,PP@((ھ0\4 `@# ` "" $@` `T@   b@w"@H*/+  "bH  0  "  "  * " !` " @ %s: can't open device㿐@K#@  b("b( @ "   @`@)  @   "H@@%s: alloc failed%s: block table corrupt%s: read failure%s: short read㿐 `@    !@`  @ D ? c' / - + ,`2 @      @@ @`a@@?@2 @a aa @` @Ȳ@  ? Ċ`Ī@` Ē`IJ@` @ dvma_mapin㿘? #@(1? @@#1?dvma_mapout㿘 #@(1 @. 1㿘@ " ْ㿘 @  promprom0㿘  ` @ "H `  "  ` ""J  *@J` )*@Can't open device `%s' 㿘@   ` @ "H `  €b  $€b 2$   " @!X0   $   $`$` 㿘# bH`   ``*  `bH   '@`2`0`,6 * '@ 㿘  2& `& $& (   €5 " '@ 㿘 "H  @@ 0(@  㿘  @ $ ? `$ *㿐 "H/  0T@㿘  㿘 "H`t€Invalid controller number prom_iopen: "%s" error=%d 㿘) " ?N  @  "bPbP$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $`  @ `+  " * @F $`0 "$`4 " @$` @ 2" &  %"   @  㿘# b  @ 4 "$b  & 4$b prom_mapin: length=%dprom_mapin: invalid maptype %d㿘  *`@   "H@ Ę    L         "`@{` `  @   8 <?*  Ș آ&@  `   Ȱ@㿘?( ,1 \&"H H L` T ` X P d l$ p  t @  .@ ДЖ ? * `:```?  `Ԕ "`"     А?"  㿘 b'H'L'P'T 'X "b@0H @  exit㿘 !@ ( 㿘!  !X'L'P'T'X$"@L"*㿘 'H'L'P'T'X @ H㿘  @8N@`N@`%` N@`|`  `*` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @L N@ @C N@ @: N@ 0 x  @, N@ % w ls4l404x444444444444444d44444444444@444444440123456789abcdef㿈  @ @,@"  ?L?|/-\㿘  ؀`  "  a8J@ #" @ @   @ *0   @ *`( `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" bootxx &&''' '0'@&4444444H44\4   4444#4p,4\74=4F4M4 pV 4 c4m4t4 |4 4H44 4(4@4 4H @ : <   @@: LI@@PK/mnt<@`bT @ :    @@: LI@@P^<@`bT U: (kGGA : : :1-: :1-Hv/A: >: : eA, A: : .5: .5B@s0: !: Ĵ: 8CPX`hpx S: : !`: !` h,5: v: : -LI; : ܓ: u*: -LO0D!: ;3: ;3: bZjoOa: : : (sa: W: W: ( 0a: G: G: (!: 4΀: 4΀: (6k!: U: U: (6AsnJ!: $s: $s: (6Չa: 3%: 3%:   a: 6: 6:  %7a: :i: :i:  !: bZ: bZ:  6!: : :  6Bb!:  h:  h:  6˙a: ׄ: ׄ: + ғ*a: t: t: +!'ua: e: e: +"'\S!: !: !: +6 2]!: $s: $s: +6!ٓ^!: 'c: 'c: +6")a: 6=: 6=:  X0Y'a: 98p: 98p:  X1va: : :  X26!: : :  X60g㴛!: : :  X61ln!: р: р:  X62gH!a: >: >: ) @_a: G: G: ) A7a: 8: 8: ) BK!: (: (: ) 6@@!: ": ": ) 6A0 !: % : % : ) 6BVa: 3%: 3%:  !P$Ⰹa: 6=: 6=:  !Q1a: 98p: 98p:  !R0I!: : :  !6PuF!: : :  !6Qͣ#!: w: w:  !6RE6|Ma: ܓ: ܓ: &6`ʧa: >: >: &6aa: 9: 9: &6bu!: 4΀: 4΀: &66`e6!:  /:  /: &66aa: 7n: 7n: rؽT!: :i: :i: 6pm!: 1-: 1-: 6q8(!: ,: ,: 6r} ?!: z9: z9: u*xD!: t: t: exV7! : (: (: +yW{: .}: .}: .}ss00x! : 3%: 3%: 6y?: 9: 9: 9ss1{!:  h:  h:  X|+N!: p: p: pc!: t: t: tAA!: !`: !`: !`r}v!: #F: #F: #Fc#!: *Q: *Q: *Q!: ,: ,: , !: 3B: 3B: 3B c!: 5: 5: 5׷m!: : : !: : : G !: р: р: р;!:  :  :  !: : : &C!: ܓ: ܓ: ܓ?_!: t: t: t!: e: e: e͕w!: )': )': )'(.!: ,: ,: ,.:Y!: 3B: 3B: 3B 0\@!: 5: 5: 5 KWk!: : :  c!: : :  ]&!: р: р: р 1p!:  :  :   (!: : :  ?S%!: ܓ: ܓ: ܓ w!: k : k : k  Ъ!: e: e: e hn7!: $s: $s: $s.N!: 'V: 'V: 'V,C(!: -L: -L: -LI!O!: 0G: 0G: 0G/fa: 98p: 98p: '!: :i: :i: 'n_a: À: À: '!: : : 'n߽Ra: : : '۲!: ': ': 'na:  h:  h: '~_{!:  S+:  S+: 'nT!a:  :  : '!: I: I: 'n0]8a: : : '0!: : : 'n+a:  :  : '{!: >: >: 'nP/a: 9: 9: 'w.!: k : k : 'nĘa: e: e: '_!: (: (: 'n1ca: !: !: ' s!: #F: #F: 'n Va: &6: &6: ' va,!: 'c: 'c: 'n ga: *T: *T: ' _!: ,: ,: 'n Xa: .}: .}: ' k4!: 0G: 0G: 'n Ka: 2: 2: ' Y 9!: 4s: 4s: 'n I.a: 6: 6: '!}l!: 8ـ: 8ـ: 'n6C$a: ;3: ;3: 'O!: À: À: 'nka:  X:  X:  !: N: N:  na: v: v:  (A>!: z9: z9:  n2Na: ܓ: ܓ:   F!:  :  :  nHQa: : :  m" n!: 9: 9:  n9;a: 4΀: 4΀:  4a: : : 'Viv!: Ĵ: Ĵ: 'VnFua: ': ': 'V}S!: X;: X;: 'Vna:  S+:  S+: 'V%!:  X:  X: 'Vna: I: I: 'VT!: v: v: 'Vn00a: f: f: 'V!!: ܓ: ܓ: 'Vn 9a: ׄ: ׄ: 'VSZ!: : : 'Vnq+ra: : : 'V1,!: 4΀: 4΀: 'Vn a: (: (: 'V8M&!: !: !: 'Vnl=M^a: ,: ,: 5Eq!: .}: .}: 6=n a: 05: 05: 5p!: 2: 2: 6=nia: 5 R: 5 R: 5*!: 6: 6: 6=n'/-a: 98p: 98p: 5F4!: :i: :i: 6=nhڔa: À: À: 5KlB!: : : 6=n߭a: : : 5vx|!: ': ': 6=nTfa:  !:  !: 5כ!:  S+:  S+: 6=n׼Da: N: N: 5!!: I: I: 6=na: : : 5 !: f: f: 6=n2a:  :  : 5x!: ׄ: ׄ: 6=n]Ta: 9: 9: 6=VT!: : : 6=nE2a: e: e: 6=q!:  /:  /: 6=nb@ٝa: ": ": 6=~!: #F: #F: 6=nÃa: &6: &6: 6=7B}!: 'c: 'c: 6=n=mua: *T: *T: 6=f!: ,: ,: 6=n}qa: /q: /q: 6=Bt/!: 0G: 0G: 6=nRa: bZ: bZ:   pJdJ!: : :  n -a: w: w:  ! c!: : :  n!a:  :  :  "!:  :  :  n"ca: 沀: 沀:  #2!: ߀: ߀:  n#CJa: z9: z9:  $XoƐ!: C: C:  n$T^a: W: W:  %F!: p: p:  n%ZjQa: t: t:  &( !: 8: 8:  n&dQa: : :  '!:  U:  U:  n'3a: #*: #*:  (]b!: % : % :  n(pa: (: (:  ) ffL!: )': )':  n)Ga: ,: ,:  * x!: -D: -D:  n*%_b|a: 0G: 0G:  +!: 2b: 2b:  n+Ea: 4s: 4s:  ,) (!: 6=: 6=:  n,a: 8ـ: 8ـ:  -M!: :i: :i:  n-ja: 1-: 1-:  .^y !: : :  n.X:a: ]J: ]J:  /#ZBK   . .. binmdecsbinshare . ..termcap . .. bin dev etckern mntmnt2sbin tmp usr varinstbin install.subinstallupgrade bsd.profile? 4 install.md4bootۀ echo _i=0 resp="X" while [ $_npartitions -gt 0 -a X${resp} != X"done" ]; do _pp=${_partitions[${_i}]} _ps=$(( ${_psizes[${_i}]} / 2 )) _mp=${_mount_points[${_i}]} # Get the mount point from the user while : ; do echo -n "Mount point for ${DISK}${_pp} (size=${_ps}k) [$_mp, RET, none, or done]? " getresp "$_mp" case "X${resp}" in X/*) _mount_points[${_i}]=$resp break ;; Xdone|X) break ;; Xnone) _mount_points[${_i}]= break;; *) echo "mount point must be an absolute path!";; esac done _i=$(( ${_i} + 1 )) if [ $_i -ge $_npartitions ]; then _i=0 fi done # Now write it out _i=0 while test $_i -lt $_npartitions; do if [ -n "${_mount_points[${_i}]}" ]; then echo "${DISK}${_partitions[${_i}]} ${_mount_points[${_i}]}" >> ${FILESYSTEMS} _mount_points[${_i}]= fi _i=$(( ${_i} + 1 )) done rm -f /tmp/fstab.${DISK} done echo echo "You have configured the following devices and mount points:" echo cat ${FILESYSTEMS} echo echo "============================================================" echo "The next step will overwrite any existing data on:" ( echo -n " " while read _device_name _junk; do echo -n "${_device_name} " done echo ) < ${FILESYSTEMS} echo echo -n "Are you really sure that you're ready to proceed? [n] " getresp "n" case "$resp" in y*|Y*) ;; *) echo "ok, try again later..." exit ;; esac # Loop though the file, place filesystems on each device. echo "Creating filesystems..." ( while read _device_name _junk; do newfs -q /dev/r${_device_name} done ) < ${FILESYSTEMS} else # Get the root device ROOTDISK=`df /mnt | sed -e '/^\//!d' -e 's/\/dev\/\([^ ]*\)[a-p] .*/\1/'` while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done fi # Get network configuration information, and store it for placement in the # root filesystem later. cat << \__network_config_1 You will now be given the opportunity to configure the network. This will be useful if you need to transfer the installation sets via FTP, HTTP, or NFS. Even if you choose not to transfer installation sets that way, this information will be preserved and copied into the new root filesystem. __network_config_1 echo -n "Configure the network? [y] " getresp "y" case "$resp" in y*|Y*) donetconfig ;; *) ;; esac if [ "`df /`" = "`df /mnt`" ]; then # Now that the network has been configured, it is safe to configure the # fstab. ( while read _dev _mp; do if [ "$_mp" = "/" ]; then echo /dev/$_dev $_mp ffs rw 1 1 else echo /dev/$_dev $_mp ffs rw 1 2 fi done ) < ${FILESYSTEMS} > /tmp/fstab # XXX We no longer do the following. It is not neccessary. It can be done # XXX after the install is complete. # # echo "The fstab is configured as follows:" # echo # cat /tmp/fstab # cat << \__fstab_config_1 # #You may wish to edit the fstab. You may also wish to take this opportunity to #place NFS mounts in the fstab (this would be especially useful if you plan to #keep '/usr' on an NFS server. #__fstab_config_1 # echo -n "Edit the fstab with ${EDITOR}? [n] " # getresp "n" # case "$resp" in # y*|Y*) # ${EDITOR} /tmp/fstab # ;; # # *) # ;; # esac # # echo munge_fstab /tmp/fstab /tmp/fstab.shadow mount_fs /tmp/fstab.shadow "-o async" fi mount | while read line; do set -- $line if [ "$2" = "/" -a "$3" = "nfs" ]; then echo "You appear to be running diskless." echo -n "Are the install sets on one of your currently mounted filesystems? [n] " getresp "n" case "$resp" in y*|Y*) get_localdir ;; *) ;; esac fi done resp= # force one iteration echo echo 'Please enter the initial password that the root account will have.' while [ "X${resp}" = X"" ]; do echo -n "Password (will not echo): " stty -echo getresp -n "${_password}" stty echo echo _password=$resp echo -n "Password (again): " stty -echo getresp -n "" stty echo echo if [ "${_password}" != "${resp}" ]; then echo "Passwords do not match, try again." resp= fi done md_questions install_sets $THESETS # Copy in configuration information and make devices in target root. echo cd /tmp echo -n "Copying " for file in fstab hostname.* hosts myname mygate resolv.conf; do if [ -f $file ]; then echo -n "$file, " cp $file /mnt/etc/$file rm -f $file fi done echo " ...done." if [ -f /etc/dhclient.conf ]; then echo -n "Modifying dhclient.conf..." cat /etc/dhclient.conf >> /mnt/etc/dhclient.conf fi # If no zoneinfo on the installfs, give them a second chance if [ ! -e /usr/share/zoneinfo ]; then get_timezone fi if [ ! -e /mnt/usr/share/zoneinfo ]; then echo "Cannot install timezone link." else echo "Installing timezone link." rm -f /mnt/etc/localtime ln -s /usr/share/zoneinfo/$TZ /mnt/etc/localtime fi if [ ! -x /mnt/dev/MAKEDEV ]; then echo "No /dev/MAKEDEV installed, something is wrong here..." exit fi echo -n "Making all device nodes (by running /dev/MAKEDEV all) ..." cd /mnt/dev sh MAKEDEV all echo "... done." cd / remount_fs /tmp/fstab.shadow md_installboot ${ROOTDISK} _encr=`echo ${_password} | /mnt/usr/bin/encrypt -b 7` echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2> /dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd dd if=/mnt/dev/urandom of=/mnt/var/db/host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 /mnt/var/db/host.random >/dev/null 2>&1 populateusrlocal test -x /mnt/install.site && /mnt/usr/sbin/chroot /mnt /install.site unmount_fs /tmp/fstab.shadow # Pat on the back. md_congrats # ALL DONE! exit 0 stallboot ${ROOTDISK} ) populateusrlocal test -x /mnt/upgrade.site && /mnt/usr/sbin/chroot /mnt /upgrade.site unmount_fs /tmp/fstab.shadow # Pat on the back. md_congrats # ALL DONE! exit 0  ɬ  @D, @' "$ሜ+#@  /@Z / "%8 %8 @<@`@g`Ƃd??/usr/libexec/ld.soNo ld.so Failure reading ld.so Bad magic: ld.so Cannot map ld.so crt0: update /usr/libexec/ld.so ld.so failed h! Р!$   Ŗ ?$   `"!      ؐ        ?@ ?# @! ?a ?@ ?# @ `     | ??"  #\@ #`?# @!  3 @@! -? ?c@  ̀@ ! @ ̀@? ?c@ ! @   @! @     #d#h  Ŕ  ( ? $ ( !    ?#\#`ؔ@ ?# @!   a ?@  ?#  ?FB?? ?# ! 2 ?1@! ,? ?c@  ̀@2 ?@ ̐ ? ?c@ ! @" @! @2 #?:  ?# !  ?/ @! )? ?c@  ̀@ ? @ ̐ ? ?c@ ! @   @! @   #d#h   Ř u ?  ( o  l 䀣 !  #\܆    #d#h`#`  R ?2  " ( L  I  "a8 $ $ $ $  ` ?2 @  !1 `  ?2   h %  "  "!`@9"㿘!€ 㿘!쀢``@?㿘!€ 㿘! ?Service unavailable㿐!쀢     ?1 !P  @ *`:` J " %s: %s not compiled in instbin㿘@.I@ J 2@@F@@G /  @ @`"@W 2   €   a@=j!@!㿘 ?@?Œ`Usage: %s ..., where is one of: %s㿘  c@=@!`@ `@) + @d@  O4@=-#P@@=(cX`@ @= #P@d/ hostnamedmesgexprmvsleep-shshkshsedmkdirmtshutdownstringsrmtipmount_kernfsgetoptmount_mfsnewfsinitsortfsckfsck_ffschrootchflagschownchgrpchmodgzcatgunzipgzipcutcpedhaltrebootffsmount_ffsdhclientftprouteinstallbootslattachmknodrshumountbasenamefgrepegrepgrepnfsmount_nfsmorelessresettsetsumcksumsysctllsifconfigcatpingcpiotarpaxdisklabellnsttyvibuildsyncmountnetstatdfcd9660mount_cd9660dd㿘@!0505,/7/5H/5t@@/5/5/5/5 /6@@/6$skipseekofobsifibsfilescountconvcbsbsout of memoryunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %useek offsets cannot be larger than %qd㿈 "b"`#"  #쀢 $a%C+) 5 7 / - 3 @ $@א @[ = 2,a @ΐ  L aa8@Ő  ' @6Ϙ x @  "`X@  €$x  $x`@"@ $xx` @ @ x` `@ "` `@~ c!< !"@!   !<$x%c `@b "` " `@Y  %c"  c` % a@H  ? @+ג  2` $ 8 `  @+ƒ`   `$   aX @?㿘@@㿘@"b "㿘@"b㿘@쀢 "bH@ 㿘@"b(㿘#x`@"b  (㿘#x`@"c 㿘@:㿘@:07 &77 '7 (7777p #7` $7X %7P7H7@7870unblockucasesyncswabosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combination㿈 ,'D) % !' # 1D@#'@  @5V @> x`"`c@5 ` `"x&#|D ߐD㿘@@%s%s: illegal numeric value%s: %s㿐@ ?2!`@: 2J!`@ `k`m`b". `w . . . 8 'J`x 4쀢``*2 @V"!!!@ʐ "@ !`@ 㿐 @    !`@ڐ 2K!`@  k m b .J w(J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& 2 @" 'J`x 4#쀢`%`*2  @, @!!!@H "@@ !`@; 㿘#|쀣 b  "@    *b``$   $ @   $`$` 㿘!?`$)"  "     """ "  "@`"@ ""?"`"`%"# "@ "P '`@8#|    +@ `  0 +@`    "`*`"` " "`?"` |   @_O" *#` " "` %` "  "`? "`  "` ? %"`#`` ` $` $`@: ` `"" @ " 㿘"` %!P#` "@ "@_ٔ c| `` `   ! "@^" " "㿘#|+쀢b ??   @? ?,@ b@ <b#   @?*" ?   " " " @_@$$ $*@` $@  @ " % b   b@_c"@ b  $ %s: short input record㿘b  2  @'"xb  %   b ? *b "?b $  `@_.``@$`$` `"* "㿘@'@53`@\ `@\ @2#<b(@Wb(??&b(@@^4 stdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffer㿘"   #$  $ @,3 $  `@] @"(`   `@ #   8 $ $ ')cx# "& @,! $ #x" & @+! $ `$ ` ` @`@#x @2`` @Z ? $`@@ $! "@*"@Y@  $`"@Y@ $`P@ `$"`$ ` " @  $@#x@#x  #x   @)ǔ     @~ #x"@L쀊`!&b x| *  +@ ( 5x x| *  +@ ( $x x  *  +  x x  *  +  x |p@ @T_` h `@e <     a@[     @\Y ?   "!`  & 㿘 )b#"P/1"H"P` #x -쀊` @\` @\`  @[f  h$ 6. x$2   @   @\@I  x      @\ @x @Hx``$` "P@  $`%"P  x $ "P@  $ %"P $  $  $ ` %`x` `@w&`$`@@ `"`` %``@*5`` 〒@€$`x㿘c @^!<@  䀢@#x !#`#@  " @\  #@\ #`"`# `@ %s: end of device%s: short write on character device%s: short write on tape device㿘# #``#35/+-  ?# #`   2 `` "@v`#` "$` @@ZU bP "@ !` @ bP  > B; Ǥ@2   # #  " &   #   #@\X"@ #  & %u+%u records in %u+%u records out %u odd length swab %s blockblocks%u truncated %s %qd bytes transferred in %ld secs (%qd bytes/sec) @Ɛ bP` " ' '``` P#\ d@ @[ @YԒ`""" d@ l@[ @YP """ d@ V@Z @YP !<`#@$ʒ#\#` d@ =@Z֐@Y 㿘! "!$!㿘@Z %sskip reached end of input㿘b 2   @'1     @Z7 ?CAa@&  9 +-@Yi  "  &!D?D? b( ?"b(@ː #xd @La9 a@ 㿐#      @&֔      @Yܖ ?vt a@ː   $  '7a@Y' c a@    X $ Tc c@X  4A6  a@   7 'a@X? a@  D 4c, $ (cc @X    a@v  D 4c $ c0  D4c $c㿘@`VUUUUUUUUUUU Uupdateunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaegjo:Rcd9660%s: Filesystem not supported by kernel%s on %s @#: '+) "'%/5 0* c@€    !@ @w@-??ሓ* & @ @h@?` '' ' '''@В  "!`-b @~p bH@ @YB VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVusage: mount_cd9660 [-egjR] [-o options] special node 㿘`@1!@X ,-o %s: option not supported㿘@-  @D 1' n L  o  @  = 2*`"@0 2   @2    &*@&`@}  @ؠ 2L@U0㿘@9hiklnPt:only one -t option may be specified.-i is incompatible with -Pretrieving information on mounted file systems%s%s is not a local file system%s mounted as a %s file system0@"5%!';/-+ ")+9 $&* h@€ $ $# $ܐ $#$ؐ 'cА %Ԑ "cP b@@}f @a@L@+Ɣ"0?Ґ?!ܑ*@` & cȀ @Ȑh@4@r  2@b@r  !@ Y@0@ `R' @@&%  @@ @@"=`< @ @2 @@@@ 2-`%a@͒@ !cЀ  @@@w`@z D 2 ab@@iD` @@n"`@  @`  @W 4?a` $ Ȁ @˔0@d@W [[[[[[[[[[[[[[[[[[[[[[[[[X[h[[t[[[[[[[[[㿐@qg  @6  @+ ` T@! 㿘 P  c`?  #@     2c@ empty type list㿘 N  nc@|L  N  o "c "# %  @  , ` @Sd*  $P @` $@ , `$@  @  , 2*@, $@㿘#Д` P` #Ԁ` @pג ., ' D#Ѐ @"!s #Ԁ`@U! T@a!!&X' 4 ` hB) p xB  B  B  ࠁ B : 0B %5.0f%cBKMGTPE %5.1f%c㿐?? B@ސ#0  # J  #@ђ 0# J  #(@ɒ 㿐 '  B B? ' B?  D?%-*.*s %*u %8u %8d %5.0f%% %7u %7u %5.0f%% %s 㿐  @ `#   " F `  h@6 @L@K  @L@KT ` @ @Lt@Kɐ @Ll@K@` @ @L`@L]  @LX@K, @8 x' `ȍB'`ЅD?@  @ c܀ (   `"@ ' ȍB'``ȉBЉ B?@  @ @  @ T Size%-*.*s %s Used Avail CapacityFilesystem1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted on 㿐#؀`#H@U'#Px@#` #$'@T'@ry#x@#܀`"@#@#؀` !1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5d%% %s 㿈#` $!"@T!x@H`l T  " ,` d* @KK* @;[@@Tu!P` @6 @K7@J  @K-@J ` @6 @K!@K #\@K@I#\  @  @K @K  #` @K@I#`#h#d@a!ᨁ㿘@"s @"?@\ @  @  ?  df: %qd: %s 㿘 @S@R” "!!`   @2@,  usage: df [-hiklnP] [-t type] [file | file_system ...] 㿘`@,ؐ!@S ffs㿘#А  F\!T@"&<?4&0&(& 8@IA̘ d &<(#  ; @ <  @v d$"@&@I,,?&Ȑ&& ;&$ !(T@Tk Z@Tg Za0D@a .S lfs㿘#cА f c!b@"&F?  d& &   "@ 2 &    $"@ 2 & T @H" @Ib d& $ 8 &  " : && (& d@H $&& &$ߐ "pT@T Z@T  ZbxD@ .S ext2fs㿘-А $ $  ;`8#S@I?`L (&C?`$*&`4 * &@I`(``` $@I4 ?@H`@Hz$& ` &`"@ &&`& &&$ #T@S Z@S ZcD@ .S 㿘@*ɔ$OpenBSD: if.c,v 1.21 2000/10/23 19:17:08 mickey Exp $ifnet: symbol not defined %-7.7s %-5.5s %-11.11s %-17.17s %8.8s %5.5s %8.8s %5.5sNameMtuNetworkAddressIpktsIerrsOpktsOerrs %5sColl %sTimeDrop%-7.7s %-5ld %-11.11s none%-15.15s %-17.17s %-*.*s %25s %-17.17s %25s %-*.*s %xHipx:%-8s%-17s atlk:%-12s%-12s ns:%-8s (%d)%x%c%8lu %5lu %8lu %5lu %5lu %3dx`@ِ!0& "@0 @,Ô  08@b#\#`#d" b(@!bP@"H#`  "X@b`:`p  "X@bh ``?"`  * % @앐 `٢ `%P@,w Ϡxd@9~ "#T/`T@ ` @` *,@`,@\"p@`x`!"@W""@Sx/@,A  " ``* ,*` €!"@6""@>#8`  @Qp  @Qk ! @"@>48` @QZ  @QU  "@a %/ !#!P@+ $@>Pb@"d P`? ?  '#8` $`$`,` ,` @>8` @Q  @Q ! @Ő"@?88` @Q  @Q  "@a /0 #% @+ ,( @o .8`  @P  @PېؒbЖ @  ? `* * @' `* `* `* @@A@j"!#@@A!# @D4@\!# @D,2?`# `*` '7 @@AҐ@># !#@?ېc0@3" ```2 ` `! "@C@@"/G/  @ `@#8 @ @ /@ 8L@ "8 ? #@ @ `  .@? " ?  `?`$``@  * % @ ?H@`W@͐#h`p @Ɛ#h ` ?"` * % @ `.`Qvzv(zzzyzzzzzzzzzy`zzzzzzxwD(%s)%s: %s: unknown interface input %-6.6s output input (Total) output%8.8s %5.5s %8.8s %5.5s %5.5s packetserrscolls%5.5s drops %8.8s %5.5s %8.8s %5.5s %5.5s %5.5s%8ld %5ld %8ld %5ld %5ld %5d %8d %5d %8d %5d %5d'DH@*<  "#T5Ha 'DxP D)d'9P5 -:+;@-   @ԖT`"`(@] "`(@ T @*  2 " 8cT!@(h`@Ow @Mؐ #D@w*`@!$ *` *  *  *  :   p @@`!o@ `&`&`&`&`&` &`$`(@*&```?"`` * %`@ː !8(0a@p`@@H!$ *` *  *  *  :   P @ p ap@H``?"`` * %`@鉐 @Cǐ` D`$ $ $ $ $ $ $I!@)f C @`x" `" `# `#@ ` @Z p`a`$@R" &`&`&`&`&` &`$  $ `  $ `  $ `  $ `   $ `$ $@T$ $`( @ !$ *` *  *  *  :  a "  "  #  #@   @ p`a $$@" ``?#`  $ $ $ $  $ $ $ $ $$ $$` * %` @ @C#`@v# 耢 @v @v#D@vS*耥 DL`# ($OpenBSD: inet.c,v 1.48 2000/06/30 20:04:01 itojun Exp $TIME_WAITFIN_WAIT_2LAST_ACKCLOSINGFIN_WAIT_1CLOSE_WAITESTABLISHEDSYN_RCVDSYN_SENTLISTENCLOSED㿘@V 㿘@O tcp??? Active Internet connections (including servers)%-*.*s %-5.5s %-6.6s %-6.6s %-18.18s %-18.18s %s PCBProtoRecv-QSend-QLocal AddressForeign Address(state)%-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s %*p 6%-5.5s %6ld %6ld %d %s㾘 'L!@ea`?@( !!'9!7!5!L0 3 a!3!a  #X @L' # ``@' `d#D@' !#ꀢ`@%"!@!a`!@ސ!0`` ?"``* $`@ؐ "#``!!#\!a!!!#`aH!#d#h  !@$!!a!a!#\!@$`  `d@  @! @(!b@ `\!`8"@a ^L@V \<@V  `X@ 4 \H@ / `#bD`* 2` :!" @a: `T!@Y"(`` ?"``* $`@S   (@'8 4@)!@>!