8}yx~8yhyPyH!y@y8y0y@y8y(yy~8yx~8xx~8yx~8yx~8~8x~8xx~8xx~8xxp~8xxX~8xxH~8xx0~8xx~8xx~8ww~8|wwww~8Awwx~8ww`~8wwH~8ww0~8ww~8wv~8vv~8vv~8vv~8vv~8vvp~8@vvX~8@zv@v8v0v(~8Hv v~8@v v~8@xvv@uu~8uuuuu~8uuuuu~8xu~8upuXuPu@u(~8}u~8}t~8tt~8{tt{tt{txtthtP~8t@t(~8t@ttt@s~8ss~8ss~8sssssxspssXsPs@s(s srrrr~8srr rr~8rp~8rhr`~8~8rX~8~8rH~8r@r0~8r(r ~8rr~8rq~8qq~8{0q~8qq~8qq~8qqx~8qqh~8q`qP~8qHq8~8q0q ~8q X <`hDK|xPpxѬxxxxxxxxxxxxxp XpH0p ppHp Hp pphpX@p0pEEEETPppp X           h  X@ H,  @  0@ H,    @ H,    .    .   p  ` 4 h  0 0 0 0 0 0   0   0   0   0   0   0  x 0  ` 0  H 0  0 0   0   0(!!*|+,11245 545787>87THI`HhKLxK@UUVLoholo((p0LXamd7930xaudioamdP`hL,DL,l Ƙ`hpl(XSUNW,CS4231aonboard1@%+>IV"k}3 3 D `X (P4H $t|$hp@+ + + + X4P<(0$phtdp`ppppp p@0pP 0p`$    h ( x  (08pp p@ p p p $TdH4P`"#<"(%&L&T)/@04505(5 5(`5D705@LbdX`iLkX`{HX@@<H   pl # pp  #,PPP #xp  #@`@@ #pppHpPH #\p@`@@ #`` #  #@@@@x #P  #  #$  #p<  # < #  #T # # #8 # # <  #  #h  #  #  #L @  #@  @ #PPP #0  #|0H@  #  # #`  #PPP #PPPPP #D pp((p  #HP @P #@@h #(0 @ #t @@@  #@  @ # p  #X  #0 @ # #< p  # @@ # PP  # `  #lp @ # pp #0PP #Pp #pp # @@@ #4ppp #pxp # p p  # p 0 @ #d @@  # #@  @ #Hp  #px # P #,HHHpHHH #xpp #HHHHHHH # #\ #pp # #@p p #8` # #$ #p # #pp #T #pp # #8ppp #  #p #PPP  #h #PP PP $PP  $L @@ $p@@@@@@@p $@@  $0pp $| P $ $0 $`pxx $ $pp $Dxx $pp $0H@@@@@@ $(pxp $t $ ` p $ 0` $X $` p $ $< $pp $ $ xx $l $p`p $@@@@@H0 $Ph $PP  $P $ 4P P $ hp $  @ $   $ d  $   $ H $ HPPPPPP $  $  $ , pp  $ x0H@@@@ $ PP $ PP  $ \  $ pppp $ P $@pp $`p $(PP( $$ $px $pp $p $T`` $  $` @ $8` ` $` $ $xh((((( $h p  $0 $ ` p $Lpp $P(P $@@H88h $0@@H8$H $|` p88h $ @p $0p $``p $ Pp $h P $DP P $ P p $<P $(pp0 $t0 $` $ P $XP $0p p $`p p $< Pp p $Pp p $HHHHHH $ h $l0pp $`pp $ Ppp $Phpp $Ppp $P P $4xp $0p $`p $ Pp $dPp $`PP  $ $H` $0pxx $`pxx $, Ppxx $xhpxx $Ppxx $  P pxx $ \(xx $ pp0 $ 0pp $!@`pp $! Ppp $!Ppp $"$0` p $"p0` p $" P` p $#P` p $#T xp $#h $#0pp $$8`pp $$ Ppp $$hpp $%Ppp $%h  $%xp $&0h $&L`h $& Ph $&Ph $'0`hp $'| $'Php $( ##`###D###(#t## #X###<### #l###P###4####d###H###,#x###\###@###$#p###T###8####h###L###0#|###`###D###(#t## #X###<### #l###P##$4$$$$d$$$H$$$,$x$$$\$$$@$$$$$p$$$T$$$8$$$ $ h$ $ $ L$ $ $ 0$ |$ $ $ `$ $ $ D$ $ $($t$$ $X$$$<$$$ $l$$$P$$$4$$$$d$$$H$$$,$x$$$\$$$@$$$$$p$$$T$$$8$$$$h$$$L$$$0$|$$$`$$$ D$ $ $!($!t$!$" $"X$"$"$#<$#$#$$ $$l$$$%$%P$%$%$&4$&$&$'$'d$'$'$(H $08D@@@D8  @ $>@@@@@@| $?#aaq: $? $?DddTLLD $@`DDD(( $@ $A@ $A $B  $B $C $Cp $C $DP $D $E0 $E $F $F $F $G`xx $Gpp $H@?111` $H@ 0`@ $I  000>|? ?1 $I $J $Jp $J $KP000` 3ff $K?ff`f>``f`? $L08`DDE9  2 2 a $L>wc`aaa?` $M   $M $M0  0 $N`f`vvf` $N $O@   $O $P  $P` 00` $Q00000000 $Qp6? $Q?a@ 0  $RP @````@``@? $R !? $S0 ?1```@```0 $S 00`gop``````p@? $T?`@@ $T000  000 $T ``````p?```< $U`   $U    $V@`xx` $V $W `88` $W9  $X?0```g ollg`0? $Xp ? @@`@` $X````a`````````` $YP` `````` 0 @ $Ya``````````````````@a $Z00@0@000?00000 0  $Z0@0@000?000000x $[` ````a`` `0`` $[`````````````````````` $[ $\`80 $\acflxx|ngca`p $]@x00000000000 0  $]p`pppY`Y`Y`M`N`N`D`D` $^ p` p x X L F G C A@@@`0 $^ ````````````` @0@ $_00`0`0`07000000x $_p `````````````0@8@# $_a````|ngca`p $`P0`` ` p<@`@`` $`F  $a0p` ` ` ` ` ` ` ` ` ` p@? $a`@000  $bf f f v w@3@7@;; $bp` 0@8   @` $bp` 0@  $c`?   ? $c $d@``00  $d|| || $e 1` $e $f $fp0009 $f ```gop````````p`xO $gP1 ````p@0 $g`````1 ````````p9`p $h00``````0` $h   $i 1```1?`? `@ @ ? $i0p00790000000y $i $j` 08 $j````acf|x|ngc $k@ $knf`f`f`f`f`f`f`p $l 'y0000000y $l ````````p@8 $mq``````````@p```` $mp  ````````p`8```` $ms48000000x $nP00@8 0? $n  @ $o0y00000009` $op` 0@0@  $ppf f f 7@;@;@ $pp@8  $p` 0@0@  xp $q``A8 p` $q $r@ $r8    8 $s  >`6gC $sUPUPUPUPUPUPUPUPUPUPUP $t $tp $t $uP $u $v0 $v $w $w $w $x` $x $y@ $y $z $z ${ ${p ${ $|P $| $}0 $} $~ $~ $~ $` $ $@ $ $ $ $ $p $7%dlhx90 $P 000>|? ?1 $` w@;008.@` $0p` 0@ ?? $ $`0 8 1`p`8A@a $ $ @/@YYX X YY/@ @ $`1?? $ @3 ` $@```` $ $  @?@YY_[ [ Y9 @ $?? $#aaq: $p $  $P $ $0y00000009>`0000` $>~~~> $ $  $ $` 008? $f3 "D $@88 `?@ 2dG $0pp0 0`013`2``A $ 8|L  `L};@ 2dG $ 000@9 $ ? @@`@` $p ? @@`@` $ ? @@`@` $P 3 ? @@`@` $ ? @@`@` $0 ? @@`@` $  @'&@>&FFF $` `````` 0 @  $0@0@000?00000 0  $0@0@000?00000 0  $`0@0@000?00000 0  $0@0@000?00000 0  $@ $ $  $ $a````````````````@a $p 3p` p x X L F G C A@@@`0 $ ````````````` @0@ $P ````````````` @0@ $ ````````````` @0@ $0 3 ````````````` @0@ $ ````````````` @0@ $``00`` $`!!c`c`f`l`l`x`8@0@8o $p` ` ` ` ` ` ` ` ` ` p@? $`p` ` ` ` ` ` ` ` ` ` p@? $p` ` ` ` ` ` ` ` ` ` p@? $@p` ` ` ` ` ` ` ` ` ` p@? $p` 0@  $ x00?00`0`0`0`0?00x $1136663104`6`w $0009 $p0009 $0009 $P 30009 $0009 $00009 $6@&``?fffg`? $1 ````p@0  $0``````0` $0``````0` $`0``````0` $0``````0` $@ $ $  $ $01 ``````p@8 $p 3'y0000000y $ ````````p@8 $P ````````p@8 $ ````````p@8 $0 3 ````````p@8 $ ````````p@8 $ $!c`f`f`l`x@8 $y00000009` $`y00000009` $y00000009` $@y00000009` $` 0@0@  xp $ ````oq``````````@p```` $` 0@0@  xp $ $< $=8 $= $> $> $> $?h $? $@H $@ $A( $A $B $Bx $B $CX $C $D8 $D $E $E $E $Fh $F $GH $G $H( $H $I $Ix $I $JX $J $K8 $K $L $L $L $Mh $M $NH $N $O( $O $P $Px $P $QX $Q $R8 $R $S $S $S $Th $T $UH $U $V( $V $W $Wx $W $XX $X $Y8 $Y $Z $Z $Z $[h $[ $\H $\ $]( $] $^ $^x $^ $_X $_ $`8 $` $a $a $a $bh $b $cH $c $d( $d $e $ex $e $fX $f $g8 $g $h $h $h $ih $i $jH $j $k( $k $l $lx $l $mX $m $n8 $n $o $o $o $ph $p $qH $q $r( $r $s $sx $s $tX $t $u8 $u $v $v $v $wh $w $xH $x $y( $y $z $zx $z ${X ${ $|8 $| $} $} $} $~h $~ $H $ $( $ $ $x $ $X $ $8 $ $ $ $ $h $ $H $ $( $ $ $x $ $X $ $8 $ $ $ $ $h $ $H $ $( $ $ $x $ $X $ $8 $ $ $ $ $h $ $H $ $( $ $ $x $ $X $ $8 $ $ $ $ $h $ $H $ $( $ $ $x $ $X $ $8 $ $ $ $ $h $ $H $ $( $ $ $x $ $X $ $8 $ $ $ $ $h $ $H $ $( $ $ $x $ $X 1234567890-=` qwertyuiop[]asdfghjkl;'\ zxcvbnm,./ !@#$%^&*()_+~ QWERTYUIOP{}ASDFGHJKL:"| ZXCVBNM<>?   13457890=   ;'  ,. AEIOUaeiouy ^AEIOUaeiou ~ANOano Cc AEIOUYaeiouy `AEIOUaeiou !!""+-,,-,-:Aa|/u0Xx12434<<>>??A"*E^`~ôC,/OD-E"^`ȴI"^`̴L-N~O"/X^`~մP!|ROSOTHU"^`ٴY-\\^*-.0123_Ooa"*^`e~c,/od-e"^`i"^`l-n~o"/^`x~p!|rososthu"^`xxy"-||property length0h,w  mhm$$<dδPޠݨdgXh(ppxDw!8"-x5<4pyu{vuzD Dd\tt|,d\ ֔ ׄ,ܰ,,H@p$$Ìü<Ĉ|`x.l./ /,/4/$Lpdδ PD< <$dX#|##$$!8,X,-x6L (:<<@<`!8!!! ! @!V0 I ! P % !!(0!58 MX L\ !!o|!m  !M` 4 :͐ > Bx !AD!C,!= !<8!Bl!C!1(!1!- !+!Xd @! `!Xj` $x   !M !N !O!"H!$!$4 A!4 I!R!5!": !T,˨! X!Wl!"!3< =x!!H!!4h!44556<!4"op"o !D !!PD!Q!Q!2d! !! ! !GlU OP  "{ Tbl"|l"| "|"} "~HX  "{ "{db/emul/sunossunos$%^\Ș`pj0 p ` !\&!!@ 2 6(! % !x = A "kʤ!P!$! 0!!0!X,Ȁ!D !!Ǥ 4 : !x P %"j "w 8j`!`  ! @͐! =x"r<""" ! P I  N T "{Ј"}"|l O!P  !"R@"R"R "| "~H8٨d  9H Bx >"|"op"o I"j"j5LX blU L\ MX D!X: "{"!Ƥ!"T "{  !° N\!!ļ!4! *0"y@"y|!!p!t!¸"pH"q"q!h !, $x!4!Ʉ :`'p!!t2Kn,X  `  % K2Kn,X `%K@  @@ @  !"#!0! !!0!!@`!0!! @`!0!!˨ @`!0!˘!ˈ  @`!0!x!h!0!X!h @`!0!H!0 @`!0! !!0!!@`!0!!@`!0!!ʰ!0!ʠ!ʐ!0!ʀ!p@!`!X!H@!h!!@4!ؼ! !H!!(!P!!!!!!4" " (!D"L""8""""@" """""""`"@" "h" "X  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzK%  `   X,nK22Kn,X `%KOpenBSD3.1GENERIC#16 @(#)OpenBSD 3.1 (GENERIC) #16: Thu Apr 11 12:40:32 MDT 2002 deraadt@sparc.openbsd.org:/usr/src/sys/arch/sparc/compile/GENERIC 0H!2 DEJRP[3j &݀y+ 8( xBH#d8|9tl"!#. B &hO#iXoda%j]x#,DH#L"O#pdT &޸ &޼  0 5%>#BPF# L[ jj Pv#_0||"O0$ & 5KH<@v!#_7fTC N#IZ .xf#sD\ pt & &!Ǥ B#j` & 70"|-|9(H hT\`#m &rg`}ބ  X &  & P &Kh&? O 4] l &y  L w"; & {#_D#%(#t &"3W<ChQ.gLs#L  &ld &p$'H kt  "#[*t6+O(gr ri#Bk8ޜf0T#dk@#x &t+h@M"+Xt^h!ty 4,Dt &x  T  +!$ 6! A S &߀ [ i pt w &  4 , #(  bD  "h  T P Ut # & 1 @ & Qx [ g, s P ~ &  &  j $0 X  #n #mt #6   & # . & ; E" O & \ o  ~#l ":|  & !E !C  & P 4 #x 1 "k 0#o ?\ G# ]! jx y}x t @ 9 "> ̤   6\ , 9H  & *38 ; A!` KL X` hy   #h &    &T &   H   r" &4APX"< bu|q= `\ 4)  &x &/˨"h%.NG"pH]یie`te0"KP & ## i|V,"<`l  X0?!&|OH]$k }.`8$,#D &ˈ & #8t##3hK|Wlg5<pxyZ##\` & `#P3#(&#^0>I\tQ 4`Hv" """v  & p6<#(',AQ#8`@q &{X *   &h#T #[ #d, &8EzP \%hx &!T,$dP &(d & m#"2B$KU^g#z G &@ 75 &HUpf# %/$9 &`FOe]p!|{} &x  &|hZ  &#[T &X `% T3 AgXK!`!Rpyo &\ &` !X &d"U#R#_ St0 = NDL Zi@v |!1( 2&\( `<#[$"##!#ߜ * 07B~OW"*ak#| $ h $4wxh"Yt|٤)I`@Hu8 n| e&(5>G1X%`Ho azhü &hό ^ ] ((#4j` ([8*5I ^HY &Pd s#l &T##! #\ H' 9 &XCOw]"etHdeI h t#i#iX o+ xx60CϤQf x#B!p=  t   l,[?@M8\!lxthx <m#HlU#=\ M `! &4>N|\ &esPuy x"< l"q._N  gd ' ,at :< DH SU _ n/, w_  , | x  84  ! !  6! &!!# &!. &!89!E"|l!Y"}!mS!y !2! (!#`! Ol! S,!5!s! &!!!$0"O" " g",?"60"Bl"R &"d E8"r^"} MX"x"""" V" "|"|" #j8# # X##@#1 m#Cst#Q#l#[ & #f #q &#| ##k# l####A## #0$#[8$`$ &P$&$2$?x$R!M$b\$jU$u ($ %$`$ !$$$#$$!l$$p$[\% % &T%/ &X%A &\%L$H%[mt%h%%#7L%p%% (%"`%/ %P%0&!& `&,=L&;0&F |&S `&_ h&i!C,&~^&&h&X&&&& h&#P&& Ht'" ' #a' ''% &`'7'ET'Mnd'] mL'k'w͐' ''7' '''' `( x( h(" &d(/d(A(L l(Z (g(o0(0((|( &h(T(x(x(#(" ()t) f))( &l)6 jP)D &p)O\)])pd)})#|) &X),) &`) 1)#B)#)H* V0*G*' *3 **D# *O P*[*r#x* &d**QP*!4*! **x*#+ K@+#y+" +-4+6#C+M#+]l+jd+#Kh++d+nL+#|+#`++\+ + &h," H,!8, &l,"^,, &p,@a,Z &t,c"H,i! ,{ ,d,, &x, u,"H,!,P,@, -  - OT-'[P-8 -B `-Tz-` (-o4-y --U-)-X0- &-D-X- -|--p|. l.'.'#.8x.Fq,.Tא.a .o H. \.#n.0.T.."N.#$/#/(/"# // l/=#a/E/Wt/d!D`/t;/ #/ "/ !|/ !\0 `p0 |0#qL04#oh0L#n0e#n0}#m0#m0#ml0 P0$80#h0 0 1 ?41 m1<1&1/1= &1G#1Sip1c D1q 081w11`1 &1#D1 1 &1"R1)(2 2!#D2/2< d2Nzl2V2j#P2uw2 &2 W2 n2Ј2 bP2 &22 &2#3 l3`3(9h36 &3@|3T$3bD3q"y3 &33^3 3 l83lt3383 Y4J4 &4/4;4J %4Z1L4h4r!<4δ4 &4#@4 84#_4#_4{4ݸ45 &5 &5. & 565H{85W &5b5r\5#55 &5 _555 &556y6  6|6(69#p6B&6NP6Z 6}K66#!6 &6H6z6P6 & 66 &$6 &7 #7 ;7$ v7397J 7Z#7eB7p 7777#47"P@79x7 x7(`8 8l8$|868IɈ8U8b & 8k A8w8888@8d8 &8:899 9 &9( 9: &9Id49T@9a9j9w#H9 '9J@9K@9 9HD9 '99.9 8:!ļ:8:" И:0 '0:>"uP:U8:` '8:o:}<: m: 8:#7H::8: '<:$:H:; '@; ';' Ơ;7Kh;F '0;O;X;f;q!h;~uh;8;9;#q ;#p;#p;#l8< #l <"#k<:#k0!>$>7#h>Bbl>OZ>`#>n> >>nH>>O>>E>E>>? ? ?)?7?A)?U d?d ?u d? W? 'P?#fd? ?#oD?@?# ?!?kX?#h@ 'X@ 4@* i@;>@F#@c,@oH@@#C@@!@#@@ '<@dA#8A!TA6A"xA> ALdAT '@A_ `Ap A '@A 'DA#@A 'HA&LAAAPA#B B l(B)|B2 B<BFppBP,XBY#Bd/Bl#lBvlB"MBaHB.BB" B dB ' BtB",@BBChC '$C '(C' W@C8#CD"(pCN#C_Cn p C~CMC!CC CLCJdCXC '0DD  ]DiPD.@D8DE 48DQ>LD[ TDg#Ds"HDz7D D LD [0D D '@Dc`D DtE uE!<E(DE6tED!EUEi*EtqE 'HE,EthE E 'LE +E 'PE4pE 'TE$F F!QF$^F2FFFW|PFj#$Fz 0F FF!DFsFƬFtFxDF";F.F{G `G|G"G8_GDA0GQ=Gh;$Gw 4G 0$G#qtG#ppG#oG#oH#ldH#kH5#kHL '8H\"s(HhH| HiH '<H SH H Q\H H HI EI X(IQI-mI= '@IE0IOI[#oImIvIhI#IɌI$II jIJJ HPJJ&|pJ6#\JD @JS-JbJs#_J#J JJ:LJJ5JӈJJDKBKKK'K4dK@ gKO#KX/Kb]Kv##KlK 'DKP K \K$8KK 'HK#xL  XLL- L8"BL@LOL^4LtLsdLHLLQPL"PLLLL 'LL L M #hMXM$M3M> 'PMP#!XMYMclMs 'TM|#[LM4M #4M 'XM Z8M|MM_HMM#0M AN  [NTN& '\N0xXN9HNGMxNW %Nf!1Ny#N#NN,N#jNpN=NO $O O O0 O<1OFOW '`OhDOvO O OxO8OOO(pOO 'dO r@P P #_HP"XP1P@ PRlPa#Pr P O P hPnPˆPP#C P 'hP!`P"P<PmxQpQ 'lQ*pQ9 'pQB 'xQN 'QX\<Qd ӄQu Q#\QQQ)QQ"DQ$8QQvQ '4QfR hR '8R*#PR66LRD$RO٘R`p0Ro R| '<R6lR '@R#fR!°R!4hR#nR#n\R#n0S #mS%#lS;ߨSJ#pS^"y|S{"y@SSSS0ShSPS 'DST!T T[T$T1tT< @TL 'HTY ',Tf`TtTT ͔TTT#!xT#!PTTTĈU/0U4U.UA 'UI"US( Ud(U{ UUU#XU"sUUU @U UͰVV1V:VH@VU V_"SVuDV0V#VV 8V~V-\V#H|V#pV8V8V#W 'dW<W&xW;#(WFWUW_7@WiWx 'HW8W6`Wh<W"|W#n W#W%W#`X#xX#XX0 'LX@#XP%(X[Xh 'PXyDX!XpX`X 'TX tXX#BxX#@XDY/hY8YY/`YF$YY!ƤYn!$4YY\Y JY p@YY"xY~YY!hZNZZ6DZN#4Zc#Zl =Zw@ZpZ '8Z!xZ zZ{Z 'lZZ#[Zp([ [l[ D[/t[@<`[L [Z x[c#[m[|4[#\[ \[8[ˌ[T[["N[![<\$\#G\%#D(\.#\8##(\Bh\P<\aP\l\|S\^\ 'p\\#B\#\\ &\ 'ϐ]tl]#]+#]? ]L#O]cI0]l]u 'Ϡ] 'Ϥ]]#]:4]] 'Ϩ] 'Ϭ]"P] 'ϰ]X]"$^^|^ 'ϴ^1 Ș^;#RX^C^T$^^H^p # ^ "^ 'ϸ^#m@^#l^#k^^ T^__+_F_R '_^ h<_f U_w T_v`___"a__lX_ >_ [_ '` \`,`/'`> `P`[ ' `f`t '`c`*|``hH`]`\@`)`#a8``"KPaTa֔aSla'ya/ 'a>aMaUa_#am Da}aa 'a a 4a r$a Daa '0ab 'Xb 0b# '\b/#[Db>"+HbG0bQbh.Tbybb b '@b 'Db#bbc #c 'Hc/hc7=8cC#JHc\#Dcutc1c#mcc#f`cxc!lc!Oclc d d!d/"d?u dHGdS>da dndx(d#ddd2Dd$0d$\dd e  de#De3eDeW 'Lemew˸ee!ADe e|e 50ee!<e""\f*Df0f)`f2 Qf> TfL 'PfT#p fd ^fm!fk`ff#0f 'Tf '8ff8f#f#Tg g!,g. LgA\gOg`Lgjgr"AgPggǼg '@g 'Hg#IgKg#6g#0hhh6h@dhX#ho#xh#h#ph#(h#h#h#i#i # i9#HiP#if#8i|#}i#zdi#yi#xLi#ui#sj#rHj#jj3j>jH#NXj_#M(jw 'hj$xj]j Hjn8ju<j 'LjԨj90j {Pk 'Pk 'Tk,k7kJkT tkc 'Xkpkyk#pDk#ok#ok#lk#jllll 8l2l:ЄlClR\l] '\lr l{٬l '`ll$@l ,l$l#[ll 'hlA4l 'ӈl 'hm jtm m,#[0m8HmI 'pmU#mbmn#m{ 'Xm׸m Hm(mzdmmm mmn"n!#Cn:#BnR#Bni#Bnnn<ntnYdnؘnhnn nMnXooo.o?poP#o_pol#ow,oo oxo\oo" o o o#n8p"Nhp pp#p2 p@ppM 'Xp[ *pgotpyk4p '<p '@pp4p#Cpp|p p Pp q  qq'Ռq1 q;qQq\qqwqqqPq '@qKLqtq#[Xq+q"qr _r 'Dr/ 'HrC 'PrZ% revrrFr| r rEr!r!r!rr|r 'Xs s '\s's3bsC _sS cLsk$s s#BsE s#!ts\ssKTs Đs s \t4t@t&)t4't>tK#itW %tctont|#t -t#_Pt8tY,t '@tĄttuuϘu&-Hu0u:huE DuO uY(uj;u{u$uuuǔux u#pu#o<u#mv#`vv'v1&v=vE!vZ!$vnvy#8vpvvhv 'Hvv"v"dvPw w 0w&$w8 \wH wX%wa 'Pwwew w#lw$ݴw>w w wlw 'hx 'ܸx !xx A@x. &xH 4xX5xe xr"x|0x!xx 'ݜx x#ixx4x$<x yDyy%#y7 'ݠyB=(yR"Zy\4yjEyuy $y8yry }yypy/y=y$z  zz'èz9 (0zMz\#\zhuzpz{z 'ztz *z zz#nhz٨zz{{0@{Gd{\ L{h&@{s H{"j{l{ P{`{]{C{| | | '|(/|; '|I,|T|_Y|j|w *d| ||o|#B|y|0|| '| '} '} } Lx}+#}9 '}FJl}U}}k!(}}$}\}#e@}}!}|}}} L} '~~~3~G! ~Wm~c~o~]l~0~ '~!~aX~o~#~ '~#f#f=#a0""{=f(N_ix|]#Z@  '! '3!FxX8k '#i *T"cpn XpP"(!p #x (% '7#pM#k\b0pK,~ 8Lcsj8   '  T10;G!8[<fzs"C`n\L# m5\@!9 G2:=$pK`#nxf` '*X'x#@l /   X* ':%G #Q"h\Ie\r %$ ue#### #Kl #B3H=5J}l\ 'e,tt : YP #`%#X?P%#H#x% '9#BN#sh\ 's/@| ' 0"& | 'z\ L%#`!,|.(= MB[ 'es$t"2 O90l ' #B# 0% '2#(I>\ 'm 'px F 't Tp 'x   #8 $('@7 B PQY#_e;xm yvxט$ '|M T! '.8#EhpP!o|a|X" #Pb(8L'6 'F}Xb vT f!Li 'u ' '#p- 6x$NYZ,cO8s# !: '#.#I[0Ĉ ' # !I- %;xJ 'Y xj 'vMP f< |*p#Hx$h# 'hl  XlѰ  R0 A< |KS(akt# 8#q# ' 4`4, Ơ* RT6 DF=N [8mPw '4 '(xt 8 '0Lu#CX9P " 0"Oh9# C Pވ]kl{Ȁ#t  t|  #t  "B  .T=#IXUTle 'n{b7#DpH#.#pl& ސ2 >#DR9\ 'hMsn-P N ' S ' '$#   ː Q:<c Xp ;<| #_t ˨  :q  ٨& '|5#K4bPu88 /@sL`H/p0#[ Č#, l@DN 'X0h#r 5 68t#j$ ' '#fT 0(8tTo '{!<8Cd4<$l N\"k"1 <aLdWg2r# u4fL!P ' S '  qh&(5'HBlJhRb"Tx#Dt+4 ' ' @ d '.@t> 'IS,b k#(}   L$!Cx#x#4#j`0 #l@@/!N@ Ss`Q\n t{ %< j ' '! ,j, #c.$:RGc#@H#xw R$ $x '(!P(+#1 '9L^nk\j#O#QHXj/ $g!/ \:@F#JT#P\ <h`t$}5H# <9p '#!P '#< l 2#h"!ؼ. '?@I|U0` } ,#XU$xG v=<)#JT=#H`N!4]`j#v ## Bx#P W`jL |#['#/ '< 'ISO^8my ' ' '" P ' #(!/!BlD)T (\s (P h]@ l#, 6,NR\Lh%s!9\d,P@d#v0 0-< DL 'Xblf!tv0#pz, 'bhPt#c@ X( :JT#c#r h  P#P#$$T]%Xf 'oz#px 'G0 'PzH?L|#G K(I7#`E UO_(r%p{P#Hl ''  ` dMh '+ L7 'A FO |^#o ' ' #v8 '#[|@#x"(#( (' 3 \@ mO !8[#j###H#p#~#yl##z-#{F#t^#Hy####h#vX#s`##h2#jTIT#Ol#NPq$(tP#*#, ( 9 (2<#KdI (V$(j~ (x<  x!Ft"#2<LHYfpo||v‹ œ _¨ ¸w(Do$ (^tY0 (x$ eL0wH: (\EN= [@j,z@ËxØï#eh÷XP @  @ (`l P#̌3 v$B Q (h[WcsDĆ#ğ#Ŀ# ޠ H#^H& (p/d?# JW $d \m <z$Ň!gŚ"{Űſϴ#8 9#8 G$$)/'>~4GRXa#JLz$ƈƐƟyƪ#Hpƻ (tS(8`#! fl3L>G>\ (xe *|u@DŽ<ǒ xǟ $ǮHPǶ ( (4l8 #k"+43LElN#݄U#Ð\!;uȁ Dȋ ȗ (Ƞ (Ȫ _(ȳ!x (#P  ֘#p!#è([:#I] d$i" (u Ɇ (ɕ5ɝ#ɳ X$%#BL, #4("0 (?#L"rXpj!Pu(ʁʊ#Hʜ#ʬ Pʵ#_#X8h  r'|/ (:ZLP[ (j Alˋ ˝3<˧˱#oR:(P !Q24>pN^ |t (̆ G̟̯̓ ̾6t#4 ( #mH%6"S!"g dxú͏h͛#kdͪ"#pͻ ? OG@= #pwT*Xh7]|DtL (xY h tu (|`HΌ Ι#xΡ;β ` (ld Ҡ9 (!D.r@>L8Q ``#c8iv#nω#qPϜϪ8Ϲh( X  ()7 (pC#N ( pZ ( tfppz#ВРЦи!X ( X %X pD"#!l.F)P `#`hkxGhц|ѓ9<ѡ(Ѯ  ( ` ( x ( |*x(1 X> \Fߜ^r~z ( ҂pҋ ( ҜJҦ tҮ ҿ1@#_X~0#B/ 4? P ( \$Ġe+(w Ӄ ӑ ݸӞ (Ӯ#e ӷL`H#D ( $z1t=IWZ &k{ڌԌԠ԰H#  jh(  + D7AGL \0\i: vlՆ 4Տ/՝`է^ղ#@ # Y c 8;,   X/ I= K $Y i ( yPֆ-֓֟Ì֧vִIp Π | @D ( ̈́-@@?#8F|Z ( ao ( z^׈ Xה#}ק׹~p (  (  Y<t$)7#CxXbo#yip؂!ؓ#أ<ص#p 1#Q @  "=)6 N ܄[#R h#Hov%هHِTٙdٮ  !M,{$ (  98 ( 8@0L# Xjp~ nډ#`ڐ,Xڟ8ڰgd" !6hd n. > PL]bj ( s#ۆ#@ەۜ"۩pۺwl   h ( $"q:H ZTo܄"CP܏? ܜ ܪ ܶ ( #_#Jeg ')L0$P9 (C (R1d ^dq V (݈ (ݓڌݥ aݲݼ ( #l h .