%s: %u packet%s sent %u data packet%s (%qd byte%s) %u data packet%s (%qd byte%s) retransmitted %qd fast retransmitted packet%s %u ack-only packet%s (%u delayed) %u URG only packet%s %u window probe packet%s %u window update packet%s %u control packet%s %u packet%s received %u ack%s (for %qd byte%s) %u duplicate ack%s %u ack%s for unsent data %u packet%s (%qu byte%s) received in-sequence %u completely duplicate packet%s (%qd byte%s) %u old duplicate packet%s %u packet%s with some dup. data (%qd byte%s duped) %u out-of-order packet%s (%qd byte%s) %u packet%s (%qd byte%s) of data after window %u window probe%s %u packet%s received after close %u discarded for bad checksum%s %u discarded for bad header offset field%s %u discarded because packet too short %u discarded for missing IPSec protection %u connection request%s %u connection accept%s %u connection%s established (including accepts) %u connection%s closed (including %u drop%s) %u embryonic connection%s dropped %u segment%s updated rtt (of %u attempt%s) %u retransmit timeout%s %u connection%s dropped by rexmit timeout %u persist timeout%s %u keepalive timeout%s %u keepalive probe%s sent %u connection%s dropped by keepalive %u correct ACK header prediction%s %u correct data packet header prediction%s %u PCB cache miss%s %u SYN packet%s received with same src/dst address/port p F"@"@%!(`!"3!`` !""@%@  @!"3!``4 !"" @%@%@p  (,@!"3!``40!""H@%o(@%k,@S04 03!`` 80%"x@%U @?8   !"3!``4 @!""@%?@)@`!"3!``4  max ip packet size %lu tunneling packet%s that can't find gif ( ǒ@  p""@  !(3!``4 !("@ $@ !(3!`` !("(@ @(3!``4("H@ (3!``4("p@ (3!``4("@ג (3!``4("@ʒ ؀(3!``4("@ (3!``(#@  !(3!``4 !(#(@@ !(3!``4 !(#H@@耦 !(3!``4 !(#x@@} !(3!``4 !(#@@lȀ !(3!``4 !(#@p@[ !(3!``4 !(#@_@J !)3!``4 !) @N@9 !)3!``4 !) 8@=@( !)3!``4 !) X@,@ !)3!``4 !) x@@ !)3!``4 !) @ @䀦 !)3!``4 !) @@Ā !)3!``4 !) @@Ӓ܀ !)3!``4 !)! @א@’̀ !)3!``4 !)!P@Ɛ@Ѐ !)3!``4 !)!x@@Ԁ !)3!`` !)!@@쀢)3!``)!@  !)3!``4 !)!@@q !)3!`` "@v@aaddress mask replyaddress mask requestinformation request replyinformation requesttime stamp replytime stampparameter problemtime exceededrouter solicitationrouter advertisementecho#7#6routing redirectsource quenchdestination unreachable#2#1echo reply %lu call%s to icmp_error %lu error%s not generated 'cuz old message was icmp Output packet histogram: %s: %lu %lu message%s with bad code fields %lu message%s < minimum length %lu bad checksum%s %lu message%s with bad length Input packet histogram: %lu message response%s generated ؐ 8@ ""@8 !+3!``4 @!+"@@@ !+3!`` !+"@@! D)+'+    `"@t#0 P@o?  2!+3!``4 !+#`@p@[ !+3!``4 !+#@_@J !+3!``4 !+#@N@9 !+3!`` !+#@=@(! )+'+    `"@# P@?  !,3!``  @@ %lu message%s received %lu message%s received with too few bytes %lu message%s received with bad checksum %lu membership quer%s received iesy %lu membership quer%s received with invalid field(s) %lu membership report%s received %lu membership report%s received with invalid field(s) %lu membership report%s received for groups to which we belong %lu membership report%s sent p @| $""@Ѐ !,3!``4 !,"@@sԀ !,3!``4 !,#@w@b؀ !,3!`` !,#H@f@Q܀,3!``4,#x,#,# @< ,3!``,#,#,# @' 䀦 !,3!``4 !,#@+@耦 !-3!``4 !- @@쀦 !-3!``4 !- P@ @ !-3!``  @@localhost0.0.0.0%ldPc?`q'  ?  -?#c/@u#h @B  <-#x@ < o'7ab'  2@! [''`#\@ 0 8  c耢 ``€ 0A#耢 "(`+--@=V  #c$%c4 $ @ "# @ @"$  `$`@# . 2  2 "  2  %.*s.%.8s*%d[%.8s]%d %-*.*sH"#`.!`  '4Ḁ " @b P@א@H Ḁ  .`2  @p  ?.`2 `?.%a.!@ %`Ḁ 2?!a@6     .?% @ `?.% @4 `   .!@ה %s%u.%u.%u.%u㿈aЀ %4 G "aЦ 0@F! 2 ,0@ڒ . @H`,0 .  *'@?e@?'  `@@  2`2 @uƔ  "@ . `0@` ",@` `!.#@$ 2# !.#@ 2# `2`2`.#\2` `#@  2# %u input AH packets %u output AH packets %u packet%s from unsupported protocol families %u packet%s shorter than header shows %u packet%s dropped due to policy %u packet%s for which no TDB was found %u input packet%s that failed to be processed %u packet%s that failed verification received %u packet%s for which no XFORM was set in TDB received %u packet%s were dropped due to full output queue %u packet%s where counter wrapping was detected %u possibly replayed packet%s received %u packet%s with bad authenticator length received %u packet%s attempted to use an invalid tdb %u packet%s got larger than max IP packet size %u packet%s that failed crypto processing %qu input byte%s %qu output byte%s @ 7@ X""@Ȁ/3!``4/!@z ̀/3!``/!@m !/3!``4 !/!@q@\!/3!``4 !/!@`@K쀤!/3!``4 !/"@O@:!/3!``4 !/"@@>@)!/3!``4 !/"p@-@!/3!``4 !/"@@!/3!``4 !/"@ @!/3!``4 !/#@@!/3!``4 !/#H@@Ԓ!/3!``4 !/#@ؐ@ÒĀ!/3!``4 !/#@ǐ@Ѐ!/3!``4 !/#@@耤!03!``4 !0 @@!03!`` !0 P@@܀ 3!`` %0@ @k䀒 3!`` %0@n @X %u packet%s were dropped because of no interface/bridge information %u packet%s dropped for other reasons %u input ethernet-in-IP packets %u output ethernet-in-IP packets h @ 0""@Ȁ!/3!``4 !/!@!@ ̀!/3!``4 !/#@@Ѐ!13!``4 !1!@@Ԁ!/3!``4 !/"@@ْ؀!13!``4 !1!@ݐ@Ȓ܀!13!``4 !1"@̐@!13!`` !1"0@@쀒 3!`` %0@ @ 3!`` %0@ @ %u input ESP packet%s %u output ESP packet%s %u packet%s with bad encryption received %u packet%s with bad payload size or padding received @ P@B X""@J̀!23!``4 !2!@N@9Ѐ!23!``4 !2!@=@(!/3!``4 !/!@,@!/3!``4 !/!@@쀤!/3!``4 !/"@ @!/3!``4 !/"@@@!/3!``4 !/"p@@Ӓ!23!``4 !2!8@א@’Ā!/3!``4 !/"@Ɛ@!/3!``4 !/"@@!/3!``4 !/#@@!/3!``4 !/#H@@~Ȁ!/3!``4 !/#@@m!23!``4 !2!h@q@\Ԁ!/3!``4 !/#@`@K耤!03!``4 !0 @O@:!03!`` !0 P@>@)܀ 3!`` %0@+ @䀒 3!`` %0@ @ %u total input packet%s %u total output packet%s %u packet%s with possibly spoofed local addresses %u protocol family mismatches %u attempts to use tunnel with unspecified endpoint(s) h @ 0""@Ȁ!33!``4 !3"@Ő@̀!33!``4 !3#@@Ѐ!/3!``4 !/!@@耤!/3!``4 !/"@@}쀤!33!``4 !3#0@@lԀ!/3!`` !/#@p@[܀ 3!`` %0@] @G䀒 23!`` %0@I @3!33!``4 !3#h@7@"􀤠!33!`` #@'@$OpenBSD: ipx.c,v 1.7 2000/10/23 19:17:09 mickey Exp $dropresponduseroutputinputspx??? Active Internetwork Packet Exchange connections (including servers)%-*.*s %-5.5s %-6.6s %-6.6s %-*.*s %-*.*s %s PCBProtoRecv-QSend-QLocal AddressForeign Address(state)%-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s %*p %-5.5s %6ld %6ld %-22.22s %-22.22s %d %sX 'H4c@ڐ`?@ 4:#ظ`8'ܨ 7454!`    # #  `@k  0p@d h!!ꀢ`D'"4@f# `4@`#P ` ?"` * $ @Z "#``4#44c44#\#h#t#hc#`#d#l#p#x  @6%a444#c4#\㠔@(%a` 5 0`@ ` 85 \H@ @5@0@?5@ `@p ` 5@ P  *`T5@ X ` ?"` * $ @ ܀@ : @Ԕ \ @Q4@ڐ#%s: %ld %s%s%s -- %s connection dropped due to no new sockets x terminated due to our end dying dropped due to inability to connect incompleted due to mismatched id's dropped due to mismatched id'spacket dropped out of sequence duplicating the highest packet refused as exceeding allocation initiated accepted established droppedembryonic connection closed (includes drops) where we tried to get rtttime we got rttdelayed ack sent dropped in rxmt timeoutretransmit timeoutpersist timeoutkeepalive timeoutkeepalive probe dropped in keepalivetotal packetdata packetdata byte retransmittedack-only packetwindow probe sent with URG onlywindow update-only packetcontrol (SYN|FIN|RST) packetrequest to send a non-existant packet received received in sequencebyte received with ccksum errs received with bad offset received too shortduplicate-only packetduplicate-only byte with some duplicate datadup. byte in part-dup. packetout-of-order packetout-of-order byte with data after window rcvd after window rcvd after 'close'rcvd window probe packetrcvd duplicate ackrcvd ack for unsent datarcvd ack packet acked by rcvd acksrcvd window update packet  @Y 5#@aW* !5#5#c@i55#@OcW4 !5#5#c@W55#@=cW* !5#5#c@E65 @+cW, !5#5#c@365 @cW. !5#5#c@!65 8@cW0 !5#5#c@65 `@cW2 !5#6#`@65 @cW8 !5#6#`@65 @њcW6 !5#6#`@ِ65 @c< !5#5#c@ǐ65 @c@ !5#5#c@65!@cD !5#5#c@65!@cH !5#5#c@65! @wcL !5#6#a0@65! @ecP !5#5#c@m65!H@ScT !5#6#`@[65!h@AcX !5#6#a@I65!@/c\ !5#6#a@765!@c` !5#5#c@%65!@ cd !5#6#a@65!@ch !5#6#a@65!@cl !5#6#b@65!@՚cp !5#6#b @ݐ65!@Úct !5#5#c@ː65"0@cx !5#6#bH@65!@c| !5#6#bX@65!@c !5#6#bh@65!@{c !5#6#bX@65"x@ic !5#6#bh@q65"x@Wc !5#6#b@_65!@Ec !5#6#b@M65!@3c !5#6#`@;65"@!c !5#6#b@)65!@c !5#6#b@65!@c !5#6#c@65#@c !5#6#bH@65#(@ٚc !5#6#`@65#8@ǚc !5#6#cP@ϐ65#8@c !5#6#`@65#X@c !5#6#`@65#x@c !5#6#`@65#@c !5#6#c@65#(@mc !5#6#c@u65#(@[cĀ !5#6#`@c65#@IcȀ !5#7#`@Q75 @7c̀ !5#7#`(@?65#(@%cЀ !5#7#`@@-65#(@cԀ !5#6#`@75 X@c؀ !5#6#cP@ 75 p@c܀ !5#6#`@75 @ݚc !5#7#`@65!@˚c䀦 !5#7#`@Ӑ65!@c耦 !5#7#`@75 @c쀦 !5#7#a@65!@c !5#6#cP@75!@c !5#7#a(@65!@qc %ld %s%s%s smaller than a header smaller than advertised with bad checksumsh 8@E ,5#@MԀ !;#6!8`@U;@=!HЀ !;#6!8`@E;@-!`̀ !;#6!8`@5;@!㿘a*`  *` *` *` *` *`  *`  *`  *`  *`  *` @"*`$OpenBSD: iso.c,v 1.7 1998/02/27 12:07:36 deraadt Exp $%s: %d esh sent, %d esh received %d ish sent, %d ish received %d rd sent, %d rd received %d pdus not sent due to insufficient memory %d pdus received with bad checksum %d pdus received with bad version number %d pdus received with bad type field %d short pdus received 㿀 -@   (;@#8;@#@;@#`;@#;@#;@~#;@z#<@v (<@r P%s: %d total packets sent %d total fragments sent %d total packets received %d with fixed part of header too small %d with header length not reasonable %d incorrect checksum%s %d with unreasonable address lengths %d with forgotten segmentation information %d with an incorrect protocol identifier %d with an incorrect version %d dropped because the ttl has expired %d clnp cache misses %d clnp congestion experience bits set %d clnp congestion experience bits received 㾀 D@ Ԕ! ? <@ِ!0<@Ր!P<@ѐ!p<@͐!<@ɐ!!<!@ Ր@<@"<@"0<@"`<@"<@"4<@"8<@"<<@#(%s: %u incomplete header%s %u bad data length field%s %u bad checksum%s 㿀 "@ w  != x@ @w!= @ @n!= @ z@e%s control block: symbol not in namelist tpprev %p next %p isop_prev %p isop_next %p??? 耦 ==!h@@0Ga@y 2 H@S0==!@/06@  0!!@0 !@&'#!@  `ߔ ` @ @^ ` ?"`* "@ Active ISO net connections (including servers)%-*.*s %-5.5s %-6.6s %-6.6s %-*.*s %-*.*s %s PCBProtoRecv-QSend-QLocal AddressForeign Address(state)%-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s %*p %-5.5s %6ld %6ld () *.* x" `N!"=@#a =@#8`?"`਒ * "@˘ "#``==== 㰞====#\#h#p#t#x#P〘#c#`#d#l@p $b =======#\#Ȓc㘘#@^c$b #`  !#  =c@P   \>= 8 @Ha`4 a  >a@D>@: `!` l>@/ (`!3`l#@/ # #@  #@֒ `4 `΀  >`@>@ 0!` >@ (0!:` x@/i  x  x@   x@ undefined tpcb state: %p %d %-12.12s㿈 @ Ԑ*`@, h@ ʒ*` ^ ->+#)'>`N4  @ ! `@(!`2    8 6 5 `@   `  @4 !@     `*`>@#H@P` ?"`* "@ʂ  * @*%8lx tpip4`$ @ Z@a  "p<@/M'< "#``"#?!0@R#``\>`8 ?@Ia8!=!vpt`TP not configured 㿘 ?@0"0 ;@,#8!"ؒ!@ @u %*sReceiving: %*s%ld variable parameter%s ignored %*s%ld invalid parameter code%s %*s%ld invalid parameter value%s %*s%ld invalid dutype%s %*s%ld negotiation failure%s %*s%ld invalid destination reference%s %*s%ld invalid suffix parameter%s %*s%ld invalid length %*s%ld invalid checksum%s %*s%ld DT%s out of order %*s%ld DT%s not in window %*s%ld duplicate DT%s %*s%ld XPD%s not in window %*s%ld XPD%s w/o credit to stash %*s%ld time%s local credit reneged %*s%ld concatenated TPDU%s %*sSending: %*s%ld XPD mark%s discarded %*sXPD stopped data flow %ld time%s %*s%ld time%s foreign window closed %*sMiscellaneous: %*s%ld small mbuf%s %*s%ld cluster%s %*s%ld source quench %*s%ld dec bit%s %*sM:L ( M mbuf chains of length L) %*s%ld: over 16 %*s%ld: %d %ld: %d %*s%ld EOT rcvd %*s%ld EOT sent %*s%ld EOT indication%s %*sConnections: %*s%ld connection%s used extended format %*s%ld connection%s allowed transport expedited data %*s%ld connection%s turned off checksumming %*s%ld connection%s dropped due to retrans limit %*s%ld tp 4 connection%s %*s%ld tp 0 connection%s LOCAL, PDN LOCAL,~PDN~LOCAL,~PDN~LOCAL, PDN %*sRound trip times, listed in ticks: %*s%11.11s %12.12s | %12.12s | %s CategorySmoothed avgDeviationDeviation/Avg %*s%11.11s: %-11d | %-11d | %-11d | %-11d %*sTpdus RECVD [%ld valid, %3.6f %% of total (%ld); %ld dropped] %*sDT %6ld AK %6ld DR %4ld CR %4ld %*sXPD %6ld XAK %6ld DC %4ld CC %4ld ER %4ld %*sTpdus SENT [%ld total, %ld dropped] %*sRetransmissions: %*sCR %6ld CC %6ld DR %6ld %*sDT %6ld (%5.2f%%) %*sXPD %6ld (%5.2f%%) %*sE Timers: [%6ld ticks] %*s%6ld timer%s set %6ld timer%s expired %6ld timer%s cancelled %*sC Timers: [%6ld ticks] %*s%6ld inactive timer%s cancelled %*sPathological debugging activity: %*s%6ld CC%s sent to zero dref %*s%6ld random DT%s dropped %*s%6ld illegally large XPD TPDU%s %*s%6ld faked reneging of cdt %*sACK reasons: %*s%6ld not acked immediately %*s%6ld strategy==each %*s%6ld strategy==fullwindow %*s%6ld duplicate DT %*s%6ld EOTSDU %*s%6ld reordered DT %*s%6ld user rcvd %*s%6ld fcc reqd B㿀%'??bp@@!?"@@`!?"@@` !?"@@`!?#@@Ր`!?# @}@ɐ`!?#@@q@`$!?#p@e@` ?c@`!?#@R@`H!?#@F@`L!?#@:@`X!@ @.@z`P!@ (@"@n`T!@ H@@b``!@ p@ @Va!@ @@J@`@D`D!@ @@8`@!@ @@,`\!@!@Ԑ@ @a8@a !@!P@@a$!@!h@@a@a@a!@!@@@a@@a(aؖ@a( %@/A, @, @ , #`#\@іb  $, alb@b@Đat@b @ap!@@f"8@@bX@`,!@@T"p@`0!@@H"@`4!@@<"ؔ@`!@@0#@{a|!@@$#@@oax!@@#`@c@c@]A`0A @#\#`@AAc ` @Maa"   b#d#\#`P@; `dA`h  `b' " BB`,'􀢠"" Bą"?  `<#`#d#\@ `#A``Ħb`̢`#\#`@`!A` `Ȗ`#\`#`#d@`lA`8a8@````#\#`@ِ````#\`#`#d@̐Aah@Ɛ`tA`|a`x#\@`A` a'  BB`,' "" Bą"?  @#\`A`ab' b BB`,'􀢠" Bą"?  @l#\`ԢbAaؖ@c`@ 'A`@ `@+A`ܔ#h`ؚ#``#\#d@K`Ab@@D`@b``@1A`@"`#h`#``#\#d@,`)A@Ր@!Ab@a"@Đ@a-A@@a@@aAc @Ac@@aAcX@aAcx@ߐaAc@ؐaAc@ѐaAcЖ@ʐaAc@ÐaB`@BaĐ`@{}[]<>㿘 E@J   2    2   "   >`  @7 2   "   E ` @ @&   E `   @ @ @`?"``਒ * "@ %s㿘@ $!8@ "( .@*`  :  ** *@ *@E(8#8*@~*$OpenBSD: main.c,v 1.23 2000/06/30 23:32:14 itojun Exp $_mif6table_mf6ctable_mrt6stat_ip6_mrtproto_pim6stat_ipsec6stat_ipsecstat_icmp6stat_ip6stat_etheripstat_ddpcb_ddpstat_ipipstat_espstat_ahstat_ipx_errstat_spx_istat_ipxstat_ipxcbtable_viftable_mfchash_mfchashtbl_mrtstat_ip_mrtproto_igmpstat_file_nfile_cltpstat_cltb_rt_tables_nimp_esis_stat_tp_stat_tp_refinfo_tp_inpcb_clnp_stat_ns_errstat_spp_istat_idpstat_nspcb_unixsw_rtstat_icmpstat_imp_softc_ifnet_udpstat_udbtable_tcpstat_tcbtable_ipstat_mbstatetheripipencapespahigmpicmpipudptcppim6icmp6ip6spxipxns_errsppidpesisclnpcltptpddpAadf:gI:ilM:mN:np:rstuvw:inetinet6localunixnsisoencapatalk%s: %s: unknown address family %s: %s: unknown or uninstrumented protocol %s: kvm_open: %s %s: %s: no namelist %s: no namelist %s: no stats routine 㷘@'D"   "#\# "'9;4947#5#-#1F 8I* 8@€ ""c` " :"`pFa@ެ F $\a@ޣ F $\a@ޚ wFa@ޔ qFa@ގ0 F v$\a@ޅ F m$\a@| F d$\a@sȀ F [$\a@jЀ  R$\ 8Fa!@c@'  :E"aa "$`?"T <$` 9'`7a 43"` 1a .'!@@a    8Fa!@Zc@'i #"< #"b3` "` &  $\  &8@a %@$`@uD@ٔ#x?K?a* @@L @ `" @@א %@#!/bin/sh # $OpenBSD: install.sh,v 1.74 2000/06/16 03:19:42 deraadt Exp $ # $NetBSD: install.sh,v 1.5.2.8 1996/08/27 18:15:05 gwr Exp $ # # Copyright (c) 1997,1998 Todd Miller, Theo de Raadt # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Todd Miller and # Theo de Raadt # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. FILESYSTEMS="/tmp/filesystems" # used thoughout FQDN= # domain name trap "umount /tmp > /dev/null 2>&1" 0 MODE="install" # include machine-dependent functions # The following functions must be provided: # md_get_diskdevs() - return available disk devices # md_get_cddevs() - return available CD-ROM devices # md_get_partition_range() - return range of valid partition letters # md_installboot() - install boot-blocks on disk # md_prep_disklabel() - label the root disk # md_welcome_banner() - display friendly message # md_not_going_to_install() - display friendly message # md_congrats() - display friendly message # md_native_fstype() - native filesystem type for disk installs # md_native_fsopts() - native filesystem options for disk installs # md_makerootwritable() - make root writable (at least /tmp) # md_machine_arch() - get machine architecture # include machine dependent subroutines . install.md # include common subroutines . install.sub # which sets? THESETS="$ALLSETS $MDSETS" if [ "`df /`" = "`df /mnt`" ]; then # Good {morning,afternoon,evening,night}. echo ================================================== md_welcome_banner else echo "You seem to be trying to restart an interrupted installation!" echo echo "You can try to skip the disk preparation steps and continue," echo "otherwise you should reboot the miniroot and start over..." echo -n "Skip disk initialization? [n] " getresp "n" case "$resp" in y*|Y*) echo echo "Cool! Let's get to it..." echo ;; *) md_not_going_to_install exit ;; esac fi echo "You can run a shell command at any prompt via '!foo'" echo "or escape to a shell by simply typing '!'." echo # Deal with terminal issues md_set_term # Get timezone info get_timezone # Make sure we can write files (at least in /tmp) # This might make an MFS mount on /tmp, or it may # just re-mount the root with read-write enabled. if [ "`df /`" = "`df /tmp`" ]; then md_makerootwritable fi # Get the machine architecture (must be done after md_makerootwritable) ARCH=`md_machine_arch` if [ "`df /`" = "`df /mnt`" ]; then # Install the shadowed disktab file; lets us write to it for temporary # purposes without mounting the miniroot read-write. if [ -f /etc/disktab.shadow ]; then cp /etc/disktab.shadow /tmp/disktab.shadow fi while : ; do if [ "X${ROOTDISK}" = "X" ]; then while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done DISK=$ROOTDISK else DISK= while [ "X${DISK}" = "X" ]; do getanotherdisk done if [ "${DISK}" = "done" ]; then break fi fi # Deal with disklabels, including editing the root disklabel # and labeling additional disks. This is machine-dependent since # some platforms may not be able to provide this functionality. md_prep_disklabel ${DISK} # Assume partition 'a' of $ROOTDISK is for the root filesystem. # Loop and get the rest. # XXX ASSUMES THAT THE USER DOESN'T PROVIDE BOGUS INPUT. cat << __get_filesystems_1 You will now have the opportunity to enter filesystem information for ${DISK}. You will be prompted for the mount point (full path, including the prepending '/' character) for each BSD partition on ${DISK}. Enter "none" to skip a partition or "done" when you are finished. __get_filesystems_1 if [ "${DISK}" = "${ROOTDISK}" ]; then echo echo "The following partitions will be used for the root filesystem and swap:" echo " ${ROOTDISK}a /" echo " ${ROOTDISK}b swap" echo "${ROOTDISK}a /" > ${FILESYSTEMS} fi # XXX - allow the user to name mount points on disks other than ROOTDISK # also allow a way to enter non-BSD partitions (but don't newfs!) # Get the list of BSD partitions and store sizes _npartitions=0 for _p in `disklabel ${DISK} 2>&1 | grep '^ *[a-p]:.*BSD' | sed 's/^ *\([a-p]\): *\([0-9][0-9]*\) .*/\1\2/'`; do _pp=`firstchar ${_p}` if [ "${DISK}" = "${ROOTDISK}" -a "$_pp" = "a" ]; then continue fi _ps=`echo ${_p} | sed 's/^.//'` _partitions[${_npartitions}]=${_pp} _psizes[${_npartitions}]=${_ps} # If the user assigned a mount point, use it. if [ -f /tmp/fstab.${DISK} ]; then _mount_points[${_npartitions}]=`sed -n "s:^/dev/$DISK$_pp[ ]*\([^ ]*\).*:\1:p" < /tmp/fstab.${DISK}` fi _npartitions=$(( ${_npartitions} + 1 )) done # Now prompt the user for the mount points. Loop until "done"#!/bin/sh # $OpenBSD: upgrade.sh,v 1.15 2000/05/12 06:02:13 deraadt Exp $ # $NetBSD: upgrade.sh,v 1.2.4.5 1996/08/27 18:15:08 gwr Exp $ # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. ROOTDISK= # filled in below trap "unmount_fs -check /tmp/fstab.shadow > /dev/null 2>&1; rm -f /tmp/fstab.shadow" 0 MODE="upgrade" # include machine-dependent functions # The following functions must be provided: # md_get_diskdevs() - return available disk devices # md_get_cddevs() - return available CD-ROM devices # md_get_partition_range() - return range of valid partition letters # md_installboot() - install boot-blocks on disk # md_labeldisk() - put label on a disk # md_welcome_banner() - display friendly message # md_not_going_to_install() - display friendly message # md_congrats() - display friendly message # md_machine_arch() - get machine architecture # include machine dependent subroutines . install.md # include common subroutines . install.sub # which sets? THESETS="$UPGRSETS $MDSETS" # Good {morning,afternoon,evening,night}. md_welcome_banner echo -n "Proceed with upgrade? [n] " getresp "n" case "$resp" in y*|Y*) echo "Cool! Let's get to it..." ;; *) md_not_going_to_install exit ;; esac # Deal with terminal issues md_set_term # XXX Work around vnode aliasing bug (thanks for the tip, Chris...) ls -l /dev > /dev/null 2>&1 # Make sure we can write files (at least in /tmp) # This might make an MFS mount on /tmp, or it may # just re-mount the root with read-write enabled. md_makerootwritable # Get the machine architecture (must be done after md_makerootwritable) ARCH=`md_machine_arch` while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done # Assume partition 'a' of $ROOTDISK is for the root filesystem. Confirm # this with the user. Check and mount the root filesystem. resp= # force one iteration while [ "X${resp}" = "X" ]; do echo -n "Root filesystem? [${ROOTDISK}a] " getresp "${ROOTDISK}a" _root_filesystem="/dev/`basename $resp`" if [ ! -b ${_root_filesystem} ]; then echo "Sorry, ${resp} is not a block device." resp= # force loop to repeat fi done echo "Checking root filesystem..." if ! fsck -pf ${_root_filesystem}; then echo "ERROR: can't check root filesystem!" exit 1 fi echo "Mounting root filesystem..." if ! mount -o ro ${_root_filesystem} /mnt; then echo "ERROR: can't mount root filesystem!" exit 1 fi # Grab the fstab so we can munge it for our own use. if [ ! -f /mnt/etc/fstab ]; then echo "ERROR: no /etc/fstab!" exit 1 fi # Grab the hosts table so we can use it. if [ ! -f /mnt/etc/hosts ]; then echo "ERROR: no /etc/hosts!" exit 1 fi cp /mnt/etc/hosts /tmp/hosts # Start up the network in same/similar configuration as the installed system # uses. cat << \__network_config_1 The upgrade program would now like to enable the network. It will use the configuration already stored on the root filesystem. This is required if you wish to use the network installation capabilities of this program. __network_config_1 echo -n "Enable network? [y] " getresp "y" case "$resp" in y*|Y*) if ! enable_network; then echo "ERROR: can't enable network!" exit 1 fi cat << \__network_config_2 You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. __network_config_2 echo -n "Escape to shell? [n] " getresp "n" case "$resp" in y*|Y*) echo "Type 'exit' to return to upgrade." sh ;; *) ;; esac ;; *) ;; esac # Now that the network has been configured, it is safe to configure the # fstab. We remove all but ufs/ffs. ( > /tmp/fstab while read _dev _mp _fstype _rest ; do if [ "X${_fstype}" = X"ufs" -o \ "X${_fstype}" = X"ffs" ]; then if [ "X${_fstype}" = X"ufs" ]; then # Convert ufs to ffs. _fstype=ffs fi echo "$_dev $_mp $_fstype $_rest" >> /tmp/fstab fi done ) < /mnt/etc/fstab echo "The fstab is configured as follows:" echo "" cat /tmp/fstab cat << \__fstab_config_1 You may wish to edit the fstab. For example, you may need to resolve dependencies in the order which the filesystems are mounted. Note that this fstab is only for installation purposes, and will not be copied into the root filesystem. __fstab_config_1 echo -n "Edit the fstab with ${EDITOR}? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac echo "" munge_fstab /tmp/fstab /tmp/fstab.shadow if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit 1 fi # Check all of the filesystems. check_fs /tmp/fstab.shadow # Mount filesystems. mount_fs /tmp/fstab.shadow echo -n "Are the upgrade sets on one of your normally mounted (local) filesystems? [y] " getresp "y" case "$resp" in y*|Y*) get_localdir /mnt ;; *) ;; esac # Install sets. install_sets $THESETS # Get timezone info get_timezone # Fix up the fstab. echo -n "Converting ufs to ffs in /etc/fstab..." ( > /tmp/fstab while read _dev _mp _fstype _rest ; do if [ "X${_fstype}" = X"ufs" ]; then # Convert ufs to ffs. _fstype=ffs fi echo "$_dev $_mp $_fstype $_rest" >> /tmp/fstab done ) < /mnt/etc/fstab echo "done." echo -n "Would you like to edit the resulting fstab with ${EDITOR}? [y] " getresp "y" case "$resp" in y*|Y*) ${EDITOR} /tmp/fstab ;; *) ;; esac # Copy in configuration information and make devices in target root. ( cd /tmp for file in fstab; do if [ -f $file ]; then echo -n "Copying $file..." cp $file /mnt/etc/$file echo "done." fi done echo "Installing timezone link." rm -f /mnt/etc/localtime ln -s /usr/share/zoneinfo/$TZ /mnt/etc/localtime if [ -f /mnt/etc/sendmail.cf -a ! -f /mnt/etc/mail/sendmail.cf ]; then echo "Moving /etc/sendmail.cf -> /etc/mail/sendmail.cf" test -d /mnt/etc/mail || mkdir /mnt/etc/mail mv /mnt/etc/sendmail.cf /mnt/etc/mail/sendmail.cf ed - /mnt/etc/rc << \__rc_edit 1,$s/etc\/sendmail.cf/etc\/mail\/sendmail.cf/g w q __rc_edit fi echo -n "Making devices..." cd /mnt/dev sh MAKEDEV all echo "done." md_in (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxhpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx@HPX`hpx @X $``@  ``  @P@PM@P@P9  @<:  "` 8G!`(@@' @P@P1@P@P:b@h  ` 4   8G!`@@Җ0 8G!@˒`X@&ڐ  #@`@&Ґ b<   ` * @*`  0G @|I p@& @' @W ` ##b@]`P@& ؀  3!``@`t0@a@& :a 43!``\  "aX@aL"#\  H@4 <0  "a|aLad@ap"#\  `<@2T@&h \  % @V @ɚ 0  @ 2     @@V @U\   \!@  2 \   \b@~  2 \   \L@n  2 \   \"@^  2 \  3a` \@`\   "@B  2 @% $x,<P\ht㿘3!``  * b* `@  * b* `@    "#\` %s: %s 㿘!: @Ŗ  8# a!I@ "@Z?s I(Ees IPE㿘b b@      2 㿘  @T@@TȐ 0 @   2@T 2`@T˰ usage: %s [-Aan] [-f address_family] [-M core] [-N system] %s [-gimnrs] [-f address_family] [-M core] [-N system] %s [-n] [-I interface] [-M core] [-N system] [-w wait] %s [-M core] [-N system] [-p protocol] 㿘#!!`8J`p@`8J`@`8J`@`8J@a0@$ $OpenBSD: mbuf.c,v 1.7 1999/02/27 21:22:19 deraadt Exp $interface addressesaccess rightssocket optionssocket names and addressesfragment reassembly queue headersaddress resolution tablesIMP host table entriesrouting table entriesprotocol control blockssocket structurespacket headersancillary dataoob datadata%s: unexpected change to mbstat; check source %s: mbstat: symbol not in namelist %u mbuf%s in use: %u mbuf%s allocated to %s %u mbuf%s allocated to %lu/%lu mapped pages in use %u Kbytes allocated to network (%d%% in use) %lu requests for memory denied %lu requests for memory delayed %lu calls to protocol drain routines 㿘#a  8J!@c@0  3 8J!@ڒcp0!dc" #  ` /4  *  @ !J#i@yT  ,`34!a %J*@` *% * @N @y8   2c  %3!#J. `c.   c.c@yc &. ad J  "@ @y #K  *`   *  :` "*` *  * @   d@xad K@x H K@x hK @x %lu%c㿘  # k2  m21!Kp@w ip_mrtproto: symbol not in namelist no multicast routing compiled into this system multicast routing protocol %u, unknown mfchashtbl: symbol not in namelist mfchash: symbol not in namelist viftable: symbol not in namelist Virtual Interface Table %s%sVif Thresh Limit Local-Address Remote-Address Pkt_in Pkt_out %3u %3u %5u %-15.15s %-15.15s %6lu %7lu Virtual Interface Table is empty Multicast Forwarding Cache %s%sHash Origin Mcastgroup Traffic In-Vif Out-Vifs/Forw-ttl %3u %-15.15s %-15.15s %7s %3u %u/%u Multicast Forwarding Cache is empty Total no. of entries in cache: %d 㶰 'HK@x#0ג$ $``L@w 0L@w 00H L@w X0L@w 04L@w 0!x' "!Δ(    ;L9L/L+L)L  #.2  В@wĔa   @ @w!@L`!`@ L!x @w $*`2   ְ D2HL@w!H    `R N  .`@z `?`9L/L-L+L)L2!@wv (e P0@ @wjb(4@ \8@w_"8 @:#L.2  "@wRbX*`2  @wJb`(`'@ LL@w:"h0"@w6@w4b`4"!mrtstat: symbol not in namelist multicast routing: %ld datagram%s with no route for origin %ld upcall%s made to mrouted %ld datagram%s with malformed tunnel options %ld datagram%s with no room for tunnel options %ld datagram%s arrived on wrong interface %ld datagram%s dropped due to upcall Q overflow %ld datagram%s dropped due to upcall socket overflow %ld datagram%s cleaned up by the cache %ld datagram%s dropped selectively by ratelimiter %ld datagram%s dropped - bucket Q overflow %ld datagram%s dropped - larger than bkt size X K@v#0 ``L@v 0vL@v 00q`M@vy"80ji 4M@vr"`!M"x~@vi!M"u@v`!M"l@vW!M"c@vN!M#0Z@vE!M#`Q@v<!M#H@v3!M#?@v*!N 6@v!!N 8-@v!N h$@v$OpenBSD: ns.c,v 1.5 1998/02/27 12:07:38 deraadt Exp $dropresponduseroutputinputspp??? Active NS connections (including servers)%-8.8s PCB%-5.5s %-6.6s %-6.6s %-18.18s %-18.18s %s %-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s ProtoRecv-QSend-QLocal AddressForeign Address(state)%8lx %-5.5s %6ld %6ld %-22.22s %-22.22s %d %s8 ƸN@ڒc `?! T!h@ T!h@7# ;Oa     #  #  `h  (` _ h2~#%ꀢ`;!"N@u]#0a`N@uW#H` ?"`* $@Q "#``NNch@u?`#` N#pN#O #\ NNN#NcN@u(%#` " O @u  \O 8@u @C@u`0@>O@u `@# ` O@u P *`TO@t X` ?"`* $@ h ה T @ZN@tݐ#(%s: %ld %s%s%s -- %s connection dropped due to no new sockets x terminated due to our end dying dropped due to inability to connect incompleted due to mismatched id's dropped due to mismatched id'spacket dropped out of sequence duplicating the highest packet refused as exceeding allocation initiated accepted established droppedembryonic connection closed (includes drops) where we tried to get rtttime we got rttdelayed ack sent dropped in rxmt timeoutretransmit timeoutpersist timeoutkeepalive timeoutkeepalive probe dropped in keepalivetotal packetdata packetdata byte retransmittedack-only packetwindow probe sent with URG onlywindow update-only packetcontrol (SYN|FIN|RST) packetrequest to send a non-existant packet received received in sequencebyte received with ccksum errs received with bad offset received too shortduplicate-only packetduplicate-only byte with some duplicate datadup. byte in part-dup. packetout-of-order packetout-of-order byte with data after window rcvd after window rcvd after 'close'rcvd window probe packetrcvd duplicate ackrcvd ack for unsent datarcvd ack packet acked by rcvd acksrcvd window update packet  [ O#@scW* !O#O#ckOO#@sQcW4 !O#O#cYOO#@s?cW* !O#O#cGPO @s-cW, !O#O#c5PO @scW. !O#O#c#PO 0@s cW0 !O#O#cPO X@rcW2 !O#P#`xPO @rcW8 !O#P#`xPO @rӚcW6 !O#P#`xېPO @rc< !O#O#cɐPO @rc@ !O#O#cPO @rcD !O#O#cPO!@rcH !O#O#cPO!@rycL !O#P#a(PO!@rgcP !O#O#coPO!@@rUcT !O#P#`x]PO!`@rCcX !O#P#aKPO!@r1c\ !O#P#a9PO!@rc` !O#O#c'PO!@r cd !O#P#aPO!@qch !O#P#aPO!@qcl !O#P#bPO!@qךcp !O#P#bߐPO!@qŚct !O#O#c͐PO"(@qcx !O#P#b@PO!@qc| !O#P#bPPO!@qc !O#P#b`PO!@q}c !O#P#bPPO"p@qkc !O#P#b`sPO"p@qYc !O#P#baPO!@qGc !O#P#bOPO!@q5c !O#P#`x=PO"@q#c !O#P#b+PO!@qc !O#P#bPO!@pc !O#P#bPO#@pc !O#P#b@PO# @pۚc !O#P#`xPO#0@pɚc !O#P#cHѐPO#0@pc !O#P#`xPO#P@pc !O#P#`xPO#p@pc !O#P#`xPO#@pc !O#P#cPO# @poc !O#P#cwPO# @p]cĀ !O#P#`xePO#@pKcȀ !O#P#cSQO @p9c̀ !O#Q#` APO# @p'cЀ !O#Q#`8/PO# @pcԀ !O#P#`xQO P@pc؀ !O#P#cH QO h@oc܀ !O#P#`xQO @oߚc !O#Q#`PO!@o͚c䀦 !O#Q#`ՐPO!@oc耦 !O#Q#`ÐQO @oc쀦 !O#Q#`PO!@oc !O#P#cHQO!@oc !O#Q#a PO!@osc؁ %d %s%s%s smaller than a header smaller than advertised with bad checksums㿀 8G O#@oO耦 !U#P!0`xWU@o?!@䀦 !U#P!0`xGU@o/!X !U#P!0`x7U@o!x too large to be forwarded forwarded too many times while gatewayed Refused due to lack of space at DestinationPacket at SocketNo ListenerBad Checksum at DestinationUnspecified ErrorNS error statistics: call to ns_errorerror ignored due to insufficient addressingerror request in response to error packetserror packet received incomplete received of unknown typeOutput Error Histogram: Input Error Histogram: 㾰   U@n#h !U#U!0cU@n# !U#U!0cU@nt# !U#U!0c|U@nd#p !U#U!0clV@nT l !U#U!0c\V@nD  Ъ)V,` ",`@n6 @ ,``@+`,`  %V,`@ ",`@n!` ,``@`,`in transitat destinationUnknown XNS error code 0%ox *` * c ` 2``V"V"V@ݔ   !U!0@mט㿘` 2`  2` 2` 2` 2`  @2` $OpenBSD: route.c,v 1.38 2000/09/19 03:18:46 angelos Exp $Routing tables rt_tables: symbol not in namelist Netmasks: W@m ("c`    x` @y :W@m 808a y  !"'W% .  &m t #\c` " #\ 2 @ml`@G  2 @1 $t@0@@4  ֑. InternetInternet6XNSIPXISOX.25EncapAppleTalk %s: Protocol Family %d: 㿘?`W"*` €W!W!W!W!W !W !W!W! `W@m "0W"@m^P^^^^h^^^^^^^^^^^^^^^^^t^\^^^^^^%-*.*s Address%-*.*s %-*.*s %-6.6s %6.6s %6.6s %6.6s %s DestinationGatewayFlagsRefsUseMtuInterface㿀"#``WW#X` @l W  #h4!`  "   4!`W "W  #4!`     4!`W WWWWWW#c#Țc#\#`#d#h#l#p@lv%-*s %-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)㿐"#``XW! `@lN X!hXXXXWX#\!(aP㘚a`@l? 㿘! H * H$%-16p (root node)%s => 㿘%##"  T `Kc` X"8@l c` 8X `"@X"PX"X@l ,  t`!#! @~c`  @N    @\ ,`?"`਒ * "@ސ     0    t`X@kŐ"8@$ `` mask (%d)%6.6s %16p : %16p %d refs, mk = %16p {(%d),%s ->㿘#" T"   Y@k W  @?``_%0!9"4Y @/Y @k{`%?9)#Y"4`H"-Y+Y `  8@U" 8 Y `@k[   @̖?` }?"``* $@K } `@k=`h`͒`?"` * $@4 route-sysctl-estimateout of space sysctl of routing tablex   ?''''   @ Y@`"H@v @ܢ 2Y@j"`@l   @ 6Y@H"p@^ @ @  %-6.6s 㿘 L% `" $ 2    @; $  @5  L ?  M@ P  @(  Y @c`?"`਒ * "@ defaultlink#%d%s%x: %02x%02x%s  x?`}[ *` €   @@`Z  ? ?  ? ? & 2`@͐` @-@^{@w    2  Z @ h  ! `  Z @ Z`+Z)Z?$@͔`@: ` @ D@0@@ ; z $Y @٬@:( :&+Z)Z?$@ٙ`@   ?$@ي @    ?4Z @iɒ0!`X! @i0W#X@i hjjjijjjjjjjjjjjijjjjii㽘 7@q  ( . @h  2 @0u " @Y  (  @P     44!`  "  0   4!`"      4Yc 8[ t@i#  T`[@i  @[[ @i` @!"l a  @$"l[ a [!Z @h `?"`਒ * "@ %u.%u.%u.%u㿐`| 'D"`|#p@`! 2 ,cp@ . @b4,cp4!` D @H  @ݒ . cp@ ", #bp@ , D! 22[#\P2 `"p@F!"p%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d㿐4!`   `@  2`" @` !"@ #`p@ť , 6` `!\ 6  p@!* p `!6 \ 6   !6 6 \#\6  ` p@! p!6 6 \#\#`ȗ6  ` p@ߒ! pillegal prefixlen invalid%s/%dp`    ' `' '  ' ''' E @C`@ + 3` "$  "  `` " `"  "   ` 2 `  ` ``2+ + `@ Ĕ  ` `䀢  `耢  `쀢 `1Z& \!@b84!`2 !#\ؔ! @ \P@F!1!p\X@=!㿐  !!#\"x! @ƚ Z ,"xrtstat: symbol not in namelist routing: %u bad routing redirect%s %u dynamically created route%s %u new gateway%s due to redirects %u destination%s found unreachable %u use%s of a wildcard route 㿀 ]@g9!03* ]@g3!(!]!8?@g*!]!X6@g!!]!-@g!]!$@g!]!@g*.%xH*.*any*%02x%02x%02x%02x%02x%02xH.%xH%xH.%s%sp 7  7 7 * 7777&7+  2#+` 2 2,2  #cx] 2@t@T 1!]#x@j 21W#x @_S  ], " @_H  2  ],"1%'#]# c ]#d   #\#`  `@;Lc,`01% #]   K 0 *  2] @ #x,#xc( 2@@0H.㿈 7777 7 7 77`^!h@^  " %02x:%02x:%02x:%02x:%02x:%02xp ? / / // 7  / / / / / / // ///#/    #c] 2@խ@!]#@գ 2G# @^  ]"" @^  2 `]"! `*  `: L` (L`+ +`#\#`O^#d; ;`@v  !]  @m 1* 1#](  2@^@>㿈 7 A7 77  A// 7 7 7 7 //X^!h@ơ  " %-18s %-5u %-18s %-5u %-5u %-42s %-5u %-42s %-5u %-5u %s/%-u/require/acquire/use/dontacq/permit/deny//in /out / 㼸 @I 0  @D 0 0h@? 0ʀ  !_ ڒ@e0!_ ܐ@e&ʀ 2@j@q  `@q   /a//`/@ h @ !_!@e@q @p ///a/`@  @!_!Ȑ@dj ilҔ Ȑ  #\  @!_@dА!0B_@d̐!8A`%*``! €_@d!@_@d!P_@d!`_@d!h_@d!x _@d!_@d!`  _` * *_@d!02 `` ` _ __@d}!0@dz! 4H  J(8f4 a* J TP_CONFIRMING(0x8)TP_LISTENING(0x7)TP_REFWAIT(0x6)TP_CLOSING(0x5)TP_OPEN(0x4)TP_AKWAIT(0x3)TP_CRSENT(0x2)TP_CLOSED(0x1)ST_ERROR(0x0)T_ACPT_req(0x18)T_NETRESET(0x17)T_DETACH(0x16)T_USR_Xrcvd(0x15)T_USR_rcvd(0x14)T_XPD_req(0x13)T_DATA_req(0x12)T_LISTEN_req(0x11)T_DISC_req(0x10)T_CONN_req(0xf)XAK_TPDU(0xe)XPD_TPDU(0xd)DT_TPDU(0xc)AK_TPDU(0xb)CC_TPDU(0xa)DC_TPDU(0x9)DR_TPDU(0x8)CR_TPDU(0x7)ER_TPDU(0x6)TM_data_retrans(0x5)TM_reference(0x4)TM_notused(0x3)TM_sendack(0x2)TM_retrans(0x1)TM_inact(0x0)$OpenBSD: unix.c,v 1.6 1999/12/08 12:30:17 itojun Exp $Out of memory (file table). :`!`  @!H !Ha@c 00 *` *   "aL$"P h PT P (v P`   P` P (@LP 0* seqpacketrdmrawdgramstream#0Active UNIX domain sockets %-*.*s %-6.6s %-6.6s %-6.6s %*.*s %*.*s %*.*s %*.*s Addr AddressTypeRecv-QSend-QInodeConnRefsNextref%*p %-6.6s %6ld %6ld %*p %*p %*p %*p %.*s㾰  , h `  H  2  '< 'a@c !aaaa!a "#\aaaa#h#t###!!a#`#d#l#p#x#|#@b $O  ` K ݼ@h@X!A  ` 8 ݩ@h@X".(  ` $ ݕ@@Xb p\ ` 4݂ @Xl"8  @XeH   '3 ;h9h7h3h @ hh@XNb "#  T,=N t ` 4KB h@X+!@|  ` 7 /@@Xb. ( ` 4% @X"  p܀ ` 4  @W8  @WbH   '3 ;h9h7h3h-h @ gh@WԐb ""` S+<M` ` 4JȐ @Wa@ ` 48ܶ @W".`(  ` $ ܣ@@W `p\ ` 4ܐ @Wzb8  @WsH   '3 ;h9h7h3h-h+h @ g@WZb "" S+<Mt  ` I N@@W8!@| ` 48< @W&.( ` 4%) @Wb p܀  `  @@W8bH  @V 쀒@3!`` h# @V @3!``h#( @V֔ Warning: socket(AF_INET6)ip6 on %s: Warning: ioctl(SIOCGIFSTAT_IN6) %qu total input datagram%s %qu datagram%s with invalid header received %qu datagram%s exceeded MTU received %qu datagram%s with no route received %qu datagram%s with invalid dst received %qu datagram%s with unknown proto received %qu input datagram%s discarded %qu datagram%s delivered to an upper layer protocol %qu datagram%s forwarded to this interface %qu datagram%s sent from an upper layer protocol %qu total discarded output datagram%s %qu output datagram%s failed on fragment %qu output datagram%s succeeded on fragment %qu incoming datagram%s fragmented %qu datagram%s reassembled %qu datagram%s failed on reassembling %qu multicast datagram%s received %qu multicast datagram%s sent x  @g m@P#0@m@U#0HaS@ m@=#0|쀒 3!`` %m @U̔ 23!`` %nΐ @U 23!`` %n@ں @U 23!`` %nhڦ @U 23!`` %nڒ @U| 23!``  %n~ @Uh $ 2 3!`` ( %nj @UT(, 2(3!`` 0(%nV @U@04 203!`` 80%nPB @U,8< 283!`` @8%n. @U@D 2@3!`` H@%n @UHL 2H3!`` PH%gh @TPT 2P3!`` XP%n @TܔX\ 2X3!`` `X%nސ @TȔ`d 2`3!`` h`%n@ʐ @Thl 2h3!`` ph%nhٶ @Tpt 2p3!`` xp%n٢ @Tx| 2x3!`` x%nَ @Tx 23!