~>E!@V!=l$u!ނ`ލޡ ްl޻@^(# ( `#  ((!E< (PQ\m l{4߄#ߋ#ߚ#t߭#0߿ #4<$,"!P@d&K7G,U _k"~l t4#0l| (T_(!#`.t=ׄHR#a Y? jw#J#!x (X (\ S"> #!d#KX(H6#@#BH$DPiLY#0fzN +< (`w (d : (h % (L#!| p @/ p=#iH ISa (Pj04tu#<ƠS 2(#yxL:8# !+ӄ=xGCS&c tupި# T ( x ( ( DJ5 (I 0W Rlc#jvch`H ( P&3!V0D#ޔN (^:`k $x 4`?T h <  g#a(L a@Ƙ# T- (B 8PA]q=t~#D hۤ6T# L% 1 w\?#M\#Pj (tHH~:4#_T ( #8!D ((8P!|!-@8J8W b p >D~ l#h` )  tD (HL (Lbd (Pwp"H1#< K#iHYor|p#DT# (X ( (  L\X;#! X+ (9B;S#i#{  {l ( )<!(!" (8qp (@*"'h2!mCƘTfKr x (` bE=9 o opt%}1}C (Udĸs "x ( 8"!uX##pل!H $. ^;E (N#_VP` Sl#H|!Rxa(L#<#KT (!# fD ( "L,h;#G;V_h}# o T+HS P ( (+ (+&!858H W _Ru (+ #;@#!""R 0` #) (66 @ \M V c"j{#C# ]2<p#^N\!%8 NH /pe#42 (6;IK)XcVm# p# 5Dݴ T (6 (7R<0B (7L]Ǵjl̰ !#tp` % (7 (8L+8 GpU _c w!wm#v0"t#m (< (< (</ (< A#X*e*n#@z## (< (< #L( (L2zO/,`#l (Mzmi (M0lLXv #" t, ;ØGpOpc p# (MX , (M\%@ (M`!M".KA Q 8_ (Mdj&u})08 Hs@! @d%8XBMXf*po}x##vH#fP#bH#`{8XT #_2`(a4  @P (MhZ%(c#o d\pPZlW (Mp (M6% (M5Kb |q_H}!t- %@#(,$#` Ȩx&#ڤ-" 9I#WSh~ (N| H (N <@   _, R7AM#ڼT# \l (Nt 86 (N#d0 Px *< (O#!cX9 (OEdWd\n z~ (O ߈\#H#LK  3| Q##f/@8HxD SSE_$fqzؠ#d (O _0 XhYܐ (O  pT L* (P3<HHY#f yr 0" ! I\]S` (P o@#h #<,0|: (PI YDR!|[fy2 \#]##0 7P#  C0)h6-\AJR (P `j (P4 l (P8# #tt"wf)#!2!E´S _nz! (P< ?l# P#   \%#$,!"H=J Vrxb ^p4wh[% ! (P@L $#p#k8!<* (PD3#<: (PHCQ&b (QHp~ f@ @   (R,#tT (R0 9,#' p= M qW#ih"Bp#^Pyuh (S"Y4 |#^#D# C P|9K@Y8j u} (S" # X (S#\m ,s!X `D(:#<N18Y'ph#Qv#  `;X"( 4 T#[(   g4 "* . &d 38 D P a \* h# q   x x !0 $ @ O   o + 0 : L"  d.T q z (S     <   Ș  (S( s (S0    (SD 'd . 93P B M (T( TF ]! g tb k< #  l (T@ 0  '$  !PD #oM-xWft#p~ HTz p "{gD"k\t *0*":@1" <YE$,Vg ; t !X$P8 , #f +   ( 7thPuZcI`pH @"!  (V0( KHD"N(!#ؤ'#Ӱ:#OX g#s"op@ (V4!h (V8#jhL| H #H&0?4G#bXOt\Lh$op~  x# (V@M#8h&2?#S (VX](kx1 (V\L< (V`c0  '#[@# + &8 (gHE#i8V`ܰh0} (h, D`#i"O!M`ѬL (~0L5 EH4S 9^h(k!w  l=##\ H#[ ('X4D#T`xo#Pw#H#d ("A<#JP4 T a (#P*9 ORa"_s}c]X7  X Ʉ! ( .ޤ;MI"j ^eo ((##  e"Oz (,/4L:):DLN"|^ (0hLr  Qdt@hP p"|*= VIRD^ :i w (4` D )H X  (8' (3 (l;DO ]i N (  (5LslD  J8  l  " ,# 6 I B H Nh Z8 e0 n"O }` <  Ψ !5 !P  H ?8 x! X!#(!&!@ (!H!X!^!l%!u"!|`!! ! 8! l! ]!|!!!! ]"  ""%."3"B (8"K "W d"c"n%"w"v""##JSl#b (#o#fh#w (#٘#&# p# BD#>\## (#Ʉ#$ ($#$T$8#$H(t$Z$g &H$z 4$ 0$=X$ $<$8$#$$$ %$(`%#%&P%7G%B%M`%T<%c؜%q8%l<% H% v% % (%%dX%" %$%% <& 0& &# &,#&4")&;")&E!4&X&d# &l#h&t E|& &&#`&0&P&&(&J&#P&cd& & & (' ('d0')9'8 '@#'H'U'f#fp'n'v'" ''' (' D'՜'#['@''s' r(  ((5<((= ވ(M e(X ((` (m"o((!\(?(( <((( !(`(0)<()%)$ ht)8+)E4)M 6)X P)d)u#J)l)D))@)|)7|)&)m))X* `*%*#*,M*7*K#K*U*f *z (h*<*#_*S*Pl*#^*!- *s* (l* 2+  p+D+/#k+@ (p+J+X<+bK+s+/++#+4+p+#ݠ++ (t+ + (x+ kd+#J+R`,, (|,! \,.},B#ݸ,J D,ST,\,e&,n#^,{",X,,,B,r,<,,"R@-!w-#-&-2 -? ;-O -c .-o -|-}-i\-p- 4- -#-!2..P. #.4.Bp.P `d.[z.h{x.t#..(.}`. (."&..#f. (. =. (.08/;/$/,(/@#/H$8/N!X/Z#/i#/z /// %/#8/!¸// (// // (0)0  0#0(0:$ 0D#P0K!$0]!0m'0{Q0+X0 (0=0Q0 0 (00 a001u1 (1-(1@! 1M1\ p1g1t1} (11%811 1 X1 1 H1H2 (22, (2>#T2E2Z2e2n D2{`22 2 2 2 =2222H3#3# 39 3G (3M 3X3g#@3n!3H33 3 ?33#!3\3#3Dx4f4 L4P4#ۄ4/#JD494G4T#4^#4p#4~#H4 (4Θ4 (47x4 k 4 (4 4T4#[4 (p5#!T5ܠ5 5+#p57$x5G5VP5o55@55 (5# 5Q56"C(6 iP6f6(63I6? l6K@6V (6_ |6k#߈6w546!6u6t6@66 \6|6"Vx7 (7 *77+l7;87F dl7Qh7]%7f7sG`77 (7 7 7#f07PH7n8 (8 (8+86 8F8X08_ l8q#<8~Z8 8888 $@88 x8d8X8#9#fx9 9$93h9@89M 9[ 9i (9p!9z#9 (9#|95(9J999L9 \959" 9 &:#:*#:K#:j#: : (::#(:: `:#_::@: ; (; O;#[P;%#Ҹ;,!8;=#d;J*h;Q#;_;i!;yb;#; =X;#; Q;; Դ; ;#;!58;;< (<I <(<9 (  p> >& X>/ͼ>8#_ >C i0>Q>^ 6(>j#op>|zX> (0> e> ><> (8>>! X>> K\? ?ڴ?/ (<?==x?L&?Z?g (@?s`??#qx? (D?d? (H? @p? (L?#X?$?+@eH@,<@=@KD@\ x@p!(0@ p@@#@ p@ c@ (@ (@\AzLAA (A7#pABVLAL4A`#PAm#z(A|#pAhA (A#hA (AİA"AxAoBB mB+dB;#BF xpBUxBgBt&\B|B:`B (dB 4dB |XB^\B!XB (BC (CC"ΘC) XC6C= CJCdA(Cl`Cz,C x@C (C (C!8C!CtC (C ?C dI#I. I?IG!Ib$Ik I&DI x8ILI I#KPI$ItI%I J JXJJ*}J9JH$JX#Jf xPJu J LJ (JJ (JJ|J\ JK#xK #eDK PK1KA (KH")KR#|KZKb˼Ks oTK K (K$K#8KK"NK7K#KKK$L"wLL# (L/}8L8#LL \L\#|Lc+LmLw tLL!L (׈L q<L:L*LL (׌LkLaL c4M#ŔM (אM$M4M?v@MX#Mj#dMp MMM (טM#FM#܈M"&xM!M!>MMM $N (N (NAN!ZN-8N7#NFz(NT#q(Ni#pN~"kN (PN NN (TN=|NӈN O O3O@C8OM#ܠOUO[$8Ol.OujpO^OO#,OO%xOO#OO$O#LO qHOôPx8PP!P, (XP:<PO tP]PdyPs#Pz#!lP (\P <PB P.lP`PqPPP P8P$$P (`Q (dQ  `Q Q$JDQ0Q<QI (hQWQg (Q{ DQ Q (lQsQQ#DQ (PQ (4Q R1XRR (R+ R9RLH,RY,Re!)RwRR#|R R bR[R#żRE|R PRRS S MS (,S+ +S7]S? xSI#_XSW (SdSr (0S ES#4S~S=<SxS GS (4S#T"NHT T nHT# T3!4TF!TQTeVTt (8TTҘT$T<TPT (<T'TXTyU ʤU#K`U!#U+?\U6#UD!VUT \8Uf'Ut#,U (@UψUDU (DU7\U"QU|UU(U`U!DV V5V&3V0!XdVC!VTV] (HVn4VXV :`VXVlVVQV#V#V#^XV|VW WW##W/WE RWO$WY!Wd3WsW (,WWWoW%WW#`W (0W iWƬW WX:HX ňX)"AX0XBٴXN X\ Xe n`Xq (4X~ (8X,XX 8XX#mX aTX!5XaLX XYYY/#ƠY;YDYM# Y` Yk Yx#vhYgYYY^HYY6Y#[<YtY$Z #ƸZHZ##Z<\ZK ZR!Zb#hZyMZbZHZ (Zv4Z Z:$Z: Z"AZ Z'[[ L[& X[7 (@[By[J[S#[d g([k[y (`[B[5 [[[[#[[[[ ;\ (d\\\*\6t`\B*\Uk\i#$\x\"<8\"O8\"\\[$\#(\ \";\x\#]] d]T]4w]=#l]O]_]lP]x] ]`]]%@](]]#R]#H]R^^\^" (h^,o^<$^G (x^R^W^`4^u#^} (^ W ^5h^ ( ^#6^^^^g __ 38_`_!\_-|_A_T #d_g ((_x_ _#_TD_ (0__ (4_<__ L_)h`#!` `` |`( lP`3+`@_`H``V `_`rJ`}`#``(`U`!`<``l` Daaa/Ha ,`a(Ua1HaG<aT#a] hah"Ya~jaa#a}4a@a#Da a a b b Lb)b2[bI##bT#!pb^bn!Glb b vbb#b (8bbNbbbFc  c")(c$ m|c9cLc[,ce$ cm (@cw (c!c!c^c# c_XcDc)c"McKcHc o`ddΌd2#d:"dE"4dPodZdgH<du Pddtd#dd7ddbddTdd (e e#_\e(e2#e:"<e?eOe_ (ei ev#0e~#D0e (he_kbd_serial_nfs_readlinkrpc_tcp_timer_rexmt_bridge_filterrule_log_copyin_sdioctl_scsi_scsi_cmd_inodedep_pool_swcr_newsession_arplookup_addlog_ccdlock_proc_trampoline_isbad_ffs_oldfscompat_nfs_niothreads_ipintr_pool_catchup_ncr5380_pio_out_pf_match_addr_tctrl_intr_nv3tov_type_nfsm_srvpostopattr_nfs_iodwant_doforce_vndread_mtty_ca_iommu_attach_icmperrpps_count_remrunqueue_cdevvp_kqueue_stat_cd9660_vfsops_max_sw_3_leftover_getproplen_cuio_apply_db_hangman_timerok_ffs_fifoop_p_spec_ebadf_ttychars_acc_discard_filters_mtty_cd_isp_cd_cold_nd6_rtrequest_rt_timer_init_rti_delete_msgs_cd9660_readlink_htonl_bsd_to_svr4_sig_reginval_ctx_free_kbd_repeat_dayyr_uvm_pageidlezero_uvm_map_pageable_all_nfsspec_read_nfs_getnickauth_nd6_ifattach_userconf_maxlocnames_sys_shmget_spec_read_db_lastsym_spppattach_lebuffer_ca_write_all_windows_cd_get_parms_esp4_input_cb_sppp_ipcp_TO_devctty_pf_nfrents_sunos_sys_reboot_union_write_devopn_sys_rfork_iso_uiodir_isohash_xdc_error_ieattach_fdcattach_rip6_input_nfsspec_close_spec_close_isp_attach_lebuffer_cd_buf_bootstrap_getidprom_fdprint_bgetvp_rcons_esc_fsrtoname_uvm_pager_dropcluster_ifv_softc_bstp_config_bpdu_generation_nfsd_head_flag_sys_revoke_db_cmd_loop_done_qecprint_sd_scsibus_get_optparms_crypto_freereq_in_pcbdetach_in_pcbconnect_zeroin_addr_bridgeintr_msdosfs_symlink_procfs_symlink_vndsize_audiowrite_htons_arp_allocated_fdesc_setattr_ccpu_altq_enable_le_ca_ttydebug_si_debug_cdioctl_cpu_model_uvm_map_protect_pfclose_getfp_hme_reset_rx_scsi_test_unit_ready_eeprom_uio_ip6_auto_flowlabel_in6_purgemkludge_vmi_list_slock_handle_written_filepage_ffs_reallocblks_nfsnodehashtbl_blf_dec_tdb_walk_rt_timer_queue_create_msdosfs_reallocblks_nprocs_cgtwoclose_scanjet_trigger_scanner_mustek_trigger_scanner_mfs_close_nfs_readdirplusrpc_if_attachsetup_unp_detach_ttyclose_le_cd_scsibusattach_uvm_map_submap_ipsp_acquire_sa_catq_dofileread_uvm_doswapencrypt_fork1_sw_1_leftover_timerreg_4m_userconf_common_dev_iso_shipdir_MD5Update_bootlshldi3.o_sunos_sys_uname_rcons_invert_cs4231_halt_output_hme_eint_sbus_establish_mountroot_hook_establish_nd_defrouter_softdep_setup_directory_change_powerhook_establish_vmapbuf_hook_establish_mbpp_recv_mbpp_send_mmu_reservemon4m_ahstat_kernfs_print_fdesc_statfs_needbuffer_spec_strategy_cnrom_uvm_map_clean_auth_hash_key_sha1_VOP_READ_cnputc_tctrl_match_viking_cache_flush_srmmu_cache_flush_ms1_cache_flush_import_address_mfs_rootsize_esp6_input_cb_vnode_free_list_pipeinit_vattr_null_sys_setgid_sys_umask_db_last_symtab_m_copym_cons_swcr_encdec_getsock_bdevsw_acct_process_sys_readv_vop_symlink_desc_vop_fsync_desc_pdevnamesmax.o_stat_direct_blk_ptrs_tcptv_keep_init_cleanerproc_unp_scan_intstack_cons_ocount_cd_scsibus_getvol_encode_comp_t_vop_ioctl_desc_getsn_isofntrans_ccd_softc_svr4_find_socket_svr4_sys_context_hme_reset_tx_sparc_led_to_getpropint_quotaon_vnode_regyear_soo_write_compat_43_sys_quota_vop_lock_desc_cnstop_ipsec_expire_acquire_sys_munlock_cd9660_unlock_db_boot_crash_cmd_bootpath_store_uvm_swap_markbad_RMD160Final.rem_ffs_realloccg_writedisklabel_change_sign8_ukioctl_scsi_free_xs_sys_settimeofday_cd9660_ihash_slock_am7990_shutdownmin.o_mttyread_fpu_compare_cgfourteenmmap_softdep_setup_allocdirect_gettdb_icmp_mtudisc_clone_maxvfsconf_randompid_db_listwatch_cmd_pv_unlink4_4c_p9100ioctl_vndxfer_pool_blf_enc_msdosfs_lookup_adler32_fdesc_allocvp_kinfo_vgetfailed_sysctl_file_sys_getgroups_bdevvp___adddi3_ufsfifo_write_deflate_compress_rtrequest_slstart_filt_pipewrite_tablefull_tickdelta_cd9660_reclaim_region_freelist_msselect_vfs_unmountall_fill_eproc_sys_seteuid_compat_43_sys_stat_ccdinit_pf_purge_expired_states_compat_10_sys_semsys_net_sysctl_sys_wait4_db_put_value.urem_mmusegments_umapfs_vptofh_devin_groupmember_devio_VOP_ADVLOCK_sys_semop_eintstack_kbdwrite_nfs_mknodrpc_blf_ecb_encrypt_dvma_mapin_space_mii_phy_add_media_am7990_config_svr4_sys_times_nfsrv_statfs_cryptof_stat_filt_fifordetach_sorflush_filt_sowrite_db_show_regs_vmel_ca_nptesg_zsabort_uvm_map_entry_kmem_pool_enosys_sys_ntp_adjtime_cd9660_getattr_cgfourteen_ca_in6_ifindex2scopeid_tcp_do_rfc1323_filt_generic_readwrite_fd_getfile_cd9660_unmount_ccddump_uiomove_copystr_fpu_implode_si_dma_alloc_arpt_down_vmel_cd_si_dma_free_beioctl_nfsbootdevname_spec_pathconf_cgfourteen_cdmemset.o_in6_pcbsetport_nfsrv_slpderef_devioc_addrmask_db_mult_expr_ptyattach_beintr_bpf_allocbufs_userconf_common_attr_stty_start_ttymalloc_sys_getfsstat_compat_43_sys_gethostid_compat_25_sys_getfsstat_check_console_mii_activate_encif_null_reclaim_sys_nanosleep_ccdstart_mii_phy_down_uvm_page_lookup_freelist_uvm_map_advice_uvm_deviceops_audio_free_ring_cache_alias_dist_cddump_cd_read_subchannel_findroot_getprop_bstp_timer_start_umapfs_init_reassignbuf_mb_map_pfctlinput_inetdomain_ttvtimeout_kthread_q_db_strcpy_cddkdriver_nd6_defifp_cryptowrite_ipe4_init_pflogioctl_pipe_close_filt_sigdetach_acctp_pf_put_sport_svr4_sys_systeminfo_ccodes_cnwrite_fdwrite_prelist_update_rawin6pcbtable_amap_cow_now_pf_get_rdr_bcopy_pmap_stats_inodedep_lookup_ipaddr_lf_findoverlap_sysctl__string_sendsig_db_unary_copyout_xyc_cmd_ipport_hilastauto_kernfs_symlink_sbflush_ccddevs_switchexit_espattach_vlan_set_promisc_sys_obreak_swcr_init_pf_expire_to_pfattach_cddone_ufs_mkdir_umap_bug_bypass_fdesc_badop_ttyflush_fdremove_rnd_timeoutmuldi3.o_be_tcvr_idle_ncr53c9x_readregs_mttyclose_filt_ufswrite_proc_waiting_in_gif_input_kernfs_pathconf_msqids_donice_semexit_fifo_pathconf_multicast_register_if_time_adj_pager_map_wanted_lock_doscheckpath_union_revoke_spec_advlock_vndclose_bsd_to_svr4_termios_svr4_sys_uname_ev_read_intr_establish_vmeintr_establish_nd6_defifindex_ext2fs_fifoop_p_bstp_received_tcn_bpdu_m_tag_init_disk_change_compat_43_sys_wait_emul_native_db_panic.mul_pmap_kremove4_4c_chainlength_union_abortop_kernfs_write_sysctl_struct_sys_mincore_audioactivate_m_tag_free_svr4_sys_statvfs_pmap_rmu4m_pfkeyv2_flush_walker_in6_ifattach_pmap_collect_acctresume.div_seminfo_cs4231_device_ffs_clusteracct_ipcomp_sysctl_union_start_ttylclose_extent_free_calcru___divdi3lshrdi3.o_xformswNXFORMSW_procfs_dostatus_VOP_LOCK_safepri_vndclear_db_malloc_print_cmd_stackgap_init_sdmatch_vfs_isbusy_mi_switch_seminit_kbdselect_ufsfifo_read_dead_badop_VOP_LINK_filt_piperead_isocharnotdi2.o_scsi_execute_xs_ostype_filedesc_init_VOP_CLOSE_db_aout_lookup_xywrite_swap_key_in6_pcbconnect_sppp_lcp_open_sppp_lcp_down_portal_statfs_uvm_deallocate_finishdup_sys_nfssvc_sys_vfork_db_examine_rmc_dequeue_nextsaveregs.o_in6ifa_ifpwithaddr_sppp_lcp_close_unp_gcing_m_tag_prepend_uvm_swpkeysdeleted_softdep_worklist_busy_ipsec_soft_timeout_dosdirtemplate_proc_stop_enodev_mbpp_hztoms_me_alloc_softdep_disk_write_complete_doreallocblks_sppp_chap_scr_si_obio_intr_off_ipipstat_esp4_input_unp_shutdown_readdir_with_callback_xycattach_hme_meminit_be_tcvr_init_ufs_mknod_bstp_record_config_information_procfs_getcpuinfstr_process_read_fpregs_stat_rush_requests_iftovt_tab_pv_unlink4m_newblk_lookup_fc_lookup_pool_print1_sys_setlogin_amd7930_halt_output_cd_scsibus_set_pa_immed_bpf_m_xword_sys_ovadvise_audio_init_play_pf_change_a_pftm_udp_single_sunos_sys_exportfs_deflate_decompress_pflogrtrequest_sppp_chap_tlu_link_rtrequest_dead_ioctl_config_deactivate_pf_change_ap_sc_print_addr_sunos_sys_stat_ststrategy_frag6_drain_in6addr_any_sys_fchflags_extent_print_all_db_radix_write_user_windows_cnrint_export_address_readbuffers_MD5Update_int_union_readdir_start_reaper_kernel_pmap_store_hme_mint_pfkeyv2_create_filt_ufsread_ipintrq_kthread_create_db_uvmexp_print_cmd_db_extent_print_cmd___muldi3_cdmatch_getcacheinfo_obp_compat_10_sys_shmsys_amap_wiperange_evcnt_attach_knote_enqueue_pmap_is_referenced4m_qsphy_service_iommu_remove_uao_init_ext2fs_access_ufs_remove_igmp_fasttimo_mswrite_sys_shmat_db_value_of_name_cnread_fdread_flush_inodedep_deps_vlan_ioctl_null_getattr_mbpp_timeout_svr4_sys_execve_pmap_page_protect4_4c_newblk_hashtbl_getdevvp_unp_defer_logsoftc_kqueue_init_compat_43_sys_recv_compat_43_sys_send_sys_execve_spec_bmap_kbd_reset_tcxopen_prtrealloc_rn_inithead_union_print_ipcperm_db_map_addr_pf_fragqueue_mbpp_mstohz_sparc_vsyncblank_export_sa_free_allocdirect_VOP_INACTIVE_sbappend_trapsignal_scsibuszeroref_req_clear_remove_union_remove_sys_shmdt_sys_rmdir_in_gif_output_gif_output_merge_inode_lists_newallocindir_rtable_init_rcons_cursor_qeioctl_zsioctl_sppp_chap_tld_ttyinput_vsprintf_altq_disable_ienab_bic_4m_pmap_copy_page4m_ufsspec_read_icmpmask_bridgectl_null_lock_filedesc0_spec_open_vop_getattr_desc_bpfilterattach_scsidebug_level_oclk_set_secs_ip_sysctl_in6_pcbhashlookup_in_pcbhashlookup_getblk_time_offset_stackdump_mkdirlisthd_roundrobin_cpu_startup_db_page_print_cmd_svr4_sys_xstat_fdsize_ufs_ioctl_cryptof_write_bstp_initialize_port_unp_mark_sys_fstatfs_sys_swapctl_pf_get_nat_cfdata_mttystop_cnselect_uvm_fault_unwire_locked_ufs_rename_des_ecb_encrypt_msdosfs_vnodeop_p_procfs_vnodeop_p_rootvnode_pgt_allocator_ufs_symlink_ulinear8_to_linear16_le_linear8_to_linear16_le_pdevinit_cgthreeioctl_fd_mountroot_hook_union_vn_close_xbox_fix_range_msread_in6_addr2scopeid_postsig_svr4_sys_sysarch_ifa_ifwithdstaddr_socantrcvmore_pipespace_sys_sysarch_sched_sync_VOP_BMAP_svr4_sys_sigsuspend_beeint_ip6_nexthdr_m_tag_next_ptcwrite_sys_sigsuspend_ccdopen_hme_rint_ssattach_sd_switch_mii_phy_setmedia_union_rename_sbppwrite_ttclos_ltsleepgetsn.o_cache_alias_bits_xdc_startbuf_findzs_mld6_fasttimeo_sppp_lcp_scr_ttyunblock_sys_setgroups_bounds_check_with_label_ext2fs_reload_vnode_ffs_reload_vnode_cryptof_read_db_printf_process_sstep_dohooks_VOP_OPEN_pppattach_sd_scsibus_get_parms_zshardscope_uvm_map_pageable_ah_sysctl_sppp_lcp_tls_umapfs_vget_ptytty_uvm_map_checkprot_execsigs_checkreplaywindow32_vfs_getvfs_pidhashtbl_mixer_open_db_pool_print_cmd_db_map_print