`` %nz @Td@node information replynode information requestrouter renumberingredirectneighbor advertismentneighbor solicitationrouter advertismentrouter solicitationmulticast listener donemulticast listener reportmulticast listener queryecho replyecho#103#97#89#60#59#58#51#50#44#43#41#29#22#17#6parameter problemtime exceedpacket too bigunreach#0 %qu call%s to icmp6_error %qu error%s not generated because old message was icmp6 or so %qu error%s not generated because rate limitation Output packet histogram: %qu message%s with bad code fields %qu message%s < minimum length %qu bad checksum%s %qu message%s with bad length Histogram of error messages to be generated: %qu no route %qu administratively prohibited %qu beyond scope %qu address unreachable %qu port unreachable %qu packet too big %qu time exceed transit %qu time exceed reassembly %qu erroneous header field %qu unrecognized next header %qu unrecognized option %qu redirect %qu unknown %qu message response%s generated %qu message%s with too many ND options  ?#Pg @S ` 3!``4?!p#`  @R?#P  23!`` ?!p# @Rޔ?#P 23!`` !p#ݐ @Rǔ?#Pa ?c@@?"@#<?"#8?#c4Ȓ@?"@#0А?"#,ؘ?#c(@?"@#$?"# ?#cD@  "@3p#h @ ",@R}c ,@Rw`` ?#P 23!`` ?!q r @R\?#P$ 2 3!`` ? !q @[ @RE?#P,( 2(3!`` ?(!q hD @R.?#P40 203!`` 0!q - @R!  -h'h` @@ ",@R@ ,@Q`` q@Q ?cP  H  3!`` ? q В @Q ?#P`P  3!`` ? @q  @Qʔ ?#P`X   3!`` ? q! @Q ?#P```  3!`` ? @q!  @Q ?#P?#@ `h  3!`` ? @q!@ @Q ?#P?#< `p  3!`` ? @q!X @Qj ?#P?#8 `x  3!`` ? @q!p @QP ?#P?#4 `  3!`` ? @q! @Q6 ?#P?#0 `  3!`` ? @q! @Q ?#P?#, `  3!`` ? @q!В @Q ?#P?#( `  3!`` ? @q! @P ?#P?#$ `  3!`` ? @q" @PΔ ?#P?#  `  3!`` ? @q"  @P ?#P<8 283!`` ?8!q"0ճ @P?#P?#D `@  3!``  @!q"XՖ @Picmp6 on %s: Warning: ioctl(SIOCGIFSTAT_ICMP6) %qu total input message%s %qu total input error message%s %qu input destination unreachable error%s %qu input administratively prohibited error%s %qu input time exceeded error%s %qu input parameter problem error%s %qu input packet too big error%s %qu input echo request%s %qu input echo reply%s %qu input router solicitation%s %qu input router advertisement%s %qu input neighbor solicitation%s %qu input neighbor advertisement%s %qu input redirect%s %qu input MLD query%s %qu input MLD report%s %qu input MLD done%s %qu total output message%s %qu total output error message%s %qu output destination unreachable error%s %qu output administratively prohibited error%s %qu output time exceeded error%s %qu output parameter problem error%s %qu output packet too big error%s %qu output echo request%s %qu output echo reply%s %qu output router solicitation%s %qu output router advertisement%s %qu output neighbor solicitation%s %qu output neighbor advertisement%s %qu output redirect%s %qu output MLD query%s %qu output MLD report%s %qu output MLD done%s x  @ m@#0@t@O% 0HaT@V t@w!0쀒 3!`` %t0 @O 23!`` %tP @N 23!`` %tx @Nޔ 23!`` %t @Nʔ 23!`` %t̐ @N 23!`` %tӸ @N 23!``  %t(Ӥ @N $ 2 3!`` ( %tPӐ @Nz(, 2(3!`` 0(%tp| @Nf04 203!`` 80%th @NR8< 283!`` @8%tT @N>@D 2@3!`` H@%t@ @N*HL 2H3!`` PH%t, @NPT 2P3!`` XP%t0 @NX\ 2X3!`` `X%tH @M`d 2`3!`` h`%t` @Mڔhl 2h3!`` ph%tܐ @MƔpt 2p3!`` xp%tȐ @Mx| 2x3!`` x%tҴ @M 23!`` %tҠ @M 23!`` %uҌ @Mv 23!`` %uHx @Mb 23!`` %upd @MN 23!`` %uP @M: 23!`` %u< @M& 23!`` %u( @M 23!`` %u @LĀ 23!`` %u( @L̀ 23!`` %uP @L֔Ԁ 23!`` %uxؐ @L”܀ 23!`` %uĐ @L䀒 23!`` %uѰ @L쀒 23!`` %uќ @L 23!`` %uш @Lr@Ɛ %qu message%s received %qu message%s received with too few bytes %qu message%s received with bad checksum %qu message%s received with bad version %qu register%s received %qu bad register%s received %qu register%s sent `  8g @L" 3!`` %x8$ @L̀ 23!`` %xX @KԀ 23!`` %x @K܀ 23!`` %x @KҔ䀒 23!`` %xԐ @K쀒 23!`` %x @K 3!`` %x(Э @K%.*s.tcp6tcpudp6udp%.8s*%d %-*.*sH"#`y `  %4 " @J@@   `y`@ 2yy ``@ 2y`@%> y`.`y  y @}`y`@v2`   y @K* ?pa %4 > "a#@b! 2 ,@Ē . @`, %         @+'  "@ß . c@"` ",@ `  `   ` `y :2b!@\"3    ?  ???  ?//''''' /'/ !!#\آ ؔ! @ y"P4 !"@Ҕ 2b؁mroute6pr: symbol not in namelist no IPv6 multicast routing compiled into this system IPv6 multicast routing protocol %u, unknown mf6ctable: symbol not in namelist miftable: symbol not in namelist IPv6 Multicast Interface Table Mif Rate PhyIF Pkts-In Pkts-Out %2u %4d %5sreg0 %9qu %9qu IPv6 Multicast Interface Table is empty IPv6 Multicast Forwarding Cache %-*.*s %-*.*s %sOriginGroup Packets Waits In-Mif Out-Mifs %-*.*s %9qu %3d --- %3d %u IPv6 Multicast Routing Table is empty 0 z@I 0F#?bؔ ``gz@Iݐ 09z@Iؐ!04`z@Iѐ!@0-4z@Iː!h0'? ? " ήb  b/z-z%z  'Ο `. @Iᐪ .  2`@I z`!0@"z!@I  (  @I *`2  ? Ҡ ``z@I|"l$  *``?cpzc`" [ `734z@Ia"@`z`"hḀ    '`  'Ḁ   `z`"Ḁ    `  Ḁ  z#\@I0#` `z`"Ḁ    '`  'Ḁ   ጐ@I``Ḁ    `  Ḁ  q@H`z" @H   3zܔ    @Hb8?#@zz@Hؐ"?@HԐ"?c  3z. 2 2 *  :  @HÐb *`2  @ z@H2N `$?*``zz@H#z@Hb?$ḁmrt6_stats: symbol not in namelist multicast forwarding: %10qu multicast forwarding cache lookup%s %10qu multicast forwarding cache miss%s %10qu upcall%s to mrouted %10qu upcall queue overflow%s %10qu upcall%s dropped due to full socket buffer %10qu cache cleanup%s %10qu datagram%s with no route for origin %10qu datagram%s arrived with bad tunneling %10qu datagram%s could not be tunneled %10qu datagram%s arrived on wrong interface %10qu datagram%s selectively dropped %10qu datagram%s dropped due to queue overflow %10qu datagram%s dropped for being too large (  ``gz@G 0z@G!0`|@G h0ٔ h|@G !| @Gؐ!| ؖ@Gΐ!|ڠ!@GĐ!|Р!(@G!|Ơ!H@G!|̼!@G!|̲!@G!|̨!Ȗ@G!|̞!@G!|̔"(@G~!|̊"X@Gt!|̀"@Gj!|v"@G`㿘@unionsoftdepsynchronousroot file systemread-onlywith quotasnosuidnoexecnodevnoaccesstimenoatimelocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasynchronousffsAadfo:rwt:uvonly one -t option may be specified.rorwrqnoautogetmntinfounknown special file or file system %s.can't find fstab entry for %s.%s: unknown special file or file system.%s has unknown file system type.:@nfs/var/run/mountd.pidr%dsignal mountd㿀@Ϡ }"   75:# "%/:+}2'쀢 8-* @€ (  %&"aJ@ @ 4 }b@$ @Ja a@  % ?@@|b?ː?a * & ^@   0406.`? @耢 } @ } @ @  } @  @     @g#\ 2 @( }0@   @}c@<  @ D "@Ő!@4 @@@@@ '}@c@ @ T 2& }@c@@ ) T@@  }@@ }}@c`@{  @耢 } @  } @  " }@c@d    #\ 2`}@@ }#@@ 2`@#\ @@.`&@< !}c}@1ఒ }#@ΐ  @ ?  "a }c@  :0"  !@#@A :!` @/ #@A 0@u %s on %s type %.*s%s%s (, %sunknown flag%s %#xsv3v2nqnfsudptcpsofthardintrnoconn%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadleasetermdeadthreshmfs%s%s=%lu %ssizeadosfs%s%s=%u, %s=%uuidgid%s%s=0%omaskmsdosshortlongnowin95gemcd9660norripgensextatt) 㿐  T #@CI D:>a *   } `@C5 "8` D#3}"8 `-+)@`  2 ` @C ,@`  뀌@`   @" 8" @Bc@2 O !   !2 " @ H P@Bא   @    @BÐ       X `@B   ᘤ    @Bh  "     @Bp  @"     @B{x  ᘤ    @Bjᘀ      @BTᘀ  $    @B>ᘀ  (    @B(ᘀ  ,     @Bᘀ  0     @Aᘀ  4    @Aᘀ  8"     @AԔ !Bᘀ  <     @Aᘀ  @ (    @Aa@ߐ @ v!  !!x@!@Aa @ 7ᘀ  ! l  p !(    l8 p@A`!@ᘀ  t̀!H   @AKXa`@ {ᘀ  ! l  p !(    l8 p@A%!@ᘀ  t" x!H   @AX x     @@h x     @@p x     @@ݔx x K    @@̔=@a 7! l     @@ l     @@ l     @@!#p@@㿐@  @6  @  @ T `@! 㿘"4  a`?  #:@f    2a@ empty type list㿘 N  na@ΐ  :N  o:: "a "! %  @@ , ` @*  $4 @6 $@ , `$@  @) , 2*@, $@%s,%s㿘 L@ @=@: @滐  @6 @`@`@̐-o㿐@'!%  -}, &@ =  ,  .&b@  ,  c, &&  @7 2N&@usage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special node[-adfruvw] [-t ffs | external_type][-dfruvw] special | node㿘``Ș ؚa@ː!@ڐ ufs%s: fstab uses outdated type 'ufs' -- fix please%s: fstab type %s != disklabel type %s㿘} @c  }@c 2( @ "" @q   @ka` 2 }b@d 2 @=:!h  !@=3  ,-o %s: option not supported㿘@  @5Ғ 1' n L  o  @ = 2*`"@ 2   @2    &*@&b@n  @⠠ 2L@徐㿘@㿘@@ @, 㿘@㿘ؠ! ?R$ ! @ 4  H @!0? @!  @2!  !@"` !@F;?` !"  smcuprmcup㿘 ` $`"4$0T!܀ )3! `$!a@@!! @@ 0 3! $!a @,!! @? @݄`@݂`' !  @?ܒ !@?֒ @i  !@"!"`@ 㿘 `$@H! "&"X K"""X 2 ! n  !!,""X    !"X$"&@ "X!&@ 㿘$ ch @ޔ 1 !̀ " !! *` * 8`0 @ 0@E_ 0 " !! *` * 8`  ch @殔  㿘@Fa8`?؆"?P"@"?P" H@ "@㿘%؀ /@ &!`?R@?R4@@H ? @Dڔ ??  @ Ҙ @DΔ@ {?8`?㿘 ` $`w! @> !!`l Ԑ @0 @> ! `?"``਒ * "@  !@>Œ 0F!    ?`&  @  * $ @<     ?`&  @  * $ @<  `?"``  * $ @ڐ @ 0@f 㿘a@  8`? ` $ ` `"  *`?"" Error: move: l(%u) c(%u) o(%u)㿘 H@@D?   HX@  㿘  $a `a@s @E a8`?xterm]0;%s㿘  \ $!  a(@w  !`&!!0@$! @䀢 <   @  2&` @ڎ#'#@ʞ* "@*`@*`'0!@$`!*` € &`&` &` &` &`@ -|--,$,\input`$!" @U 2'    ??p?x?' 'pp 'p  @ ? `0 `0, @ْȀ 2(T`  ̐ '''''''Ԅ '''' @ ՔT  @ ϔ!\T @  ?pp??x?'p p3@ d"`2`*@ `.  #@ 42d  @; ?$ p@G @LQ Ű 06 @2d!  1$! ! .'  "!` ذ @ `   ?` "' !*'$! `  @ Xȁlines=%lucolumns=%lupР?8''''$@@⟐'@] 2 H$@@⎐'@M @ 㿘 (T   $@j 2e (T ?$(T`$`2[ ``2V $  ?&$$  &$ ! H  4!@? @K! 4  H@!@?~@@!)@ 2. a $a$`"' a"# " " " "  *` 8* ? @ܐ @9   @]  a ? $a 㿘 $!  # @ 2 ! ""2!@ 2 ! "" @ 2   @ !! $!016|Vi's standard input and output must be a terminalTERMLINESCOLUMNS%s%s: unknown terminal typetcgetattrtcsetattr㿘  $a a\"@׫   p@c   >@n 2 #耊 " ## * * `8@! @Ԑఒ @t @ʐ" "  * * `8@ฒ @a @޷!` !X * * `8@@Q `! "$!@s `!  @  e Ȗ@ ]  @ ` @ ఀ2 @  j@>!@>f@=!@6? !@6  $aܒ @߽  @جa\ @ג + a"$a\"$a\a$"aha\$$a\ah  $ah,a~,aw,au,av,a{,az@ 2 a\ @    @  @ 0 㿘! $ @6O!!`! @> !@Ē?! @>@?$!@@&!܁ cupsmsormsoelcuu1㿘  $! K!0"N`@Y!`@T!`ؐ@O!`@J!`@E!!` ! 2! `@G $!! "! @@$!! $!8!!$!@!$!D!$!H!a!! %!$$!L!($!P!,$!T$!X$!<$!0$!4!0 @    @   㿘 $@# 㿘@= " @Z "  @ِ & @  @= 㿘! "!@&!! "!@&!! "!@&!! "!@&!! @&!%lup`  (@w@  ?>>>>>>>>>>>>x>p>`>X>P>@>8>0> >>==============x=p=`=X=P=8=0=(===<cursor upkkcuu1cursor rightlkcuf1delete to end of screendGkedscroll upkripage upkpppage downknpcursor lefthkcub1delete lineddkdl1insert at cursorikich1go to sol^khomego to eol$kllscroll downkinddelete to eolDkelcursor downjkcud1delete characterxkdch1insert lineOkil1>?>=?x==?p<=0?h=lakahaja㿈#`%  @ "@@ @ #\#`#d@ 2  #`0)   @ " ! !`@ 2``"@@א`#\#`#d@ 2_  #`"B   -@ 4"3@ ". @ޫ@ި#\#`#d @ޜ@ޙ@ޖ#\#`#d@    !D " $     @=  2 $ 㿘!D`  `$ @@3 2 `$ 㿘$    " @ kf%d233|This terminal has no %s keyfunction key %dH#c@R @@@  " @" ` ` !@  #(@Qߐ@p @ ?8 ?@ #d#\#`@㿘 ` $`>` `" (T0,`I"0' (T`"(T$  &$  @0`?0   "  0 " ```   stderr%s046|messages not turned on: %s045|messages not turned off: %s8@蟐    < @O 7 @ 6a؀ .((     &a؀@ϒ` 6 0?c @ 6  P@  TERMlinestigetnum: linescolstigetnum: colsLINESCOLUMNS㿐  '`h @4?  `1 ` 2q'0oi" " " "  *` * 8 0YW!` " !X!X *` * 8@ ܀0G@؀0C`( @D" ! `@" 6 @ `` @" 6 @  " `" P@"  @D @"Ȁ  @; 2&2& 㿘 `? "`` *:   * # @wl 㿘  `C  @  2 @ @ L ` `  "  *@ ` L ` ` *@  ` !@ $ `      2   @" @ 1 !$  @W    @  $ , $  a@ $ !@"` "a@ !@$  @B $ ,  "  , @8>   @ ^`@/ @"   @ I   @ >`@ @  @~ ,   "!  L `2  1  `e 1 !@  `  }  z  2s  m  @ΐ , $  㿘 !@) ?π` "H*` € 2* 3* 4* 5* 6 * 7 * 8* 9* 2  `"  "`  @"@!MMMMMMMMM㿐 @xo 2(  @F    "" @o@&  & &  2 ' "'     ' 㿘!@  "@F `"  "` @"!@ 2 !,!,@0㿘 @  <  @  & @׈ &  @   `@ע  @& 㿘`& "`@&"@ @2@㿘  @x@v002|Line length overflow㿈/ @  ' @x4  d d@& d  (T`  @u   (T`@? ' @y 2      @w쀢 2 @`? k @'' @w _ d d@& d  (T`  @tɖ   (T`@? '@ @wM쀢 2s    `T! ' @ 耢 !x t@x "Q &ttx'T!&T@4``@@x * < @ 2Q` @w 쀢 20    T!"x ' @ǔ耢 ޤ` t@x " &ttx'T!&T`@ `" `@`# @@xF" נ ՠ 6 @v 2ް    !T!"x ' @u耢  t@jx " &ttx'T!&T@ؠ @v쀢 2 쀢 [?@W"  @       T!"x/''   "TtTx >&T  t@x "k &ttx'T! &T@耢  `@?" "@ @@w 20 @ '' @v # d d@8& d  (T`  @sf   (T`@? '     ` `thT >"hT@zscript 170|Interrupted㿘`@a "lܰ  `x   `"  "` "@@O @Ml 2 T   $$?#` *  p+$d @is 2 @n&@ $d@ @2d`L@ d $d@< a<`"a4a4`*` * 8@2 @ b ` @ b  8bؑ*` * `Tb؀ T "T :@\0 2Y `(T`  @r   `(T` `@;@;Ɛ @-`x` 2` $$$`$ $@ "`T 2% `(T`  @rj  2T`(T` T "T @aT 2&dV & !#&*<=>@~080|Unknown command name1bca1082|%s: command not available in ex mode083|Count may not be zero084|%s: bad line specification085|Internal syntax table error (%s: %s)lr086|Usage: %s088|Flag offset to before line 1089|Flag offset past end-of-file090|@ with range running when the file/screen changed091|Global/v command running when the file/screen changed092|Ex command failed: pending commands discarded093|Ex command failed: mapped keys discardedx  |` "`` %`%`@ @v< L  ѐ & P`*@$`` @   %` ``* $` $``   3@9`Q`@$`@v 2 T` $` `` $`$`` &:`J   %` `$`  2`  :` ?  $```$`J`:"``  "`?  $`` $`J  2``J 2|` `@ ?$`$`y$`"`` J`?$`  $`J "` "``   $ `("`@ !  3 |` " /'L``   *`J` *$` @    쀢 2`` u ` J`?$`  $`J "` "`:"`` ] `J`|X` V@0   ``?$`$$`` ` L @ ` "` ``$``$`  `2``2 L * : I #* €b! 'JL   'JL L l p + - ^ ##``"@! $`0!Ę !`$!$`!$`!$`$$`($`,$`4$`8$`0a$` `+   ,@  T$` L k s0> <``?`$`$`@$` ?L  L c" g" r""`?`" $$`($@$$`$$$`$$`$`$$`,$`0$`4$`8$`($`  `*  ,@ Đ`` !X@$ `$` ` ! " H !Ӏ"#X "#P#P *` * 8`2  @^ `#p `0L < `02&` L >! `+ `: `J@2```$``$`J"``" @ 2S`` #(@  "@$`@2`%`(`*@"$` ``(``@$`$@2 ` $`` L`$`d P$`h` $`" """ *` * 8`2` ` " ``@`| b$`4`|@*@$`$  ` $"` $` >$```  ؠ  @  $`@h@@v8``"``J !2 ``|!$`4`|$`$``  5` J`$`` $`J "` "```" ``J +2``$`$`:``@ J 0  'S ` 0 'R @m  `` ` $`$`J    "`,`` $``$`ʨ `$`֮"@x@P@0X` ` 5`J\ `` J  $`$` J`%`  $`  ,`` $``$` @Ȁ@:' 5``?`$`$```  J   '쀢~!2}`` #0@쀢 "t`J "p```$``g$`J 2`b`@ ]5`  J`$`` $`J "` "`` L  `*:  |2`"$$`($$`$$$`$$$`,$$`0$`4$`8$`(($` `%$``$` `J \2 ```$`$``J@ "`` $``$`2`` `J@ @ Y```@ J 04  'S ` 0* 'R &@lȒ " `  `J ` '쀢`|2%, 2 ` %` `$` ` ` $`$`쀤 |2, 2``  $``? $`,`` $``$` ```$ "`$`` $` $` $`   L \",` `c`` 050 `` "  "`l~@$`` $`@q耢 2`耢 2 L`$`d $` L$`d Pd$`h$```p$`d_$`h] 0( & @ $`$``  $`l@q`l 2```   `l  `$`$`d$`d`$`p $`6$`h "*`d2 20` ` $``$` L 2$`d @q_耢 2`耢 2  L`$`l $`$`d L$`d$`l P$`h $`p `h$``$`l$`p 2` ` @,  $`` L`$`d#4   L#, *` * 8 #,$`l P$`h$`p@q!耢 2\`耢`" `  L@(` `l 8$`l` $`\ L`- !2``""`J@ !2`|`!$`$`4`| "`` J`$`` $`J "` "``  ϑ* : Fݘ "* €` ?#`J ^"`\ l +"`\ - #"`٤" `\դ p"`|Ϥ $`\?$`\`| b$`4`|`(" %`(`|$4`|`(d 4`|`(@ %`(`` $``$`` "`J ."`| = + -" `| ^" `|   @`| ( L 32`| 4`|`` $``$`y`J + - ^ #2 `@* 1 2h` L  ` 2_``|?`,`Q$`$`T4`|` `L ` L +2H*:  + -2A`J - +`| 2``| 4`|`@ 2G䀢 L 0*``"@ " $`$`L a `l`p$`d$`h ?$`l$`X`|  4`|`@ ـ @a u쀢 ܀ `@o $`T ` #@ ``?@ M ``'``?``@ J 0  'S ` 0 'R @j3  `  ?`$`$` ,  2 ,`` $` $``` $``$`$ @ ޒ 2`` "` ` J`$`` $`J "` "`` "` `'``6!``@J"`",   'S `"`, 'R @i͒ 2,`  ?`$`$` ,,`` $``$`$ @  2U`]```@  KL NQ?'L o`$ "J`` 2>` E``` aP ` *` *  !X@+ :`@hސ@w L  ` `? $`" ``J  $` ` 2 ` @tْa " ```  @wt ``` ( 2@$`l```2`d$ 2` @2`d` ֔ @nn 2`d`| ʐ@n耢 2`$`l`d`` $ 2` @2 $`  @nJ $ `@B@=<``  21``l L   '`# " & L& P@\ P``d L   `  " & L& P@D P``$`$`@ L  P''`* $` '@v+ 2\`$ "  , & ,  $@2`@nؐ` @" `   "`$ "`T 2`@2|` @2`|€ ` *@$`` `€ 2T (T`2T  @iQ  2$ (T`" $T " `$$&$ " @x  "&$`\""$ L @ٔ8   @ `@ @mv 2 LƔ L`\ & L$ G  C L ?`|`:! @4`|`@@<`|! @4`|`|"@ $@ ! "!! *` * 8`2`  ` @2   L''@/ 8`@J?`"`!` ?   'S `"`` 'R *:`@gː 2 `` $`*` $```"$` @G$``@$```$`$`$"Ȥ   |`# `P`"*` € 2@ 2 @  @u @@D@`2 `P pn$"@2y'|@u ``0@vђ `  @Ӗ ` @͔ ` 2@`` "<`! `J` @$` 0  'S ` 0 'R @g6  ``` $` $` |2 `` 8 $```? $`` |@" `@u. @u@j  @u"  '%$*@&$DD<<<<tuu|||||||||||||||||||||||||||||||x|||y||||||||||vw(||xP|||||xh||||||y|||{dddddddddddddddddddddddddddddddc094|The second address is smaller than the first㿈&`  &``` @ ?* : `2r *` €`@2    @k’`l ǖ `l` `@ `?&`d&``&`&`&`p&`h`@2հ    "!``` " L  " L`" `l` &`d P&`` &`h`p&`d&`h L &`l P&``&`p`J`;2``` "`d  `" `l `@& L`h& L`p& P` `?&`9&`@ޘ 2  쀢 - \`` "   ` ` &`d&`h&`` &`l&`p &```l&`d`p&`h&`l&`p ` 2O``@2M ;`` "2 L   02"&`l.`` L&`d P&``'&`h  @ .   @  (   @ ! !   @  `p&`d&`h L &`l P&``&`p`` 2 `d`l @@s  & \tttttttttttttttttttttt\tttttttttt@ttttttttttttttT$0123456789'\/?.+-^095|No mark name supplied096|\ not followed by / or ?097|Reference to a line number less than 0㿈'&`* &`  2``J@~O!x     @r '` @ ?ܑ* : `8!$*` € &`@&`&@jO 2 `` ? &` &`` @ @= z'&&``""@&`&` &``  &`@rђ _'`J @qה "`T'` &`j&`` K  / ?" `@r  ` ?&`&`K `/265"|6" L@& P&`` ` p!p#\ m  ``" " &`&`&` )&` & P& L 2&@i "  "`&`  ``L  ` ++` ?&`&`` Ơ `J "` 2```?&`  &`J` "`` "``  `  `L `2 *:  + - ^2 2 ` & L& P&` &`` L`J "` 2```?&`  &`J` "`` "`` iL`  ` 2 *:  + - ^2Y L `2`  `2 `+2? ``?`&`&`J@ - ^ ``?&`&` ` @|2  ` " $   ` $ :  { `$``" " &`|&`  "    @q~ ^ 8   S @& dLX㿘$*@ &$|@2 ``@m @`h$` 2f `P ?`<`<  @@ $`@"` @$`<"@@`<2 2,`H `P `D`@h " `D@h2 L " L+   & L@`H@`"``"``@@"|`L   @;$``L$` & L$`D`$  `P $ &$ 㿘 `|`"1`| P ` < <@& @"`@& <"@@Œ  <2@Ō H`"  "` @Ł"`|2 P`|"  098|The %s command is unknown㿐    (T!" x ' @ 1(  t t@ x %$ t t x'(T!$(T,@@ǹ @q   ` `t@hT >"hT@+㿘@$   #耢@%@ 㿘@J?`!  @   !@`?㿘b bLJ@4 2  @   2 099|Address value overflow100|Address value underflow101|Illegal address combination102|Illegal address: only %lu lines in the file103|Illegal address: the file is empty104|The %s command doesn't permit an address of 0㿐"      @o 07)0&P @@Q 0('!@. €p@f̒ @oy 0@os 0 @ @@oj  105|No abbreviations to display106|Abbreviations must end with a "word" character107|Abbreviations may not contain tabs or spaces108|Abbreviations may not mix word/non-word characters, except at the end㿈`x  "`t0 @ޔ 2q X@o j @İ@` ?L@ ` 2 @`_Rx@ "@  B  @ ` L  ` _2    ` _   @ `  #\#d@&#` 2  hT  "hT@n  109|"%s" is not an abbreviation㿘 `t(T @@`@ "  @8@oՒ  㿘@ 㿘@ 㿘@  273|Entering ex input mode.㿐    `  @P\ 0`d & L`22``d `d`l   2Ѱ Ζ  2ɰ ` C`%     2 2$$@$   .2  @d3  }`   @d$ n`ǖ2&`&`$@u``&蠟€  `  @O 0o$!2  ``&$!@) @ra @)!@)@)`|!! "!! *` * 8`2!< "!<!< "!4!4 *` * 8`2@  @  ? ''@I۔  @```@c  `@@2`` & L@d   & L 111|No more files to edit㿘`x `(   2`K `!"`|`x 2`( @Ś@  @T}@}y a@[  r `x Jd@2d`$ " d@  @`$d* $d$`(`x @q   $`$  @mI `t `"$@ $ `  $`$$`(@R d $d `(@R d@  2`|!  $ @S[    "d`( $`(d ($d㿐 @ 3 @ `t@R  `|2 @S.  @ @c 0 @"`("`$  "$@ $$$ 112|No previous files to edit㿘`(`$@2 `@lr 5 !"`|@ķ@ ' @q" a@Z   `(@RV  `|!  $@RД   `( d($d$`(113|No previous files to rewind㿘 $ 2 `|@l( !  a@Z  2  $& (@R " `|!  $@R 2 $ &$ 114|No file list to display %s%s%s[]㿘 $ @k 0Q   H)'-@( (  8@ ?@   @'"  (" ( @' ( # # # @'b hT   @^g  2  (T`  @'g" 㿘` `x @   @k `2`t@ʐ@ &  @ `"$@@ $`@`  $㿘  @Y$ $ &`t $&`x 㿘 @N $ *  @² $ *` * $ * "` $  $ $&`t $&`xx    (T!" x'' @G" "e '쀢!  t x@;" "Y $ t t x''(T!$(T#\#`#d'@ʚ    ` `thT >"hT@ݐ /  @ @  J@  J@ "` "`@ y   ` `thT >"hT@  echo x  ` (T!" x'' @ɖ" "̰ '쀢!  t x@" 2$ t  t x''(T!$(T  *@  *`  *` *` + '#\#`#d@5 2  3@yk  R  4@yd  K cp " chch`* * `8@N     L ` J?  ? # N@uK  0  %N   L@ `2 ? @u4  ?   ?'N * .@@]  @` `` `thT >"hT@ɐ 㿘z "xN N " ""j )`N  0  'S ` 0 'R  @[}     ؤ@$*@ " @ ))`" @L@ "` @   'S `"` @ 'R  *:`@[A 2 @` @,`ܠ ,$ $$&`t$&`x 115|No previous command to replace "!"116|No filename to substitute for %%117|No filename to substitute for #㿐\`@d'@+N #"`  % ! '`@ \'`"`  @V'@    "(T t(T x >@  '(T t x@ " ' t(T ta x' '(T@ @  ӠN  @'@    "(T t,@@ '@    "(T t(T x >@  '(T t x@Ж " ' t t x'(T! '(T@ @ @`@@&`(`N % # !2`'`    "(T t(T x >@  '(T t x@ "^ ' t t x'(T! '(T@ @z B, "'`   `"hT`thT`x >@  &hT`t`x@X * &`t`t`x'hT!&hT@@F  ؐ@h    ,'@%` "㿘 ` `$@&"`` @,  @,  $` @g `2` @e? * @9 P$` `,   @& ` "@ @gÔ ``!`  #$  $ @  @ $ @g   $ , $  @g   , `,@   @ ` "@ @g ``, "`㿘   "& $  @ ,``"  ` " @\@ @Y@ `@& @R & $& &  ./%s304|Shell expansion failed㿘@ e / !  ! ,@} @y@u 2M$@hh _ 2  L  .? @c@^@ 4@ -@ `$`*` @f`M / /, `@X$ *` " $`$$' t$' x@x @u$@  .