_cmd_eeprom_ca_spifstcintr_cdopen_scsi_do_ioctl_free_inodedep_num_inodedep_sppp_lcp_tlu_proc_pool_sys_recvfrom_pool_sethardlimit_matchbyname_nfs_sillyrename_procfs_vfsops_tk_nin_icmp6_fasttimo_nfssvc_sockhead_flag_sys_mkfifo_pftm_tcp_established_eeprom_cd_cd_scsibus_setchan_import_auth_uao_dropswap_in_pcbinit_bstp_timer_stop_intrnames_sbus_print_check_inode_unwritten_enc_xform_rijndael128_numcleanpages_filt_ttyrdetach_pf_print_host_svr4_sys_auditsys_mttytty_si_obio_dma_eop_ip6_unknown_opt_amap_wipeout_union_rmdir_null_bug_bypass_vflushbuf_selscan_pftm_icmp_error_reply_mustek_special_extent_find_elf32_load_psection_rnd_event_head.umul_pgt_page_alloc_vmeintr_nd6_delay_auth_hash_sha1_tcp_ctloutput_ip_ctloutput_if_detach_spechash_slock_spifsoftintr_mttyopen_vmeints_sema_get_stat_ino_limit_hit_softdep_process_worklist_physmem.udiv_svr4_sys_pread64_crypto_getreq_vndopenucmpdi2.o_kbd_softc_pmap_prefer_compat_43_sys_sethostid_svr4_termio_to_termios_qec_reset_mii_print_encrtrequest_bridge_input_union_reclaim_config_activate_pagemove_rcons_insertline_timermatch_nullfs_fhtovp_soo_stat_bt_getcmap_newdirrem_ufs_select_redclose_pfioctl_region_lru_uvm_pagerealloc_ipsp_ref_match_ttymodem_cgtwoioctl_mfs_ioctl_rip_input_sppp_lcp_tld_filt_pipedetach_cs4231_sa_hw_if_hme_mii_read_ufs_islocked_nfsrv_dorec_sppp_strnlen_sppp_get_ip_addrs_sppp_lcp_init_vop_readdir_desc_ulinear8_to_linear16_be_linear8_to_linear16_be_pf_find_fragment___anddi3_module_hypersparc_nd6_debug_skipjack_backwards_udbhashsize_sppp_lcp_tlf_ttopen_altq_extractflow__mulreplace_svr4_sys_pause_skipjack_decrypt_bstp_topology_change_timer_expiry_bstp_forward_delay_timer_expiry_bstp_message_age_timer_expiry_bstp_hello_timer_expiry_winChkName_umapfs_root_vop_strategy_vp_offsets_vop_reclaim_vp_offsets_vop_readlink_vp_offsets_vop_symlink_vp_offsets_vop_rename_vp_offsets_vop_link_vp_offsets_vop_fsync_vp_offsets_db_read_bytes_state_regs_pmtu_probe_tun_ioctl_ifa_ifwithaddr_union_getattr_dead_bmap_soqinsque_vfsinit_cd9660_ioctl_seginval_si_options_ip_setmoptions_union_select_union_unmount_unp_drop_acc_add_filter_defrouter_addreq_nfs_cltpsock_auth_hash_md5_bridge_rtlookup_dehashtbl_compat_43_sys_sigstack_qsphy_status_vfs_opv_init_default_db_show_cmds_endtrapcode_rcons_insertchar_xdread_amd7930_set_params_st_switch_eeprom_attach_freefile_pool_rtalloc2_detrunc_sys_getpriority_pmap_clear_reference4_4c_promvecdat_uvm_tree_RB_MINMAX_pmap_enter_p_fragtbl124_ffs_update_nfsrvw_coalesce_des1_zerokey_hostname_db_check_interrupt_pf_change_a6_pf_match_port_compat_09_sys_uname_pagetables_start_dvd_auth_nfs_quotactl_nullfs_quotactl_dead_open_scsibusactivate_nd6_output_ip6_process_hopopts_rtalloc1_db_show_callout_bucket_exec_maxhdrsz_sdstrategy_ext2fs_fhtovp_ether_ifattach_am7990_ioctlstrncpy.o_svr4_termios_to_termio_sdclose_auxio_reg_ip6_log_interval_ufs_ihashlookup_userconf_cmds_userconf_base_findnode_getnewvnode_get_random_bytes_ticket_rules_active_pf_rules_active_lo0ifp_atapi_mode_sense_etherip_input_numvnodes_pool_page_free_lkmdispatch_xydkdriver_hme_read_ffs_specop_p_sppp_lcp_RCR_vop_generic_islocked_cluster_collectbufs_schedhz_ienab_bic_si_obio_intr_on_nd6_option_umapfs_start_au_set_port_db_continue_cmd_vmes_ca_qsphymatch_tcp_delack_bstp_record_config_timeout_values_sbdroprecord_audio_calcwater_eintrnames_mrh_list_ev_init_xdsize_nfsrv_fhtovp_rttimer_queue_head_lease_check_pvpool_shm_committed_vmes_cd_pmap_protect4_4c_pmap_dumpsize_nfs_getset_niothreads_nfssvc_addsock_eeprom_va_krpc_call_cs4231_getdev_cd_play_msf_uvm_tree_RB_INSERT_softdep_disk_io_initiation_ipsec_acquire_head___ashldi3_filt_fileattach_pflogattach_p9100_get_video_ssread_ext2fs_checkpath_nfs_getattrcache_nfs_loadattrcache_nfs_getreq_tcp_respond_selwait_sys_lchown_xyc_startbuf_in6_setmaxmtu_softdep_setup_remove_getnewbuf_sysctl_string_sys_getsockopt_rnd_attached_ncr5380_pio_in_db_inputchar_hme_tint_hme_mii_write_tcp_keepintvl_sppp_print_bytes_timeout_wheel_vndattach_kernel_text_cdclose_oclk_get_dt_ip6_dad_count_allocdirect_pool_xdr_string_encode_semundo_adjust_cpu_exit_kqueue_select_udpstat_xyc_rqinit_uvm_page_init_m_tag_get_sunos_sys_fstatfs_mii_detach_bridge_ioctl_timeout_todo_compat_25_sys_fstatfs_ccdunlock_ffs_vnodeop_p_nfsfifo_read_rijndael128_encrypt_dead_lock_fifo_read_pdevnames_size_rominterpret_kbd_cnv_entry_optionsnode_fb_setsize_lebufprint_pfkeyv2_sendmessage_tcp_saveti6_tcp_debug_msdosfs_remove_knote_fdclose_domains_geteblk__umulreplace_ienab_bis_magma_match_oclockmatch_nfs_receive_des3_decrypt_vop_setextattr_vp_offsets_vop_getextattr_vp_offsets_vop_whiteout_vp_offsets_vop_read_vp_offsets_vop_setattr_vp_offsets_vop_getattr_vp_offsets_vop_mknod_vp_offsets_vop_islocked_vp_offsets_socketops_ktrsetchildren_sigactsshare_ktrsettracevnode_vop_create_desc_tcp_close_ip_rtaddr_kernel_map_uvm_swap_initcrypt_stat_ino_limit_push_crypto_drivers_pfkeyv2_acquire_tcp_setpersist_disknames_vop_pathconf_desc_qematch_bt2pmt_tcp_template_sppp_increasing_timeout_ccdmakedisklabel_audiosetinfo_rtstat_nsphy_status_fd_motor_on_ip6_mrouter_set_seltrue_sunos_readdir_callback_svr4_readdir_callback_svr4_term_ioctl_mustek_set_params_cd_switch_frag6_input_uvm_aio_biodone_union_vfsops_cluster_callback_m_tag_copy_uvm_km_alloc1_vndiodonebcd.o_qec_translate_stread_ufs_quotactl_ipsp_print_tdb_powerhook_disestablish_hook_disestablish_pf_calc_skip_steps_callrom_findblkmajor_sddetach_uvm_pagedeactivate_umap_inactive_portal_inactive_fifo_print_vn_writechk_allevents_sominconn_vunmapbuf_vop_inactive_desc_change_sign16_be_mts_xdc_ca_sunos_sys_sigvec_xdattach_uvm_swpkeyscreated_ffs_ino_pool_in_pcbbind_VOP_REALLOCBLKS_soreserve_nd6_recalc_reachtm_interval_cttyselect_userconf_common_attr_val_in6mask128_pftm_interval_hypersparc_pure_vcache_flush_svr4_sys_mmap64_cpu_conf_nfs_readdir_nfsrvhashtbl_db_get_value_xdc_cd_mttyioctl_ukclose_handle_allocindir_partdone_nfs_removeit_ureadc_ip_protox_igmp_leavegroup_msdosfs_rename_umap_vnodeop_p_portal_vnodeop_p_cryptodevallowsoft_pflogif_p9100close_cs4231_set_port_amd7930_get_port_sdzeroref_amap_clean_works_in6_setsockaddr_dead_lookup_m_apply_sltioctl_tbtioctl_vndioctl_ccdread_cpu_class_puttdb_gre_wccp_chrtoblk_strcat_dkcksum_red_alloc_in_cksum_spifppcintr_cpu_fork_locleanpages_start_crypto_MD5Final_mii_phy_statusmsg_userconf_help_proc_zap_acct_proc_hostnamelen_rtalloc_noclone_cgthree_ca___subdi3_ip6_mrouter_ver_netaddr_match_rt_timer_timer_kmeminit_nkmempages_pf_purge_timeout_sunos_sys_sysconf_me_free_icmp6_ctloutput_mfs_mount_ip6_ctloutput_uvm_meter_averunnable__umul_pmap_kremove4m_scsi_do_safeioctl_tdb_init_in6_control_vlan_input_sowakeup_m_tag_find_cgthree_cd__udiv_uvm_page_physget_rt_missmsg_bstp_supersedes_port_info_sppp_cp_change_state_sppp_state_name_tk_cancc_vndencrypt_sys_quotactl_cache_enter_db_command_svr4_setcontext_vflush_vnode_cd9660_mount_svr4_sys_llseek_mmu_reservemon4_4c_ms_serial_ufs_unlock_rpc_msgdenied_userconf_number_db_cmd_search_rwindow_save_inodedep_hash_union_diruncache_kmemlimit_ccdsize_pf_frent_pl_intrhandmoddi3.o_svr4_sys_fstat64_in6_rr_timer_ext2fs_inode_alloc_ffs_inode_alloc_Blowfish_decipher_icmpbmcastecho_in_rtchange_nullfs_inithtonl.o_svr4_sys_getdents64_ufsspec_close_clrbits_kthread_exit_vnddump_strcmp_ffs_isfreeblock_nfsrv_commit_msdosfs_islocked_ev_fini_uvm_map_lookup_entry_nfs_access_sbinsertoob_ncr5380_reset_scsibus_cast5_decrypt_bstp_port_state_selection_union_unmount_count_vnode_vop_bwrite_vp_offsets_vop_advlock_vp_offsets_vop_unlock_vp_offsets_vop_lock_vp_offsets_vop_write_vp_offsets_vop_access_vp_offsets_vop_create_vp_offsets_deadproc_slock_sys_omsync_X_db_symbol_values_db_symbol_values_db_aout_symbol_values_nswitchexit_pmap_enter4m_bridge_ifdetach_union_unlock_union_freevp_umapfs_sync_ptsclose_sys_futimes_vn_close_rmc_queue_packet_ip_getmoptions_MPFail_soo_read_pool_drain_vop_abortop_desc_m_freem_cs4231_commit_settings_amd7930_commit_settings_chquirks_cpu_sysctl_exec_aout_prep_omagic_mii_phy_status_deupdat_cs4231_trigger_input_espmatch_pfkeyv2_init_in6mask96_filt_ufsdetach_nfsd_waiting_in_pcbrtentry_resetpriority_sys_setpriority_pool_allocator_nointr_isp_sbus_ca_bpfselect_m_inject_filt_procattach_cd9660_rrip_analyze_red_getq_xyc_start_sa6_any_tcp_mss_update_pf_tree_rotate_leftscanc.o_cddetach_udp6_output_tcp_output_rt_maskedcopy_devwait_sosetopt_shm_delete_mapping_uextraloc_scsi_probedev_stat_worklist_push_sys_listen_raster_op_noclip_dvma_cachealign_sun4_cache_flush_ip6_sourcecheck_interval_uvm_vnodeops_msdosfs_select_ext2fs_readdir_null_open_strlen_db_flush_line_pgt_page_free_ch_usergetelemstatus_esp6_input_unp_bind_userconf_more_pool_page_alloc_nointr_config_rootsearch_strcpy_pf_test6_parsedisk_ext2fs_specop_p_in_pcballoc_uniqdosname_vfsconf_userconf_list_userconf_init_setsigvec_cd9660_vnodeop_p_tickadjstrlcpy.o_pagedep_lookup_unp_ino_time_phase_amap_alloc_bstp_initialization_tunctl_dos2unixfn_hmeioctl_nfs_readdirrpc_nfs_null_reserve_spi_ip6_defhlim_sppp_cisco_input_unix2dosfn_dosetrlimit_filehead_vndlock_db_flush_lex_rmc_get_weight_ether_sprintf_svr4_sys_fstatvfs_si_dma_intr_timo_module_turbosparc_tcp_sack_partialack_ktrcanset_vop_lookup_desc_ext2fs_dirremove_in6_recoverscope_ipmobile_sysctl_encstart_pppasyncstart_if_detached_start_acct_start_red_addq_si_vme_intr_off_ufs_ihash_slock_cs4231_close_ipsec_common_input_arptimer_pppfcs_vndunlock_au_check_ports_ddb_init_in6mask32_ufs_checkpath_nfs_bmap_nfs_udpsock_route_usrreq_ppptioctl_pool_head_compat_43_sys_getkerninfo_hme_poll_stop_mii_phy_activate_nfsfifo_write_ipsec_exp_bytes_sl_compress_tcp_union_inactive_fifo_write_nfs_reclaim_enterpgrp_inferior_pftm_other_multiple_whichqs_magma_hard_sttytty_stwrite_scsi_probe_busses_swread_tcp_delack_ticks_userconf_attr_tickfix_rnd_states_ms_softc_bewatchdog_msdosfs_readdir_procfs_readdir_module_sun4_nd6_is_addr_neighbor_pfslowtimo_redopen_suword_stty_param_waittime_hmeattach_qe_rint_mfs_vnodeop_p_nfs_open_freeclusterchain_sync_vnodeop_p_mfs_vfsops_filedescopen_amap_copy_nfsrv_initcache_nfsrv3_access_bpf_reset_d__timeout_lock_dupfdopen_savacctp_sb_max_sunos_sys_nfssvc_svr4_sys_acl_vop_readdir_vp_offsets_vop_rmdir_vp_offsets_vop_mkdir_vp_offsets_vop_kqfilter_vp_offsets_vop_ioctl_vp_offsets_mclpool_alloc_etherbroadcastaddr_compat_09_sys_setdomainname_compat_09_sys_getdomainname_tprintf_close_pgsignal_ncr53c9x_scsi_reset_ienab_bis_4m_nfs_getattr_inet_ntoa4_nwindows_soft01intr_cnpollc_in6mask64_nfs_unmount_nfs_realign_inet_ntoa_nullfs_unmount_socket_pool_plimit_pool_cs4231_alloc_uvm_map_clip_start_Blowfish_expand0state_igmp_joingroup_socreate_db_watchpoint_cmd_mcllowat_eintrcnt_mmu_pagein_cs4231_set_params_ch_get_params_fdshare_exec_aout_prep_nmagic_pf_test_state_udp_uvmexp_sttyread_p9100_set_video_softdep_sync_metadata_umap_lock_exec_elf32_makecmds_pf_ip2key_memreg_ca_statfs_to_ostatfs_xyc_rqtopb_nfs_renameit_ppppktin_sppp_keepalive_ulinear8_to_linear16_be_mts_linear8_to_linear16_be_mts_pf_test_scsibusprint_mfs_reclaim_arptfree_compat_43_sys_sigvec_ncr53c9x_msgin_pcache_flush_fragtbl8_nfs_readrpc_inflate_ktrwrite_schedclock_db_look_token_memreg_cd_findblkname_cgtwogetcmap_fbconstty_uvm_amap_pool_db_print_cmd_db_object_print_cmd_cgfour_ca_svr4_esigcode_esigcode_dmaprint_st_mode_sense_pmap_extract_p_uvm_map_clip_end_nfssvc_iod_proc_reparent_compat_43_sys_recvfrom_vop_rename_desc_timerblurb___bcd2bin_sd_patterns_cd_patterns_doclusterread_ipsec_adjust_mtu_dead_vnodeop_p_msdosfs_vfsops_osversion_signal_init_nfsv2_vnodeop_p_timeout_set_svr4_sys_creat64_cs4231_get_props_cdzeroref_vndbuf_pool_kernfs_access_pffindproto_ncr53c9x_debug_cgfour_cd_fpu_execute_scsi_start_cpu_spinup_userconf_change_audio_silence_copyout_pf_test_state_tcp_sunos_sys_getrlimit_svr4_sys_getrlimit_pfkeyv2_policy_cast_decrypt_rn_delete_sppp_ipcp_close_sys_getrlimit_compat_43_sys_getrlimit_randomclose_sprintf_sunos_sys_auditsys_qec_fix_range_srmmu_vcache_flush_page_sun4_vcache_flush_page_vm_page_zero_enable_fragtbl_sppp_pick_ttyrub_sys_lkmnosys_sigacts0_sunos_sys_execve_pmap_writetext_ufs_kqfilter_igmp_timers_are_running_pool_chk_nkmempages_db_find_breakpoint_subyte_xdc_perror_in6_savemkludge_pool_page_alloc_ip_forward_nullfs_mount_pppread_cgtwo_ca_xyc_piodriver_ssopen_ip6_keepfaith_rtredirect_audioattach_linear16_to_linear8_le_X_db_forall_db_putnchars___xordi3_mtty_start_fd_dev_to_type_ufs_bmaparray_db_last_command_naltqsw_cgtwo_cd_extraloc_cgthreeclose_ip6_mrouter_get_nd6_ioctl_ext2fs_reclaim_nfs_decode_args_nfs_fhtovp_bufqueues_userconf_pnum_pftm_udp_multiple_ie_hardware_names_defrtrlist_del_union_mkwhiteout_pf_rdrs_uvm_pglistfree_ext2fs_fifoop_entries_ffs_fifoop_entries_nullfs_vget_cd9660_fifoop_entries_iereset_hmeintr_tcp_debx_stathz_isp_reset_ss_switch_nfs_getauth_udp6_input_ipq_locked_fdesc_vnodeop_p_strncasecmp_spec_vnodeop_p_pool_init_bppopen_rt6_flush_in6_len2mask_tcp_maxpersistidle_tunwrite_sysent_blf_cbc_encrypt_pool_get_softdep_freefile_bstp_hold_timer_expiry_bstp_tcn_timer_expiry_lastdtime_vop_revoke_vp_offsets_vop_lease_vp_offsets_vop_close_vp_offsets_ptsopen_vn_open_pf_change_icmp_srmmu_vcache_flush_context_sun4_vcache_flush_context_chiptotime_ipcompstat_rtinit_sppp_open_event_sppp_down_event_unp_connect2_tvtohz_cd9660_tstamp_conv7_ttcompatsetflags_ext2fs_getattr_ipsec_get_acquire_sppp_ioctl_rtfree_par_err_reg_ext2fs_unmount_vop_generic_kqfilter_pipe_kqfilter_ether_input_mbuf_fdcresult_power_reg_sys_minherit_nswitchdiff_fpu_newnan_scanjet_set_params_uvm_unmap_detach_nfs_close_nfsrv_readdirplus_nfs_doio_tdb_rehash_char_type_qe_read__urem_timetochip_cttyread_config_attach_xdopen_counterreg_4m_userconf_pdev_vprint_fdcretry_module_swift_sppp_chap_open_hmeinit_cdstrategy_nd6_slowtimo_ch_bpf_m_xhalf_msdosfs_unlock_msdosfs_reclaim_procfs_reclaim_printf_userconf_cmdbufbcmp.o_fc_largedistance_kernfs_readdir_pcred_pool_time_maxerror_MD5Init_pool_put_sd_scsibus_mode_sense_scsi_change_def_userconf_show_db_symbol_is_ambiguous_db_disasm_ticket_rdrs_active_pf_rdrs_active_ch_patterns_in6addr_linklocal_allrouters_tcp_seq_subtract_ipsec_require_pfs_null_vnodeop_p_ttread_sys_kevent_db_watchpoints_inserted_db_breakpoints_inserted_cpu_switch_ip_flush_vop_kqfilter_desc_b_to_q_somaxconn_exec_elf32_fixup_cd1400_write_reg_svr4_sys_fxstat_cs4231_match_bstp_designated_port_selection_portal_open_tprintf_open_spifstcintr_mx_qe_tint_ledmaintr_espdma_reset_nullfs_root_vfs_busy_cd9660_symlink_aobj_pager_cryptoioctl_vfinddev_scanjet_compute_sizes_mustek_compute_sizes_ufs_dirremove_nfsrv_cleancache_msdosfs_unmount_procfs_unmount_db_next_free_breakpoint_mii_media_table_node_has_property_pmap_is_referenced_p_amap_add_linear16_to_linear8_be_savefpstate_svr4_sys_sigprocmask_db_print_ifa_uvm_io_sys_undelete_sys_sigprocmask_magma_soft_tadpole_set_video_fb_pfour_get_video_uvmspace_fork_nfs_adv_raw_attach_clusteralloc_profhz_vop_print_desc_vn_lock_sunos_exec_aout_makecmds_nfs_nget_icmp6_mtudisc_update_routedomain_pgrp_pool_tk_nout_cpu_exec_aout_makecmds_exec_aout_makecmds_obio_ca_ip6_rr_prune_uvm_swap_needdecrypt_free_diradd_sl_uncompress_tcp_config_defer_cd9660_inactive_pf_routeulmax.o___builtin_saveregs_ststart_nfs_connect_cd9660_close_curproc_swap_syscall_lock_db_qualify_ambiguous_names_rmc_modclass_cfroots_size_obio_cd_cs4231_query_encoding_amd7930_query_encoding_hmematch_cd_scsibus_load_unload_ext2fs_specop_entries_ext2fs_vnodeop_entries_mfs_vnodeop_entries_ffs_specop_entries_ffs_vnodeop_entries_fifo_nfsv2nodeop_entries_spec_nfsv2nodeop_entries_nfsv2_vnodeop_entries_window_inflate_msdosfs_vnodeop_entries_union_vnodeop_entries_umap_vnodeop_entries_spec_vnodeop_entries_procfs_vnodeop_entries_portal_vnodeop_entries_null_vnodeop_entries_kernfs_vnodeop_entries_fifo_vnodeop_entries_fdesc_vnodeop_entries_dead_vnodeop_entries_sync_vnodeop_entries_ttyretype_nfs_init_cd9660_specop_entries_cd9660_vnodeop_entries_pf_rdr_pl_initfpstate_scsi_decode_sense_procfs_docmdline_extent_create_nd6_init_ext2fs_vnodeop_p_nfsrv_getstream_des1_setkey_clusterfree_kernfs_vnodeop_p_fifo_vnodeop_p_au_portof_amd7930_get_props_nd6_free_msdosfs_rmdir_nextvnodeidxordi3.o_tcp_del_sackholes_vop_pathconf_vp_offsets_vop_bmap_vp_offsets_vop_abortop_vp_offsets_vop_select_vp_offsets_vop_lookup_vp_offsets_cd9660_lookup_ncr53c9x_msgout_ncr53c9x_get_ecbulmin.o_dumpsys_amd7930_close_ledattach_stat_blk_limit_push_nfs_msg_tcp_drain_swapdev_vp_cd9660_fhtovp_dumpsize_bpf_filter_db_active_kmem_map_ip6_mforward_nchstats_itimerdecr_vmspace0_region_locked_softdep_flushworklist_nfs_commit_time_state_pfkeyv2_cleanup_mkdir_pool_nfsrv_mkdir_gre_lookup_nd6_gctimer_mf6ctable_ipcomp_output_portal_link_uvm_km_valloc_wait_clockfreq_mrt6_ioctl_tcp_disconnect_procfs_statfs_userconf_disable_cd9660_tstamp_conv17_ccdstrategy_pftm_other_first_packet_pftm_icmp_first_packet_pftm_udp_first_packet_pftm_tcp_first_packetmd5.o_cs4231_set_speed_msf2lba_fd_motor_off_ufs_whiteout_audio_attach_mi_susword_hme_tcvr_bb_readb_stdump_ffs_init_process_read_regs_mustek_minphys_umax_uc630_sw_sd_atapibus_ops_cd_atapibus_ops_crp_req_queue_au_set_gain_ip_defttl_oldmon_w_trace_swift_hotfix_nfsrv_setcred_icmp_init_tcp_init_am7990_reset_sttystop_in_setsockaddr_sysctl_rtable_vop_mkdir_desc___ashrdi3_fuibyte_esp_write_reg_scsi_inqmatch_procfs_start_user_config_session_pool_sys_fhopen_uvm_fault_unwire_nfs_hash_rttrash_domainname_vmcmd_map_zero_db_delete_pftm_timeouts_nfs_request_nfsrv_setattr_bpfattach_msdosfs_getattr_procfs_getattr_ether_ioctl_ncr53c9x_abort_tbattach_slattach_mii_phy_auto_timeout_nfs_flush_db_delete_temp_breakpoint_db_set_temp_breakpoint_rip6_ctloutput_ffs_alloc_nfs_false_xdr_string_decode_rip_ctloutput_time_reftime_rqinit_spifstcintr_rx_ext2fs_create_sema_release_stat_sync_limit_hit_stat_blk_limit_hit_deferred_config_queue_osrelease_vndshutdown_cbqclose_ffs_balloc_kernfs_findtarget_timeout_del_sunos_sys_quotactl_sunos_sys_setsockopt_mbppclose_cgeightclose_uvm_map_replace_stat_countp_request_cleanup_sackhl_pool_lf_advlock_sys_setsockopt_pmap_extract4m_pmap_is_referenced4_4c_icmp6_redirect_output_m_tag_copy_chain_pftm_tcp_opening_timeout_add_mblowat_setpte4m_fdcpseudointr_ffs_fhtovp_tunread_kernfs_reclaim_vn_ioctl_db_write_variable_ss_set_window_ffs_bufatoff_nfs_link_nfsrv_mknod_vttoif_tab_sys_chroot_sys_getpid_ufs_readdir_nfssvc_nfsd_vlan_setmulti_pool_inactive_time_fdcloseexec_uvm_fault_numdquot_handle_allocdirect_partdone_nfs_fsync_domaininit_cd9660_ihashrem_reserve_dumppages_lehwinit_ledmatch_amap_init_rt_ifmsg_pppstart_filt_ttywdetach_filt_procdetach_pf_get_sport_svr4_sysent_amap_free_tcp_drop_sys_getsid_clockmatch_vop_reallocblks_vp_offsets_vop_inactive_vp_offsets_vop_remove_vp_offsets_pipe_rfiltops_putchar_tty_init_am7990_gethtons.o_sunos_sys_setrlimit_svr4_sys_setrlimit_fdc_reset_ip6_accept_rtadv_ip6_ecn_ingress_swwrite_ip_ecn_ingress_nfs_bufq_sys_setrlimit_compat_43_sys_setrlimit_spifstcintr_tx_dvd_read_disckey_nd6_ifptomac_cryptof_ioctl_gre_mobile_input_sppp_pap_close_kernfs_getattr_dumpdev_proc_waiting_timeout_ipsp_pending_acquire_kernfs_unmount_vop_select_desc_nchrdev_ledmamatch_in6_restoremkludge_procfs_rw_ip6_forward_nfs_asyncdaemon_file_pool_sttyopen_bwtwoopen_krpc_portmap_bstp_set_bridge_priority_sppp_chap_init_ksymsattach_rcons_pctrl_bppclose_cgfourioctl_bt_putcmap_uvm_map_setup_max_softdeps_umapfs_quotactl_suid_clear_sys_getuid_exec_script_makecmds_dumpmag_sbus_match_fd_do_eject_ext2fs_buf_alloc_ipsec_soft_bytes_ppp_softc_socantsendmore_ttcompat_pf_get_binat_ip_output_nfs_disconnect_procfs_print_filt_solisten_pidtaken_m_copybackstrlcat.o_uvm_map_reserve_ufs_quota_alloc_inode2_nfs_savenickauth_autoconf_nzs_fdesc_select_st_check_eod_ch_getelemstatus_bstp_set_path_cost_uvmspace_init_am7990_put_xddump_icmp_send_ip_init_union_vnodeop_p_uvmspace_free_bstp_timer_expired_portal_badop_uvn_attach_vop_rmdir_desc_audio_alloc_ringimax.o_cypress_cache_flush_all_hypersparc_cache_flush_all_srmmu_cache_flush_all_ms1_cache_flush_all_in_ifscrubbpendsleep_sys_ftruncate_compat_43_sys_ftruncate_db_end_line_if_attachhead_m_tag_first_config_detach_children_pf_tree_rotate_right_nd6_ra_input_db_print_llinfo_nullfs_sync_session0_db_show_all_procs_pf_tcp_ports_ccdattach_clockintr_nfs_mkdir_nfs_clientd_union_dircache_fifo_kqfilter_db_delete_breakpoint_pftm_tcp_closed_uvm_swapout_threads_ttspeedtab_process_set_pc_uihashtbl_clockreg_zeroin6_addr_xdc_piodriver_qecattach_nfsv3_procid_arp_intimer_kqueue_wakeup_db_boot_poweroff_cmd_cd1400_write_ccr_priv_regs_cd_scsibus_set_mode_mclpool_warnmsgimin.o_svr4_getcontext_pmap_pa_exists_nfs_advlock_ah_output_vn_isdisk_vnd_softc_hypersparc_get_asyncflt_cypress_get_asyncflt_srmmu_get_asyncflt_svr4_fil_ioctl_be_mcreset_sdactivate_swap_key_delete_ffs_reclaim_userconf_add_read_rndstats_mustek_read_si_get_uvm_pglistalloc_ipcomp_enable_tcp_rndiss_cnt_unpdg_recvspace_unpdg_sendspace_sb_lock_ttyout_compat_43_sys_getsockname_sys_getsockname_cd9660_ihashinsstrncmp.o_atapi_mode_select_in6_ifawithscope_softdep_change_directoryentry_offset_nfs_vgetashrdi3.o_xdc_rqinit_esp_dev_ffs_fsync_tcp_freeq_checkdirs_sys_madvise_ticket_binats_active_pf_binats_active_svr4_sys_getdents_pfkey_unregister_crypto_unregister_ipsec_acquire_pool_kinfo_vdebug_vfs_unregister_ccdiodone_ttcompatsetlflags_scsi_probe_bus_dos2unixtime_sys_accept_strncpy_m_copydata_svr4_sys_access_ss_gen_quirks_sppp_null_arcbroadcastaddr_vop_print_vp_offsets_vop_open_vp_offsets_uvm_vnp_sync_knote_remove_sys_access_disk_init_X_db_line_at_pc_db_line_at_pc_db_map_equal_isp_reinit_rijndael_decrypt_revarpwhoarewe_if_mark_unignore_nfs_reqq_rcons_scroll_Blowfish_stream2word_ip_drain_icmp_error_svr4_to_bsd_sigset_dt_to_gmt_nd6_options_amap_share_protect_ffs_unmount_ip_freemoptions_ip6_freemoptions_ppp_deflate_draft_dead_select_soo_kqfilter_userconf_device_sysctl_clockrate_svr4_to_bsd_sigaction_pmap_changeprot4m_sonewconn_console_font_cs4231_mute_monitor_module_sun4c_amap_ref_disk_busy_db_print_loc_and_inst_isp_control_prom_vstart_fb_pfour_set_video_pim6_input_uvmpagerops_nfs_mknod_sppp_input_cttyopen_greattach_nfs_removerpc_nfsrv_access_tcp_rndiss_msb___hex2ascii_pmap_map_sttywrite_fpu_add_ufs_reclaim_umapfs_fhtovp_m_reclaim_randomioctl_ccdbuffer_pmap_redzone_scsistrategy_udp6_recvspace_udp6_sendspace_tcp_recvspace_tcp_sendspace_ifaof_ifpforaddr_rnd_event_tail_pftm_tcp_fin_wait_ffs_vget_nfsrv_rmdir_db_boot_sync_cmd_max_hdr_in6_purgeaddr_csecreate_union_create_vn_read_ptsread_db_sifting_stopen_st_patterns_sun4_hotfix_swdevt_nuidhash_max_buf_dirty_sbrelease_audiodetach_stty_ca_bwtwo_ca_xddkdriver_pmap_is_modified_p_mfs_pri_tcp_attach_fdesc_vfsops_kernel_segtable_store_lematch_tcpcb_pool_bstp_root_selection_strlcpy_msdosfs_start_m_pulldown_sysctl_rdquad_initproc_arc4_reinit_nfs_root_union_symlink_ttycheckoutq_stty_cd_bwtwo_cd_ffs_isblock_in_iawithaddr_portal_setattr_ppsratecheck_zombproc_db_delete_cmd_spifstcintr_rxexception_st_erase_tcp_dooptions_ip_dooptions_union_lock_kqueue_kqfilter_cd9660_ihashget_handle_workitem_freeblocks_speclisth_pftm_tcp_closing_trapbase_has_iocache_sadb_exts_required_in_uvm_page_physdump_baddynamicports_lastddate_union_link_pf_route6_xyattach_nfsrvhash_sppp_params_pf_test_icmp_masterpaddr_mii_phy_update_bpf_detachd_pppopen_machine_suswintrntohl.oadddi3.o_bufcachepercent_ext2fs_advlock_encoutput_null_inactive_soinit_db_console_setuse_extendfile_sofree_ktrsysret_nd6_option_init_ext2fs_bufatoff_nfs_readlink_nullmodem_userconf_enable_uvmspace_exec_mmu_has_hole_nfs_bioread_raw_ctlinput_sysctl_rdstring_db_run_modeumoddi3.o_ip6_mrouter_disk_lock_svr4_sys_getmsg_srmmu_vcache_flush_region_sun4_vcache_flush_region_icmp_input_tcp_input_config_detach_sys_mlockall_sys_dup_ip6_use_deprecated_nfs_boot_init_des1_encrypt_tcp_timer_freesack_proc_cansugid_vfs_mountedon_db_store_count_db_boot_dump_cmd_snapshot_mmu_install_tables_ssstart_nfs_send_VOP_READLINK_svr4_sys_open64_xydump_hmestop_mld6_start_listening_ipsec_def_auth_ktrinitheader_psratio_rnd_event_space_module_cypress_ipsp_process_packet_vwakeup_extent_alloc_subregion_gmt_to_dt_mountnfs_get_sa_require_ifmedia_baudrate_descriptions_spec_kqfilter_bsd_to_svr4_sigaction_ihashtbl_ipsec_in_use_ip_freef_db_symformats_fpu_mul_zsread_map_forwmerge_ip_frags_pppgetm_svr4_sock_ioctl_pmap_release_nfs_sndunlock_nfs_node_pool_portal_pathconf_unp_rights_fpu_div_tcp_notify_VOP_SYMLINK_pppwrite_fdexpand_db_look_chariordi3.o_cd_size_zsconsole_ext2fs_bmap_arpinit_done_pt_softc_sys_getpeereid_vn_rdwr_xyc_reset_raw_disconnect_rn_addmask_msdosfs_print_vgonel_sodisconnect_solisten_gsignal_nfs_rcvlock_ah_enable_umap_strategy_vfs_op_descs__randseed_pmap_kremove_p_fillinusemap_ttywflush_am7990_copytobuf_contig_opennode_get_buffer_status_tcp_ident_igmp_input_raw_detach_speedup_syncer_sbwait_ext2fs_open_softdep_slowdown_nfs_read_tcp_rndiss_sbox_ext2fs_blkfree_nfsd_head_qe_eint_viscpy_portal_mount_newblk_pool_ufs_getattr_uvm_vsunlock_pf_pool_limits_uvm_page_physload_uvm_km_valloc_align_child_return_strncmp_esp_glue_nfs_sigintr_tcp_mtudisc_icmp_mtudisc_sysctl_tstring_sys_getgid_ip_mtudisc_swap_key_createntohs.o_SHA1Init_ether_input_vfs_findname_db_fncall_pv_link4_4c_vme_ca_uvm_useracc_ufs_getlbns_strlcat_uvm_km_pgremove_intrsafe_ext2fs_lookup_in6_ifstat_getnulldev_pf_print_flags_tregion_search_prom_busprint_uao_set_swslot_mfs_statfs_swcr_sessions_pool_do_put_db_find_breakpoint_here_pf_tree_next_pnozz_ca_scanjet_set_window_mii_submatch_vme_cd_ufs_readlink_bpf_movein_union_init_db_breakpoint_list_setquota_num_dirrem_semid_n2o_db_breakpoint_free_pf_test_state_icmp_ffs_clrblock_rn_walktree_nselcoll_sys_pwritev_ticket_nats_active_pf_nats_active_pnozz_cd_filt_fifowrite_procfs_domem_sys_kqueue_ksymsclose_scsiprint_shmseg_ffs_read_nfs_namei_ipe4_attachstart_esp_dma_stopbpendtsleep_pf_addrcpy_pmap_changeprot_p_mld6_stop_listening_uvm_coredump_pf_rules_ledma_ca_fuiword_rushjob_audioamd_ca_bstp_set_port_state_procfs_doctl_portal_root_nchinit_lkmenodev_ip6_forward_srcrt_deflateEnd_soqremque_ttkqfilter_inittodr_db_max_line_ledma_cd_i7_softdep_initialize_nfs_create_crypto_invoke_sysctl_rdstruct_pf_purge_expired_fragments_pf_compare_nats_audioamd_cd_stty_modem_control_mtty_modem_control_cs4231_halt_input_vfs_shutdown_mclpool_release_xdwrite_rijndael128_zerokey_soisconnected_svr4_sys_hrtsys_cd_play_scsi_xfer_pool_obio_scan_pause_timer_stat_dir_entry_msdosfs_advlock_soread_filtops_ttyread_filtops_xdc_rqtopb_scanjet_ctl_read_uvm_anon_lockloanpg_quotaoff_vnode_softdep_freequeue_msdosfs_statfs_cttywrite_vcount_vrecycle_wtab_allocrem.o_timerattach_rip6_recvspace_rip6_sendspace_cryptoclose_rip_recvspace_rip_sendspace_bridge_addrule_fdesc_readlink_unpst_recvspace_unpst_sendspace_viking_pcache_flush_line_srmmu_pcache_flush_line_sys_msgrcv_spec_select_ccdlookup_db_boot_cmds_in_selectsrc_vn_stat_mtty_param_nfs_lookitup_rijndael_set_key_ipcomp_input_sppp_close_event_cbqioctl_uvmspace_unshare_sysfilt_ops_mbppioctl_cgeightioctl_kfshead_lf_setlock_pf_tree_insert_blf_decrypt_tcp_rndiss_init_tcp_pulloutofband_nullfs_start_initmsgbuf_pv_changepte4_4c_cpumatch_turbosparc_nfs_sync_ttyprintf_lo_microtime_fc_bmapcalls_db_set_breakpoint_u0_fpu_shr_ifmedia_init_procfs_stat_gen_icmp6errratelim_in6_maxmtu_nfs_mount_ptsstop_config_make_softc_db_write_bytes_isp_uninitlmax.o_xyc_error_pfkeyv2_release_uvm_fault_wire_rijndael128_setkey_timeout_hardclock_update_db_deletewatch_cmdcmpdi2.o_sdread_device_lookup_sys_msgsnd_db_history_prev_openpromopen_tun_output_msdosfs_write_pmap_is_modified4m_lebufmatch_scsibussubmatch_vmel_scan_ext2fs_readlink_union_strategy_rootvp_kbdattach_kbd_initialized_cg3_videoctrl_ip_ecn_egress_tunopen_tcp_canceltimers_hexatoi_bstp_enable_port_pool_setlowat_emul_sunoslmin.o_xdcattach_in6_ifaddr_des_ecb3_encrypt_pf_nats_svr4_sys_memcntl_bppioctl_bwtwommap_uvm_vnp_terminate_nullioctl_ttioctl_dvd_read_copyright_scsibusmatch_nfs_prog_Blowfish_initstate_gre_output_max_keylen_elf32_check_brand__umulreplace_end__mulreplace_end_svr4_sys_msgsys_nd_ifinfo_in6_prefix_add_ifid_ffs_sync_MCFail_clock_ca_xyopen_xyc_unbusy_nfs_ticks_umapfs_unmount_cluster_rbuild_ip_optcopy_dvma_end_sdsize_ext2fs_makeinode_sppp_cisco_send_rn_refines_deadproc_VOP_UNLOCK_kvm_iocache_sc_err1_ipcomp_output_cb_clock_cd_dvmamap_extent_SHA1Final_esp_init_extent_print_vndsetcred_uvmexp_print_svr4_to_bsd_sigaltstack_kdb_kbd_trap_ffs_vtbl_sppp_cp_type_name_soisdisconnected_sppp_qflush_sppp_flush_sppp_lcp_opt_name_ndflush_userconf_lines_audio_calc_blksize_setjmp_kdb_trap_nd6_rs_input_pppintr_sys_readlink_copywords_bus_untmp_procfs_badop_sys_getrusage_db_load_count_ip_mtudisc_timeout_q_am7990_zerobuf_contig_sparc_interrupt4m_in6_selectsrc_ext2fs_init_vlan_start_qestop_dvd_read_manufact_zsstop_uvm_map_create_tcp_slowtimo_ip_slowtimo_cansignal_acctsuspend_nfs_sndlock_swcr_sesnum_ipcomp_attach_rt_timer_queue_destroy_vdevgone_tcbtable_cd_play_tracks_ip_nhops_vlan_config_union_lookup_pool_cache_destruct_object_vop_default_desc_swap_decrypt_uvm_swap_markdecrypt_softdep_workitem_pending_numcache_doingcache_uvm_unloananon_sppp_chap_close_vflush_srmmu_vcache_flush_segment_sun4_vcache_flush_segment_syncerproc_svr4_sys_sigaction_iestart_fdcstart_in6_delmulti_softdep_setup_freeblocks_in6_selecthlim_sobind_pool_cache_put_sys_getdirentries_compat_43_sys_getdirentries_sys_sigaction_isp_start_xdgetdisklabel_sdminphys_fdgetdisklabel_ffs_mount_nfsrv_updatecache_z_errmsg_pmap_count_ptes_cd9660_mountroot_vndgetdisklabel_sttyclose_bwtwoclose_ext2fs_inode_pool_union_pathconf_umap_node_hash_fdesc_sync_kill_vmcmds_cs4231_attach_qsphyattach_m_zero_unputc_filt_sigattach_compat_43_sys_killpg_db_show_all_cmds_pmap_virtual_space_ext2fs_checkoverlap_ffs_checkoverlap_nfs_true_ipsec_def_comp_ifmedia_delete_instance_arpresolve_cdactivate_map_backmerge_cuio_copyback_sbappendrecord_mountlist_fdattach_cryptof_close_arpintr_ppp_bsd_compress_sppp_pap_TO_msdosfs_readlink_procfs_readlink_mainbus_ca_svr4_sys_kill_xdc_cmd_icmp6_redirtimeout_icmp_redirtimeout_usermount_sys_kill_vop_read_desc_ncr53c9x_reselect_svr4_sys_lxstat_dvma_malloc_space_uvm_kernacc_ipsp_address_bridge_span_union_mkshadow_VOP_WHITEOUT_bufhashtbl_numfreepages_sunos_sys_getdents_pv_syncflags4_4c_lehwreset_nfs_nhinit_tcp_rndiss_next_msdosfs_vptofh_vop_generic_lock_disk_find_mainbus_cd_fpu_explode_in6addr_linklocal_allnodes_in6addr_nodelocal_allnodes_lk_nfs_renamerpc_nfsv2_procid_icmp6_mtudisc_callback_register_union_bmap_sys_fchdir_mclpool_wakeup_sunos_sys_ostime_dumpconf_cgfourclose_amap_pp_adjref_cast_encrypt_rootfs_vfs_export_lookup_X_db_sym_numargs_db_sym_numargs_db_aout_sym_numargs_db_aout_line_at_pc_cgsix_use_rasterconsole_tdb_add_inp_vclean_copyright_db_set_watchpoint_be_read_uvm_anon_init_bpf_validate_pipe_stat_disk_unbusy_cryptoselect_hw_sysctl_audio_mmap_audio_blk_ms_tcx_ca_union_open_sys_munmap_nblkdev_pf_flush_fragments_quotaon_tcp_backoff_procfs_close_msg_freehdr_vsnprintf_timedelta_hz_rpc_vers_xformsw_sppp_auth_type_name_sysctl_tty_sys_link_tcx_cd_mtty_match_kbd_repeat_step_fpu_init_amap_unref_nfs_timer_bstp_become_designated_port_bstp_designated_port_ifqmaxlen_fpu_ftoi_dvd_read_struct_ufs_root_udp_output_unp_disconnect_pool_cache_get_sys_msgget_fdcstate_diradd_inode_written_pool_reclaim_db_watchpoint_list_db_print_format_svr4_sys_nice_ext2fs_link_ipip_allow_bpf_tap_ext2fs_fifoop_opv_desc_ffs_fifoop_opv_desc_sys_fchown_cd9660_fifoop_opv_desc_db_watchpoint_free_suibyte_fpu_ftod_be_tcvr_write_bit_nd6_timer_memname_ttywait_qec_ca_mask_rnhead_segm_locked_mii_down_import_sa_cuio_copydata_getphysbuf_vfs_register_pf_binat_pl_kernel_pagtable_store_kernel_regtable_store_sbppopen_in6_mask2len_ffs_blkfree_numnfsrvcache_bridge_stop_pool_destroy_qec_cd_sunos_sys_sigpending_svr4_sys_sigpending_uvm_pageunwire_bstp_disable_change_detection_bstp_enable_change_detection_bstp_topology_change_detection_config_process_deferred_children_killpg1_sys_sigpending_in6_ifawithifp_nfsm_reqh_nfs_rephead_fdesc_symlink_lockmgr_mii_anar_ufs_quota_free_blocks2_ipsp_reffree_audio_open___bin2bcd_bsd_to_svr4_sigset_cgsixioctl_sd_reassign_blocks_uvm_pagezero_uvm_pagealloc_strat_amap_extend_initiate_write_filepage_kern_targets_viking_hotfix_in6_ifinit_vfs_opv_init_explicit_soshutdown_slopen_tbopen_knote_pool_sys_shutdown_magma_attach_oclockattach_swap_encrypt_initalized_filt_ttyread_sys_ktrace_db_call_depth_db_add_expr__main.o_fpu_norm_uvm_pagermapin_tbconf_cd9660_access_fpu_ftox_uvm_map_spacefits_in_pcbdisconnect_ienab_bic_4_4c_udp_init_raw_recvspace_raw_sendspace_m_tag_delete_disk_unlock_initclocks_cd9660_strategy_rcons_doesc_fpu_dtof_statvar_pv_fdfinish_nfsrv_readdir_cd9660_start_cd_reset_pppdealloc_xdc_tick_scanjet_attach_ah_attach_icmperrppslim_last_invalhash_logopen_qs_sunos_sys_access_tunselect_vfs_hang_addrlist_swapdev_db_trace_until_matching_cmd_tz_fpu_ftos_xyc_submit_iorq_cpu_coredump_sys_msgctl_machclk_per_tick_locnamp_mmclose_rom_console_input_uvm_anon_dropswap_ext2fs_inode_free_ffs_inode_free_nfs_vinvalbuf_winSlotCnt_filt_signal_sys_symlink_uvm_init_limits_db_delete_watchpoint_nfs_setattr_free_msghdrs_Debugger_icmp6_error_svr4_sys_mmap_stioctl_ext2fs_blkpref_ufs_makeinode_sys_mmap_sys_exit_nd6_dad_start_esp_output_cb_in_interfaces_nfs_mountroot_ffs_mountroot_dk_mountroot_time_status_vfs_mountroot_am7990_start_cpumatch_ms_chkdqchg_nfsrv_pathconf_nfsrv_write_ah4_input_bridge_rtdelete_nbridge_buf_daemon_uvm_anfree_softdep_setup_allocindir_page_vn_initialize_syncerd_userconf_parse_curpriority_magma_ca_fusword_sw_2_leftover_ufs_advlock_nfs_lookup_icmp_ratelimit_tb_pv_syncflags4m_nonidempotent_rpc_msgaccepted_pftm_other_single_copyinstr_udp_recvspace_udp_sendspace_magma_cd_tctrl_setup_bitport_ip6_setpktoptions_ufs_quota_free_inode2_nfsrv_fsinfo_in6_pcbbind_rt_timer_add_pipe_select_checkalias_am7990_copyfrombuf_contig_amd7930swintr_icmp6_sysctl_ip6_sysctl_ext2fs_vget_fdhashtbl_autoconf_verbose_swcr_process_des_encrypt2_in_pcbnotifyall_VOP_SELECT_pollscan_pool_page_free_nointr_tbr_dequeue_ncr53c9x_reset_promvec_pmap_init_freeblks_pool_tcp_mssdflt_sppp_to_event_lastday_VOP_SETEXTATTR_randomattach_ncr53c9x_attach_xyc_ca_pmap_destroy_nfs_reply_SHA1Update_umap_bwrite_xbox_ca_sttymatch_rip6_usrreq_nd6_lookup_in6_are_prefix_equal_ffs_truncate_rip_usrreq_ptcopen_db_eqname_memerr4_4c_in_pcbrehash_ratecheck_xyc_cd_svr4_sys_open_ufs_seek_sys_open_uvm_map_db_tok_number_pool_sethiwat_loopattach_xbox_cd_desiredvnodes_fs_sysctl_sys_mprotect_audiommap_svr4_sys_facl_xygetdisklabel_hme_tcvr_bb_writeb_cdminphys_setdisklabel_ip6_id_setup_allocindir_phase2_ip4_input_bridge_bifconf_pipe_pool_cd9660_pathconf_cd9660_print_if_index_svr4_sys_fstatvfs64_union_removed_upper_db_history_size_sw_0_leftover_igmp_sendpkt_bridgeintr_frame_pgfind_disksort_ext2fs_dirrewrite_ufs_dirbadentry_ufs_quota_delete_tcpdropoldhalfopen_null_strategy_cpu_initclocks_sys_fork_pf_chk_sport__insque_p9100mmap_st_mode_select_csefree_statclock_limfree_vfs_export_fb_unblank_etherip_sysctl_soisconnecting_free_msgmaps_kqueueops_time_esterror_reaper_in_socktrim_fdesc_root_dmaattach_fddkdriver_module_viking_icmp6_input_skipjack_setkey_tcp_rst_ppslim_last_tcp6_input_sppp_pap_input_sppp_cp_input_soaccept_wakeup_n_uvm_aiodone_daemon_bridgeattach_encattach_nfs_rmdir_tty_count_bpf_mtap_st_mount_tape_ch_get_quirks_uvm_unmap_tcp6_usrreq_icmp_reflect_db_show_radix_node_lkmopen_sys_fhstat_sys_fchmod_spif_ca_utsname_getptep4m_ttypend_vop_advlock_desc_status_ifp_pflog_packet_microtime_zsshortcuts_ext2fs_setattr_tcp_reass_sbreserve_audioopen_db_examine_format_db_set_cmd_pf_insert_state_pf_find_state_ip6_log_time_sppp_pap_my_TO_sys_bind_ncr53c9x_scsi_cmd_spif_cd_cd_pause_ip6_mrouter_done_db_history_curr_mmuregions_uvm_pagewire_ufs_makedirentry_msdosfs_close_union_updatevp_VOP_REMOVE_sbcreatecontrol_fdesc_pool_ccdinterleave_sysctl_int_zeropage_sppp_cp_send_union_newsize_ufsread_filtops_allocindir_pool_nfsm_srvwcc_tcp_keepidle_tunioctl_fiforead_filtops_slpque_kqread_filtops_fixalign_zsopen_nd6_prune_srandom_iommu_ca_st_read_block_limits_uvm_vmspace_pool_arprequest_sppp_lcp_up_dead_strategy_sys_statfs_enc_xform_des_ext2fs_specop_opv_desc_ext2fs_vnodeop_opv_desc_msdosfs_vnodeop_opv_desc_union_vnodeop_opv_desc_procfs_vnodeop_opv_desc_kernfs_vnodeop_opv_desc_umap_vnodeop_opv_desc_null_vnodeop_opv_desc_portal_vnodeop_opv_desc_fdesc_vnodeop_opv_desc_fifo_nfsv2nodeop_opv_desc_spec_nfsv2nodeop_opv_desc_nfsv2_vnodeop_opv_desc_mfs_vnodeop_opv_desc_spec_vnodeop_opv_desc_fifo_vnodeop_opv_desc_dead_vnodeop_opv_desc_ffs_specop_opv_desc_ffs_vnodeop_opv_desc_sync_vnodeop_opv_desc_pipe_read_cd9660_specop_opv_desc_cd9660_vnodeop_opv_desc_db_clear_breakpoints_p9100loadcmap_esp_dma_intr_esp_sysctl_iommu_cd_lerdcsr_ip6_sendredirects_pf_status_mem_access_fault_des3_setkey_arp_inuse_lockmgr_printinfo_sys_acct_vnddkdriver_max_datalen_ignore_bogus_traps_in6_prefixlen2mask_softdep_setup_allocindir_meta_nbpfiltersubdi3.o_amap_unadd_ext2fs_remove_bmsafemap_lookup_bridge_flushrule_sl_compress_init_svr4_add_socket_softdep_mount_enc_xform_3des_m_pullup_knote_drop_blf_cbc_decrypt_pf_routable_Lfsbail_clk_wenable_nfsrv_getattr_msdosfs_setattr_unix2winfn_procfs_setattr_cpu_configure_st_unmount_scsi_strvis_oclk_set_dt_pagedep_pool_recvit_sendit_pf_sport_pl_sparc_noop_VOP_RENAME_ktrnamei_profprocs_ssclose_qsync_vnode_ipcomp4_input_sysctl_sysvipc_pf_compare_rdrs_clockattach_tcp6_mtudisc_callback_unixswwinuf_invalid_nd6_purge_nfsrv_rcv_rn_insert_kernfs_lookup_pppclose_uihash_sys_getlogin_fifo_advlock_ncr53c9x_sense_pmap_activate_kernfs_freevp_tk_rawcc_pfopen_ip6_ecn_egress_uvm_map_findspace_crypto_pool_initialized_ipsec_acquire_pool_initialized_ipsec_policy_pool_initialized_fdesc_read_sddump_in6_localaddr_portal_readdir_pool_prime_maxdmap_lastpid_ncr53c9x_sched_auxreg_ca_nextsibling_pmap_create_ifafree_if_slowtimo_sys_getpgid_svr4_stream_ioctl_compat_43_sys_accept_ext2fs_rename_ext2fs_read_DES_version_sppp_attach_vfs_free_addrlist_sys_dup2_auxreg_cd_tbread_sys_truncate_pipe_init_write_dsfield_xdcintr_csedelete_softdep_fsync_db_next_free_watchpoint_db_write_cmd_random_softdep_error_tcp_trace_db_history_last_db_recover_pf_print_state_si_vme_dma_eop_xdc_e2str_sddone_fdctimeout_fdc_debug_cryptof_select_sppp_lcp_RCN_rej_insmntque_limcopy_ncr5380_cmd_timeout_db_line_ether_delmulti_st_loadquirks_ah_output_cb_bridge_init_bridge_rtfind_sbdrop_shm_nused_bufpool_sys___sysctl_amd7930_halt_input_nfsrv_wakenfsd_nfs_writerpc_m_free_vop_close_desc_psignal_db_hang_am7990_setladrf_vprintf_qe_ca_zs_ca_bsd_to_svr4_sigaltstack_mii_attach_pppalloc_chainalloc_db_next_bpf_dtab_rtioctl_svr4_to_bsd_termios_amd7930_start_output_iommu_sc_nfs_numasync_sppp_ipcp_opt_name_procfs_allocvp_qe_cd_zs_cd_in6_prefix_ioctl_enc_xform_blf_vop_generic_unlock_VOP_REVOKE_sbppattach_rcons_clear2eop_segm_freelist_ukopen_sadb_exts_allowed_in_umap_bypass_lf_wakelock_p9100open_hmestart_sdebug_esp_dma_isactive_scanjet_read_nd6_maxndopt_chkdquot_nfsrv_create_igmp_slowtimo_useloopback_sys_swapon_ncr53c9x_dequeue_sttyioctl_bwtwoioctl_stmatch_hmac_ipad_buffer_tcp_rst_ppslim_rn_init_userconf_histsz_ext2fs_reload_doasyncfree_rijndael_encrypt_suser_icmp6_reflect_ext2fs_truncate_fdesc_init_unp_gc_dvma_base_scsi_print_sense_nd6_ns_output_uvn_sync_lock_crypto_get_driverid_union_read_buf_replacevnode_sogetopt_sys_sstk_vop_unlock_desc_nfs_mount_diskless_kbdopen_defrouter_select_csefind_yield_cd9660_lock_ncr53c9x_timeout_svr4_sys_lstat64_xyc_perror_sdgetdisklabel_cdgetdisklabel_mii_phy_delete_media_pager_map_wanted_deflateInit_uvm_sysctl_cd9660_defattr_readdisklabel_ccdgetdisklabel_memerr4m_nfs_realign_test_espstat_vop_revoke_desc_cd9660_link_ncr53c9x_free_ecb_xdc_remove_iorq_compat_43_sys_getdtablesize_svr4_sys_sysconfig_rcons_clear2eol_xdclose_e2fs_i_bswap_nfs_bwrite_vop_open_desc_tctrl_read_data_pmap_changeprot4_4c_fpu_itof_uao_swap_off_ufs_quota_init_kernfs_allocvp_vop_reallocblks_desc_uvm_swapin_sys_sendmsg_sys_recvmsg_qeintr_newblk_hash_revarprequest_bridge_hash_nbigpipe_rmc_dropall_crypto_done_ripsrc_ip_stripoptions_union_newupper_vfs_opv_numops_be_ifmedia_upd_oclk_get_secs_in_localaddr_soisdisconnecting_nfree_msgmaps_hmewatchdog_frag6_slowtimo_xdr_inaddr_decode_msdosfs_fsync_nlinesw_sys_getpgrp_vop_readlink_desc_vop_strategy_desc_acc_classify_pf_test_other_mld6_init_des_set_odd_parity_ah_init_procfs_ioctl_killproc_lkminit_sys_sync_pf_state_pl_ncr53c9x_watch_cryptoattach_ip6_protox_route_src_disk_count_pf_tree_pl_xycmatch_ufs_bmap_auth_hash_hmac_sha1_96_dofilewritev__mul__uremreplace_end__remreplace_end_sunos_sys_otimes_statmin_bstp_stop_sysctl_malloc_syscallqdivrem.o_chattach__div_ext2fs_sync_softdep_change_linkcnt_ip_reass_kernfs_setattr_semtot_be_ifmedia_sts_uvm_pagefree_ffs_blkpref_RMD160Update_tdb_timeout_bstp_received_config_bpdu_arc4_timeout_umap_node_hashtbl_null_node_hashtbl_sosend_sys_profil_getinoquota_tdb_soft_firstuse_bpf_attachd_readde_elf32_olf_check_header_elf32_check_header_qeinit_zslist_bus_map_num_on_worklist_ufs_open_pcbmap_procfs_dofpregs_uvm_swap_get_uvm_anon_remove_userconf_maxdev_dequeue_randomness_enqueue_randomness_ncr53c9x_variant_names_pv_changepte4m_db_machine_init_tcp_saveti_oldpvec_uvm_pageactivate_bpf_ifname_umap_reclaim_procfs_root_portal_reclaim_mbtypes_cs4231_round_blocksize_amd7930_round_blocksize_nfs_clearcommit_db_free_breakpoints_softdep_worklist_req_ipip_sysctl_qewatchdog_replacemul_import_identity_union_vn_create_cluster_wbuild_userconf_modify_iso_disklabelspoof_pfkey_register_crypto_register_tcp_totbackoff_umap_print_VOP_GETEXTATTR_ttstart_exec_aout_prep_zmagic_getdevunit_ifmedia_baudrate_fdesc_link_blktochr_softclock_audio_initbufs_red_destroy_kbd_cnv_out_si_vme_intr_on_ssmatch_scsi_prevent_mfs_bmap_nfs_start_des_check_key_ifmedia_match_sd_ca_export_auth_VOP_KQFILTER_vinvalbuf_RMD160Transform_bstp_root_bridge_bridge_rttrim_deflateReset_sppp_chap_TO_umap_getattr_portal_getattr_time_precision_cd9660_mmap_am7990_intr_cnkqfilter_xyread_uvmcnt_dump_indir_trunc_nfs_fsinfo_subkey_table_gen_msdosfs_mkdir_readep_portal_unmount_pffindtype_ex_region_pl_addupc_intr_ncr5380_scsi_cmd_sd_cd_sparc_interrupt44c_vpage_uvm_swap_put_dqhashtbl_nfs_checkexp_inflateEnd_proc_root_targets_cd9660_deftstamp_uvmspace_alloc_ext2fs_alloc_bpf_iflist_bpfopen_null_node_hash_vn_write_ptswrite_userconf_add_cgtwoopen_amd7930match_esp_switch_ss_identify_scanner_mfs_open_getdirtybuf_leapyear_ttyopen_sunos_sys_execv_doclusterwrite_skipjack_zerokey_ip_mobile_allow_union_root_emul_elf32_fifo_lookup_db_unread_token_rcons_delline_cs4231_trigger_output_qsync_nfsrvw_sort_sl_uncompress_tcp_core_ppp_restart_md_diskconf_uk_caudiv.o_sunos_emul_path_mmioctl_ieioctl_ipsec_delete_policy_sysctl_dumpentry_loioctl_svr4_sys_stat_xdstrategy_uvm_map_extract_kqueue_initialized_sys_stat_cd9660_init_arc4random_initialized_physio_audio_rint_proc0paddr_sd_scsibus_flush_uvm_swap_freepages_chkvnlock_uk_cd_lemediastatus_hme_mediastatus_be_tcvr_read_bit1_nfs_vfs_init_ptcread_elf32_read_from_sbppread_svr4_netopen_be_tcvr_read_bit2_sdopen_sppp_ncp_check_fifo_printinfo_uvm_page_printit_xldcontrolbidle_xysize_nexpire_desirednfsrvcache_ext2fs_vfsops_vrele_am7990_init_xdc_submit_iorq_eeprom_match_handle_workitem_remove_procfs_access_VOP_PRINT_proc0__udivreplace_end__divreplace_end_compat_10_sys_msgsys_ffs_freefile_procfs_validregs_db_del_symbol_table_db_add_symbol_table___qdivrem_ledma_reset_inflateReset_spec_print_vnode_hold_list_soconnect2_userconf_cnt_db_maxoff_swift_mmu_enable_nfs_boot_getfh_ip_pcbopts_in_delmulti_preempt_db_regs_npmemarr_uvm_aobj_pool_swcr_freesession_sppp_lcp_TO_unix2dostime_bufhash_semu_list_ext2fs_mountroot_VOP_GETATTR_hmereset_rpc_call_nfsrv_errmap_null_node_create_vop_lease_desc_change_sign16_le_mts_swap_bytes_mts_noswap_bytes_mts_db_examine_cmd_qzero_sunos_sys_creat_svr4_sys_sigaltstack_sparc_i_nsphyattach_rip6_init_ah_massage_headers_msdosfs_mknod_uvm_total_ruadd_sys_sigaltstack_fpu_sqrt_tcp_rst_ppslim_count_mono_time_db_term_rt_getifa_cpumod_bsdi_strings_svr4_delete_socket_pmap_page_protect_p_nfs_print_tcp_timer_funcs_msdosfs_root_uprintf_si_ca_p9100fbdriver_icmp6_rediraccept_icmp_rediraccept_union_copyup_vmcmd_map_pagedvn_pf_map_port_range_want_ast_tadpole_powerdown_fpu_stof_cgsixclose_in6_purgeprefix_uvm_unloanpage_uvm_pagecopy_pppinput_audio_pint_mustek_get_status_fdcstatus_umap_reverse_findid_pf_normalize_tcp_si_cd_svr4_sigcode_scsibusdetach_getcacheinfo_sun4c_ip6_sourcecheck_dest6_input_ah6_input_tcp_timer_2msl_ppp_deflate_cluster_write_cttyioctl_ptyioctl_ttybg_kqueue_register_sys_getppid_db_vars_esp_ca_sunos_sys_mknod_spec_nfsv2nodeop_p_fifo_nfsv2nodeop_p_union_islocked__rem_amap_lookup_bstp_configuration_update_maxproc_bufinit_ncr5380_wait_nrq_timo_rmc_newclass_arpintrq_esp_cd_dumplo_xdmatch_vm_nphysseg_flush_pagedep_deps_ufs_setattr_bstp_ioctl_tcp_rndiss_reseed_nd6_setmtu_kmembase_sys_mlock_sys_adjtime_indirdep_pool_revarpwhoami_mountroot_isohashtbl_fscale_dvma_free_msdosfs_sync_vnode_procfs_mount_syncdelay_sys_fsync_db_read_char_bsdi_si_leattach_ufsfifo_close_nfsrv3_procs_nfs_rcvunlock_ipsp_parse_headers_nd6_nud_hint_vlan_input_tag_null_vfsops_audio_ioctl_des3_zerokey_ipsec_last_added_startprofclock_svr4_sys_wait_userconf_pdevnam_ktrgenio_espdmaintr_ufs_dirrewrite_procfs_docpuinfo_issignal_csignal_mbinit_mmumod_handle_written_inodeblock_nfsrv_writegather_rn_mkfreelist_fdesc_open_udbtable_cachestats_si_vme_dma_setup_stclose_powerdown_in6_prefix_remove_ifid_newblk_in_progress_kernfs_badop_sys_preadv_vop_islocked_desc_ddb_sysctl_scsi_user_done_ip6_mloopback_uvm_km_init_minphys_fdformat_ip6_input_ext2fs_fsync_dqhash_mfs_doio_msdosfs_ioctl_sys_sbrk_uvm_km_free_audio_check_params_audiostartp_svr4_sys_utssys_sa_hw_if_ip6_forward_rt_blf_encrypt_db_print_sa_bpf_setf_sys_clock_gettime_audio_drain_ietint_in6_addmulti_nfs_remove_rn_lookup_VOP_RECLAIM_ttyin_audiostartr_pmap_is_modified4_4c_allocsys_nd6_maxnudhint_in6_ifscrub_pmap_clear_modify_p_gre_in_cksum_itimerround_db_find_watchpoint_pf_compare_binats_malloc_newfreefrag_ip6_hdrnestlimit_sppp_lcp_RCN_nak_process_write_regs_filt_sordetach_qsphy_ca_viking_mmu_enable_uvm_km_valloc_prefer_wait_audio_read_rcons_text_pmap_dumpmmu_machine_arch_getpropstring_uvm_cnt_head_vmi_list_ufs_init_uao_create_pool_head_slock_nfiles_randomwrite_qsphy_cd_sunos_sys_ioctl_mii_tick_iso_nchstats_pf_tree_key_compare_svr4_sys_execv_mbppwrite_wzero_cd_scsibus_setvol_fdcswintr_swap_key_cleanup_start_nfsio_if_qflush_msdosfs_read_union_access_sys_poll_db_aout_forall_cgsix_ca_xyc_chain_bstp_tick_fdesc_lookup_pgrphash_config_init_cd9660_fifoop_p_si_find_foundfpu_softdep_setup_blkmapdep_incore_pf_tree_first_route_dst_procfs_donote_maxlockdepth_pool_allocator_drain_db_list_breakpoints_db_set_breakpoints_machclk_freq_cgsix_cd_kernel_regmap_store_rr_prefix_uvm_map_call_in_arpinput_sys_mkdir_db_read_line_iewatchdog_ipsendredirects_sloutput_tree_ext_gwy_ssioctl_uvm_page_rehash_nfsrvw_procrastinate_hmac_opad_buffer_esp_input_pppdumpb_sppp_chap_input_va_null_ifmedia_ioctl_am7990_read_fubyte_mbpp_attach_svr4_sys_vhangup_prom_vend_nfs_rename_unp_attach_logread_sysctl_kmemlock_memset_svr4_sys_putmsg_cs4231_get_port_amd7930_set_port_ufs_access_nfsrv_lookup_pppioctl_buckstring_uvm_vnp_setsize_VOP_WRITE_pf_tree_remove_isp_async_ierint_fd_set_motor_des1_decrypt_sppp_ipcp_open_sppp_ipcp_down_ttyinfo_ttyoutput_randomopen_db_boot_halt_cmd_cons_cnfbdma_tmo_esp_dma_reset_nfsspec_write_bstp_designated_for_some_port_null_unlock_nclruhead_spec_write_xboxattach_bsd_to_svr4_speed_ev_select_sw_options_gettdbbysrc_vfs_unbusy_svr4_sys_pwrite_ext2fs_mkdir_mfs_init_vn_kqfilter_ptsstart_ttylist_v_putc_lkm_list_sys_pwrite_db_output_line_svr4_ustat_si_free_tdb_firstuse_tcp_do_sack_ttyfree_ncr5380_wait_req_timo_swbuf_svr4_sys_creat_inet6sw_VOP_READDIR_addupc_task_msgbufmapped_bppwrite_sbus_testdma_eeprom_update_pfkey_addr_cast5_zerokey_ttwrite_longjmp_uvm_swap_allocpages_swcr_id_fdesc_start_raw_usrreq_pf_test_state_other_am7990_tint_viking_memerr_nfs_write_bpfdetach_mif6table_dqfreelist_in6_if_up_log_open_db_single_step_cmd_svr4_sys_time_si_obio_dma_setup_in_baddynamic_ifunit_ipsp_skipcrypto_mark_db_break_table_xy_casdiv.o_cast5_setkey_ipcomp6_input_ipprintfs_svr4_sys_mknod_swap_encrypt_compat_43_sys_sigsetmask_sys_mknod_cd9660_bmap_uvm_km_suballoc_tcbhashsize_ipqent_pool_tunclose_ifmedia_set_bpfread_umap_mapids_compat_43_sys_truncate_X_db_lookup_pftm_frag_xy_cd_uvm_swap_alloc_pmap_unwire_chkiqchg_ufs_lock_nosuidcoredump_rmc_delete_class_svr4_sys_break_pmap_enu4_4c_in6_ifdetach_sys_pipe_cd9660_statfs_db_prev_pf_tree_search_fb_pfour_id_iszerodev_ufs_link_ether_ip6multicast_min_dounmount_sys_read_ether_ipmulticast_min_nmi_hard_iematch_fdcmatch_ppplogchar_mfs_mountroot_procfs_doregs_disklist_sysctl_diskinit_pf_frag_pl_uvm_pagermapout_uvm_tree_RB_NEXT_ip6intrq_elf32_load_file_cd9660_open_ulinear8_to_linear16_le_mts_linear8_to_linear16_le_mts_pmap_alloc_cpu_ch_switch_hardmemerr4m_rip_init_ifa_ifwithnet_sunos_sysent_pmap_zero_page_p_vm_physmem_ext2fs_mknod_tty_attach_setrunqueue_rcons_delchar_tcp_newtcpcb_VOP_ISLOCKED_m_tag_delete_chain_sunos_sys_statfs_ufs_vinit_nfs_inactive_ether_ip6multicast_max_ktrsyscall_compat_25_sys_statfs_vop_remove_desc_ticket_binats_inactive_ticket_nats_inactive_pf_binats_inactive_pf_nats_inactive_ether_ipmulticast_max_am7990_rint_ms_rint_module_ms2_ipsec_exp_first_use_ipsec_soft_first_use_msdosfs_sync_sigacts_pool_db_get_variable_kernel_segmap_store_esp_dma_setup_cd9660_rrip_getname_nd6_useloopback_pfkey_init_forkstat_db_machine_commands_install_am7990_watchdog_module_ms1_uvm_mlk_call_ipip_input_sockargs_userconf_argbuf_tprintf_sigactsunshare_cd9660_islocked_audio_fill_silence_db_shift_expr_db_print_position_xdioctl_sadb_exts_required_out_arpioctl_portal_lookup_lf_getlock_bwrite_vop_generic_revoke_au_get_port_si_vme_dma_start_ipport_lastauto_sys_writev_si_head_handle_workitem_freefrag_fdesc_print_bd_req_tctrl_ext_statuses_ip6_flow_seq_audioread_svr4_sys_fstat_mfs_checkexp_nfsrv_null_xdr_inaddr_encode_vfs_getuserstr_portal_start_nobuffers_sys_fstat_memcpy_fbrcons_rows_hme_put_RMD160Init_msdosfs_mount_db_force_whitespace_db_breakpoint_cmd_svr4_sys_ioctl_xyc_remove_iorq_cs4231_query_devinfo_amd7930_query_devinfo_skipjack_forwards_kmeminit_sys_ioctl_isodirino_pf_add_sport_lewrcsr_memregattach_st_space_ufswrite_filtops_fifowrite_filtops_sowrite_filtops_ttywrite_filtops_pipe_wfiltops_procinit_uvm_init_pow_w_ffs_write_sppp_pap_open_consintr_in6_cksum_frag6_init_sync_print_elf32_copyargs_boottime_mbpp_ca_cgeight_ca_pmap_clear_modify4m_esp_dma_go_esp_read_reg_qe_ifmedia_upd_import_key_in6_init_prefix_ltimes_delete_each_prefix_uvm_grow_inodedep_in_progress_pagedep_in_progress_kbd_rint_bmsafemap_pool_Blowfish_expandstate_ipsec_common_ctlinput_fdesc_readdir_device_ref_db_restart_at_pc_sunos_sys_mount_scanjet_ctl_write_mbpp_cd_cgeight_cdstrcat.o_cs4231_open_ch_position__uvm_tree_sanity_ifnet_addrs_sys_getegid_db_search_cmd_ss_ca_sbppselect_esp_dma_isintr_ip6_mrtproto_uvm_mk_pcluster_handle_written_mkdir_rpc_reply_ifioctl_db_lookupudivdi3.o_makememarr_procfs_bmap_sysctl_disklock_lkmexists_db_trace_until_call_cmd_kbdread_cgthreemmap_nd6_setdefaultiface_VOP_LOOKUP_raw_input_ptcclose_pipe_write_ss_cd_cputyp_qe_ifmedia_sts_idprom_bstp_send_config_bpdu_filt_soread_bootpath_amd7930_device_cryptof_kqfilter_gre_sysctl_sppp_phase_network_m_devget_zstty_pppoutput_sys_ptrace_tree_lan_ext_suiword_svr4_stream_ti_ioctl_cpu_hotfix_nd6_cache_lladdr_cast_setkey_consinit_rcons_puts_emulinstr_uvm_swap_initcrypt_all_ext2gennumber_procfs_open_hashinit_db_symtabs_xd_ca_qecmatch_ifmedia_add_db_stack_trace_cmd_drop_early_fpu_xtof_cryptoread_sun_noname_ttrstrt_ufs_fhtovp_sppp_up_event_sbcompress_sleep_selwakeup_db_trap_db_delete_line_gifattach_xd_cd_virtual_avail_ifa_ifwithroute_pmap_enu4m_export_identity_esp_zeroize_udp6_ctlinput_tcp_ctlinput_nifvlan_deextend_allocbuf_m_getptr_runtime_ch_move_ldcontrolb_crypto_dispatch_route_proto_updatefats_portal_print_probeset_tctrl_attach_sunos_sys_vhangup_pmap_enter4_4c_uvm_errno2vmerror_uvmfault_anonget_ipforward_rt_sppp_ipcp_init_process_write_fpregs_nfs_vfsops_usercrypto_red_getstats_tree_fragment_rtalloc_mbpp_rw_cgtwommap_si_obio_dma_start_uvm_pageboot_alloc_bridge_output_memall_xdc_reset_scsidebug_luns_nfsrtton_ip6_sprintf_tdb_delete_inetsw_rt_newaddrmsg_union_ioctl_m_prepend_initsiginfo_strayintr_cd_read_toc_scsi_size_uvm_page_unbusy_uvm_mlk_hint_uvm_loan_pmap_clear_reference_p_nfsm_uiotombuf_bridge_rtupdate_buffers_auth_hash_hmac_md5_96_sppp_set_ip_addr_iskmemdev_fdesc_targets_dofilereadv_compat_43_sys_getpagesize_db_aout_sym_init_intrcnt_svr4_sys_pwrite64_nd6_dad_stop_bstp_input_cd9660_vptofh_audioioctl_am7990_stop_mmu_3l_ufs_ihashinit_realitexpire_xymatch_cgfourteenclose_ufsvnode_filtops_nfsm_rpchead_crypto_drivers_num_procfs_validfile_shm_find_segment_by_key_st_ca_svr4_sys_xmknod_rip6_output_nfsrv_link_rip_output_vn_closefile_wcopy_cs4231_round_buffersize_iommu_print_pfkeyv2_dump_walker_db_find_variable_sdwrite_pfkeyv2_get_pagedep_hash_m_pad_bridge_filter_vop_whiteout_desc_vop_mknod_desc_vaccess_tcp_now_st_cd_pmemarr_pfkey_sendup_uvm_lock_fpageq_cryptop_pool_ah4_ctlinput_rt_setgate_cpumatch_unknown_des_set_key_in_canforward_db_show_arptab_filt_fifowdetach_rawcb_uk_switch_uvm_map_init_freefrag_pool_ffs_reload_in_pcbnotifymiss_bstp_transmit_config_msdosfs_access_reinsert_syncer_maxdelay_memchr_maxsmap_uvm_vslock_db_lbuf_end_stackgap_alloc_handle_workitem_freefile_msdosfs_bmap_startuphook_list_sw_ca_gre_input_myip_ifp_union_lease_fdesc_write_lkmclose_swap_bytes_change_sign16_le_change_sign16_le_amd7930_trap_in6_setpeeraddr_sppp_ipcp_RCN_rej_pool_serial_xboxprint_tcxioctl_softdep_typenames_in_pcblookup_nchash_sw_cd_ip4_input6_umap_node_create_db_map_current_svr4_sys_fpathconf_pmap_clear_modify4_4c_romgetcursoraddr_ip6_maxfragpackets_soo_ioctl_sys_fpathconf_elf32_probes_sbus_ca_msdosfs_open_VOP_CREATE_filt_proc___moddi3_db_read_token_in6mask0_sppp_print_string_union_advlock_acctchkfreq_spec_lookup_VOP_ABORTOP_memcmp_scsi_inquire_eeprom_take_ext2fs_inactive_nfsrv_noop_win2unixfn_ip6_output_sbus_cd_turbosparc_get_syncflt_ms1_get_syncflt_viking_get_syncflt_hypersparc_get_syncflt_srmmu_get_syncflt_sunos_sys_lstat_trap_type_qe_mcreset_uvm_pager_init_sppp_lcp_check_and_close_fdesc_reclaim_db_read_variable_tctrl_process_response_lenocarrier_cdwrite_ipsec_hdrsz_fixtick_vgone_cd9660_check_export_firstchild_udp_sysctl_if_detached_watchdog_setregs_sigcode_segm_lru_qereset_cp_time_sys_mount_uvm_map_entry_pool_vhold_ptcwakeup_settime_sys_nosys_pgrp0_cbqopen_mbppopen_cgeightopen_ip6_optlen_ufs_rmdir_encdebug_null_bwrite_ticks_start_update_ether_addmultianddi3.o_svr4_sys_stat64_in6_embedscope_pflogoutput_cd9660_sync_pv_size_want_resched_sbusreset_mrt6stat_igmpstat_ether_ifdetach_userconf_totdev_rcons_cnputc_pool_cache_invalidate_pf_pull_hdr_emul_svr4_import_credentials_export_credentials_in6_rr_timer_ch_uvm_mmap_cryptodev_key_slioctl_bpfioctl_fc_lfcempty_fdesc_unmount_uvm_exit_start_cleaner_in6_createmkludge_ext2fs_sync_vnode_ffs_sync_vnode_cache_purgevfs_shmsegs_itimerfix_db_guesses_svr4_sys_utimes_pmap_rmk4_4c_uvm_tree_RB_FIND_ext2fs_mount_nfsrv_zapsock_nv2tov_type_udp_input_nd6_storelladdr_pipeclose_sys_utimes_db_ed_style_pf_test_udp_ffs_fragacct_sppp_pap_init_knote_attach_led_blink_swap_key_prepare_uvm_unmap_remove_ipqmaxlen_bridge_timer_vn_statfile_file_filtops_compat_43_sys_sendmsg_compat_43_sys_recvmsg_cd9660_quotactl_ncr53c9x_done_etherip_output_fdesc_inactive_unp_connect_pmap_protect_p_pf_binats_setroot_cseadd_semundo_clear_logselect_pfind_in6addr_loopbacktreesanity_label_inside_enc_xform_skipjack_udp_ctlinput_vlan_unconfig_inet6domain_unixdomain_ktrpsig_qcopy_cs4231_free_createde_randomread_tcp_iss_probe_switch_dqsync_nfsrv_init_etheripstat_kernfs_vfsops_cd9660_specop_p_pf_remove_fragment_if_attach_tctrl_write_data_dma_isintr_e2fs_cg_bswap_tcp_rndiss_encrypt_swap_bytes_change_sign16_be_change_sign16_be_lemediachange_hme_mediachange_uvm_map_reference_Blowfish_encipher_udp_usrreq_pf_test_tcp_power_ca_probeget_cache_print_ipsec_policy_pool_kprintf_mem_no_hypersparc_mmu_enable_ms1_mmu_enable_nfs_setattrrpc_sppp_auth_send_union_check_p_shmid_n2o_sys_unmount_vop_bmap_desc_ccdioctl_db_stop_at_pc_db_putstring_power_cd_procfs_init_uvm_map_inherit_db_command_loop_gre_ioctl_sysctl_iflist_compat_43_sys_getpeername_sys_getpeername_compat_43_sys_creat_db_lex_stopprofclock_sys_getfh_ulmin_sbppclose_bestart_sparc_led_blink_ext2fs_cgupdate_rn_search_m_no_asyncflt_regs_cd1400_compute_baud_svr4_emul_path_memregmatch_mfs_inactive_ufs_inactive_esp_output_union_mount_sync_inactive_doclusterraz_qsphy_reset_fdmatch_ifconf_nullfs_statfs_kthread_create_deferred_uvm_fork_romboot_lebufattach_ricoh_is410_sw_sppp_proto_name_sys_geteuid_idle_u_mbpp_start_rcons_bell_numemptybufs_init_machclk_st_rewind_deflate_timeout_startup_ulmax_async_daemon_ss_quirk_patterns_st_quirk_patterns_scsi_quirk_patterns_tcp_mss_null_islocked_ffs_vfsops_compat_43_sys_setreuid_audio_close_db_dot_mbppselect_pmap_kenter_pa_p_vnops_vfs_rootmountalloc_tbr_get_fuswintrskpc.o_pflogstart_brelvp_db_last_non_space_db_putchar_m_gethdr_nfsrv_symlink_breada_linesw_cd9660_read_swap_bytes_panic_openpromclose_cgfourmmap_bstp_make_blocking_fdesc_getattr_mixer_ioctlstrcmp.o_fbclose_chclose_nd6_timer_ch_uvm_pageratop_enc_xform_cast5_icmp_mtudisc_timeout_unp_dispose_hardupdate_audio_clear_ip_mtudisc_timeout_mem_page_p9100unblank_cgthreeopen_uvm_setpagesize_inodedep_hashtbl_pool_prime_page_cd9660_rrip_getsymname_xyioctl_icmp6stat_route6_input_ttysleep_kbd_ascii_bstp_set_port_priority_time_tolerance_breadn_pmap_remove_diradd_pool_generic_filtopsashldi3.o_mmopen_cs4231_setup_output_nfsrtt_union_fsync_prtactive_db_watchpoint_alloc___iordi3_svr4_sys_lstat_sdstart_ext2fs_vinit_ext2fs_statfs_initiate_write_inodeblock_dirrem_pool_softdep_update_inodeblock_msdosfs_fhtovp_kqueue_write_sys_lstat_vndstrategy_spifattach_tcp_timer_persist_m_get_fifo_select_fifo_badop_ncr5380_abort_locnames_ipcomp_zeroize_in_losing_uvm_km_alloc_poolpage1_buckstring_init_siginit_lockinit_virtual_end_cd9660_seek_amd7930_getdev_bstp_etheraddr_tty_detach_uvm_scheduler_nexecs_db_output_position_ifindex2ifnet_rpc_auth_kerb___umoddi3_putphysbuf_uvm_km_valloc_db_free_watchpoints_m_adj_xdc_start_st_load_rtrequest1_m_pullup2_db_printsym_raise_nd6_na_output_bstp_make_forwarding_config_rootfound_ttcompatgetflags_stattach_nd6_na_input_shmget_allocate_segment_shm_deallocate_segment_sigactsinit_cd9660_vget_ksymsopen_nfs_writebp_crypto_freesession_procfs_link_procfs_domeminfo_allcftables_sigactsfree_sys___semctl_compat_43_sys_fstat_m_cat_m_copym2_kbd_repeat_start_des_is_weak_key_ipsec_exp_allocations_ipsec_soft_allocations_sppp_pap_scr_msdosfs_init_scanc_arc4random_8_max_linkhdr_msioctl_amd7930_start_input_blf_setkey_cryptodev_dokey_m_copym0_logclose_sys_munlockall_panicstr_snprintf_sbus_attach_getvnode_disk_attach_db_cmd_list_am7990_meminit_uvm_km_pgremove_nfsrv_remove_tcp_usrclosed_cache_lookup_mainbus_match_amd7930_open_pool_allocator_alloc_brelse_swift_get_syncflt_pmap_enk4m_cdstart_fdstrategy_rn_search_sppp_pap_tlu_pool_cache_reclaim_msgbufenabled_uvm_pageout_db_set_variable_in_pcbnotify_union_dowhiteout_null_bypass_crcopy_sys_sendto_rip6_ctlinput_tcp_xmit_timer_fc_lmdistance_ucred_pool_mbstat__remque_ssminphys_ufs_ihashrem_nfsrv_read_ipsec_common_input_cb_findwin95_knote_dequeue_ipsec_def_enc_igmp_init_netisr_vfs_getnewfsid_sys_flock_db_listbreak_cmd_romhalt_in_addmulti_union_mkdir_kernfs_open_bdwrite_ttselect_vmmapbsy_sys_rename_fifo_ebadf_pffasttimo_sys_msync_biowait___one_cmpldi2_hme_mii_statchg_dma_reset_pgdelete_change_sign16_swap_bytes_be_mts_svr4_netattach_svr4_ttold_ioctl_sun_dkioctl_dma_enintr_sdattach_nfsm_srvfattr_kernfs_epoch_pool_cache_do_invalidate_limit0_cd9660_setattr_vput_pf_send_icmp_sbpp_ca_etext_cs4231_intr_mii_mediachg_sl_compress_setup_ifa_ifwithaf_kernfs_xwrite_vn_select_logpri_cache_purge_sunos_sys_fcntl_pmap_extract4_4c_rcons_init_ext2fs_sysctl_ffs_setblock_nfsfifo_