` "@rX  @f’  㿘@@@u289|Shell expansions not supported when the secure edit option is setpiperfdopenvfork-c118|Error: execl: %s119|I/O error: %sx'D#X'H'L 'P#P *` * 8`  DDcP D/  cd  Dc\`* * `8@'#\'@  / '' 'H?@'L'@''@(  DP @fC @x`X  'D`@f6 @3 Dh@f% 쀢 "@yq?"@r? @l @  @f@d@b p@ W Dܖx@gC @ @QC쀢`9D     t@L(T >&(TL x*`  x t@D "Z & t t'L x"(T!&(T@*  D@L "E 'L@"@'. ?'`? "`@xQ@  "@䀦( .N?  2.?.P"@H"` @@xܐ  D@fʒ   D @*m 2 N  N " "" ``D@e] `@ 㿘`|  @`Q ` @ *2 , @2 ਐ 9 , L 䠐 ` $䠐 ` + @  ` !@     2  +  * !X@ @VJ @G 0^@a 4`<$`<$`@ @Y  ,``d " `P"   `P`l " ,`P`<"`@"$`@"`$`<        @.  $` @d͔ " $`L$`H*   @/   .  `| $@`|"  "`| |$`!!%s 303|File modified since last write.! 㿀`t@` 2  `  @F 0  @~@W:@ $  @d|  `@$@2```@`@@ߐ ``@`H@ @ W`` L  > X ";$!$ "!! *` * 8` $T  @S@  "#$m $T "$L$L *` * 8`2$$ "$$@2 $`P@i< $ @`?@(\:$ 2 ``  @F 09 `d @`&``l 2@@[E쀢 (  2@&`l&`d @`d`l#\@ $ & L& P@7 P$& P$ @2 @`x 120|File modified since last complete write; write or use ! to overrideHOME121|Unable to find home directory location%s/%s122|New current directory: %s%s㷘  `X "`x`|!2`x  J@/@c  `x  "#`t0$@ # L @p@   "J  @ch k @@@  2`x_ V`t `/"P  `.H `.2 !H  .2 !H  /; :!H " !@!@ * * `8@ ')`N@ @ :2`((.@@̐.@@Ð 2N@@(  0@dR   N@ ږ`P@dF  A|h`AX8 ŀu8BX`H@18 uTBXŀ1p`4X@ T8"h`TX@ TX 8BxH@ XB8 Ph` X8 X״Xh`TLXP x1`@8,B05A`XXP9BH(52,6xhPH4@ AX>xPHAX ?4?4xh?X0 Jq߰ߐ߈Kxh`Ll1@@xTޘސހP}xVXݰݨjݠ`0(j {|ܸ|ܨ܈܀|p܈h8BH@$8 l8۠xpd`@8|(4@ڸژڈXx`X4P@ ٸٰ`ٰوـ!xH ـ Xڬؠؘ $hXPH$($װר<$X׈׀xpH( 0֘`replace previous RE with previous replacement string,[line [,line]] ~ [cgr] [count] [#lp]~display different screens of the file[line] z [-|.|+|^|=] [count] [flags]3c01zcopy lines to a cut buffer[line [,line]] ya[nk] [buffer] [count]bcayankexit[line [,line]] x[it][!] [file]xitwrite the file and exit[line [,line]] wq[!] [>>] [file]wqwrite the file and switch to the next file[line [,line]] wn[!] [>>] [file]wnwrite the file[line [,line]] w[rite][!] [ !cmd | [>>] [file]]writedisplay vi key usage statement[viu]sage [key]viusageedit another file (from vi mode only)[Vv]i[sual][!] [+cmd] [file]enter visual (vi) mode from ex mode[line] vi[sual] [-|.|+|^] [window_size] [flags]2c11visualdisplay the program version informationversionexecute a global command on lines NOT matching an RE[line [,line]] v [;/]RE[;/] [commands]vdelete an input or command mapunm[ap][!] word!w1runmapdelete an abbreviationuna[bbrev] wordunabbreviateundo the most recent changeu[ndo]undorun the tcl interpreter with the commandtc[l] cmdtcldiscard all tagstagt[op][!]tagtopmove to the previous tagtagpr[ev][!]tagprevreturn to the previous group of tagstagp[op][!] [number | file]tagpopmove to the next tagtagn[ext][!]tagnextedit the file containing the tag[Tt]a[g][!] [string]!w1otag[line [,line]] t line [flags]tsu[spend][!]suspendsuspend the edit sessionst[op][!]stopread a file of ex commandsso[urce] filef1rsourcesuspend editing and run a shellsh[ell]shellset options (use ":set all" to see all options)se[t] [option[=[value]]...] [nooption ...] [option? ...] [all]wNsetrun a shell in a screensc[ript][!] [file]scriptsubstitute on lines matching an RE[line [,line]] s [[/;]RE[/;]repl[/;] [cgr] [count] [#lp]]re-edit all the files in the file argument listrew[ind][!]rewindgrow or shrink the current screenresize [+-]rowsc+resizerecover a saved filerecover[!] filerecoverappend input from a command or file to the line[line] r[ead] [!cmd | [file]]readexit ex/viq[uit][!]quitappend a cut buffer to the line[line] pu[t] [buffer]putedit the previous file in the file argument list[Pp]rev[ious][!]previouspreserve an edit session for recoverypre[serve]preserverun the perl interpreter with the command, on each lineperld[o] cmdperldorun the perl interpreter with the commandpe[rl] cmdperldisplay lines[line [,line]] p[rint] [count] [#l]printenter "open" mode (not implemented)[line] o[pen] [/RE/] [flags]openchange display to number lines[line [,line]] nu[mber] [count] [l]numberedit (and optionally specify) the next file[Nn][ext][!] [+cmd] [file ...]!fNnextwrite a .exrc filemkexrc[!] file!f1rmkexrcmap input or commands to one or more keysmap[!] [keys replace]!Wmap[line] ma[rk] keymarkmove lines elsewhere in the file[line [,line]] m[ove] linelmovedisplay lines in an unambiguous form[line [,line]] l[ist] [count] [#]listmark a line position[line] k keykjoin lines into a single line[line [,line]] j[oin][!] [count] [flags]!ca1joininsert input before a line[line] i[nsert][!]insertdisplay help statementhe[lp]helpexecute a global command on lines matching an RE[line [,line]] g[lobal][!] [;/]RE[;/] [commands]globalbring a backgrounded screen into the foreground[Ff]g [file]fgdisplay (and optionally set) file namef[ile] [name]filedisplay ex command usage statement[exu]sage [command]w1oexusage[Ee]x[!] [+cmd] [file]exbegin editing another file[Ee][dit][!] [+cmd] [file]f1oeditdisplay buffers, connections, screens or tagsdisplay b[uffers] | c[onnections] | s[creens] | t[ags]w1rdisplaydelete lines from the file[line [,line]] d[elete][flags] [buffer] [count] [flags]bca1deletecreate a set of tags using a cscope commandcs[cope] command [args]!scscopecopy lines elsewhere in the file[line [,line]] co[py] line [flags]l1copychd[ir][!] [directory]chdirchange the current directorycd[!] [directory]!f1ocdchange lines to input[line [,line]] c[hange][!] [count]!cachangeput a foreground screen into the backgroundbgdisplay file argument listar[gs]argsspecify an input abbreviationab[brev] [word replace]Wabbreviateappend input to a line[line] a[ppend][!]append@ [buffer]@shift lines right[line [,line]] >[>...] [count] [flags]>display line number[line] = [flags]1=shift lines left[line [,line]] <[<...] [count] [flags]<execute a buffer* [buffer]b*repeat the last subsitution[line [,line]] & [cgr] [count] [#lp]s&display numbered lines[line [,line]] # [count] [l]ca1#filter lines through commands or run commands[line [,line]] ! commandS!scroll lines^D x`X0dx4PxDiscard all current cscope connectionsresetkill numberKill a cscope connectionkillhelp [command]Show help for cscope commandshelpfind c|d|e|f|g|i|s|t buffer|pattern c: find callers of name d: find all function calls made from name e: find pattern f: find files with name as substring g: find definition of name i: find files #including name s: find all uses of name t: find assignments to nameQuery the databases for a patternfindadd file | directoryAdd a new cscope databaseadd309|Use "cscope help" for help㿘 $8   @l " $8_  ,$8`t@  L @ `      `2"7 L @ ` 2 L   `"L , L   L@ `   L  @ `2 @ 2  @Z  CSCOPE_DIRS :㿐@ x "T @ِ     (T!" x`' @~ @  t x@~ 2$ t-  t x'(T!$(T`@͐'# @!@:` 2J   ` `thT >"hT@6 %s/%scscope.out8 @}`x} 2 `x@ @gby @@< q `t,  @ @Z a <  2"$@w@ @Y E @  / .@`@. @8`8  4 @Y֔ /  $ @>$ $ @. @  $" $$ @ @>   @ cscope.tpath%s:8` P(@wE@* Q@]` &`, @Y \  @  `,@`@Z  G @ŐC @`, *@ `,:2`J` 2`J@  @@  #&`(`, `h@* "! & h@#   @K` &`, @  &`(`,  "@`,  @"&`,pipevforkcd '%s' && exec cscope -dl -f %s/bin/shsh-cexecl: %swr㷈?''''D'H'L@ݐ @ؐ耢 DH@X @H?"`  0DDP@X ?"@8?"@2耢?"@,쀢?@ @&@ؒ @Ւ @Ғ @@H LX(@vib @"D@Y @ @ @Hb"$@j HH"` b @j"H"`310|No cscope connections running%d%s 278|No matches for query㿐 ` 2 @@Xp     @’ $$  @ , % % 2$ " $$@ ~   L  P` !`?` '+ `@ @} @?  @@18` 2  2  @X R $ ``|! a @.G <   @. 3@2 $$`2@$`" $@@$ $`2@$`" $@`@ "  "` L"  P"`" "` "  @  @ sgdct efi311|%s: unknown search type: use one of %s㿘`SN@N@ "` "`N@ FN`  A&J##  &L`"LN@@2L 2N`@ ` #* *  !X@*`:`@Hc@Wn n `L  "  " L  "@bXY ) L  % L  " L  `  *@  `  !@ `     2  @r @|`#  @W @.&& & *`& @y@ *` . cscope: %d lines%1[ ]%s: "%s" x@b '*@` @Vޘ`@#( b@ۢ  ??'`@#(  @a '``? "`@iY``@  "@ 2`*@' #"   "   @@g  @qc 値  Z耢 U`"T@Ǥ@m܀ 2  @e   .@`@`@  ; ( $ @ / *@  ' @`@$  $  $ $  @$  $$ &"@&  &??_'@  @V  ` `  " "a``@WV @  8`( ""'%$@s@| 2 &@<'`   '@ 2'㿘@"%s doesn't match any cscope command Command: %s (%s) Usage: %s cscope commands: %*s: %s 㿘`N@ c@ 2 c@\#  c@U @Pc c@Kc c3 c@?   2 㿘@!@  312|%d: no such cscope session㿐 `` ``@ 2@`2 `@UY * ` "` @h` "`@h`@W @`"@`"`@`"@`, "`(@1`( @+@) 1㿘   " #b0 "    No cscope connections. %2d %s (process %lu) 㿘   @b0  %  @ ` 㿈 2$@K 2` ' #\ '' @s ` @.0 0  "& & L & P@y P 㿘@#`#@c˔   2 㿘``? "`@g@``@  "@>2`2` % `? "`@g$` >` @`">``? "`@g` ` @`" 2` 㿐  2 `|`  @6U 0&  `Q`d`l  2 Җ  2 `d& L@K " L  8& L buffersconnectionsscreenstags㿘`t `c" `s`b"  >`  `t", 8` 4 @qb( 2/` @@0 ' @qb0 2"` #  @qb@ 2` @  @qbH 2` @+q`  @5Ҕ 123|No cut buffers to displaydefault buffer㿘 a@ 2  a 2 @S 0\!@ "( # `L 2  @@]  (T`D  @FZ  2 (T`8 2  !@ "' # `L   @@4  (T`  @F1  2 (T` 2  ! @ ********** %s%s (line mode) (character mode) 㿘À!``*` *  !X@@Dq` !!@ܐ``3% & ` *` *  !X@@DM@ߐ hT   @EƖ   (T` ޴@Ȓ2 㿘`x  "`t0       @8 7  @@8 . `t @B`@c`!@`|@Af a 2 `|!,@95  $ ($$ 㿐 @oԔ = @ `|2 @9 @ @pF 0# "` ""`   `2 L"`L P"PԒ "`("`$$ &$&  %ld 㿐  2 ``  @4K 0@ @I   `d'@ ax 㿘  2 `x`  @4) 00 ) %`t@ @v 2`!  `@AK@ ``?#? @`6`&`   h @ L@T  piperfdopenvfork-cexecl: %sfilterforkwparent-writerp'L'T'`'D'P'X"'ܐ "D 3@`۔ ? ''''\  '@Ә D@Ӑ耢 D @cc  'D@Q @(?D@Q ?"@?@`@dѐ 쀢?"@쀢?: @̞؀?"@{ @x @u ?"@?@@@D d` D\ * * `8@Dc\@k / D d  D\ * * `8@Dc\D d  D\ * * `8@Dc\ X @u D d` DD\ * * `8@c\DĖ(@RS @% @_@]\`'@Tc8DL@ǚ   'D\`\D "\L TT" "D  `X @*`X? 0$DĒ @Pǔ@ @'@kD@@c cH 2 @А #`Dc8L#\P@5> @@\ @kD  'c8DP@i   'D\ "\DP @x   '܀`T\TD L P   L PD  'T` D@GvD DT@?"@D `X *`X\  Dd @ DX@7 2 ܀2 filter read㿐   @ s 2` @0 2`  (T`  @Bܖ  2`, (T`"`,` @Ɛ@P  @c[ 㿘`|2@ 㿘@ 124|The %s command can't be used as part of a global or v commandppp  2 $`  @1֔ 0I@ ` @O͒ > `x "` `t@ "  "   L ` 2 ` \|   `  @1 02   \ 2 *  *   ꀢ \ " * @   2$ @1x  @2 L Đ #\   @Қ " Lٰ #\"   @ƚ 2ϰ  &  L P '' '@N 2  @ `<`t$`<$`@@$"@`'ƒ #P'@*  $` @O.  ؒ  $`H@$`L `P$`D  ,`P `| $@`|"   " |`l d `d |@z$`( (T`2@  @A   (T`@`"@`"`@`"@@`@U@pB  d @D4؀  ؘ    ??ܐ @   0 "/` `@"*``@@!`@ @ $  @   @N " $ $ $`@$ `<@2`@$`<"$`@`@(@o  㿘``@$2  [  @N U  |"Q P G<<B  : @ `2`? $ -$ 2 ?@'$ @ $@$` @$<"@@C@  $` `$` $ $@$`2" $@$2 $D2 P 㿘 @$<  $ &`$$ $  $    "@@ $  @N    @&%   㿘 2$$ @@ @3@ u 2  , " @  @@' 2 @А& 㿘`= @'G/etc/vi.exrcNEXINITEXINITHOME%s/%s.nexrc.exrcȠ#Ȓ  @~  2  @Ɛ 2   |`"$Ε$&2 Ȣ#@ " @ @ H #@  " @ @ 7 @#蠒 "5 L 0Ȣ8#Ș#$@k @,  "    ɔ $@j @  2  @` 2[   |`"$/$&2O ! "!! *` * 8`? ;Ȣ#8 @ "%   8 ɢ  @՘ 2 8@<@ @ "    |`"$$&  X#\   5  @-q@@-@㿘 `| ` @~ 2`| @L 3  $`|" `|$`|$ ` $ $ `2 $ @q5 $  `$ $ @@q% $    $ $  125|%s/%s: not sourced: not owned by you or root126|%s/%s: not sourced: not owned by you127|%s/%s: not sourced: writeable by a user other than the owner128|%s: not sourced: not owned by you or root129|%s: not sourced: not owned by you130|%s: not sourced: writeable by a user other than the owner㻐@rƒ  @#` "` `" ``  `?`   w @Qo@W* / ?`@$ 7@Q^`  ` ʔ @K ʔ@ @Kۘ -   ` `thT >"hT@`  `  @K ʔ @K    ` `thT >"hT@ 131|No following lines to join.?!㿈 2 `d`  @-} 05@B  ː@Ks )   "'(T!"  x' @o! `|   t x@o! "  & t t x'(T!&(T`| "`d`l &`l`d`l@2`d`&`l`d `l   쀢`   "(T t(T x >  &(T t x@oG "а & t t x'(T! &(T @o5 L `|!I쀥  쀢 ?J 쀢 9'`0'J "쀢 "(J`)#ː @U ",@,`` ,@` ` J'` 'J "쀢 "쀢 @"@ @J?@  $@?"$P " ?"$P  @?쀢 ]&`l`d$L`d`l @@T ?$@@AQ  ` `thT >"hT@]  ` `thT >"hT@K`d h`l`" @$h132|No input map entries133|No command map entries134|The %s character may not be remapped㿈`|!  `x  "`t0@l۔  2 `!!@J  @ @ #: L @ ` 2    `2 '`  ` #\ #d#`@kK " Z ( `t KI `27`t  23`t ` 'S 'R  @;  "  " `t2`t ̀` "*` *  !X@@:֐@I   ` #\#`#d@j 135|"%s" isn't currently mapped㿘`t ``|!@ @k} 2`t  @@J  136|Mark names must be a single character㿘  2 `t`  @+F 0 `   @H`dh@I6  .exrc137|%s exists, not written; use ! to override%swabbreviate map map! 138|New exrc file: %s8`x  "`t0  "@@89`|@`|! @o ͐ ] &@o! R͒bX@[: ! "!@9E`@l' 9! "` @6!͔p@l  2,! "` @2(! "͔x@l   2! "` @2! "@Z 2! "` @2! "@[  "!͐@I  !@["!͐P @Iڰ X    `  @* 0?`d `l `h`p? ''?耤 ''?'''ؐ  M Ƞ `T /'' @^   & P"  & Lū139|Destination line is inside move rangex 2 `d`  @*+ 0`h'`l'`p'`T@ '쀢@ ΐ@H    8`T   '"  8    . @@ג 2   "'(T!"  x' @l! Р耢   t x@l ! "ư & t t x'(T!&(T耦@"@G` &@ @=܀ 䀢   @k䀢 ܠ@"ܐ @=ϖ ` 8 `  '" "&  2 @=a wŐG A @<٘܀ d䀢   @k䀢 Xܠ@ݐܔ @= K`` 8 "   '" "&  2  @= 1Đ ` `thT >"hT@/$L`$P 8 "l  '"   @? 2 l $l140|The open command requires that the open option be set141|The open command is not yet implemented㿘" " "" *` * 8` 2ϐ@F  306|Vi was not loaded with a Perl interpreter㿘ϐ`@FΒ  142|Preservation of this file not possible143|File preserved㿐  2 X`  @( 0$ @ ϐ@F  @^ 2 @= 2 @_   2 ϐ@F  㿘`t@5`|@5- a 2 @,} "  2`|a  $ @,  $ ($$㿘`|$`d@8`l  `l $ L`p$ P㿘`|"`d@%`l  `l $ L`p$ P㿘`|`d@`l  `l $ L`p$ P%6ld TOOBIG x  2 `  @( 0VU PЦ"?bH#!Ѐ"'䀦 b@@c''  @ 24  @;E܀ ܀  $@"X  @ 2  (T`  @8  2 (T`2 " $㿘 'PP$@ 28  (T`  @8g  $ (T`2' $ ВcP @ "   (T`2   @8G   (T`2 А@KbX  [ynq]㿈" '" *` * 8`@" ѐ!'  @Q 2J @ @:쀢 2A  ` @= 26 `  '&  @+ ^ 2$  (T`2   @7   (T`2 ѐ!'  @  2 @ %c㿘", ""$"$ *` * 8`2$#Ā "#ĸ$#Ā " ## * * `8@@ 4`$2 @\ 8 }%@??yѢ"Ѐ` @x hT p  @7}  2 8 (T`2e& 8:\??‧`V  , *  !X@@5ג ,  * a] @@5Ð`2 ? 8@@T-??"*)# 8 @D"Xb @ hT   @7$  2? (T`2 &??ݤ2v@& 㿘`$'L'P'T'X$4L`4" @d$4$$4J`3 @)㿘N@    4$4$(@@@$4* , :`$$4 ` N@  `@㿘 $4 4 h $$4 㿐  2  L`  @% 0  P'`|`'`Q `d @Y    $ L$ P㿘`| !@2 2 @$ `  $$"&$ !!%s ! r%s145|Only regular files and named pipes may be read146|%s: read lock was unavailable `x   "`t0'( @ @ !`#X`   #P 8*` * `2 `  #P " `  @%o 05 @    @)i  @) 2!   `x!  2 `x2  `  @%> 0?` "`t@1`t, @5@ $` Ȕ $ `@`tc@$`@ `tcĐ0Ғcݐ$`2$@&$$ (€  `  @$ 0$ &$`t  @#\`d 2 ` @&`$ & L& P@g- P  J  2 `x 7  "`t2`t@[!   ` ! @gG "  @` "  ?#? @2   ` 3   蜟@ Ӑ@1ʒ `t@ @$ 0NӒ`@B% T @E  Ӑ@C ; < @  @" T @UӐ @Bc 0'T   @1  ӔH @BS`d@! $ `d & L``d & L 147|Reading...148|%s: %lu lines, %lu characters㿐 !   0@ d 2, (T`,  @4Ֆ  ` (T` `2 ,   hh , @8 >@" ͐ @1@U: ,Ӏ 2'`/ @GBԐ @AҖ    ` `thT >"hT@  Ӑ@B @U `hh  㿘@ 㿐``x` !`t@  @|    $ &$&  㿘`|     "  ` "  `  @#o 0`X@ž149|No background screens to display 㿘     Ր8@AQ 0I     @` 8@ ?@ բ a`   Ւah   T   @3  2  (T`єT   @3Ԗ   (T`Րْa` 150|The script command is only available in vi mode㿘$  Ր@@  `x    @@ tcgetattrptyforkTERMemacsTERMCAPemacs:EMACSt-iexecl: %s㿘 3@OΔ 2 @ ? @@  $ & $  \$ $  @u?2 `Րp T d ? $ `$ d`h @ϔ?Ր p  @ ?Ր@@  @L?$ 0bՐ@@r  ?" @ ?b @xՐ#c@Ċ ?Ր#c@ā ? Ր#c@x ?@f ~@  @}`a@  @L  @I  @F @ #d`" #\#\ * * `8@@M / 2 Ֆ @tՐ@A` @2 @  2  $@ @&$T  "TselectError: timed outError: shell: EOFshellh    ????'' Й2+ @  * "@      @Ғ f "@  ''  @@ ` גa@ǔ   ` " "a@> D A   `"hT`t@hT >&hT`x  `t@b`x "; &`t`t`x'hT!&hT  @b䀢 % @@@5I 2    ` `t@hT >"hT@Rp Ш  ????'' @ $"  2`* `(  "  ` 4 2$   @:? "'  ֐@>  '@$" `2* @ :@ `"@  2 2$ `@5=̀ 2̰     "'(T!"  x'Ȑ @b $  #  t x@b$ " $ t t x'(T!$(T  `@$?  @ ֔@= } (  'S 'R  @/   2 ̦$ '̖ @3 V  * C$@Ā Ā %a  ????''`Й2+ @  * "@ `   @9 @@2 +  '̐ @3k  ̀& L& P& P@%    ` `thT >"hT@!㿘  @@ $  @=   @P $ *@ @I   5 1 . K2!K )? K"? "" J@K `J@2" KJ@ `?Ԕ  2" script-shell㿘` 2d  @*@$d@ ?" @ ?"@ٔА @  @ @$`   "(T@䠀 "(T 2(T߁"(Tttypqrs0123456789abcdef㿘@ ؀ ? J `T "+ `M`耢 F-"  p,,  @b   t "!`/:?@B,@ܐ!@@ @b ?&&@@.Β@   `g@b @~L 2  M 2  " "a?㿘`x 2` @KI   `t @H " %s -i㻘 3@K 1  #dښ"`  #\ * * `8@#\  @Y$ h  $3    @  h $@$$ vfork-cexecl: %s㿘'D  3D'L@JÔ D d  (€  D`  @ 0u(\  D$`"$ DacЀD\DXc{D@d` DO D@;v L D cd " c\c\`* * `8@@ / D cd  Dc\`* * `8@#\D cd " c\c\`* * `8@ L@ޙ D #d` D#\ * * `8@c\Dږ@N"hT@M `2J :` E2D N #N " "@?@b `"hۚ"p : #\@:    ` `thT > "hT@d  @@:e   tt tttxthtHt@t(ttss s sss ssx shsXsHs8s srrrrrrxr`Filesize limit exceededCputime limit exceededWindow size changesVirtual timer expiredUser defined signal 2User defined signal 1Urgent I/O conditionStopped (tty output)Stopped (tty input)SuspendedTrace/BPT trapTerminatedBad system callSuspended (signal)Segmentation faultQuitProfiling timer expiredBroken pipeKilledIOT trapI/O possibleInterruptInformation requestIllegal instructionHangupFloating point exceptionEMT trapContinuedChild exitedBus errorAlarm clockAbort trapUnknown signal: %d㿘ܖ!` @  ``1:!ݔȐ@W (㿘@ 㿘@  152|shiftwidth option set to 0㿈`    @E 0k c| " ctct`*` * 8` ݔp@92 V  dlј  N t @'J " ctct`*` * 8 `'J` >" c| <" c|` ` "'(T!"  x' @]%! d   t x@]!  $ t t x'(T!$(Tdl  @.1쀢 `쀢 = @. M  # &  cĀ  c`* * `8@ c  *`  8*  @w.&`@*M   $ ``L"  ` ` "(T t(T >$(T x   t@\ x " $ t t x'(T! $(T@\ ~ c, cĀ`  c`* * `8@& c& cĀ  *`@ *` 8    , ?@@"" "@/ ` `` `thT >3"hT@; `L2  `P$ `P%@@ "@$`P %` `$`L$`P@\N`P` `` `thT >"hT  @ݐd `pl`" @$`p%s8`t  @^s F@ AȀ   " @ " 2"a@`  @7 `@2 ,@@ɐ@ ș>`̀@ ȕ>`̀ " "a@ސx@8͒    귚 㿐`|!2  @&q  2  h€    2  @\  㿈`x `t`@L@ `L@ " "2L@@hd`L  ``\2.  P . 2 @L` \`2 @,`  @,` L@  @ꀢ \"`,L $ 2$ @ % @  Đ #\   @W 2    #\  @H  #\ ؘ @< Ȁ 2  & L@` @@`%@"` "& @& & L``@2@``Ϣ*`:   :  ~` L@ 2*`   ` hT!"`x' @Z  `t@Z`x " $`t`t`x'hT!$hTL ' ~L` \?` ~,` 827 @"D `"< *` * 8`2) @ "< 2# @ 2 @"D ""<"< *` * 8`2  @ " @  @`   @,` L@  @ \"`'&  @ @ &  @6    ` `thT >"hT@ @c   ` `thT >"hT@ې@㿐 ؀2$ @͔ !  @  ܐ #\   @' "`x `x  `t@@b 㿐 2$ @ ! @  Đ #\   @ "`x `x  `t@@6 153|Count overflow155|Regular expression specified; r flag meaningless156|The #, l and p flags may not be combined with the c flag in vi mode169|Confirm change? [n]157|No match found㾈 'L  'P`  @A 0<! L ' P '!| *` * 8`!| L. . L ''`'J@ y @?* : `i}"̓*` €`\ b&`\`\?^&`\m5 "LL&@  "&LJ 'L "2`l֔ @4   &`l&`d@+ 0L@,$`l *LѰ  $' $`?`.   ?'' `?.  '  ' $@  'PL 'LJ 2 @LJ`2 ` 2 $ " $`  @ 0$ "`d `  "`di0`d `l'' '''' L@)̘ C  C    T!"x/''   "TtT >&Tx t@Xqx "= &ttx'T! &T@X_ ZL@'L ' '   L   ? ?(P@ @qY  Ӓ `'8` $@24 (,@2/     !*!@' @Ð  @ ' @3  " 'L? *@  ' $',@''̀'''$ 4 ' 'Ԑ& P& L@  ax@8ǔ @ ؐ @&a o ")  (k @(@f иȐj 2[  2T  @( I  @/䀢 q"E  y"H(   B    &L@ $@  2!a ! ' @  @W ' @3<  )L@,@,@T' 'hT !"hT& L  @ B  $ & P2)@ & @ B 4  2! !   ' @Ӑ  @ ' @2   L@$@[$ L'@ @֚ 2 ',` $ú  ` * @  !*!@' @  @͐ ' @2  "'L@@@'  ! @  / "  @) b   \`  & \ $@ " '&  @)T I L@'˘ A   "TtT >&Tx t@Vx "R &ttx'T! &T@Vt oL@ 'L' "!@' @  @? ' @2$  "J'L@@' `   L `  )  !*!@' @Ɛ  @ ' @1  "'L@N@@'   @  / "  @(L    \`  & \ & " ' @(   X `& X & `` 2' "!'''̀`'ԐЖq$Жh" Ж_쀢`8  (T`  @$/   (T`  L@ 2& P P & P@U P  `    ` @&`P@  $@ @10   !   ``thT >"hT@1   @   9'@ @dddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddd㿐\'H'L T ! "!! *` * 8`2 ! "! ! "!! *` * 8`2`!䀢 "!`!䀊 "!! *` * 8`L  LH L @ `    `""`  $@ @ $*@&$  $ @ @ $ *@&$S  HL@y 2e ` HL@ L@^ 2T   @& L'L@͐  & @/  H@^LL*@    ` H`thT >"hT@А `" 'HH@p  2 @ `$ &$ $ &$ [[:<:]][[:>:]]㿐 @` L ["l"D \ *f ."e"Dv ~"H"Dp`(m L < [ *' ."