close_ip6stat_fifo_close_spec_fsync_altqclose_sbpp_cd_nfsrv_rename_vndthrottle_swapconf_kbdioctl_led_sc_quotaoff_cd9660_root_llinfo_nd6_vref_hme_mcreset_softdep_load_inodeblock_sppp_pap_tld_sys_connect_db_symformat_nsphy_ca_fbrcons_cols_esp_enable_ipsp_skipcrypto_unmark_lastdosdate_netcon_boothowto_gif_start_uvm_unlock_fpageq_pmap_phys_address_pmap_page_protect4m_dqget_nfsm_strtmbuf_hostid_sys_setpgid_cd9660_vget_internal_mbpool_nsphy_cd_softdep_setup_directory_add_window_deflate_swcr_authcompute_ipcomp_init_bstp_disable_port_bridge_blocknonip_nullfs_vptofh_ncr5380_intr_raster_textn_uao_reference_locked_ufs_dirbad_ppp_compressors_m_getclr_q_to_b_trap_console_font_fixed_nd6_mmaxtries_ip6_get_prevhdr_ufs_start_soreceive_exit1_sys_getitimer_oldmon_w_cmd_blf_ecb_decrypt_ipsp_spd_inp_in4_cksum_sppp_ipcp_RCN_nak_msdosfs_lock_kmemusage_ncr53c9x_intr_exit2_sbppmatch_nam2blk_xyc_tick_union_mknod_vwaitforio_crypto_thread_tbr_set_cpu_ca_bzero___negdi2_sunos_sys_unmount_cgfouropen_maxslp_around_rn_addroute_msdosfs_link_ptcselect_ttydefchars_fuword_cs4231_wait_statintr_putc_knote_execsw_vmeprint_null_print_kernfs_mount_mountlist_slock_msgpool_disk_construct_filt_kqdetach_ifinit_cpu_cd_cgeightmmap_cpumatch_viking_netcls_crfree_db_single_step_sbpp_rw_cnioctl_fdioctl_nfsstats_bpf_mcopy_relookup_proc_filtops_altq_lookup_pf_normalize_ip_ipip_output_msdosfs_inactive_procfs_inactive_vfs_mount_foreach_vnode_ieintr_bridge_brlconf_VOP_RMDIR_bucket_acct_thread_compat_43_sys_setregid_vop_generic_abortop_cd1400_read_reg_dma_setup_cd_load_toc_ufs_ihashins_in6_pcbnotify_union_copyfile_start_init_vn_default_error_ncr5380_init_bpp_ca_pmap_zero_page4_4c_scsi_get_xs_mapdev_sys_lseek_sys_select_scheduler_start_audio_ca_ah4_input_cb_sysctl_quad_au_get_gain_mmmmap_ext2fs_vptofh_filt_sowdetach_sys_close_vndstart_audio_init_ringbuffer_pf_free_fragment_ncr53c9x_init_bpp_cdstrlen.o_ipsp_kern_pool_cache_destroy_audio_cd_cgfourteenioctl_procfs_checkioperm_numdirtypages_uao_reference_powerhook_list_sys_semget_rmc_init_shutdownhook_list_svr4_sys_waitsys_ufsspec_write_nfs_xdrneg1_union_statfs_portal_symlink_uvm_km_kmemalloc_vop_access_desc_db_endlpstrncasecmp.o_cdattach_db_show_callout_pf_reassemble_scsi_donestrcpy.o_cn_rxc_out_fdc_namei_hme_caurem.o_pagedep_hashtbl_kernfs_xread_lbolt_VOP_BWRITE_audio_default_ieinit_cpu_attach_nextgennumber_umap_rename_db_boot_reboot_cmd_hme_cd_slinput_tbinput_sigexit_unsleep_sig_filtops_compat_43_sys_gethostname_nfs_getcacheblk_malloc_roundupmemcmp.o_dqrele_ufs_print_nfs_reconnect_lkmioctl_compat_43_sys_sigblock_svr4_to_bsd_speed_scsi_autoconf_swstrategy_inflateSync_union_whiteout_procfs_validfpregs_vlanattach_pmap_rmu4_4c_deallocate_dependencies_softdep_move_dependencies_softdep_deallocate_dependencies_in_revarpinput_revarpinput_led_ca_svr4_sys_alarm_lba2msf_uvmspace_share_crp_req_queue_tail_esp_input_cb_ah6_input_cb_VOP_MKNOD_db_help_cmd_arc4random_ss_patterns_sd_scsibus_ops_cd_scsibus_ops_myetheraddr_vmebus_sc_skpc_tcp_clean_sackreport_netlck_sema_sys_chmod_allproc_uvm_anon_add_skipjack_encrypt_db_list_watchpoints_db_set_watchpoints_led_cd_regs_nsphymatch_nd6_umaxtries_icmp6_ifstatmax_ext2fs_rmdir_mfs_start_m_split_sys_chdir_cd_ca_sunos_sys_ustat_swap_encrypt_ctl_cred0_selrecord_in_setpeeraddr_ttwakeup_time_myleintr_ufs_ihashget_tcp_rttdflt_setstatclockrate_db_eregs_cd_cd_sunos_sys_ptrace_svr4_sys_fcntl_fbrcons_init_qec_get_scsi_init_mainbus_model_deflate_global_ipsp_is_unspecified_removede_nchashtbl_vfs_sysctl_VOP_SETATTR_sys_fcntl_cd9660_rrip_offset_sd_crazymap_filesys_syncer_audio_init_record_mtty_attach_mustek_attach_bpf_freed_vfs_op_init_soabort_arc4random_state_uvm_tree_RB_REMOVE_COLOR_sccs_cgsixmmap_sppp_dotted_quad_looutput_kernfs_inactive_fifo_inactive_buf_undirty_ticket_rdrs_inactive_pf_normalize_init_pf_rdrs_inactive_be_ca_cypress_get_syncflt_ctx_allocslowtrap_dvma_mapout_getcacheinfo_sun4_pfdatatopacket_encioctl_bridge_rtage_if_detached_ioctl_union_close_filt_ttywrite_db_search_ssstrategy_ufs_check_export_hostzeroisbroadcast_msdosfs_check_export_kernfs_vfree_semu_tunattach_tcp6_ctlinput_be_cd_svr4_sys_semsys_st_read_cryptoopen_kernfs_init_sys_chown_au_set_lr_value_msginfo_loadfpstate_auth_hash_hmac_ripemd_160_96_sbappendcontrol_shmfork_sys_reboot_check_exec_audioclose_db_evars_pool_printit_eeprom_give_udpcksum_ip_directedbcast_zlib_version_db_tab_stop_width_ihash_lookup_hidirtypages_msginit_VOP_STRATEGY_db_tok_string_raster_op_sysctl_vnode_stackgap_random_db_watch_table_tick_makefstype_sys_opipe_audiocs_ca_raster_bitmask_amd7930attach_turbosparc_cache_enable_cypress_cache_enable_hypersparc_cache_enable_viking_cache_enable_ms1_cache_enable_ipseczeroes_icmpmaskrepl_import_lifetime_sysctl_dopool___udivdi3_be_tcvr_write_be_tcvr_read_led_cycle_ufs_create_dead_write_vntblinit_shifthz_arp_ifinit_audiocs_cd_ukattach_mustek_rewind_scanner_icmp6_init_softdep_fsync_mountdev_ipsp_process_done_unp_discard_spec_ioctl_altq_attach_emul_find_pmap_rmu_p_lesetutp_cd_scsibus_get_mode_prelist_remove_in6_ifdel_VOP_FSYNC_ttsetwater_rootdev__remreplace_ie_setupram_in6_matchlen_rpc_mismatch_bstp_acknowledge_topology_change_spec_inactive_solisten_filtops_config_scan_db_breakpoint_alloc_ticket_rules_inactive_pf_rules_inactive_mfs_print_bridge_rtflush_vfs_free_netcred_nextc_pmap_zero_page4m_p9100attach_nfs_asyncio_in_broadcast_vget___assertmemchr.o_pmap_pinit_si_dma_poll_tcxclose_in6ifa_ifpforlinklocal_ah_zeroize_ip_maxqueue_netio_uvm_km_free_poolpage1_sysctl_doproc_cuio_getptr_ah_input_cb_m_tag_unlink_sysctl_rdint_ifnet_mbppread_module_unknown_ip6q_comp_algo_deflate_soo_close_udv_attach_des3_encrypt_des_encrypt_hardclock_sys_clock_settime_sbppioctl_pmap_reference_ipsec_ipcomp_default_level_ipsec_esp_network_default_level_ipsec_esp_trans_default_level_ipsec_auth_default_level_bridge_start_lastseconds_isp_done_ip6_forwarding_tcp_sack_output_filt_fiforead_bigadj_isofncmp_crdup_bridge_rtdaddr_msghdrs_config_search_time_freq_ch_ca_svr4_stream_get_pmtu_expire_dqref_tcp_outflags_bremfree_svr4_sys_pread_xdcmatch_scsidebug_targets_rn_match_constty_sys_pread_zswrite_in_control_union_check_ch_cd_svr4_sys_rdebug_nfs_pathconf_pool_set_drain_hook_pidhash_kqueue_close_tcp_sack_option_tcp_maxidle_llinfo_arp_updatepri_stty_compute_baud_uvm_wait_z_alloc_union_allocvp_vmcmd_map_readvn_ovbcopy_auiop_st_interpret_sense_sd_interpret_sense_scsi_interpret_sense_ext2fs_flushfiles_ffs_flushfiles_nfs_statfs_inet6ctlerrmap_dopowerhooks_fdinit_compat_43_sys_lstat_numccd_bufpages_openpromioctl_icmp6errppslim_ext2fs_vnodeopv_descs_nfs_strategy_bridge_broadcast_vfs_opv_descs_fdfree_fbioctl_chioctl_amap_splitref_stat_inode_bitmap_bpfclose_kernfs_link_slclose_tbclose_diskstats_VOP_PATHCONF_audioselect_sys_unlink_vop_reclaim_desc_ipe4_input_in_ifaddr_VOP_MKDIR_sync_fsync_uao_detach_db_sstep_print_uvm_object_printit_svr4_sys_fchroot_ext2fs_direnter_pmap_enk4_4c_si_obio_dma_stop_defrouter_lookup_lodirtypages_sys_setitimer_read_dsfield__divreplace_pmap_rmk_p_iommu_enter_nfs_attrtimeo_vop_bwrite_desc_mntvnode_slock_fddump_auxio_regval_union_setattr_ipstat_oclock_ca_native_to_svr4_errno_ufs_quota_alloc_blocks2_ipsp_delete_acquire_uvm_vnp_uncache_randomselect_ncr53c9x_select_mem_access_fault4m_svr4_sys_ulimit_raster_op_nosrc_noclip_st_touch_tape_ipsec_exp_timeout_bstp_transmit_tcn_winChksum_userconf_history_msgbufp_audiogetinfo_sync_crash_defrouter_delreq_vnode_free_list_slock_oclock_cd_beattach_uvm_tree_RB_REMOVE_bpf_bufsize_portal_vfsops_umap_vfsops_disk_resetstat_pmap_copy_page_p_gre_allow_alldevs_leavepgrp_compat_43_sys_sethostname_vop_generic_bwrite_vndwrite_change_sign16_swap_bytes_le_vmes_scan_ext2fs_mountfs_gif_softc_sppp_ipcp_scr_exec_setup_stack_xyc_xyreset_nsphy_reset_mfs_initminiroot_ip_srcroute_bstp_ifupdstatus_sppp_output_fatentry_copyargs_sunos_sys_sigreturn_pagetables_end_amap_lookups_rpc_autherr_sys_sigreturn_crget_vn_marktext_bread_altq_assert_uvm_tree_RB_INSERT_COLOR_z_free_cryptodev_op_esp4_ctlinput_sppp_ipcp_tls_nch_pool_msgmaps_ccdclose_sunos_sys_setpgrp_cluster_newbuf_db_lp_rn_newpair_sppp_dequeue_sppp_ipcp_tlu_logioctl_sys_fhstatfs_disk_detach_cast5_encrypt_sem_route_cb_nbuf_svr4_sys_shmsys_phys_avail_subnetsarelocal_in6_ifstatmax_sir_nsphy_service_shm_find_segment_by_shmid_pr_rmpage_vop_write_desc_shminfo_cryptodev_cb_db_error_rt_timer_count_sppp_phase_name_sys_chflags_nullop_nbootpath_xdc_xdreset_pil_to_vme_nfs_sysctl_crypto_newsession_proc_targets_shminit_change_sign16_swap_bytes_besrandom.o_st_identify_drive_frag6_nfragpackets_ipport_firstauto_vmcmdset_extend_ncr53c9x_poll_svr4_sys_gettimeofday_sd_shutdown_ufs_pathconf_ip6_savecontrol_pppasyncrelinq_sppp_detach_bpf_catchpacket_pipe_ioctl_sys_gettimeofday_random_state_kcopy_esym_pmap_clear_reference4m_xdc_ioctlcmd_db_skip_to_eol_cpcb_cgtwoputcmap_ip6intr_uao_swhash_elt_pool_tcp_timer_keep_rt_timer_queue_change_procfs_lookup_ipc_n2o_userconf_histcur_userconf_histlen_tputchar_resettodr_pmap_kenter_pa4_4c_mii_phy_reset_in6_gif_output_free_allocindir_kbd_docmd_mfs_strategy_ufs_strategy_enc_xform_arc4_arp_rtrequest_procfs_freevp_clalloc_cd9660_bufatoff_mixer_close_X_db_search_symbol_db_search_symbol_db_le_db_aout_search_symbol_tctrl_ca_nbpg_pv_link4m_bestop_tcp_sack_adjust_ndqb_ipc_o2n_soo_select_tickfixinterval_pfkeyv2_get_proto_alg_in6_clearscope_tcprexmtthresh_fs_posix_sysctl_clfree_cd1400_enable_transmitter_xyclose_icmp6_redirect_input_tdb_hashstats_sppp_ipcp_tld_soclose_fifo_ioctl_ncr5380_wait_phase_timo_uvm_map_printit_altqioctl_tctrl_cd_pmap_bootstrap_kdvma_mapin_ufs_direnter_esp_attach_uvm_swap_init_uvm_swap_free_nfsm_mbuftouio_arp_maxtries_sppp_ipcp_tlf_null_lookup_kernfs_get_rrootdev_shm_last_free_userconf_hist_int_kmemstats__udivreplace_getcpuinfo_iommu_match_tcp_update_sack_list_arpt_prune_mclpool_allocator_pool_cache_init_sysctl_ntptime_db_lc___cmpdi2_fbopen_chopen_ext2fs_dirempty_sppp_ipcp_up_umap_unlock_kqueue_pool_audio_write_nfs_realign_count_db_qualify_lmin_dmamatch_scanjet_special_ffs_sbupdate_lf_split_compat_43_sys_mmap_X_db_sym_init_db_history_romprop_ipport_hifirstauto_if_mark_ignore_fd_ca_lesetaui_ip6_init_fdesc_pathconf_logwakeup_sttyattach_fbnode_kvm_setcache_blf_zerokey_swcr_compdec_cdread_rpc_auth_unix_uipc_usrreq_diskerr_VOP_IOCTL_fd_cd_max_protohdr_sparc_db_command_table_fdchwintr_softdep_setup_inomapdep_ip_dosourceroute_ngre_kernfs_statfs_soconnect_dofilewrite_userconf_histbuf_db_command_table_dma_ca_lmax_spifmatch_svr4_sys_signal_xystrategy_nd6_ns_input_ifpromisc_lasttime_uvm_dma_go_export_key_getquota_etherip_allow_ipe4_zeroize_vop_setextattr_desc_vop_getextattr_desc_compat_43_sys_lseek_db_inst_count_acc_delete_filter_clear_inodedeps_req_clear_inodedeps_SHA1Update_int_ipcomp_input_cb_bstp_topology_change_acknowledged_altq_etherclassify_kern_sysctl_kqueue_scan_dma_cd_main_svr4_to_bsd_sig_msclose_mld6_input_nfs_vptofh_ah_input_bioops_firstc_fdrelease_eopnotsupp_ie_ca_delay_phys_map_sddkdriver_sppp_ipcp_RCR_nfsspec_access_unp_externalize_lkm_nofunc_svr4_sendsig_mfs_rootbase_rijndael128_decrypt_route_output_cinit_arc4maybeinit_ie_cd_maxfiles_nfsnodehash_kernfs_root_sbappendaddr_msopen_berint_qestart_dvd_read_physical_cdsize_ppp_timeout_free_fbmmap_ie_map_ngif_in_ifinit_msdosfs_create_semu_alloc_lockstatus_db_readline_db_last_addr_st_decide_mode_if_detach_rtdelete_union_newlower_fdesc_ioctl_vnode_pool_extent_alloc_region_db_unread_char_db_symformat_aout_pf_nat_pl_pf_rule_pl_pv_flushcache_uvm_analloc_nfsrv_getcache_rawcbtable_pppasyncctlp_userconf_hist_cmd_kqueue_read_sys_setsid_svr4_sys_pgrpsys_dvd_read_bca_des_key_sched_arpt_keep_msdosfs_mountfs_VOP_LEASE_bereset_fdciop_ffs_statfs_inflateIncomp_isp_intr_tcp_timer_init_lortrequest_union_readlink_rusage_pool_pmap_rmk4m_beqint_fc_purge_pool_logsize_sysctl_lock_audio_select_db_loop_count_pmap_protect4m_ip6_defmcasthlim_allocdirect_merge_RMD160Update_int_ipcomp4_input_cb_deflateInit2_db_lbuf_start_timer_ca_imin_mii_phy_detach_dead_print_svr4_elf_probe_sunos_sys_fchroot_svr4_trap_nd6_dad_duplicated_uvm_pager_put_stat_indir_blk_ptrs_nfsm_adj_userconf_hist_eoc_exec_map_kbdclose_cgfourteenopen_uvm_aiobuf_pool_uvm_pagelookup_ipsp_spd_lookup_unp_internalize_sys_setuid_numvnd_timer_cd_tdb_alloc_ipforwarding_svr4_sys_utime_pmap_kenter_pa4m_ufs_dirempty_ipsec_policy_head_dehash_audioprobe_iptime_domainnamelen_ksymsread_imax_cnopen_fdopen_tdb_soft_timeout_rmc_delay_action_sunos_sys_mctl_inflateInit_sys_clock_getres_mark_ecn_svr4_sys_pathconf_svr4_jerq_ioctl_chmatch_cryptodesc_pool_uvm_km_free_wakeup_sys_issetugid_sys_pathconf_pf_send_reset_isp_init_xyc_ioctlcmd_qec_put_ireplace_ipsec_keep_invalid_sigprop_ktrops__uremreplace_cpu_match_ufs_lookup_nfsv3_type_tcp_mtudisc_increase_raw_init_prefetch_mttywrite_anon_swap_off_tcp_quench_nsl_bawrite_enxio_in_delayed_cksum_edatabzero.o_kcur_pf_udp_ports_pmap_copy_page4_4c_xycintr_kill_user_windows_softdep_count_dependencies_msqid_n2o_fixjobc_ntohl_ipcomp6_input_cb_tcp_rscale_inflateInit2_if_down_dead_ebadf_pgrphashtbl_ipq_mmrw_cgsixopen_ppp_dequeue_userconf_show_attr_vop_link_desc_VOP_ACCESS_svr4_sys_setegid_sys_shmctl_sys_setegid_chgproccnt_elf32_os_pt_note_db_clear_watchpoints_scsibus_ca_cnclose_fdclose_auth_hash_key_md5_bpf_setif_kernfs_read_rrootdev_shmexit_cngetc_xyc_entoact_config_activate_children_gif_ioctl_nfs_symlink_time_constant_kthread_run_deferred_queue_audioprint_scsibus_cd_mii_phy_tick_icmp6_mtudisc_callbacks_SHA1Transform_if_up_sunos_sys_mmap_sadb_exts_allowed_out_ffs_sysctl_shmget_existing_cd9660_select_end_st_crazymap_umapfs_mount_filt_kqueue_pf_compare_rules_bcmp_raster_text_pfkeyv2_send_in6_gif_input_msdosfs_pathconf_procfs_pathconf_pfs_vlock_ktrcsw_biodone_tcp_ack_on_push_deget_vfs_syncwait_db_plays_fpu_cleanup_ukmatch_mii_pollstat_intr_fasttrap_in6_addrscope_icmp6_ifstat_ext2fs_update_clear_remove_ip_randomid_sppp_isempty_fc_fileextends_db_expression_copyoutstr_auxregbisc_amap_pp_establish_softdep_flushfiles_inetctlerrmapnegdi2.o___lshldi3___ucmpdi2_p9100match_nd6_p2p_rtrequest_uvm_aio_aiodone_icmperrppslim_msdosfs_strategy___main_xyc_e2str_nd_prefix_e2fs_sb_bswap_bpfwrite_pool_allocator_free_ktremul_vop_setattr_desc_pf_cksum_fixup_icmp_sysctl_tcp_sysctl_au_get_lr_value_ifmedia_list_add_filt_generic_detach_altq_detach_version_fdalloc_sys_ntp_gettime_cmask_db_max_width_config_found_sm_cpumatch_sun4_tcp_newreno_wildcard_extent_destroy_endtsleep_rt_tables_ffs_tcxmmap_cpumatch_hypersparc_dirchk_nfs_hashlock_route_init_sohasoutofband_npty_cfroots_zsclose_pfxlist_onlink_check_uvm_map_deallocate_process_worklist_item_enoioctl_closef_sys_write_sunos_sys_open_swift_cache_enable_sun4_cache_enable_pmap_cache_enable_nfssvc_sockhead_sysctl_init_db_prom_cmd_fd_types_export_lifetime_pager_map_ext2fs_sbupdate_ntun_lf_getblock_sys_xfspioctl_spec_badop_redioctl_shmmaxpgs_ch_exchange_rt_setmetrics_dead_read_setrunnable_betint_mii_phy_auto_fdstart_turbosparc_hotfix_ufs_close_ipv4_input_gre_lf_clearlock_sys_socketpair_svr4_readdir64_callback_uao_detach_locked_add_to_worklist_vn_syncer_add_to_worklist_vfs_opv_init_getc_fdcopy_falloc_bematch_pfkeyv2_parsemessage_ffs_mountfs_routesw_fifo_bmap_emul_flags_translate_vmebus_translate_sbus_translate_icmp6_nodeinfo_filt_ufsvnode_drain_output_tickdelay_ether_output_umapfs_statfs_vfs_allocate_syncvnode_cluster_read_dk_establish_blf_key_rmc_update_class_util_nextraloc_nmbclust_ienab_bis_4_4c_svr4_sys_socket_hypersparc_memerr_pmap_deactivate_ext2fs_write_nfsv2_type_nfsrvlruhead_nfsrv_readlink_sys_socket_isp_prt_mfs_badop_pfkeyv2_expire_gettdbbyaddr___lshrdi3_rt_timer_remove_all_vfs_stdextattrctl_find_last_set_ccdwrite_cdevsw_ddb_regs_securelevel_mbpp_match_sunos_sys_wait4_sema_init_devout_device_unref_cd9660_readdir_ccdintr_ntohs_ffs_vptofh_nfsm_disct_fdesc_mount_schedcpu_change_sign16_swap_bytes_le_mts_fdc_ca_xboxmatch_fb_attach_qeattach_ip6_lasthdr_kqueue_ioctl_fifo_open_altqopen_si_vme_dma_stop_desireddquot_hzto_wtab_destroydivdi3.o_beinit_st_write_filemarks_udp6_usrreq_tcp_usrreq_sl_softc_kernfs_start_pool_allocator_kmem_coredump_fdc_cd_min_cpumatch_sun4c_ext2fs_symlink_icmpstat_dosdirempty_devcls_altq_input_tcpstat@h 8`@#`3#P" $@``T@1#3cP@"@H*/+,3"`  0  "#,"# *,"#!