&"D_"""D ~ >"  V""DR O " "<"< *` * 8` 2A ' "D " "<"< *` * 8` 2/ +  ""<"< *` * 8`2   "   "D " "<"< *` * 8` 2   2~L  &&    T!"x' @S8   t@S-x 2&tȰ tx'T!&T`@ ` ~ \L [  \ * .""D. ~"q"D.`(. L < [ *F ."E"DZ."A"D ~ >Q."#"DM. . . . . . .  . . . . . . .` ""<"< *` * 8`2R.6 "3 K."D ""<"< *` * 8`2. " . 3. /. ""<"< *` * 8`2  . ". @   "D " "<"< *` * 8` 2 . .Q &&@& ^.[]$*㿐 &   , T!"x ' @RG  @ t@R<x 2&tY tx'T!&T@  J? / ? ?  J?`$ ?   N / ? ^ ?N ^,@ `?  ' \N \2 NN  / ?2N  ?@8 ".?.   $.&&@& ([ ]|/\*([^*]|\*/)*\*/)*\^.[]$*+?()|{}㿐  @L@ "?` &* @* $@   *     ` hT!"`x ' @Q @ `t@Q`x 2$`t9 `t`x'hT!$hT@ ^. `@ʔ  ) \L@` @   @8o 8 " @.  @. ?`@   $. &&@& RE error: %s㿘 @kT @  @- 0 @kF( @-@㿘'P 'L'TP'H N L & \ ” `"D ""<"< *` * 8`/   )*  `L?ڀ`O  H*` €"D  "< *` * 8`"<   *: ?Ц* @ ?@ @  {@ `?2`` ?t `` H"@3 @ `   'R  @o ' "    `L0  `L0`L ` `   `L ` `  *@  `@!*! @.@k  @,P M-`      ` 'S 'R  @   &   @2  ` & @*` @"*` &  @,  耢 2 & Z  * "  +& ) "    0  0 L ` `     L ` `   *@  `@n!*! @@Ԓ  @+ -2LL "P"T"                                                               X#\   9  @ @@ @   > $158|No previous tag entered㿘`x . 6` "`t@`t@@ $` @+  #Ѐ " ## * * `8@ "`@Q`(``*` 2 `@*  @`@ " @   @\> j$$  @\6 , b% % 2$ " $$   L  P`  a2`| `|a !@ >  @Ð 5@2 $$`2@$`" $@@$$`2@$`" $@ $@g "  "` L"  P"`" "` "   @m @h@ 282|Already at the last tag of this group㿘 2  @ &  @ 2 `|@@*G   @V "   $ H `$ @ `  255|Already at the first tag of this group㿘 2  @x &   @ 2 `|8@*    @ "   $   `$ @`  㿘` `@ &`` @ @6   ` @Y   $ >($$ 㿐` `@  &` @F G @    @ @Gk09` @@$ @ @GZ 0( "` "`"`   `2``  "`("`$䠐 >" "$@ $$$ 159|Less than %s entries on the tags stack; use :display t[ags]160|No file %s on the tags stack to return to; use :display t[ags]㿐 @@2`x @ b   "`t0ST  @&J@ $L @4;@@) 9 @]@@ /   @#'  @8 22 @@*2  2`|  @~~`|@ 㿘 @  ``|@  @,  㿘@   @  & L & P@  2)    "   #`  `3 @,  "$ (&$@@  2@@@2 @ 292|Display too small.%2d ... %*.*s %*.*s*%s%.*s 㿘 2 8 @Ɣ 0 "@([ 0xd @] ;9753/@`` ` 2 `@      ܖ 2Ւa@"` 8?• @`  8݀ 8 @!!!  㲐㯒(@@2 (T`  @   (T`2 㿈 F`@ d  '@ 2Z  "` "` " @2 ""@"` ސ"`"@@2`$@"@$` "@"쀢 "` "`` "$`     @0 $` @'r  㿘@|>  2` @'e  `$ ` @$` $ $ @$  $ &  㿘`  ` !@|  @'?  @~` $ `$ $  $ & 㿘`  ,` -` ``$ @{  @'  @~`` ($ ` "&`   $ & 㿘@` `"``" @ `"@@{`@{㿘``@ @`&` "`@&`"@{ΐ `@2@@` @`$ "``@@"@@{ 164|%s: the tag's line number is past the end of the file165|The tags stack is empty166|%s: search pattern not found㿘`  ` 0  @& 0@@'Ғ 0@|$㿘  N@ @  /`&@`()@@{>   @&f $ @{4` $  @&[   @{N @} *@, $ $  "@$ @``2ʲ` 㿘 Q@ 5 `  @{" 㿈 L@ `@8'@0 1#  ' '#\@D @% (  " #\ @Dߚ "   Q 0 2 & & L & P@J7 P 162|%s: tag not found%s㿘@~ @W' ! K  & &   &  & @}/   @J     ,   2)& p@& `  3 "#   2   c&a@&Ӓ   ,  2 @z{   163|%s: corrupted tag in %smunmapclose  'P@L   "! ' @u#  "#\    @}  "! @|' 0P@ @P@( 'M  `'J` @"J@  *@ '%`"`'@}_``@ ``2P P@}J 2>PP@*]' @*X  @$     t@T >"T@y    ` `thT >"hT@y@3 <@P.@`@`@V  , ( $ @| / *@  ' @|   $ $ $ @{$  $$ &"@G& @{ @$u @{͐  @$l  %s/%s8'N /"@J `@| / ,@`@$@A@J  /`@|&' /,@㿘&2  : @L  @3 2&2  : @L  㿘@@ "@? @0@@N@ `뀦@ J(88   ?J` @ : JJ@  @ *J  @  J@` ` 2?302|Vi was not loaded with a Tcl interpreter㿘@#  8@  8$   ݖ "m @$ $`2@&`" &@ L $  T    Q*  * L#   L  @sY 2C @e ؐ @- 3?`  "X*` €A @=      @G| " $ ?`" *` €쀊 䀎   ` @J?`\䀎    @ @J?`.@ &`"` @&@"@ذ  A Ѐ  $` @rט 2 @w   @r˘  @ז$`$ @@2`&@"i&`  @2   @~2| {䀎+  @ J@  J "` "`@  $   *  *`?`" @ e) `"&"  *" 01 @''  @F "G '  @y  '' @ |€ $ $  @@ 2( |@w| €@B䀎@  L `  Ґ  * `$  πѨѨѨѨѨѨѨѨѨѨѨѨѨѨϤ|`dhhhhh%c%6lu %.*s㿘@ "" """ *` * 8`  `@""`"@`@o. 㿘#Ā " ## * * `8@#| " #t#t * * `8@` ` @ `L 2`@`A$@ *L@`7$@  @`1$@`+$$@  `@E”` 2&` &` &` ``* `&`    `?`* `&` 㿐`L`P'' '@   , ` X 2 4  . X& 4 4   @Ր 2   & 4@y    & 4@v $`L$`PTo see the list of vi commands, enter ":viusage" To see the list of ex commands, enter ":exusage" For an ex command usage statement enter ":exusage [cmd]" For a vi key usage statement enter ":viusage [key]" To exit, enter ":q!" 㿘Ēab0ܼbhbܸܴb The %.*s command is unknown Command: %s Usage: %s ^D%*s: %s 㿀`x S `t@`L  ` `*  + "@`" @@@>H` 2`@  "``!2`  @ `*  *@`?c`0g!`9#!X@ @[@ 2 ```)#0Q"6@2`(#!$ [/@ @ ]*  /@` //@ ``*  / * +`  @`` @  (T`  @  b (T`b0@u The %s key has no current meaning Key:%s%s Usage: %s %s 㿘`x e `t `" `  @ 0 `~4,`[`]`~ #`~=$ "## *` * 8`w= w =".`@` `` "X*` *  !X@@lQ ` J b ""Z? =" #w !.`$ "## *` * 8` `.` `.`` 5"``~4  (T`  @6  Հ`~ (T`Ѐ`~ @u 㿘\  @wÐ.`@*`" @& & `& d& l& h`& p |!6 |& t & x$ x t( "`"@ x t(" x"@㿘  "`,"! `0  `,@CU`0 "2 $`,`,`? &`@1@  &@`  ᐀ 2  $6` ` 2 ,2&2&   Ť167|%d more files to edit㿘`2$  0 , @"  ("  " & 0 `@ 2` ("@ :@Ȓ  㿘 (€  "(\$   "`" " "  * * `8@!`  & 4!X * * `8@!X$& 8 ? &$ 168|Buffer %s is empty144|%s: expanded into too many file names283|The %s command requires the ex terminal interface272|That form of %s requires the ex terminal interface274|Command failed, no file read in yet.173|The %s command requires that a file have already been read in171|No previous buffer to execute172|No previous regular expression230|This screen may not be suspended290|The %s command is not supported when the secure edit option is set284|That form of %s is not supported when the secure edit option is set174|Usage: %s㿘 C#. €0@9 02%!`2@p @ђ 00x@ƒ 0@  0@hxVersion 1.79 (10/23/96) The CSRG, University of California, Berkeley.㿘@  175|The visual command requires that the open option be set%luz%c%lu%luz%c 㾐" " "" *` * 8` 2 `d@k   " & L`| (b  - @  ^  ( +  . L P#  "`@A L ` 72``|   L`X@:!  LА@:! 8  @ `|" @d"4$b2$ !  @+ܘ $   @+՘ $`2$@&$$@  `& "@{p' 2 2 2  ؿ`  &$ 㿘@j 2  @  2 k&`x㿘@U  2 @  2 `| aӒ `  $$"&$ 㿘@4 㿘  2 X`   0! @   2 @ j 2 `| a `  $$"&$ ! 㿈  2 `|`  l 0!  `x `t@L  "  " ^2]`dL !2Y`d#X "#P#P *` * 8`2`      `  5 0L  "  " L `  " 0@tn  2 $ &$`t `d#\`l+ 2 $ @2 ͒` `d `l@ ` "``x L >L  > L`L  "  " L `l`dP @t 2I `x 8  4@qO`t!   ` ! @@: "  @p` "  ?#? @2   ` 3   蜟@  @ ~   `l`d@253|Writing...%s0 `\`%'@! Q 6   h  @ X @-@O  ?`& * &@= `   @Y d Ґ (T`  @ ٖ  ` (T``@hZ 2 V@jΒ  <  @LAV 2  @.J 2    X` @1 @.9 ``h  `%'@㿘  2 `|`  ɔ 0  `Q`l`dg ---------------------------------------- 㿈  2 `|`   0 "$``X " $X$X *` * 8?`| `d ( @('  @``4(cZ`, @ "@ &`d&`d`d?X&`l"@  &`dO&`l?2 @ "@&`d&`d@&`l L ' P''@ 9`?2 @ "@&`d&`d&`l  2> # &`d&`l 20 @?`&`d&`l@ ' @?&`l&`d` @^쀢 2 `l쀢 8&`lҐ  2& L /tmp㿘`,`0`0'   $`4$  @$`0"@  @n@nӐ@) 52  @K'   @Ɣ `# b@( `0@ n  & @n @  `0&`4& `02`4$`0"$`4%s/vi.XXXXXX237|Unable to create temporary file238|Warning: %s is not a regular file%s239|%s already locked, session is read-only` `   ?#ߐ @6`@5 `6` @J \ 2 `X @^  ? $`T,`X$`H$`$`x@t | `t X @(N 2<`!xx h`  !p * * `8@!p  @6ْ$@7?x@ `@pt``` 6`@ Ȑ  &` ` 2` @  &`` "@m @ @6y`` $` 6`@ΐ`D-  @; cB + gB + 3`   8 " < `X x|  ,`X$`<$`@$`D, ࠐ @   ??  ?/''T2   '`@0B `L'@ ] $`L @ ` `X' ,`X  ! @,؀  $`Ȑ@̒  @[ 2}`@W 2w` "     "@  ``6` @ @ X``?# @6` ` @`H@ "   0 `! 6`Ш @z  $@`  `@    )  @&ܘ @ )  @&՘ @&  $@@& $ @&$2 "` @l&`` " `X@5u@l` &` `X @"`L@5l`L`L "`@l$`L`  @@lՐ`^ %s/%s㻘`2Lf& / .L / . L / @>M`?P&@>G 2"Ȑ H&   " * * `8@" - !  L : 2 ?:L,$@54#8#,@> 2L ` @lC  @j   @nՐ@l\`&`& -c option㿈  & L& P $   `2 $@ L q L 2 & L& P #ah@o o  \I$ $ @s L Q L 1 ; ` `& L`&$& P!l "!d!d *` * 8`  & L  @ & L  L  @ P쀢  & L& P P쀢@8  L& P@;9 P P L ''& T '@+240|%s: remove241|%s: close242|%s: remove243|%s: remove㿘`" @? &@  L $  P`$ `14  ".`@4-  ㈐@ @k   $  0@ "4"`  0@"0"@  @k@k~& ` `"@  @ @  C&@@f@F`X` 2`H`L " `P@3 `L㨐@ `P " `H@3 `P@ `H?"`T@m`T?"`L@m`L "`P@k.`P @k(@k& 244|Read-only file, not written; use ! to override245|Read-only file, not written246|%s exists, not written; use ! to override247|%s exists, not written248|Partial file, not written; use ! to override249|Partial file, not written250|%s: file modified more recently than this copy; use ! to override251|%s: file modified more recently than this copy252|%s: write lock was unavailableaw254|%s: WARNING: FILE TRUNCATED256|%s: new file: %lu lines, %lu characters315|%s: appended: %lu lines, %lu characters257|%s: %lu lines, %lu characters   @$ː     ` "쀊 """ *` * 8`    D"8A"p B$ " $$ *` * 8` 3`  @;   ""k  `@;ʒ  "#@# 0 @; $ `   X  <@ @@ D@ #8#-   &"  @$  !0 !( * * `8@@ " @;y!  `Ȓ @ 0  @  㸐 @##@'  `@ @l @ ''@  2 '@#\#`D`@;  " X@aD  ,X$<$@$D  2 @ y  ?  5  X ,X `@㿐 5 @<0` @ p@\ HD@$@@1?8$? 8@i 8 !@lv@@ OH /@  N@ /2` 8?:`@  ..@.@.@@ <    ` `t@hT >"hT@h 258|%s expanded into too many file names.%d259|%s: not a regular file260|%s: not owned by you261|%s: accessible by a user other than the owner?b'H! "$! @:[ ?   ! .HT N#\    < N N  @k 26    @͒ @jݐ)      (T!?# '`*  2#  @7 〥@ x*  2 (  t t@7 x Ҁ$ t t? x# '(Ta$(T @L*`: `% `/L  %" *"  *L    % d,@,`,`@ #P ,@  /,2 @$@7#`@֔ 4@$ ?@!?  `"@@0X @@9 "*<  `@@  6  㠐@ E$`@9a! : @i 1 ?#@@i 4"H@i H@i  逦   ` `thT >"hT@g~+ @iא`@/@iА`Ȑ@     ` `thT >"hT@gT 㿐  @  "  yJ@#$! &$ <J`#2j& L  @ 0^ ,/*J` *&$!&$ ( J@ *J` /`?' '  @\ 032& L/J@ /+J` /'$!&$'' ( J@ /J` /`?' '  @) 262|File modified since last complete write; write or use ! to override263|File modified since last complete write; write or use :edit! to override㿘 2 X7 1!$ "!! *` * 8``  `@   ` # @m  @B264|File modified since last complete write; write or use ! to override㿘  X   `H@?  @265|File is a temporary; exit will discard modifications㿘 "   `@"  4  `2 @  266|File readonly, modifications not auto-written㿘  `X !$ " !! *` * 8` 2"  """ *` * 8`  @Ւ    = 㿘 `@e` & @t &  @ 㿘"8 " "0"0 *` * 8`   @.& ?2 1 "@ݒ 1 "&!@ B  ! #@? ` 177|Empty file㿐@`` @   @o  ` ` @i`  &`&``&`` .` 㿐`` ``"*` 056`2@ &@ @`  @?&`$&@` `&`@i{ "` &`&`&`&` @.``?@`  &``&` .`@e 㿘` 2 ` 2  ` "  㿘 "`  " " 2  ` "  㿘``; \*` €@' &@ `@(`  @ '&@` ` @i `  &`&`` &``  ?@    &` &`?`&` .`@eA xxP㿘 "`  " " 2  ` "  079|No non-printable character found㿘 `@k͐ @ @N  @J  @F  @B #!! b @,RbS R@:  ,R ` *  `LJ`    ,p  `L @J`2 ,p p  @  㿐 h " !` !  2" 2   b!*` * `# #b㿘  ] *` , !X@   - ,@`  㿘@ 㿐bԀ /b`. (8b``@" b"'/``@b" bxbx`. (8` 1@ `@ LH L/`_  L   2b ^/`@ ?/`I b"bb`(( 8! \ȱ6  \/`/`   8 8  (@6`?'` \ x/`/`  @0@ /@@`/'`)㿐" /a#@:ɖ   㿘 a (aaa a`2 a 8 aa ("&$aa@ @ `@* @@ "aQ a .a*"@ "a* + " #H*` @g* $aaa*`" a* @0$a `"$ @$`$ `$ ` $ `$ `$ ``$ ,  'S   'R  $  $ , ՠ  㿘`  ` !  `@!!! "@@ `@ @@!!*`" !* $!*"@ `*` # -` $ @, ` 'S   'R  :$  $ ,  0@# `$ `$ ` $ `$ `$ `$  h`   @2p `A6T "xՐ 2b x1 2Y `?` #Г*` €  @RF   hT "hTg 28 A25 * "@*` ` ` &@`&``&`` &` `&``&``&`? $$ $\ ` Y`L"W ` L`  ` 2H @ : I  #\ @. Ԁ 5 $ "$$ *` * 8`2`| y ` 2!! "!! "!! * @*`8 * *  _* *` *  Y* &`L `  `2@* a@&@`&``&`` &` `&``&``&`? $$ $"  "L  2  a .` &`.`&`} * "@*`  @0S `? "@`$$  $  # "## *` * 8` J F  @K> xؔ  2     (T `"(T3&`     " ݘ  2&    Ԙ   * "@*`a    Ř  "       O &&&&&&&&㿘   "  @$(   @$276|Unexpected character event277|Unexpected end-of-file event279|Unexpected interrupt event280|Unexpected quit event281|Unexpected repaint event285|Unexpected string event286|Unexpected timeout event316|Unexpected resize event287|Unexpected write event㿘`?` .*` "x € !h        0 P p@ % ` @` @`--.T---.T.T...(.8   """  ( (  㿐 !@*`.`" "**   '!@/  2$! @YK $!   ` 㿐 '@ ` @ 2 `  @W  ' 㿈`K'H ` 월 H 2H$@"#` x |`      @`2@ `'? ;`H@" "@'H`H 2&` *&` H ?`  ? 2H H@ 2'2&  &`&` &`' `& 003|unable to delete line %lu㿐  'H ) @ @ Ӓ  29 H  22 H@ H ''    H H@    @($   ?$  X " X@" X`, XH @ 004|unable to append to line %lu㿈  'L Ԕ J L ?''   ? L L@@  4  @*$    $  X " X@!ɐ X`, XL @`L@ P L@   2 L@B   005|unable to insert at line %lu㿈  'H v F H ??   ? H H@ c 1  @:$    $  X " X@!l X`, XH@ H@ H@   2 H @    006|unable to store line %lu㿈  'H  3 @ H ''?   ? H H @    @"$  X " X@! X`, XH@] H @ 㿘  ` ߔ  2  $@  x |`"   `?   `?007|unable to get last line㿀 `2` ꮔ G  &@$@"?  x |`" 6 ''`  ?    @ &@ &@ / ,  ,  , $`$`$` $`$  | @  &@ 008|Error: unable to retrieve line %lu㿘H@U 㿘$ 2&  @   "  2  @ 2    @009|Log file㿘 &`$&`,&`(&`&` &`0 "! @ &`  @@  `X  .`X㿘` "` @&`` " @\&` &`$&` &`,&`0&`( 㿘 X  , L",P "0 ",P @"0/usr/src/usr.bin/vi/build/../common/log.c㿈     @+ "& $   ,*  @`  ( ''  ''   ? (  $ $$ (c@̔ ð 㿀 'H X " ,b ` , X  2X $ ,H Ԙ H`E  ' '  29    (   @+ ", $  H*  @`   @` ( ''  ''   ? (  $ $$ (c@`! 㿈  X " ,; V  23 $ ,    @+?  "' $   *@  @`I  ( ''  ''   ? (  $ $$ (c@!W 010|Logging not being performed, undo not possible011|No changes to undo`  `X`@  `( `x @ 0c@!z ,`X`( '' `(`$`(   ?`[!*` €"`( @_Ք  `X `P,`X @_̔ U B  d & dĒ @_  Ė 1  \ & \Ē @_  Ė?    XĀ "`( `& X & `  @_ؐ''@  `(@[ `X  ,`X@x@ @@@@ A$A012|Logging not being performed, undo not possible`  `X`@ ~ `(  `x c@C!q ,`X`( ''`(`$`(   ?`S d*` € @_1  L@2 `X`( 2`( `XB  @_!  L@"`(`( `X` ,`X3$`( @_  L@2  X   X "  `& X & `  @^ؐ''@ 2 `X`(@[B `X  ,`XCCTBBBBCC013|Logging not being performed, roll-forward not possible014|No changes to re-do`  `X  `(`$@Ȓ @k 0c@"I} ,`X`( '' `(`$`(   ?`^#H*` €"`(`(`$`( @^}  `X `P,`XĒ @^t  Ė ?  \ & \ @^c  1  d & dĒ @^U  Ė    XĀ "`( `& X & `  @^>ؐ''@F  `(@Z `X  ,`XEtEFFLFFEtF015|%s/%d: log put error267|Log restarted㿘!#h@)Y @Ƙ   @ @ exnexnviewviewc:eFlRrSst:vw:only one -c command may be specified.only one of -r and -t may be specified.only one tag file may be specified.-s option is only applicable to ex.window=%s0(h !&(h(  ",&(  0!,  |  & & |& . p& 4&!0`& & & & & 0&!,&!@@&!D   @`  @` @`(    @ "(T   @&(T     7!`80!*` €!  "!(&! %`(T ?!&(T  t r  rt "!  t  ` "!( 0@/ 0?ƒ?a`*  `  @   (T 2  @!  `  "@"` 2 & "`}& d "d ""` 2 & "` 4&  f    6 ?Ȁ )"@` 2"@`?"@@  L `!@!2@[''''''@ `   @0  (  @*  C  @$  G  @  "  "   * * `8@"4 ` " XX* * `8@`"8   r}  d& r  2 `@  ~ ` X* @*`8  2 "!   ` ?"d "dש   ( "@[= @W   & "! @ ` @x" $" (rd "d " 6$`2 @ Ȓ   |$@   2 7 n  | `d&  @ d ] [ $`!@ @Y ؟@ D B  2(d耢  2(d ?" `  "`") $` @`ѐ  2$  @ hh@   @FKKKKKKKJKKKKKKKKKKKJJKKKKKKKKKKKKKKKJ\KJxKKKKKKJKKKKKJJJKJJ%s%.*sex/vi: 㿘   . @   @  @  @ @  @(T !@3<b l !b%#  b  @3)` "` " l 2 ---c$-s㿘)' (N+L +$L  @Vn  '&@ `* `* `*8*@Yې@V^  &@ - c**@ )` -2&`L   c@VI   &@ "! @*   ( * ** T t w2`J` "``@ " @` 2@ %s: %s 㿘!a@2a@2` ! "a@Ԡ!@2@2a"`8 㿘 `8"``"` @@V"`8`2@ 017|Mark %s: not set018|Mark %s: the line was deleted019|Mark %s: cursor position no longer exists㿘``" '@   `"`*`#  `" ` "  2 `` "*` *  !X@@  & &㿘``" '@C  %@Uq    @ / 2 `8 "`8"  "`8  8 " "" $"  2     $ , $  , ,   8  *2㿐`  ` 0<@U  8 "6  * ? `. &  2 ! D  2  o      8 "     &  2  020|Error: %s, %d: : %s%.*s㿐'P'T  'X` C `"@ ?: `7#*` €$ / $$  8$*` * `$   T $T$$  8$*` * ` 0$  $@:b@US:b   "b$   ` `t@hT >"hT@T, '    (T!' @# "%b x  t x@# "%b$ t t x'(T!$(T` b@ @Vΐ @ ``@ <; 7L $ " ` "* *  !X@*`:`r@ ' L  "@@є 'n@0 "@@0P^' X`2  "a!$@@"Ȗ@' D   ?  .ڐ 蔒 !bД@0;   ` `t@hT >"hT@S%b[D\[\[㿐! "0 !@$!    ` `thT >"hT@Sa aa````299|yanked298|shifted297|moved296|joined295|deleted294|changed293|addedaHa8301|lines300|line%lu 㿐$@#  & X# * * `8@# \  ,    t   ,"@0    "'(T!"  x' @"N" y"  t x@"B" m$ t t x'(T!$(T!,`     9 3" ; , , ` !X@` ` @ ' @ @@UL ,@ @ @U?`@  $Ȧ , `h    ` `thT >"hT@R317|%d files to edit021|new file022|name changed023|modified024|unmodified025|UNLOCKED026|readonly028|empty file027|line %lu of %lu [%ld%%]029|line %lu㿈  @U` '  * (Ta  ' @! z   x  t@!| x m$ t t x'(T!$(T  L@ , @  * @ *`!] '*:`c' @ ` *`* *  !X@:`Z@T`L@` @ :, ,$@' $ #@  `@   `H@ @6@U; :, ,$*@&$ `  ?# @2"````p@@T;   ,, ,  X```@є@T   a  ,, ,`@@T  "쀊 " "" *` * 8`0  ,, ,`@@S   :, ,,쀢 |쀢 `Ȕ@q@S" @e`ؓ.`@*`@*`@J@0 `@Q@u@Tz ,$'* 8@&M /   L /2 $@8  .$? ,?,?,?,$' h    ` `thT >"hT@PېLC_MESSAGESLANG%s%sVI_MESSAGE_CATALOG030|The file %s is not a message catalog㻀@ / "#L  2@QB#` K  @Q8#p K  x@T$   @!  `\ 2*"`\*   ?'`  2` 2 `c@  " `@`\ "`\ 㘒  0  h "`\ @  " h㿘 h  @268|confirm? [ynq]269|Press any key to continue: 270|Press any key to continue [: to enter more ex commands]: 161|Press Enter to continue: 275| cont?271|Press any key to continue [q to quit]: 㿘`"#4.` €aa a b8bXbh@@Pnnnnno㿀 L@ `9` `3` `-N` |) ?@'䀦    "` h   2`  ?& *? `@R&㿐&L   L@ J` " L L  @ J `2 L  2@Oq ` `thT >"hT@Ob  @O5 + .&  (T!" x!' @z 1  t x@n  1$ t t x'(T!$(T17 p &L `(?& `*` * !X@*:`TJ@ `.J@ * @ L  * .{H{8{({{{zzzxzzzzzzzzzxzhz`zPzHz84z0,z(z 4zzzyyyyxy4yxyyy<yyxyyxypyhy`yXyPyHy8y(y yyx@xxx@xxx4@xxx xxxpxhxXxPxHP x@ x8 x0x(xxxwwwriteanywrapscanwrapmarginwraplenwindownamewindowwarnw9600w300w1200verbosettywerasetimeouttildeoptersetermtagstaglengthtabstopsourceanyslowopensidescrollshowmodeshowmatchshiftwidthshellmetashellsecuresectionssearchincrscrollrulerreportremapredrawrecdirreadonlypromptprintpathparagraphsoptimizeopenoctalnumbernoprintmsgcatmodelinemesgmatchtimemagiclocklistlisplinesleftrightkeytimeignorecaseiclowerhardtabsflashfilecextendedexrcerrorbellsescapetimeedcompatibledirectorycommentcolumnsceditcdpathbeautifybackupautowriteautoprintautoindentaltwerase}}}}}} } }x }p}h}`}X}H}@!}8$}0%}(+} )}/}1}3}9|6|7|5|=|<|A|;|>|>|H|M|H|J|K|Lwswmwlwiwawttytypettytstotltagswsmdsmslowshsectscrroreparaoptnumodelinesliichtexedebdircobfawapaicdpath=%sCDPATH:directory=%sTMPDIR/tmpescapetime=1keytime=6matchtime=7msgcat=%s/usr/share/vi/catalog/report=5paragraphs=IPLPPPQPP LIpplpipbppath=%srecdir=%s/var/tmp/vi.recoversections=NHSHH HUnhshshell=%sSHELL/bin/shshellmeta=~{[*?$`'"\shiftwidth=8sidescroll=16tabstop=8tags=%sscroll=%ldwindow=%lu031|Unable to set default %s optionhР?'''' >  @  e#`.#   @  Z"`."   @v N!``.!` 2  @j  2B#X!`.#X@L"!Ȁ !Ж$@A@Nڐ' @ " !@L!耢 !$@&@N'@~  ! ! ?/'@N'@i  " "7?@N'@V  " "'?@N'@C ͮ (8$@ِ@Nr'@1  "P "P /?@N_'@  -"`  "`????@NH'@  %−$@@N6'@  &⠒$@@N$'@ m *"  "  ? ?'7@N '@̔ V 1"@K;" "$@Z@M'@ < 3"  "  ? ?'/@Mܐ'@ % 4# # ?/'@Mǐ'@  5# # ?7'@M'@q  8#( #(7?@M'@^  ;8$@@M'@L ""֮ = "  * @*`8 ?2 '̀ ̐ '@$@А@Mi'@( "  /h`€̀ 2 ̀"X$  " " " "  *` * 8?'P$@@M9'@  H""`_  !     O  "" 0G   @  @ >  " @? * * `8@ @x ,  "@?*`  * 8`    "  * * `8@ @T + @J$  ` @?"@* @@ @L'@} 2 @`@?*   "- `Y  all032|Usage: %s291|set: the %s option may not be turned off313|set: the %s option may never be turned on034|set: [no]%s option doesn't take a value035|set: %s option isn't a boolean036|set: %s option: %s037|set: %s option: %s: value overflow038|set: %s option: %s is an illegal number314|set: the %s option may never be set to 0039|set: %s option isn't a boolean㿀  `  "@#a 2 $   L " = ?2  =`Ò   L ꀢ =`'-@`@( L n L o  '@ @kR b% :`,*  `2 ` 2  @ `?2    "  0-   "᠀   "Ѐ"` 2  ,*  a "   *` * 8`   *  a "    *` * 8` 2     @    @ܘ     2²  4 2  @&/ 2  ( 2  2    @   @  " 0` `L @ `_@n `N"䀤` ` ` "X "p @H9    ` `thT >"hT@G䀢 뀦   ` `thT >"hT@Gn+ J A ? "> ͐Ȑ" Y耢    ` `thT >"hT@G>䀢    ` `thT >"hT@G*  @   "XȀ  ,*  a    *` * 8 @À   @ʖ 2     2   2 @% 2  ( 2  2   "  ` 2 "   s- 2. ,*  a "  *`  * 8`   *  a "    * * `8@@ђ "F   @J 29     2.  2& @$ 2  h 2  2  @ " @F `2` @|㿘.`*  !`  @ * *   8@ @ې       2&`` "&`@F&`&` 2 &@@ "&@@E&@&@ 305|No %s edit option specified㿘.`*  !`    * * `8@ J 2 2  ".` %  %ld%*s  5  8@?, ?  8  ? @?# 'l   %`: `, ``"0`  ,* *  a   @  * * `8@@ *  a "   *` * < ܐl* אg* *  a   @  * * `8@@ *  a "    *` * < *  a "   *` * <`3*  /*  a "    * * `8@*  a "    * * `<@@Q }*  !`v* @E* @ ! ,!@HF` `.?S ! " @@ *` * 8` "A@? !p%#`  @ * * `8@@  @ { @H' ! "@@*`  * 8`   *  a "    * * `8@@G?l/`" `* " l'l `=@ @>@. 2`   @,l"/%- `' , @*`@=@@l %"Ȁ&ߠl @%",``*`@@l@ l%l@,`%ȁ%s%sno%s=%ld%s="%s"㿘"&@`: `+ `"A+`0q+` *  a'"0   *` * 8`  '  `"'"8@ 0M+` *  a'@ "@   * * `8@   03 *  a'@"H  *`  * 8`   ` *  a "    * * `8@"Yset %s set no%s set %s=%-3ld set 㿘"`" 2  %`):  `>,` ,*  a "@ @  *` * 8`( ( (`P(`X@ɐ` ,*  a(  h@  * * `8@@   @` *  a "@ @ *`  * 8` `  (`x@-  \2`` \?`&``@ \@* &@@`?`&``@ @* &@@ `L@ Ӏ ` =?`&``@ =@* &@@*  a "5   * * `8-@  \2`` \?`&``@ \@* &@@ϒ`?`&``@ @* &@@༒`L@ Ӏ ` ?`&`@* &@ @੒` @ 햔    2  㿀)cT"8' %@2  1 * "7')"P' N@   0(' @E  JL & 4@  2 `  " JL & 033|set: no %s option: 'set all' gives all option values㿘)t 㿘@g@㿘@a@㿘`@D#"`  a  ,@2l @ 2h  @  `*`` * 8` 2 @      F " `* * `8@      ( @ "`*` * <`2 @ " @ " `* * `<@ m  졔  `  M`㿘"   !  ,@2F @ 2B @ "*`  * 8`  @  @ "  * * `8@@A^ @ " *` * <`2 @ " @ "  * * `<@@A>`  M`㿘  B    040|Screen columns too small, less than %d041|Screen columns too large, greater than %d㿘*    *H ! 042|Screen lines too small, less than %d043|Screen lines too large, greater than %d㿘 !*В   * !ڰ 0   `?$`  & $X * * `8@ $X $`   *@ *` <  $\  *@ *` 8  HS (P  H   a H  [ B $`2 ` & $X * * `8@ $X $`   *@ *` < @ $\@  *@ *` 8 ? ( ? H  !? H   044|The lisp option is not implemented㿘+@  㿘u 048|The paragraph option must be in two character groups㿘@Cs +   㿘)$ $$ $($"$ 㿘$@  @p $*@&$$ @@pu $ *@&$ 䠐   049|The section option must be in two character groups㿘@C  + Pʒ  㿘      㿐 (`€   $@8 㿐 (`€   ;P.@  㿐 (`€  "@@   *` ( 8: 0    *` (8?" " 053|The default buffer is empty054|Buffer %s is empty㿈`H ! `2A,+   L `  *@  ` !@`` `  `@`` 2@`2,`!ؑ*` * !X5 b  '`4 2X  2``   \ '`& \ '' 9 ` $B? `' '   \ '`& \ @ '   ' 쀢 2     "(T!   ' @ 耢 U  x    t@  x "߰ $ t t x'(T!$(T쀢 @ @@˔@@'@@ 쀢 `?"  ` '` @  P  ' `@@@$ ~  X y  `& X t& `` $'쀦    "(T t@2`(T >'(T` x@(  t t@ ' x "h ' t t x'(T! '(T @ 耢 `@`@@O`@@H` ߫$ 2,  X " `& X & `   \ '`& \В    \ & \     ` `t@hT >"hT@=%s055|Files with newlines in the name are unrecoverable%s/vi.XXXXXX056|Modifications not recoverable if the session fails8 *y T." " "" * * `8@@ " "!`.@ .F 2..? +.@j֒#N` N .$@ܐ@!?.@?z@Ր &`L  @.  `X  @.`X057|Copying file for recovery...058|Preservation failed: %s059|Modifications not recoverable if the session fails㿐  X @, XB  P `0, X @m 1. +. .(h b  € . L  hh  . hh   L@jE! X `@, X砒  060|File backup failed: %s061|Copying file for recovery...㻘 "| X @ v ` €  / X ,XLp跒 c `` X ,X`P@`K  *k 2D " " "" * * `8@.$@@8!?'/ (h` L@  @>  @ " @@>z  hh  ` ` L  2 062|Information on user id %u not found%s/recover.XXXXXX063|Unable to lock recovery file%s%s %s%s %s %s %s%s %s%s %s X-vi-recover-file: X-vi-recover-path: Reply-To: rootFrom: root (Nvi recovery program)To: Subject: Nvi saved the file Precedence: bulk%s%.24s%s%s%s%s%s%s%s%s%s%s%s%s%s%s On , the user was editing a file named on the machine , when it was saved for recovery. You can recover most, if not all, of the changes to this file using the -r option to : -r 064|Recovery file buffer overrun065|Recovery fileX @\@}ޠ  /\   *g 2 " " "" * * `8@? /$@@1!ؒ   ~  /)  2 @%T %P   L  / @9 `!?"@#@!@/##d//?cp##`#h#\@//#c#l#p#x///#t @cX@6@<n0@*@00000`(H` `#`#p#x#\#h#l#t#d0`#|#0`##/00#`@d 0婒 A , <@@’ & <N 2& <8N .&@<20٢ ?@@ @<͐ 0 l    ?%T @< .recdir: %srecover.r+066|%s: malformed recovery file%.24s: %s vi: no files to recover. 8 *H ""  " "" * * `8@@gӐ  11@!p   1x` x 91715/3//1d-1!@&  ]@䥒ᘤ WT  K   @H0I$@. !@@  @  $@ cX@   @ 2* 0,@! "$!@ \  ! 2T@90 T@4{ @@@@  `1@!@ %s/%s067|%s: malformed recovery file068|No files named %s, readable by you, to recover069|There are older versions of this file for you to recover070|There are other files for you to recover('H *t ""  " "" * * `8@@+ H.ƒ ?  ' ''1a@W  2 h$@ @ Д   r       ''@;o0$@ #/c@@#  2@( $@ٔ /cX@   2@ 2 ,2 - p0N,@! "$!@ x   '! @R0;@ 6@3 `'*@t  㵔 @h  ` 㪔 @8@8@8'@:@:@w Q @v  2 ̰ 01 `2Ȑy  2p H  @8_@8]@:   "`P"`TH!2 `X  @*`X?c @  ? ? @:I @?@:V 4.  .o  㿘@:A?@@  "  ;   @: 0 㿘@? ..E 0@e2`/usr/sbin/sendmail071|not sending email: %s%s -t < %s 3#@ y 3  0 3@@(@ ~㿘& @ $ 2& ⾔    x   $ $ $ $ ,$ |& `$ xa$ ` "d@] B$ d "`$` $$, ``@ `$ `@% +$ ``Ā`$ `@  $ ``܀`$ `@ $ ``䀢$ *@7@ $  g  耢 2` _ 0`$ `$ @9Ȕ9 d$ @$$$  @  &@ 㿘 ? & m `"$ @ " "`  @""@$ @(&$@  2 $@2 x $ "  x@6  @6 $ x " _] x " @6 "$@6$@" @gj  ؀ "$@6$ @" @g]  " @6 耢 @65@6` ""@   "` @  "@" " 2   㿈 L ؒ 2s   ` `!@ h ` K2N   'N2 ' 2$@ K @D`@ Ě `  #\  2  \2 @J` 2 @` @*`J@ 퀦2` 2'"  Ě `  `2 `2 #\ 2 `@2&  㿀\ | 2ڰ  B @ Y 2ʰ @`20/ `  ' A  $ " $$ *` * 8`  @  `  d  t @  d @    $ `p@Ӓ l`$ " $$ *` * 8`   `Y@ U`;  "7  ? ?    @  "  ` d@0` @ & &@   ?&     (T`    ` (T`{``@ x\   "``@`('䀢 #@ $ " $$ *` * 8` @0  Ԑ瀧 '`  d  ɸ @M  d`@@ ``4` ʐ@ ƀ $ " $$ *` * 8`   @   䀢 䀢 2   @  '  ܀ ܘ ?    ?   @Ք  b +   X쀢T䀧`/-@ *  ?쀒   @ )  e d@I   쀢 `B ?  쀢䀌 &܀@   ?&&  ?'>` (T`  ߖ  +  (T`& @p 072|File empty; nothing to search073|Reached end-of-file without finding the pattern074|No previous search pattern075|Pattern not found076|Reached top-of-file without finding the pattern077|Search wrapped㿘`!8 (.` €777 7 (7@7x޳ 0@4M߰078|Searching...㿘 8h`@㿈`#\\d @Ț 2 ``  @  "  "$ @3l$ |$  @Ȓ (  g ` "!8 $ @ $  "!&$ @ $  "!`$ $  @Д $  "a @3+  @3%@3#$a % 0 $ $ , $ 2 !D`$ !D"` "aD !D $  $"`"$  J@  @ 2H  * @*  㿐#\ @&  @㿘`" "` "@ @2@2   @2@2 㿘\ 2$  C!D*@ 2< $ 28  @J  @85`*' 2# $ 2  @ 4 `& 8  " `2&@0  $@    `2&@ 㿘!D " @2]  " @2W  "@2Q`"  "` @2F"!D 2  㿘 !D  @2 $ 2}  -9 @` *` *  !X@\? `@D %@$ !9ޒ!Ȥ$   @` *` *  !X@0? ` , (@ %@ !9!Ȥ$  @` *` *  !X@? `2}%s㿘 !D2 $ :`@`G  |     'S ` `? 'R _ 2`` ?`&``@ @* &@@x`?`&``@ @* &@@e2 ` ?`&``@ @* &@@Q "H` `C  |   'S ` `? 'R  2`` ?`&``@ @* &@@`?`&``@ @* &@@ 2 ` ?`&`@* &@ @2@ " `   ?"` 㿘"*! @0@0Ӓ  ۸  &@4&& 㿈&Ԙ쀢 쀠'`?   "  '' J ? ' 'J   B&㿘@ / 2 㿘@0:  b @2̔. 㿘! "@$!&!``"  ?  㿘! "@$!&!  "   #@  @   %lu㿀`0" @` @ * $$ @  8   L  &$ ` *@  `  !@` `  `@` ` 2@`2. * * !X@  < ` ` '; `   X ̭ 2&    ̤ 2  2 ``0(`;`@U 8  ̊   㿘 !.` !`<!8*` €@- @̒@e@ @?@0 㿘 !.` !`<",` €@ @:@@ @z@/ "!ԝ㿘@ "`@ ?`, &`@ @2 `<&`H&`D  "a 㿈`0 ` *!  "a`48쀢 쀢 /6  ( @`8`0@h'` @ 'J @  `," `&`@`@" `<`4 `8@ `<`@&`D&`H 㿘@ 2  `@ `< &`H&`D&`@  "a㿈`0 ` *!  "a`4֘쀢 쀢  9  @L0  `8?`0 '` ?@ 'J?@  " `<?`,&`D&`H &`@@ `8?&`8 178|No previous F, f, T or t search㿘=XS 179|%s not found㿘 `= !* *  !X@w6 a8T@"Z h`(Xh [X rx6 D hHWxD8 KXW(DH  WxD  VD  pKX h PD@  H 8X  (   T  [H    x h 0 ( @   0  PD   ,  h @   0 R8D  =D@"  D  :C(  xnD@" h PjXD@" @ WxDH  LD   VDH  h ` @\@" 0 :(@  D , pPL, 8[@"d (` 8D hH8ƠD  F TEHUTExP) @  UEUE`@"* x`H P( 1\ F ` X8 D ( hD@ heD@ `H8D @ 6D@:B"( TD , pX 8 ƼD F 6 D *H hWxDX@VD0PD :`@"+ I XK @(28 F  <D h P8Ϡ h@ED@"x8D hPAD@"@ p  ~ reverse case[count]~ } move forward paragraph[count]} | move to column[count]| { move back paragraph[count]{ z reposition the screen[line]z[window_size][-|.|+|^|] y copy text to motion into a cut buffer[buffer][count]y[count]motion x delete character[buffer][count]x w move to next word[count]w u undo last changeu t before character in line forward search[count]t character s substitute character[buffer][count]s r replace character[count]r character p insert after cursor from buffer[buffer]p o append after line[count]o n repeat last search m set markm[a-z] l move right by columns[count]l k move up by lines[count]k j move down by lines[count]j i insert before cursor[count]i h move left by columns[count]h f character in line forward search[count]f character e move to end of word[count]e d delete to motion[buffer][count]d[count]motion c change to motion[buffer][count]c[count]motion b move back word[count]b a append after cursor[count]a ` move to mark`[`a-z] _ move to first non-blank_ ^ move to first non-blank^]] move forward section]][[ move back section[[ZZ save file and exitZZ Y copy line[buffer][count]Y X delete character before cursor[buffer][count]X W move to next bigword[count]W U Restore the current lineU T before character in line backward search[count]T character S substitute for the line(s)[buffer][count]S R replace characters[count]R Q switch to ex modeQ P insert before cursor from buffer[buffer]P O insert above line[count]O N reverse last searchn M move to screen middleM L move to screen bottom[count]L J join lines[count]J I insert before first nonblank[count]I H move to count lines from screen top[count]H G move to line[count]G F character in line backward search[count]F character E move to end of bigword[count]E D delete to end-of-line[buffer]D C change to end-of-line[buffer][count]C B move back bigword[count]B A append to the line[count]A @ execute buffer@buffer ? search backward?RE[? offset] > shift lines right to motion[count]>[count]motion < shift lines left to motion[count]<[count]motion ; repeat last F, f, T or t search[count]; : ex command:command [| command] ... 0 move to first character0 / search forward/RE[/ offset] . repeat the last command. - move up by lines (to first non-blank)[count]- , reverse last F, f, T or t search[count], + move down by lines (to first non-blank)[count]+ ) move forward sentence[count]) ( move back sentence[count]( ' move to mark (to first non-blank)'['a-z] & repeat substitution& % move to match% $ move to last column [count]$ # number increment/decrement[count]# +|-|# ! filter through command(s) to motion[count]![count]motion command(s) move right by columns[count]' '^^ switch to previous file^^^] tag push cursor word^] ^\ switch to ex mode^\^[ exit input mode, cancel partial commands^[ ^Z suspend editor^Z^Y page up by lines[count]^Y^W move to next screen^W^V input a literal character^V^U half page up (set count)[count]^U^T tag pop^T^R redraw screen^R^P move up by lines[count]^P^N move down by lines[count]^N^M move down by lines (to first non-blank)[count]^M^L redraw screen^L^J move down by lines[count]^J^H move left by characters[count]^H^G file status^G^F scroll down by screens[count]^F^E scroll down by lines[count]^E^D scroll down by half screens (setting count)[count]^D^C interrupt an operation (e.g. read, write, search)^C^B scroll up by screens[count]^B^A search forward for cursor word[count]^A㿐`0 2 " ` `4`<  NZ 2I P; 2A `Dɽ` 2 24   &`D+&`H`D     ߖ  &`D`0   >`H @ &`0 &`H`0  > @&`0 `4X#\    D@ @207|The Q command requires the ex terminal interface 㿘 (€  D(\   D L#  a P "  3 $ $$0  `4`0(`` `4p#\   @/<`4`<X#\   D @>`4`<X#\  v DH @suspendX#\    6] Dv @180|No previous file to edit Eѣ     2 X#\     -@)ېD@X#\   9   !0@)(@p#\ ;    @!`0@ `,>"@"@b`4p`< #\ ٚ  E" $ f  2?  $'4@. ! /  x 8  L &`D P$&`H@;r`4p#\`<    "`$  e՘     $'@$'`   p0p #\ , #\ G  x @&u@㿘`  €@   㿐  K f`!T "!L!L *` * 8`   @ 2i     Ԛ  2_ @:$ ` ?"`* "@Ï Q}u@=M < #` ,  & ,| `@တ@r : 2-  x 8    @Ő 2  ` $ &$@= 2 @ 2    @&㿐 L b  $ L $ P P ` $ P L`0&`D P ~` &`0&`H 㿐   @ 2= @ 4 @QO  ° 0*  "` " ` "  ` 2. L`L  "`L@&  "$@&$&  307|No ex command to execute㿐 L    L   @)K   Fϩ    ܚ  $  "$$$ 㿐 ` 2 @  2    `2&  ɒ 2 & ` Ś`&  㿘 p 잔  "        X `*X %#0*lo0x%0*lx0X%0*lX%+ld%ldabcdefABCDEF181|Cursor not in a number # +. + -( @( 00(   @Ԓ  4@  G 8 L @ `      `2w&`P@=̒ J`0+"`( J  X x2#K@ L @ `   *G!@:` EJ `XGa M a I K@ 0`` L @ ` & *:  8! 9Ga . `#K@ + - @  LG a   G @ `L   Gl  D!G !  `L03"00  ` *:  8 9' @?Ȑ 8&$ `L @ ` $`L  ` *:`@U!  $@# $` ` (T!  2' 9  x 2   t, x " $ t t x'(T!$(T @@'/- 7x|  t - |  `#" b  |`6   " W | '| @ "ᠠ|@e d$ Y @ + xx8  6 @:"/  'xx@B d`c c@&ɐ@&Đ"@@&""@"@ 4'J @(` `` `thT >"hT@"P182|Resulting number too large183|Resulting number too small㿘`  `` I0 @"I3 0/ 㿘 @!̢  &`$a,$a !H "!|@! $aD   !D@&O!H!H$aH!| " !@%R $a|   !,a!$a!$a 㿘 !0 "!D@!!D "!|@!!| " @! ! @!@!̐&  㿘`1""`H`%"#L% " ! #D * * `8@ " "" * * `8@@@*Ɛ㿐`4   2    ?& P   *`" *  `ē@x @& `4 & L쀢 쀢 2 ' `"  P @& P `0#\( `#`#d @ 㿘& P`4 P "    *`" *  `@@x @G & `4 & LH쀢 쀢 2'  " `0#\( `#`#d @2 㿘@  㿘@ x@   L `& $ 2\  2 ''D  & PJ#8` '*`" *  `А2 L L5 25  L 쀢 2,  L  Ø 2!  L & L 쀢 " L ?`0#\쀊( `#`#d @ x`0`4 >`< &`0 쀢  쀢 ܐ @ & `02`&`8! "!! *` * 8`2`4`4 " `4`4`8 2ܰ `4& L`8 & P  *`" *  ``;`2*`0`4`<@%`0" ``<`4F 2  "`0h#\ `#`#d@4 " ``4`<  F 2 `= `8 9`4 ; 2~     `8(T! ' 耢 > x  t x "\ $ t t x'(T!$(T@#`8H: 2G ``4`8" 2= `4& L`8'& P`4Ř쀢 쀢 2'* `8 :`0#\( `#`#d @    ` `thT >"hT@]x@  & `4쀢  쀢 2'!   " H `4 &`<?`0&`@(`<#\ `#`#d@c x@K  & `4N쀢 쀢 , ' " `4`0&``,  &`@ @"`8`82`8@!f3 `, "&`@ @" &`@`8 2&`@@!" `8`@ `, "`< @`4&`H&`@&`D " `< @&`8`<`@&`D&`H 㿘`, "&`@ @" `,`8 2`,@!^   &`@ @"`<`8?&`8`< `@&`D&`H㿘``4W 㿘@  㿘@ 㿈``<  2 "#`<0*`<  8쀢 2 `@쀢 *`,2`, `,    @"`<`0 &`0 `<&`@`@ "`,f @W "`< @`< `@&`DV&`H`<`42 `4`@`8@2`4@ G `4 8 `82`4`8`@@( `4&`4`@&`<&`8&`@''`4`8&`D.&`H`< (`@ &?&`<  Θ 2 쀢  ?`4&`@'쀢  `8쀢@  `0 &`0?&`@ 184|No match character on this line185|Matching character not foundpܖ`4  lԀ Ԁ  Oް `8؀ OfJ >"7 ] )" < (& { [ޔ }ؔ!| )#P (!| ]#P [!|  }#P {!| >#P <`4' 'i 2   `2`    `OÒ m `4&`< &`@2`<`8 :`<`, " `< @"`<`8&`D&`H`@&`D&`H`, "M  @"H `4`<@`<@`4  'Ѐ 24  Ѐ :`4- `4`<@`4Δ    ܐ @' ؐ"  ?J@    ؒ`?'܀ '`0  &`0㿈`, "`4 @"`4`8 "`0`4&`@&`<ꖔ`@ 2 `8`@@8`4`0 &`0`4   2`4`0( ``, @e "?  ` g h@0``"?@H ?> J  .?"6`,ۨ2٨ (ը !|J` H*:  2J` 2H "?H@2?J  `"@  2?2 `, "&`D @ &`<&`@&`@`4S`8&`D&`H&`<P&`@@B`4@@2!`,˘쀢 쀢 = :&`8 `8?@ `,`2`,@> ) @ ? P`0 > @&`0&`<` `,  &`@ @"`<`4`8`<`@&`D&`H 㿐`, `4 @"`4`8 ?`2`0@e`4  &`4&`0&`8`4 |   2s `0( ``, @i "`8 ?  ` i S@0K`"?@J ?C J  .?";&`Dݢ2ۢ (ע !|J` H*:  2J` 2H "?H@2?J  `"@ 2? @Y &`D&`H&`<&`@ 㿘` @ @`@"! @q  2  Ę  !| `@`@̔`@Ɣ&!| 㿘`0@@p`0(* (``0" ` `4`D- 2 `D`H&`4&`8 (T`2       (T`  ؠ? 㿘`0@@5`0(* (``0" ` `4`D  2 `D`H&`4&`8 (T`2   ܖ    (T`  ؠ?  `πR4( 2  3  4  5 6 7 8 9*`(JJJJKK KK㿘 h€ 186|No characters to replaceh``4 "Ѐ 2: Ѐ2 `0Rxý /  ``8`4? &`<&`@@`4 F  $`@2 2 ؐ X 2 ?` +T *` € 耢    .!<&!@d $$d @  @25 Πڰ հ ` ` (T!" x '̐ z̀ Ԁ  to x " $ t t x'(T!$(TԐ@wЀ'!@ "`4!@ 2`8`4&`@Ԑ`&`<`8 2~ `8ԐД"@'Ԁ`(' a "aa`*` * 8`Ѐ Ѐ  JԒ'Ԁ` 'J Ѐ А@" 6Ѐ "$&`@ a "aa`*` * 8`2`4&`@ "&`@`4  @ '    ?&`@   ?&`@`4     @+  !<@ `4~` `` `thT >"hT@`<`@&`D&`HLLLLMHM(MHMHMHMHM㿐`4   !G  `0(`8`@`&`@`8?@2`@`, " @2`@@1 & 􀢀 ?`,`&`@`@"`<`4`8`, "`< @`4&`@`8&`D&`H`<`@&`D&`H 㿐`0("(`<` #`4&`@t`@ 2N `, "` @" ``8`@@8``0 &`0`&`@+ 24 `< ,  "( ' 2`,`,@? @@  ?` &`@`@"`<`4`8`<`@&`D&`H 308|Enter to execute a command, :q to exit187|No other screen to switch to㿘$@@T  @" #  2 # T      "$ @ #$㿐`0(` `  ǒ 2  " @1`4     " &`<@; 㿘`0(`<`? @Aj   @' 㿘`< @A\   @ 㿘`0(`<`? @AH  @  < @" D ,"" H 0 4@@ " 02 4 8:  4? @  8" D" H 8" D" H㿘`0( ``4@ "@ `@&`H&`D&`< @`4 㿘$@"0 @2`4@0㿘`0(`4`@` 2`,@`4   &`< @"`<`4`8`<`@&`D&`H 㿘`0(`&  `<@;Җ   `< `@&`D&`H㿘`0(`&  `<@;   `< `@&`D&`H㿘`0( ` @   ""$`$` @  $X8*` *  0 $X @T  *` * 8   8$X* * @@  $X@;  ?`<@;k   `< `@&`D&`H㿘`0( ` @   ""$`$` @  $X8*` *  0 $X @  *` * 8   8$X* * @   $X@   ?`<@;  `< `@&`D&`H㿘`0`<( `@;   `< `@&`D&`H㿘`0`<( `@:   `< `@&`D&`H㿘@" 㿘@ search+%lu188|Characters after search string, line offset and/or z commandx`0@   @ p` / ?#@ "#8#8 *` * 8`"" ""  @x 2߰  x`8 ـ 2` L&`< P`,  &`@ @T `< `@&`D&`H $ `$!$  !`2 L@$! L  PJ܀ 2 $ ܀ 2&`H`  "l `<d&`<h&`<p&`@`<7 2`,`< `   Ob &`H " @  @Ks`[ @L zcW L @ `    `2 Ӑ *`:  + ^  ;W   W(   25   2, `<W0@c 8   2  aȐ!2a`<`@&`D&`H`0 > @&`0  8 &`H&`D 㿘 ``"     @t 㿘   @j %s%s%s[[:<:]][[:>:]]㿐 !4 `   (T!" x' —  (  t tt x 2$ t1  t x'(T!$(T X!0XX( a0@ : @@    ` `t@hT >"hT@189|No previous search pattern㿐`,   @2  !`"!`" #\ `#\`4`<ݼ  `4`<Ϛ " `, Xܒ  @u "`< @ @  0`<`@&`D&`H 190|Search wrapped to original position㿈`4`<@`8`@@ X M "`4`0 &`0`4`< 8 `82`4`8`@@( `4&`4`@&`<&`8&`@''`4`8&`D.&`H`< (`@ &?&`<  ј 2 쀢  ?`4&`@'쀢  `8쀢@  `0 &`0?&`@ 㿐#L " #D#D * * `8@ " `, "`0 @"`0`8 "`0`4&`@&`<ጔ`@ 2 `8`@@`0 &`0`0( ``4R NJ{ `, "J @ }2 J?2<`{")`,0&` H&`4&`0&`8`< `@&`D&`Hx`8`4 '' 2ư `0( `  j   e 2 ?2[ `4@o`8䀢@k  ``2H ?2E   T 0 O0-?IҒ ݠ?B )?`T#[!*` € ` `" `` 2 ?2   T  I   `4@ `8䀢@ @J ; `,&`< /&`@ @"+`<`8 2!`@ 2`42`@`4  &`<  ˜܀  ܀  ?&`@`0 &`0?&`@`4`8`<`@&`D&`H klPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlkklPlPlPlPklPklPlPlPlPklPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPklPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPlPkx`4 `8 2`4 `8 ''l 2 `0( `  A 2ذ         {   2 p  ."  ? e !0QP ^ \> ` )" ]" "" '`   2 `4y 2t `4@9`8@6 \`` " `!''` `   ) ] " ' \ 2 |&`<`, ,&`@ @"(`<`8 ! 2`4`4 &`4  q܀  ܀  ?`0&`8 &`0  &`8`< `@&`D&`H㿘`4  㿈 L&`D P@^&`H 2Y  !`$$ L ! $$ $ P  *` * 8`2  $ " $ $ "$$ *` * 8`   #`#d#\  @  $*@$$@h   4 2`D$ @$$`D $ L`H$ P4Pa"a"a"a@"aD"a<"a@D"((aa : a !!  !"!a *a "   (.!"!@"<"@"D 㿘 4 M a& <a& Da & @ 8 < (  hl€  @ (  < *` * ?@"a?$a" " "" *` * 8` 2a @7 2  !a@a a$a 4aȰ 191|Abbreviation exceeded expansion limit: characters discarded 192|Illegal character; quote to enter㾨`xd`x` \'H`$d   @:$ (6$ $$  $  $ @ $ 5֖ " $ $ 2& " & $ 8`L $ `P$ d@ ' "  $ (' $ $ d@@   d    @A    $   $ $$ $ $d@d  *   $` $ $ $ $d    *      $ @/$ d@'' d " d|d|`* * `8@" dx`8" " dpdp`* * `8@ T ', 'd2  d@  *@'d d@'  /#/#d@'''4 '('( $`L  @&$`P a H 0@d( R 4 "d 2 '!\ `4@'4" ''Ē%!\%!X%!T@&@& ?` e!0*` €d $'$d@&n؀ ɰ 0 @4 D`d@ 2 2 !D  *@ 'd `2g d !% aT aL`* * `8@ `@aL `*` * `8@ J @" @& a a`* * `8@ a  *` * `8@ J @"  "E$ 8  $@>$ 82 @O4  !'  ]@ d@i''d @%`. "!H*   !D!H "j%!D-`!D"* #"" " """d@ -`"!D* @``"  '    $( ? '( '(`?   ' ( $ 7$ ( 2' 0''``L   `D`2 @  '?`e *` €dh@  @-ٔ   d@@]  S   $@q o$ 8@T  @  0@, 2Đ0d2 (  d@@h(d "   ` ?$ $   $ 4$ $ 0 @-  d@ (@ 7$ ,4`x  J@ @  ,  $ ,J " , " ,B"@ J " , 29  , 1$ ,J " , " ,)   a  a`*` * 8` `xa `x `xJ J " "  2 0&`|& `x@2`|$`x"$`|& & ( d `*& ` x@u 2` `` `thT >"hT@ |    @Z    `8& \` X2 `"-'         و "֐& `\  X@@@ \`X@  @  & \  & `& (X& '  ( 2! 2      X "& d    'd*    `& &  @,|  d @>`  *@ ` '` 'd@$* ($ $ ('d  $@ $ 8#   $  @  $ 8(d@(T  @  0@r, K0;d(  d@@(d  d ` ?$ $ d@@`x@  (d "    @ ߒ   (" $ d @ ǒ`x         ذ "$   *@  ?$  @+ڔ  ذ 0  @d 2   @d 2 d  W`"  <`"" 0F`}d $@ wd''   g "'  @ t  ' '`^d $@ Xd     *? $  $ ("@  $ ($  `Ed $@?@  @   $ @d a$ 8 `x@'d kΔ$ #   *@  (   @ $ ($   2  `x@d J  $@(d  @ $$  @ (   @ (?`$   $ ( J? "  "    d   ( $ ($ # "  *   @J?  @ 8 (# ( $ ($ #   *@    J? v u    ?