`,"#@>> OpenBSD BOOT %s bsddevice[%s]: boot: open: %s: %s Booting %s @ 0x%x 㿘@T@-!@ 3"@`L@ 3!313%3/+3)3-'3 5@a(@ $ aH@{"H@ M"H 2%aH@r @ L 2@b !h8@a@@gBad format %d+%d+[%d+%d]=0x%x boot: short read x@ ;%?@ ?# @!2?3܀a"0?@ ?# @!2?%܀a""?@ ?# @! 2?܀a "?@ ?# @ 2 ܀`@"0@"?@ ?# @!  a ܤ` ܐ@;܀?@@ ?# @! a "?@ a?# @!"  @ .@`@ 2.@"@@ k@@ 䀤 .@?`耣 C.@ .`".`.`@`@耢@F#2@ c|@ٔ  < c|.@ .` .` .`c|  ?`@Ĕ2'@"@m`? ? @3"@a"@,c 3 3! b1  Ā 0@K",? Ċ`Ī@` Ē`IJ@` @ dvma_mapin㿘? #@(1?@,#(1?dvma_mapout㿘 #@(1@#p1㿘@ " ْ㿘 @㿘1#` @- "`3 !h@/ # $#㿘1c耢 ? "c-@}`boot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s 㿐'-@j?73"Ȣ!' @@@ )32 @b0-!X12`#@ 23#!' @n@#'@  3 3!h 2 3!p㿘3p` 231"p#"`"`"`"` "`"`" @`  "ah? 3 h ?3p 㿘  ; < 㿘 - D@@H   @="&  ?  promprom0㿘,#`3@3`  $  32 `"H3""@JJ`  -2*@3"@@ (*`J@ @ *`  2`3"!HJ  *@J` )*@` 3`""@``*J@ -& @33 *:  c` d a !J@ s !J@  !$!#a @ #!J@  @Can't open device `%s' Can't open network device `%s' 㿘@ ,#`  @aܔP$` $`%33  `( $ 3aH€  !a\$` $`$@ H@Z!02H@ $`&` 2!22,c @ "P H@@!0",c @,cԐ @ - "` #-`  $$ 㿘#3``   ``*  ``   '@`2`0`,6 * '@ 㿘  ʒ& `& $& (   €͒ " '@ 㿘 ` @ 3  `( ( @0@ 㿘   2  @! $ ?2`$ *㿘3 ` `0`4 㿘3 ` `?`8 ? xmit: not a network device 㿘  ,`@|!?K@ S`?㿘 ,5`€>㿐3 `` (`P      O/O O /O㿘㿐3  `      O ? X/O O /O㿐3 /  0T@㿘  㿘3 `t€㿘@-@D㿐3`     X  p@%x mac-address drop swap 6 cmoveX,#` #32  ` 2   Њ@+`  "".@ .` .` .` .` .``` `€0 `@`|@ielefdxyxdstsddevice_typeblocknetworkbyte㿘3 ` !-`@@Xa@a ' b@  @b    H` HN@J@2J`N` " 2 node %x property %s length %d > %d 㿘3 ` € 0#@ 㿘2 @ޖ ??" ,Invalid controller number prom_iopen: "%s" error=%d 㿘)2! ?N  @ 3"aa$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $` @ΐ#+  " * @F $`0 "$`4 " @D$` @ 2!&  %! @# 㿘#2a  @ 4 "$a & 4$aprom_mapin: length=%dprom_mapin: invalid maptype %d㿘,#*`@ -!@|! --         !@e` `,#@ ,#8 <?*   آ&@  ` ,#@㿘?(2,13\& H L` T ` X P d l$ p  t @2 .@2.1㿐``@ 0@ `@`@[ @ * @S   @@ x ` *  d,  0 2 0 0@" x @s*  @`?``"? 6"?%` 0@㿘 `  .` 8@ ^&  @   @`&@``@@6``,`G D& h`?  ,` @@!  @!0$@r     d ,  0 2 0 2 %@` ,`@L@Ԑ,`& 㿐   e<`P @@ܔ 4`0*:  8  2`0 @8e<`0e<eD `L  Ȁ)n 2; @`0$  " @   `d  *  0 @$ $  $&@&    b 8   @   " & 㿐`@  <@`@-5 2& :@ "   2  @l  " *@B<@@` ڐ2 ``@Ӑ 㻀@@ Ц @ &`@9@$`   `  @2 %\F!T@  0@@eg0   @ t,   $@  '` L@  @5<`/2L@`L@ /"`L@"y   נ  / ``4k `L@  /`,@P谒 \,@+ W(  2LL@@ $H  E;@%( 8@"@ 0 K䰒 *@`  d*  0` @O / ' 'ܒ L@  @   0@ @@ Ё㿘 &     . @ "  @0  .  "  @z0 @w@t а 㿐 @j@&B<@@`@@ ``@0 2&     ":?"   ? @ : ` :?  2`"` "`:`0㿐`  8 `@@2.@``@.@+?) @ " " ""@@C <@  @ @ @ B <@   @(*`  bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d p k3"1a"'А $  $ $ ''X@ג 2W?-a0??"a04` $@!#`"#@ #\ @  !2 @Ő#<?#3"$bD@"$*`4bD' @2 6` @##?2'ܢ ܔ"""2b0@ ?3"2b@w  ?2@b ? ?  P2"2b0''@H 2C?@!@? 2:?-a02?"a06 $"&#`a#@b#\ @'   3 H"ah''@( 2?@J 2?#'@ ? ?㿘`&"@  &@  㿘`&@   ? & @ Ԕ.@&  @""#d d " e" f" g"#" ?  +d +e +f +gd"@# @ ` J@(8(8    `J/`? `2A ` `!J@(8(8  . ` J J#   J@;..2J`;2 , `J@; @Є 8 <` CD001㿐@ ( ( @V`  -``( (  !@ R     2` * @h * *` * +  *+`  h  @ (g 8@ @`-`  ` ΀ǰ    *` *   *  M `N JL *  2D     !*  *` * @*@  @  @ L  *  "M  !   L  *  2 M  : L  *    g2 @ ``  `-`( U(  gh 8  *   *` * ƒ  @ @@ ˀg@+ @    >>>&`>  * *`   * & +` * +   :>@ 0  @  @ 㿘  @ &  㷐 R@ N`@4 @H``@C@2 *@ `  @ ,  ( )􀢨$ 2@` ' 8'" w@ '@@ @ B <@&hhB <@2&     ":?"   ? @ : ` :?  $2`"`"`  :`0 㿘c  ,  ". /.".+."&  "!".. 0  ? 0 @͠L *L0} 0z 0pؒ  @ S@ 8 'pt@ ( ,  $ #`a#\b` @' ? 3 H "ah؀`3@   "!h?㽠P  x@   'P $` $` $`  $$` ($` ,$`@ $` 8 t@  $`   h #`ab`$#\ @ ? 3!h x 0  &,& &&& D& &(&$@ 㺈 ` ($a b ????#\#`  @ ? 3!h `  dh@ d .@  ?nfsread: short packet, %d < %ld 0  '  $  $  (  ,     $$L#`a $b (#\  @b ,? L `" H3"!h?@T@ B0  @ y3 H"ah?㿘@ -3 "ah!02"!06 & 2 ?  " $?!$ "  ?nfs_open: must mount first. 㷈2##` @ :" N  m `/2N N /" N a  0 ] @ x  <$N O  N  /  .ɔ A.0 0〢 2;@ @  $+  (@;@O`/  @ x@ x  @ x N  &`  @x x@s x㿘  "& @i x&  nfs_read: hit EOF unexpectantly㿘' #3!3%@ {   ݖ? ah2  !䀢 @ P  ; B& > @ 2&     D  "; ?  ?  @ ;   `; ?  -0( 4 2`:2` <"` @"`D :`0 callrpc: error = %d 㿐\@?<6   '?'?@?2x '?` '?`@"x"?'?Đ #`#` #`#`#\ #`a $  p@X? 3` @``2"@#3 H"ah?recvrpc: reject, astat=%d, errno=%d 㿘!3$!h@ 2#x@ 2?`2 ?`` $!h H@’ ??"@?23P3( 2  2 2 *?3!P #!P!P3("#!P" " " getport: %s㾐a"@3 o'?(' "p #\#` ""   6   p'0 #3!ah@f!Ȓ@Q H$ah?bad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentUnknown error: code %d㿘`W1!(*` €10"1-"1*"1'#1$#1!#01#@1#X1#p1#1#1#1 #1  12!` @8D8D8E8E8D8D8E8D8E8E8E8E8E8E8E8E8E8E8E8E8E8D8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8D8E8E8E8E8E8E8E8E8D8E8E8E8D\8Dh8Dt8D8D8Drarp: bad socket. %d No response for RARP request Ӑ @B"J?  .@  7Ɛ(   , 4 , 4 ` 44 `~4 `4 `4 ``4 `4 #\ D .@q @"? 32b b2  b @ 0- ? @ -??"aȰ $`㿘- P@ 5㿐@3!"!h  5@2?@ 2?`(2?`&2?` 2 ? `@  ??sendudp: bad write (%d != %d)x&$`$` $`$`$`$`<* @ *@@ &  ,`,` 4` $`  $`@4`  6 4 4 `'`'` '`'&$`,` '@4` 4 쀣?&$`$`$`  $` -!؀    2`'" 'ܐ@_ܖ@( @?!@Qreadudp: huge packet, udp len %ld x@ް zހ( (  t?@͒o?2m?<@ 2f? 2b?6` <`\@u 2X? &T?``  2L?` &@  "@4  ` 2=?` 5` %@"0? ,  $ $ ' '`'''4 @8  ?$$ $ $ $ $$ $ $ $ ` ??sendrecv: short write! (%d < %d)㿘\   )3 <+`%!h(?@ @a @,`4 2 !h   $$@Ӧ` l J` Є * (Ж  (8. 53 ".?" 8" ?#  0 `(?`d((  `d(h(*  ?#㿘@㿘2!,@  .  @ 0,@@ "@  0,@@  0,@,@6 ` "@(* 8("@ Є (@ 㿐 "= N -N`$* `.! גN*`? @ . Ȓ?N*`# @ .   J `   `&     ,` ` `   ( `߀` ܗ(2 ?# : :* 㿘 3` 3` 3`  .+`+`+`+`3`  +` ??㿘   @,   -aP@%  "` ?` ?72-8 :  0 *@ `  *@`*@`2*!耢" @ ` ?  2   㿘2b'H'L'P'T 'X @"b@H@ exit㿘 `㿘3"Р , @` @ , 㿘@@V㿘@~ 㿘 < " ? 2  @13 D&!h@[  $ !h `$ <?$ 8 D$ ?$  @`$㿘אԐ* А* ̐?. ?$`8㿘-!  , @     & &"   & L`?& & S`?   2?  ?B& 8     `* ??w?2? o  e  "  < Z   <  ?& 81.1.4㿘@\?.`,@ P2". `"  P @ՐȐ?@/ 8 `@v &`D&@a&`@0 @`@ P@Ő?㿘 3 "ah?3"Г. @ 2. " @ D@y@v P@㿘2".  8?? ?2$  ?$8$ L "88 @P  "@"$ $$$$ @' 43!h`$<" $& @$$$<S < D!3$!h@ $!h $<D$@ #$8 H@є" $H H ?$88 @=$$  @ $H8 2  < 2  2L H@" $H&㾘 3 3"Г- @2@9"-  `L @?2+$`)'$`" ` 3f c3b @F ` 42$`@   @ ?L @`D P @Ȑ?@ 8$@$`D$`@.` 4@ 1@ /@ f )`' a !ڒ: @3  Yd 4 `0 Y"ah??- ? * `:```? -a "a"    -?"  耢@ @   @ *0   @ *`(㿘3. "Ѐ @  @  3 $"ah2  " @      @ $3"!h`3 "!h?㿘3. "Д@ @  3 "  3  Y :@B: Y"ah? ?   ` 㿐3"а @  `  ` 3 D"ah$@$`$` ' 83@`` / "`J -`)$@&$`  @  2" € ` `  `" ` @3"!h$@?㿐3. "Ѐ @@  3 ,"ah" @% * 2`      3 "ah B< ' 3 "ah&?2( 㿘!2#'L'P'T'X$"@L"*㿘'H'L'P'T'X#@ H㿘#@8N@`N@`%` N@`|`"*` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @L N@ @C N@ @: N@ 0 x  @, N@ % w ls8d8eh8e8fl8fl8fl8fl8fl8fl8fl8d8fl8fl8e8f48fl8fl8ex8fl8f8fl8fl8fH0123456789abcdef㿈"@ǒ @,@  ?L?|/-\㿘-!` 2" cpJ@ #" arpwhohas: overflowed arp_list! arp: no response for %s-"X@ -!@  'h@@C`@ ` X  $X#ƒ  . 7Ɛ(  , 4 , 4  ~4   44  4  4  4 hax4 j4 h!$@#\ .? h!'l#l ` `4` X4`  $X4`㿘-P2(㿐H3-"!h(2*?@ 2&?`(2"?`&2?`  @??-"X-*@ *`@ `V  ??㿘@ /`(+`&'` # `:   `6`6`` ` 6``6``6`6` 6` 6`   .6`  `6` (6`@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&   ?: :  *2@ : J@   J@J`   J " @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &   `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  㿘 ?`2"`0"`"`   "` @ߔ 㿘 ? ` $ 2`0 " $@ $  (€ $ 㿘"M?N 12I?8 D?2 @? &  & & ( $ 2  & $   (  )& "  `"   "`  ( ?"  `   "( *@  "` ?㿘 unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check㿘 "@?  "<? 7` ?? ` .#*` € %  $ $  @  " `$  "b` 2    "b " `  $ $    $`*   &@ݒb`   &@&@  ސ? `$ $    * "` $" `˒  $ $    *` " $" `  $ $    *` " $"    $ $  @ ` " $ $ 0" "b $ " @?   " F"" s @u `  5"@ "@  a? `$ $    * "` $" `N  $ $   *` " $" `9  $ $   *` " $" `$   $ $   " $@  "b $  " " ??8{D8{8|`8|8}8}T8}8}8~T8~8~8H88ԝ㿘    "#? ? @s 0  ? & 06 * ?$@ @  "@ 㿘 A?`2@0;  "@"` 20?  -"`  @`#@  ?( "$$$ "` $$ "@?㿘 " ?   ?  @m㿘?6  ` W R !6& @`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ @β` @`@##񀦠,`     㿘" <&? 8`$`(€  2 ( @G (& 8& 0& & & 4   & <&`0㿘`  `( @ 2` *  `(% $ $`(`$€ 0`  `(  $ ($ ,$ 8$  `( `$€ $`(`$€invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeath 0 4@`  "? ,"` +$#*` €Ш?  *`` 4  `&  `-`0  `4 $@&إ4@ Ð@9耢 & & & @&``$  &`&@& 4?  &4!&!p&`4& & @&``$  &`&@& 4ڔ??  *`` ?#4* @! &!&`& & @&``$  &`&@& 4?`&  m p  `& & @&``$  &`&@& 42D  , ` 0 ( @ "?"`22 & 4@E 0 4 "@ ,? ," ` 0 ( @ "?"`2 & & @&``$  &`&@& 4Y 8I "@`%%@ &     &?  *``  ?, & 4   ! !&!&`& & @&``$  &`&@& 4? `  `( & & & @&``$  &`&@& 4? &4&   2  @  #?  *``   *@ *`"  & 2  4     #* *`"  &  &   $ @ ?2 & `(`$€  && & @&``$  &`&@& 4 &&  4   ! @  -!"ha @,  a?  *`@ ,   *`    $@ * "  & T4    @  E?  *`@ + 4$@  4 @ ! @$@ 4 2!  `$€`( &&`& & @&``$  &`&@& 4+?  ( ? + "@ &  4   ! @     $4  `#\#`&    !`''#d@Sܠ ?2& `$`(€ && & @&``$  &`&@& 4@؀ 2& & & @&``$  &`&@& 4Δ?`$`(€ && & @&``$  &`&@& 4@   @G 0 4@`  "? ,"   c&&& 4@X 4 0 0 4@& & @&``$  &`&@& 4 && & @&``$  &`&@& 4q & & @&``$  &`&@& 4c?& & @&``$  &`&@& 4U& & @&``$  &`&@& 4G& & @&``$  &`&@& 49& & @&``$  &`&@& 4+& & @&``$  &`&@& 4& & @&``$  &`&@& 4& & @&``$  &`&@& 4?@8h88\8<8,88888P㿘* `( `$€ (`(`$€ $`(`$€㿘 (Ք (@& 0& 4`?㿘 (    * * " " "invalid literal/length codeinvalid distance code㿘 0 4 @`  "? ,"@` '!@*` €)` '& & @&``%@&@&`& 4 ` ``@0` 0 4@ `  "@? ,": $@ ` `$` $`$@` -`  *   -bh+`@ ` * @  @$ 4  $`$@  @ $` $`$@_   $@%$@ &`& & @&``%  &`&@& 4?` -`b  *   -"h+`  ` ` `$`$ $` $`$@4 ` -`Q  *   -bh+`@ ` * @  @$  4 $` $` A$@ @ $` * 8$`%$@ 8&`& & @&``%  &`&@& 4O?` -`   *   -"h+`  `  $` $ $@4 `  (  ` ,"  *"$@27  ,  0 ( @ "?"2% & 4@C 0 4 "@ ,? ,"  0 ( @ "?""&  ( ,  (`? $`$@2D `  ,  0 ( @ "?"22 ` & 4@ 0 4 "@ ,? ,"  0 ( @ "?"2 ` & & @&``%  &`&@& 4 (i$@ & 4?`?@ 4 0 0 4@& & @&``%  &`&@& 4r $@& & @&``%  &`&@& 4b & & @&``%  &`&@& 4T?& & @&``%  &`&@& 4F& & @&``%  &`&@& 48& & @&``%  &`&@& 4*& & @&``%  &`&@& 4& @&``%  &`&@& 4& & @&``%  &`&@& 4?@888p8888h888x8㿘`(`$€invalid distance codeinvalid literal/length code㿘04@`  , -h. ((```(@( @ @'"h` &@6 . &@`` 6@(``` (' @@"h` &@V6` (@ &@(`@ `. &@'.6, * @(!?/ (?/ y?/ / ?/ i?/ / ?/ X @2 `. `(. @@@6` 3"` @ . `. @(@@ 2l```&@/6/ 6`` 8) &@" "@'@`'@"@"`"`"42 ` "`8) &@" "@'@`'@"@"`"`"4? &``6` 8) &@" "@'@`'@"@"`"`"4 㿘 4 0@`  ,"` " `"&`&` 8 <& <&`0 ,@@ ' 4  (& 4 4`"   " `"&`&` 8 <& <&`0@&` & 0 #+3;CScspp !1Aa  0@` 'H'X\H'L'P'T''''''''''''''''@(@`&@H X&#/ @  .@"@ * 􀠠  (`@"@8 # (.@@  ,`(`@?&@0 '48' - @ `  @ `.@(&@h H`@*@ @ h'H'0?'p  '(+ '$??Hh((+`', M+`$   % ` d#,@   @&@ .`@8, . ``dp&@&#//! $0@8 '.@&@&X& 4#/,@  /@L   `/@`'LT (P/@ P(@`'0@ (?  ?..`& &   (@" @6@2@ .@@? '  .@+`@?2[  H+ ` 2?oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths tree㿀   ( ' #?#d#`#\#h   | ??*" ' *@ 2 (*"' ? ( $€oversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengths㿀d !  ( `' R?((X#Ԛ#\#`#d#h! ?  ,??*#-$ +*'#))\#`#dP #\#h  ? 2 (??+  $ ?+ + @$ ? ( $€0 ( $€ --""-"@1"" w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-+" `Y G8+ @0(` @(` @0(` @0(` @0(` @0(` @0(` @0(0` + @0(`88! 8$8%$8%8%8&X8-828284L84T848:8=(8=p8>,8>48>8 88 88 8 8X8 8l8 8888888   8@` 0123456789abcdef/8P?? inflate 1.1.4 Copyright 1995-2002 Mark Adler `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`8, 8@8W!84- 8 58u:8(C8r@I8I R8,[8 f86u8kXz8 8 8l8)8 8$ 8(8h8q@8n 8088+08+8? 88QB8K 8ʰX8n_8hj8nXr8|}8d8N08n88ST8J8 8:8Ot8z 8c 8ʴ!8+8 88B8=(M8r@T8c\8RXg 8ʸt828 88A|8n89 88+l8&888j8T&8'/8<86J 8xS88@a8=pk 8|v8P|8X8>48 8ˀ8:$84L88l8>8gx8F8D8" 8*8 9 8H8 T8Pc8Tl80v88%$ 8̀8%8\8D08888X8Tx 8̈8d8&X88-8, @8DU8kX[8! e8u8x88x088?0888u88 8 88 8H'8_x/8>,:8XD8-Q8`Y8+l8^t8  8L8_8h8( 8848 8P8S888T 828 ,8 &84T38(=8D8R 8XZ8aHa8th8Lr8R}8 8x88@88|8Y$888A8%8P 8h 8p" 8(8O/858 <8ThB8LH8^N8MDX8[_ 8f8Xm8 88,8^(88 8 8P88P858n8 88b 8@ 8 8z< $8 0 8D @ 8H F8$ Q8 a84 q 8 w 8 ~8 8 8 8 8 8 8 8 8 8 8 8 8 8 +8 78  C8  R8  d8 p8 z8 8 8 8 8 8Ɉ 8 8 8H 8@ 8Ɍ 8 8 %8 78 D8Ȁ U8 _8 n8 8 8' 8' 8,` 85 86 8? 8B 8F 8I 8Q 8RX 8S 8S 8T 8Tx 8T 8^( 8^ !8_x *8_ 28` :8aH A8b H8c Q8g W8kX ^8n h8nX q8n z8n 8n 8q@ 8r@ 8t 8u 8x0 8( 8 8 8 8 8X 8 _getsecs_rpc_fromaddr_open_dvma_mapin_gateip.rem_adler32.urem_sendudp_getprop_netif_put_nfs_getrootfh.div_devopen_socktodesc_obp_close_bp_getfile_inflate_codes_new_bp_server_addr_strtab_inflate_codes_free.umul.udiv_hostname_getchar_xdr_string_encode_inflate_trees_bits_nfs_readdir_in_cksum_pgofset_hostnamelen__udiv_arpwhohas_strcmp_net_close_inflate_trees_dynamic_inet_addr_strlen_inflate_set_dictionary_ether_sprintf_readudp_inflateSetDictionary_nfs_open_inet_ntoa_inflate_sprintf_netif_debug_freelist_netif_close_net_open_nfs_close__urem_printf_sendether_file_system_cd9660_close_inflate_trees_fixed_swapip_rpc_pmap_putcache___ashrdi3_nfs_readdata_domainname_xdr_string_decode_ufs_readdir_putchar_inflate_copyright_arp_reply_zcfree_strncpy_netdev_sock_nfs_lookupfh_rpc_xid_nfs_readlink_nfs_read_strtablen_ip_convertaddr_obp_strategy_nfs_seekstart_nfs_root_node_nfs_mount_cd9660_write_inflateSyncPoint_prom0_iclose_nfs_stat_twiddle_rarp_getipaddress_hz_getdevtype_rootip_net_mountroot_rpc_pmap_list_prom_ioctl_inflate_codes_zcalloc_rpc_port_obp_xmit_ufs_read_promvec_ufs_seek_obp_recv_strerror_prom0_close_file_system_nfs_inflate_flush_arp_num_closeall_bootfile_vprintf_ufs_stat_prom0_strategy_prom_getether_xdr_inaddr_decode_inflate_blocks_free__div_ufs_open_nfs_stat_types_inflateEnd_netmask_inflateReset__rtt_rpc_call_inflate_blocks_sync_point_file_system_ufs__rem_dvma_init_dvma_free_prom_boothow_prom_si_getpropstring_prom_bootdevice_memset_nfs_write_rootpath_cd9660_open_olseek_xdr_inaddr_encode_memcpy_get_crc_table_nameip_oclose_inflate_mask_bp_whoami_cputyp_cd9660_stat_pgshift_rpc_pmap_num_memcmp_prom0_iopen_inflate_fast_panic_cd9660_read_netif_open_prom_open_cd9660_seek_peekchar_etext_donottwiddle_ifname_oopen_bzero_getticks_readether_prom_init_inflateInit2__inflateSync_ndevs_loadfile_dvma_mapout_read_inflate_blocks_reset_arp_list_rpc_pmap_getcache_ufs_write_prom0_recv_errno_sockets_esym_intoa_nbpg_nfsys_exit_main_free_sendrecv_lseek_debug_close_inflate_blocks_new_domainnamelen_crc32_alloc_edata_cngetc_fbuf_end_dvma_alloc_bcea_gets___main_netif_get_version_oread_prom_bootfile_file_system_cd9660_inflateInit__prom0_xmit_bp_server_port_dbuf_ufs_close_inflate_blocks_cd9660_readdir_myip_files_devswsrt0.oboot.ogcc2_compiled.___gnu_compiled_cconf.ogcc2_compiled.___gnu_compiled_cdvma.ogcc2_compiled.___gnu_compiled_cnet.ogc