`L ` _2'0 '0 @ c  ( $ ($ # "  *    @ L ` _0 0C J? ? = @ 8 (9#  2  `x@\d   $@8  d@@  @ $$   (" @$ (#     ?$ * @ 8 #$ #  /#d$"@b  g d@ ' d*' ^, (   ?'i'( d'd @`L  `   ] d@2d L  ` 5_12 2 T   0@9, 0d @"  (  d@@(  L  ` _  d@ݔ `   (?`$ $ (  `'@t '"@'b$ $ d8@ H0 0 "     ' '       J "$ d  'd  *  ` $ $     '  'd@$2 `!`  @)Q  h  "!\`!`2 '@b Y '!\ 2dT d@4   @' @ 2 `!`2# $`L @ $`P@  - #  H@# " d@(Ődd*  $d%!Ld@   H"`D H" H@ x \ p@@ lxH||0|0P|x|D|x|x|x|x|`㿈'``$@ ` 0  ? , * L ` ?_? ` ? `2?_"?? ` ? `_  2?"``$2 @@  D'@'@ 2@ #\  C 4/    2+      " `"&` *` `(&`("  ``(   @ @ `( &`( `$@ " &`' 㿘` ` J  2``  @`$@2@  `$@2  @  ? &㿘&``y`$ u` q@8#&`&`k&` " ## * * `8@` `?`  ` 2 2 @& ?`? L@  @ ꀢ` <  7 @ޒ&@ؒ&%$@ "" %@ $@``"@"`&`&` ,@`  ,@` &㿐'P`' A  nP P8 'P `? 'P J@ "P P@2        '  "  @ % @'   @ ' 193|Already at the beginning of the insert㿘2 4@26f / ( $  2  *   `$ $   ?&@&`"`@"@- `@&   㿐#Ā " ## * * `8@#| " #t#t * * `8@` @  `J  @$ ` * @ *`!]   ``@ @Ӓ%@@̒$`$ `    (`` `(?`$`&` &`(`J? "` "`` @  `J  @흒$ ` * @ *`!]   ;``@*`   @~$@ @x$@$`&`  /@S ?  /@G ? 㾨&`  ` `` ` ``` L@  2` ```$  $@ ͔` "$ &`` * @,@#\    + C2 2 C֖` ,@ ,@ " 6 2  d@ @@@[@ R@  <  @2ΰ  d@Ȱ &@ϒ 2 ? (`-  `* ?@ @ 2 : @@@  " ݠ`@   ` ?,@`` ``("@&`&`( `(  ?,@`(` `&`&`(`2 + ```  $@ ` "W &````@` &`&` @@??  ?,@?` 29 @H 21 <  2* `( ?` ``  $@ ”` 2&` `` `@˒` &`&`(` / &`,@  %s %s%*s 㿐'L @'H@R / L@H$L` `$H`*  L@@  H `%L @ @  * @ *`!]   c  2 8`ߤ@릒 $ "@ *&$ '' 8,%in@H` hT`"    ` `thT >"hT@Tf @U?H@  @NH@^ 2    Ji :;i9i7iL,`%@ahl    ` `thT >"hT@T (H@@ !&hKT` Lih^T`* iahST`2ThrT ?%T $ &$ 㿐` 'L!]J@ ؀  @`L@! * *   '(Q```   `p` 2&`K `  "`L@ @@u``&``(L@`&`(J`  $'L , ` * *  !X@IL 'L @,` ` $L+ `@#] 㿘@  `2`& L & L$& P @&$㿘` ` *``J   @"``$@J  2` ! "$! @u ! 2`(`` `"* `* ``"`" &`&`*`("` `` @ݒ` "  ```(  @Ғ 㿈@`( Ȑ?&`(` `*@ &` "`` '` @ *@ `@ ``*@*  * a] @ '~ &`(`J`   `@ ՘ *  * a] @p'"c'" 'V``   `R` " &`"` @ `(@` `@W ``(@`&`&`(J `   ??(  *@??`*'  * *  !X@@ * ?`?    ?*@?` ' `( `"  &```( `  @ "'```    `` 2&` ``  &`2``` @  * ``(  @ݐ ` `* `&`㿈 4 2M 8`4 `8&`D&`HJ?`\2 #p" J? \2 #p " #h#h * * `8@ @J "`" `4@J?`\"`4`8&`D&`HJK? 2 "`4K? \"  `4 `8&`D&`H o.!Ȑ`3!$* &$ 2b   @`4`8`D H`H''J / #\?`D  #\?`Dۚ 2`D& L`H& P . a  @ )  .` 2"  ?Ȑ# @2$  &$@& a@  @Ζ 2  h€  㿐@$`'``` 29  `@!  2/ ` x@@$`'``  2   `@   "@  @@ $*@&$ Unmatched %sx`& L`& P@_  2{ ؔ @)  2s ``?' ' 2g `) { ( %mq N   `` *` *  !X@w6 > ڠ ِ?؀  ܀@*'  & P& L@ 2 "P ""H"H * @*`8 * *    *` *  *   @ ` `H @"J"`$@?D"I  2` "`"`$` 3  "` `( "`(`  #``( ` ` #` #` `(` ` #`#` #`(I   ```#`@#``$@2? " 㿐( / @ x@2``, @@ &(8  ٘ @@("@ " & &&(194|No more characters to erase㿘n0^ 㿐`0 `4(#`8!``&`H *&`H#@$@&`H? @O ` 2  `  ؀ ? @  &`D 㿐`4 l 2!  `4`8`0  `<"`@@ "`< `< ܐ 㿐     (T!" x'    t x 2$ tF  t x'(T!$(T@@`@  L@   ` *`@ ` / * u 2    ` `t@hT >"hT@㿘&`H   X`*X R"4㿘 , "a  X 2`0   *X@4   "44   `D ֒`D@195|Movement past the end-of-file㿐`  @@ o @̔ 0/ 196|Movement past the end-of-line㿐`@  s `?@o @ 00  197|No cursor movement made㿘o 198|Already at the beginning of the file199|Movement past the beginning of the file㿘`o@ ooҒ 08͒ 200|Already in the first column㿘o " J     201|Buffers should be specified before the command209|The file is empty202|Already at end-of-file203|Already at end-of-line204|%s isn't a vi commandWindow resize interrupted text input mode205|Usage: %s㿘.p". €pHp ppO 0  pF0 p@ 0p(: `p̝㿘@  㿘@ 㿀`0( ``4`8 '' 2   '  !`,@ ? @ `a` 2װ ? ??!%5?     2 `,` `P@Y@0U  l נ?h`,    L ` 5뀢_ 5 L `_ 0  `_ 1 S :   ހ `,@? P!P2 `,P "`,O    U   ?`, " @`4  `8@`4" `,&`<  &`@ @ 2`,&`@`, " `< @"`<`4`8`@&`D&`H 㿘@  㿘@ 㿀`0( ``4`8 ''v 2ǰ     2      ג 2 w w?r  n  2 E t "\`,?    L ` 5뀢_ 5 L `_ 0  `_ 0 E ,   ހ   "`,A    b   ?`, " @`4  `8@`4 `,&`<` &`@`@"`<`4`8`<`@&`D&`H 㿘@  㿘@ 㿀`0( ``4`8 '' 2     2      U 2 w w? ~ n  2 E6 k \?    L ` 5뀢_ 5 L `_ 0  `_  < ,   ހ  3 6       ?`4@  `8@`4 `,&`D&`H&`<` &`@`@ `8?&`8 206|No characters to delete㿐`4 r   s7  2 `0s/ , (`@`? &`@`@?@*`8`8&`@` &`H`0" ``<`4 2   㿘`8`2`0:' ( ` "@ &`8&`8`@ `8?`0&`@b&`H``<`4  2  c 㿐`0" `3  `4j`< 2# `4 t `<`" @ & t`D    `0   >`H @ &`0 &`H 㿐`0(` '  ؒ  `4'`8&`D`0 *&`H` "'`$` $X * * `8@  ``$X `"  * * `8@&``@~ 2y ` -" . + `K ^% `E@H = @B 7 `0(@9  2Q `D @"> &  <`D `0(@# 2; `D @"(  23 `D@   <`D @0 # 0" 'S 'R  ֐   `(  0 @    4"<@"D"D"<< (a("a@"㿘  X`    +      Œ  $ "$$110|Vi command failed: mapped keys discarded231|Interrupted: mapped keys discarded236|Interrupted0`  L@0` @h$0  ``  h  ```  h`Ȓ`40@ 20` L@Ȑ `Ȑ "0d``Ȑ("```Ȑ >"`0 ! "*D % "0 " @"$H0!" D0D@ @$H @ 4DzH )D@D$`LH$`P0@@@  @ 'P  " `  uH `(T`2`    2d`(T`"d`T  "T uxВ duɒ d@*@ $d` `` h`Ȑ`4@  2+ d( 7`$d` h  (T 2&d "`&@ `  *`" *  `2 Ȑ @  2 Ȁa?" @ 4Ȑ $`@^ 2 0!` ?Ȑ# @4Ȑ@`T` *`" *  ` 'f X' | `>!$(  L@`` @` w Г*` €=~ ( @ "'0 cX "cPcP`*` * 8`2 0 "0 `*` * `!X@B  @  `"`(p`0 $0`L'`P'`L$4$D$<`P0$8 $H$@``@֔ "0`(T`2`    Ґ`(T`2`ː0 ((2`,<? $<`, $`,(@€ dF  @"   @#9  W&     h4l,  ~ change case to motion[count]~[count]motion234|Only one buffer may be specified208|No command to repeat210|%s may not be used as a motion command211|Already in command modexب@ `? @   2& &&&&& $&$耢  쀊  '@ "0뀦      @  耢 쀊 2'@0b.&0 @  耢 쀊 2'@ L  `  0 @Z װ 0 (&0' @  耢 쀊 2'@'"4 0"  w0   @d  耢 쀊 2'@0b.&0 @P  耢 }쀊 2'@  ~  , * `!X@ u =, "@ D .0("'0& 7&0  ~@ X ~2&( d "cc`*` * 8`w&( w &( 2F0 . , * `!X@q耢   Ő& `t``,! 2 `00? `&0&( @20wXX(h&`0&`0".`@q L hD2" @b:@ @  耢 쀊  '@0".&0 `[`]`Z>z @{  耢 쀊  '@䀢(2 ~ d "cc`*` * 8`w w *  +  z8 @=  耢 j쀊  '@.L `  @ j 0 &0 @  ]耢 G쀊  '@.  w` !x*` * `!X@~= 6  @  *耢 쀊  '@.@ @      " `0 w   d@ @0#  ?????????'  @S Lئ@ '؀( 0( '@Đ0'ؒ w(d'&0@(w0` &0 L &4&8  L@   &< < I c !Cs&@  ?m&@( 耢@'?!&(  0  !А >&0`ؒ ~ L  P'''''''@€ 2O < `<  c !  : &@`&(0 !@!&0&0&,䀢   耢@( &4&8&< &@&4&8&<&@&D&H( @ @ L&` 214|Windows option value is too large, max is %u㿘  (€  2r (\  $ " `  $$"  * * `8@" $a !`  $ 4!X * * `8@!X $`  $ 8$X * * `8@$X 4$ D$ <@ z$ <$ DHΒ  4?$ @$ @ $ Ha @  "a <  *` ጑* ?@"   L" a"  a"$ $$aȒ`4aȐ   %d screens backgrounded; use :display to list them㿘 ``, ` ! "@x "!@` $`  "` @ $`"@$`$ `@2`$`"$``ڨ `@ $` "` @ $`"@`&` & `2` $`" $` {p?9 212|Cursor not in a word㿐 L  2j   P L @ `         `2  { C & P@   @ L ` _   L  :"  ` _   ""'a4 a0a4   $a0 a0@@a0*@㿐@ D S C $0 Y  _0  c $ d _ c y/.@     @=*`"@235|Number larger than %lux/ %|, *  ?Ѐ! @( 2#  L  f?  @  `L `Ց, &  㿘  2* ?` ! |"x*` € 2   hd€ 0@ ޖ  ` ʒ DDL,````lL%7lu $@'L'P !\`8= $ "` !&@ *` *  *  *   @  4 :  2" `L@ `'T "   tpp a &@ *@ *`@ *`@ *`@ 萟:`@ lh"  8" *` * 8`2 ` `" "`` ?@璐", " "$"$ * * `8@'`'`$@.'\"`  '\" *` * 8`0" @ `x|@@ 8 XLh _L T@ L@T !&@ *` *  *  *  L : "@ 8P"@"T`q`&`&` .`/.`" \@  ~\ `" $  , *  !X@T ,  * a] @@Xl@萰 tp08`T &`  l` "``3'l" *` * 8,` !@ . "+"@@2&"    l&` .`"` 'l" *` * 8`" 2 8@L 8"    " *` * 8` 0K" H >l   !'l`` #Ā  # * `8* @ # *`  * 8@$ *  * a] @h  lS 8l$?'lJ$@ Cl   !'l`  #Ā  # * `8* @ # *`  * 8@ָ$ *  * a] @W h$ 8h  ll$@?'l&` .` &` .`L`T@ L@ T P@  "@T + h hx'X'dަ l   $'l` ! #Ā  # * `8* @ #*`   8* @M$"   * @ *`!] ""   2.`$$@.`.` $$@.` 'd&`h HT?F`$ 2 d =` !&@ *` *  *  *  L : "@$@ P$"@" """ *` * 8`2$T T$@ T` P@ "@T T`@  X9x X $,X,(h x,$Xxx ` *` *  !X@@Z   @,`h & 9  * @ *`!] .`2.`\h``?&`.`  b5X ,x$Xxx  "0 @,`xl@x $ ,X萰 tp㿀$  d  a͒`p aa@M)|" """ *` * 8`2`` "`` 2- @` 2  ( a $@ + @ *`@ *`@ *`@ :`@ @" 8 X `a@(" 㿈$  F " !`h"\!\h!\ `$!` 2h $!d@!thp!l!pK 4 @? h hXhp!hhl@ 4 @? !hhch!``^!\ $!``2!p 4 @? h hl@!ph!lDh 2Ah!` < @z!t G#@ *"@ *`" *  !x* "@  +$!t!d`$!x$!d 4 @? !hh!dc( $!dhX  4 @? !hhh€ 㿘 4 @?  萔  h€ %s 㿐$   `  Q-Qnhp 4 @? h hl@` @ 8 8 hX@훐 8 @ "hXhh€ %.*s. ; 㿈$ @ hT ` hT hd€$hT$hT $hT$@`5``` h€  v> ߀`h\  "@B`2h\  @3 $*@`&$ h€ 0`2hp@g0` @ J?` " 4 2'  'X 8`?   P@ P@   @y $P'iJ J " "[X($  J  J  2  $ N " & J " "& & 2 " "  J?`."" @' (@   (T`     (T`hh€   'H @ '!X 8  "@ 2[ 4 4.!\ 2!\ @ ? l@@k!!\`!T 5!%!\%!T!\ @@2!\!Ȁ ?!T? %!\%!T5!!\  @  4 @?  !\!T`%!\%!T (T`  x  H (T`v  H @? H ?\  ?x&=N "   ,* a] @@ $@,@X,*  !X@??  @?,@`?` 2Nx@  ,@X$@ H 2l\  l@%!X `4' p!Xt.x  &@!!X ` 4!!P  $!P$!X$`  h€  "$s @2 $!\ *@g&$$* @ '&$ (T`2#$    2$ (T`2$$" @`?`@@@@ 2< $ " !Ȑ 4!  @"!$ @&$!Ȁ "h\$ &$h\  $?# @&$!\  '!\ 4@ " ''$!T$!\$!X@p $!T$!\$!X p ` hpԟhT  ?$hThd@$@*@&$ L  !`l "(\$ 2`l@_  "`lJ h  `"  "` "@@X @V`l 2 Ȑ 4\  2 @'  Ȑ 4  @  4 '\  "@'' $T $\$X@h԰ Ё㿘 4 & a\   @@ "@ "( (t€ `  4 @? ( (@aT @@ @p 4 @?   h  4`       @fhX!\$!T`$!\hl€h `2&@؟@ o   2hd q/hT $hT   q hT $hT :`2&@+=+=+=+=+=+=+=+㿘 8`8   (\ (X`(\  %.*s 㿘 @Œ  )@7 $ @ꡔ $ $  l`2@$ l& l$ @ 2@@ $@" "@$  @:!a @¢㿘` `8  *@ !*`  *  "`   `  &`  㿘$ @  @"$ &$  "  " *` * 8`2  1" " 1"$&2 ` aȀ" aȐ `@9` aȐ 2a耦`  $  !`  @"   '$  2$`€ $  $$h$    $$!  L L   @ 24 $ @&$ D @ "  ! L@:*!@a @`2` V 4 R   < @@`@T" 蠄? < v& < @@ r@(m @5 @`2` * 4 & \  < @@W@`  a "a  ! ? < ?& < @@ ; 4 @? ( (l@ < D($ L  aa" *@ *`@ *`@ *`@ (:`(l€ < & <?" < D@8  L   L@ 0@("$!2 2 L <  2  @ <`2` 0E C??""@  @??"$!x 2r L <  2   @ <`2`* > 2;  a ??"_"@z ??U"܀ 2"    L'!`' <@S' <`2` * L 2' Lܐ(  '!`  <' L`'2` @1 <`2`   L 2 L   @- 2ٰ $ @&$" " "" *` * 8` 2t$  L   2h$  P@R a L@2* `@:&  <`"2`8  (  a" @ $`@ &$@ ڐ 2  !`@  ! L@2-$@()$ <`$@2`8᐀( ᐐ"` @ $`@&$ @ ($@  2[  !`@ $ @`" """ *` * 8` !  !""Ȁ 2  L2  P@ ؖЀ Ѐ 2   P Vؐ 'Ԕ"@ @     ? 'ؔ  * @ *`!]  vؐ   ? ,`@*`!]  `^ ` ,` * ]  "@ N "@ \"S$` '" 2   K'ؔ  * @ *`!]  )" """ *` * 8` 8  8?:$$" """ *` * 8` 8  8?:  (p̟ ! L " "  2  * @ *` 8  ?   P@" "`" * * `8@2  "   )$# "## * * `8@ M   * @ *` 8 # # < `8 "  * @ *` 8  8   8?   ".$ 8 :)$# #* $ `* `"   8   `" ,$ !! ' $   a($   @2 ?'$ ! 8Z L@T ̀?" H$ !!  ?,   a(, ?'$ !! 8$̖ ì?" Ā "$  a$ @  D @ " <@ 8( (l@ @`@ (( Ā 2  P$` &$T$ L$" """ *` * 8`2` `Ȁ  ` 23 `2`` 4 `Ȁ  `$@`@<` (̟`@w T (€ `$? >&$ȔJ @ 4Ȱ *))))219|Replace218|Insert217|Command216|Change215|Append%lu,%lu x A 4 @?  (   @   "(l  L` 8 L 2 ?29 ` *`* @ *`!]  :`})(#   bq b*  #   ` *`* @ *`!] $ :`} $8  ?`L /  9   bq(Xbl  b(Xb'L `* *  !X@*`:`|ݐ `8 *` * * a] @:`|Ɛ(X L  (l@ 8#( #  *` * 8`8## 3@ܐ L @ 2`$@ 2` ' 4 @? (  (Xb  ؐ (X؟# # *` * 8`2  #   X`2 * :تؠ$- 4 @? (#`" ## *` * 8`2 0   X`  bY(XbT(X؟㿘 " " *` * 8`2  " " @` 8@ؼ?"  " *` * 8`2 &@" "&@&@ 㿘  " *` * 8` ) 2 a a   @ 8@8@ @ " "!"a㿐` 'H HŘ` H  2'̰ ", " "$"$ * * `8@" " "" * * `8@"   " *` * 8`2  "  2M??' !`#Ā  # * `8* @ # *`  * 8@Ȑ&@*  * a] @{/ @ 8  $ @t$@ ??'E` !`#Ā  # * `8* @ #*`  * 8@J&@*  * a] @z @ 8  $ @.$@ 2`   "5@ $@'㿐  ~    ?0  T @ 㿐 ~ɘ` ˰ ", " "$"$ * * `8@" " "" * * `8@ 8@@ВQ : 8 $ `" #Ā  # * `8* @ #  *`   8* @ǥ$@ǡ$  * @ *`!] @ z?@ 8@* a 2 8  8$@Q ! ` #Ā  # * `8* @ #*`  * 8@U$ *  * a] @y@@* %?80 @ 8@  &@ @-$@ 2 ?㿐 ` `      ` @ ( @1"  < " <s @ "  L?" L ?& L"  L " L  & L!Ȑ 4!!$! 4! L2$`4!$@2 `2! !\`( !Ȱ  04!Ȑhp􀦠"00@ @ 2 !Ȑ  4!@# "   @ݢ h 㿀  <??!*??$ @ &$ jK`0 <'''䀢  2 @ʔ < 2 @`1 Ȱ '  < `'2`@ < 2 @( 2 <`8/ < !" !" !j" "    a" a"  a"   maximum option value is %d -- %soption requires a numeric argument -- %s㿀acH'  @ 2` @ 2] `&` 2 N! @&D@ ^N u2 NaH@] "  N <2  aP@R  `( 4*@  @w `!X @&@ 3J`!@&@ ) `(* N ^N `(`? `-   * `(*  &`  illegal gfmt1 option -- %sillegal gfmt1 option㿘 c@\ c@Y gfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d 㿘   @' cH cH%  0 @ @'  2 @ː@Ɛ 8@':%lxcflagiflagispeed%ldlflagoflagospeed㿐'H@ : 'H H+ 'H/-@ = 2,@,@`@N@ c `@ 2N@s&  i2 N@a@z 2N@f& i2N@a@m 2 N@a@U& $ l2 N@a@\ 2N@H& o2 N@a @O 2N@;&  oa(@B  a@ʔ*& (#H` #H' N@J@2  @) 2  ? @  , 2 H H  H@貒 N@ ittyspeedsizesanerowsrawostopostartospeedoldnlnewlcaseispeedextproceverythingdeccookedcolumnscolscbreakall㿘@@illegal option -- -%soption requires an argument -- %s㿈@L@ -2&` &``` ' @ 2 # 2  `  @$y@   "  & &` @$h@  @ 㿘   D@ 㿘  " $@0 " `  & & & & $㿘@D<  & 6 F $  ߆C w   " * +* -* 0" $" 㿘   D@– 㿐    ``'@3   '``@+ & 㿘 @D @ &  @$**@"" "$@$   """$ "     " "  " 㿘 @C̠ @Ӑ & 㿘  @0 @͐  ?` # & & 㿘@C  & 6 D   $g`  "˒  " " " " $" %d %d 㿘 F!@%t D%d 㿘!!(@ @%iTIOCSETD㿐 `'@Β aX@& TIOCSTART㿘@΂`n a@ TIOCSTOP㿘@r`o a@ xph`XPH@8 0 (# 3#3233#@@@@-mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5H@80(   @@xph`XH@ 0 -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-iuclciuclc-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrkxph`XPH@0 @@@@    xph`XP@H@@80 (  C$CC$C-xcasexcase-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoechoPH@80(  @@-onoeotonoeot-oxtabsoxtabs-tabstabs-onocronocr-onlretonlret-onlcronlcr-olcucolcuc-ocrnlocrnl-litoutlitout-opostopost㿘b b  @ 2    ` *@&`   &` U&`  2 `  @} 2    `*@&`  &` ;&` 2#P`#P @c 2    `$*@&`$  &` !&`$ 2#`# @I 2    `*@&`  &` &` 2 tablet disc; slip disc; ppp disc; strip disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-xcaseiflags-istrip-icrnl-inlcr-igncr-iuclc-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-onocr-onlret-olcuc-oxtabs-onoeotcflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8s%s Ȓ& ```" `"@!3#@!/# @!*#0 @!&#@@!"#P@]@X #`@!#@!`@@!#" @!# @#! 4 # `@@  4 # `@@$ 4 #Ȓ `@@  4 #В `@@  4 #ؒ `@@  4 # `@}@ # @s@  4 # `@h@ @ 4 # `@]@  4   `@R@" 4   `@G@  (4 @=@4  0 `@1@4   8 `@%@4  @ `@@4  H `@ @( 4  X `@@4 @" h `@@@ސ p  4  x `@@! 4  `@ܐ@ @ 4  `@ѐ@  4  `@Ɛ@4  `@@" 4  `@@$ 4  `@@( 4  `@@4  4  `@@  Ȓ @@  4  В `@w@  4  ؒ `@l@  4  `@a@ "  4  `@V@ @>   @H@  4 ! `@=@  4 ! `@2@ @ 4 ! `@'@  4 ! `@@  4 ! `@@  4 !( `@@ "  4 !0 `@@ @!8(2 #4 !@ `@@ #!""  4 #4 @ؐ!H4 @Ԑ!P 4 @ϐ!X4 @ʐ!`4 !h `@Đ@4 !p `@@4  4 !x `@@4  ! `@@$ 4 ! `@@4 @! `@@4 ! `@|@! @b!#H`#H%` @@ d@O@b` @ 2`@G 0C@D #H#H`2 !aȬ d,`` " ` @%@(`( @c@ 2 ` @h @d` @ ؀ !!Ȓ@X@U(㿘!:"( @K#$"(:"",%s: %s %s %s㿘!:"(  :",@4!$"(@y"(@`H @(!!@$ $"(@!"(@$"(%d㿘 ?  1:" @ 0%:1 " "  M."  -*  ^* ? *4* ^*@**" -aefgaef:g%snot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZH@'H"! '/+ ")-H;%9@x?0 e"  f a !) g!# a@0  'ac@Z  !@H*` @p!H*`@ H!H* @:'H c@ `@ƛ c@. `h@Ɛ `@zc` `H H` HHH''@ C  4Hے .H (H L  `  @;. @4@5'c@~!  H`'#@@2H 'H Ő  @֒ c@    `g@ @c@M usage: stty [-a|-e|-g] [-f file] [operands] 㿘c@*!@9 㿘@ Ffs.%s8@':%:!:#-+:5/"   s F 0  0$4$<$"0@@`?耢 fb8"0* @ &H( "  . " `. @@`@5 @ @0@@?@ `@- <  "@@@  @@ `@@@ƻ%s: is a directory%s/%s8:"0`@˒ L :"4`<  @9!> @ :<  :@, /  @$:"<` :@s : "!`2 :"8€  @  0 usage: ln [-fs] file1 file2 ln [-fs] file ... directory 㿘cx@-!@< 㿘@fRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsBEFf:NRWb:cdenrs:tvw%srioctl DIOCWLABEL㿈@p '7!);'K5 "#K-K+K%;/9K_'쀢 8Z* @€!$  @  $!$N'!$  @ E$!$!$  @   ':$!$" 6%" 2$!$  @ )$!$!$  @  $!$'b $b %!$  @  $!$c %c $@@@??!$*@`&  $!$ b "   !$ ";@!$; @` "  `@6" !$"aX@ ?`x*` € @@ @ @t @z@o "@ @ m @h@] @  @m0`@@ R? C@LCK@`@k` `aX@' @  4/c . @~`m 'ah@ ? (`@`  `K@]C"@@Õ!@ o @@ē<|0000000000000000000000,00000000000Xhx000000000000 unknown disk type: %s㿘@  cx@i @6!&&& `&$@v DANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.ioctl DIOCSDINFOwriting label to block %qd (0x%qx) lseekwriteioctl DIOCWDINFO㿐K# ` @}#!;"@x 8"@t p@q   !W&&6@|Kbp6Kc   e`f@u  ; "!  i ;"耢`   aD + 3` @;   aD + 3` @ ;  @ 2H'  @ 6 !' `m@4 6@^U!h@ ! @^J 0% !' `m@  @^:!h K#`2  e`g@  !(@J 0 %s: No disk label on disk; use "disklabel -r" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk㿘 "!   0 0@#0@ 0 @ x0@| 0@!Xreading label from block %qd, offset %qd disk label corruptedno disklabel found. scanning.no disk labelfound at 0x%xioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO㿘K"`t;"耢`  * 2`   :  @@ ! @  @ KC"@c 4 @K"aX@Đ  !W@ @  K@ *  bK@!KK!\`" ! !W !2  2   !@ *  8! (@͐!X2 ;"` `s@ߐ Kb@r K"`K#e`r@͔ b @a #e`e@  b8@U !@& Bootstrap doesn't leave room for disk label㿘`( 2 @"&`&`( @!@Ē !Ԁ@ J `@ *J\ :%.*s|Automatically generated label:\ :dt=%s:unknown%d:se#%d:ns#%d:nt#%d:sc#%d:nc#%d:%srm#%d:%sil#%d:%ssk#%d:%scs#%d:%shs#%d:%sts#%d:d%d#%dp%c#%d:o%c#%d:t%c=%s:t%c=unknown%d:b%c#%d:f%c#%d:㿘N``!a @f`N` a @]`!@\{`8  * a@M`(a@H`(@Ca`,@>a`0b@9`8b@4`4b@/`Hb@'a8`Jb(@a8`Lb8@a8`NbH@ a8`PbX@a8`Tbh@ `\`',@x,` L  `)@975/-+@ 7@ђ= @"@˔`@Ɣ ` a *@@ ` @ `  2` ` ,`@3< @`@b`@ ¢` @@w `*`@R`K   %c: %*u %*u %c: %*.1f%c %*.1f%c %8.8s%8d %5d %5d %5.5s %5d %5d %5d %22.22s # %s # (Cyl. %4d- %dH. `@   *`@ `?* : ` "*` €' !(B`('`!(BD?' !(B'`!(BʉD' !(B`8'`!(B?' !(B'`!(B' ?!(B?`($@' !(B艠?' ?!(B?@ې$' !(Bn' ?!(B?`(@' !(B؉?' ?!(B?В@' !(B:' ?!(B?`(@' !(Bȉ?' ?!(B?@s' !(B/ ?`a0/ #\bpa@F  : #l #\#`#d#hb@6a   `* b@+ b@%  ! "@ !8# b@@bؔ8@ .mb@i `8`d!@"@@`8  ?`&  @& * *@Yy?`&  @&  * &@Yg!"`8  @Ő??@`8@А  ?`&  @ * ** &@YB ?`&  @ ) )* &@Y1 ?`&  * &@Y# `   <    l# %s: type: %s type: %d disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld rpm: %ld interleave: %ld trackskew: %ld cylinderskew: %ld headswitch: %ld # microseconds track-to-track seek: %ld # microseconds drivedata: %d %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] sizeoffset㿐K"b@` *  b@֐b@А`b@ʔ b @Ė`c@`X`c@`X c @`X c(@ ?`&  * & @XA`(@c8`,@cP`0@ch`8@c`4@c`<@c`H@zc`J@uc`L@pc`N@kc`P`@f`T`8@a`h@]`\`    ,``"`&  4 `', x@B $, `@9`  #`` #\@(` @    ``@@w # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '1024 8192 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, amiga, sun3...) No changes.re-edit the label? [y]: !@?@vq`0 ?@o!X@;| @5"@w\@s `8@h`H@d@wL-/+CP) !@T@ @  ْ@S!bx @w,@ܐ" `@ ?`? "`@vp ?  $? ? n%P`? $`@v[P  $P` 2` n N@+  @c>` 2`X@’@ sh-cEDITOR/usr/bin/vifailed to start editor%s %sfork/bin/sh㿀`'' '@'  @a@@3  @ I `@V' @,  @)  @& 1 " #@c @  &! @@S @_ @, '@'@9  ``@ޑ:  @  @  @ 䀠 `? 㿘@@bL  㿘"@WL   , @'L  # line %d: syntax errortypeIDEline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedata%d partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %s㻐&`  &`c@@_ ,$ "@mR : #H@C ,c`@q] 2  hch@T  @ `<@@ "`@TՒ v `@*@@. '#p@ n6`c@q' :'􀤠3L /-+'#א@q  '@q c  '@q㸀  'c@ Ԓ L 0&`Xc@p  &L "`\@-,`$  `L `c@W ? #@  6``6`!8`@p  `` @p `@l `(@p @-p 'a"&`( 8@ f˨ `P@p @-Z  ' 8@ S &`,``@po @-E  ' 8@ > &`8`x@pZ @-0  ' 8@ ) &`0`@pE @-  ' 8@ y w&`4`@p0 @-  ' 8@ d b&`<`@p @,  ' 8@ O  L6`H`@p @,ې  ' 8@ Ԓ9  66`J`@o @,Ő  ' 8@ #   6`L`@oِ @,  ' 8@     6`N`@oÐ @,  ' 8@  &`P`@o 2 @,  ' 8@ } &`T L  *`: `@ `Ȑ!6`*` @>@,V  '!@@ P &@!(@ F %@,=  '!`@ 7 $4, `` `P@  @ "`@Rْ ``@*@`L  `  @, '$@ : ' !@ ' ,  "^#YӐ@+ Q$!(@ H @+ې@.'>, !(@ В5 @+ǐ -$!(@ $ @+@ '􀤠, !(@  @+ 4$@: 6`!@  #@+ >@`?sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %dwarning, partition %c: size %% cylinder-size != 0warning, partition %c: offset %% cylinder-size != 0this architecture requires partition 'a' to start at sector 0partition %c: offset past end of unitpartition %c: partition extends past end of unitpartition %c: block size < fragment sizewarning, unused partition %c: size %d offset %d㿘 (  !( , 2 0!8 2 4!P@    2 H!h@    H 2 8!@   8 2 < ,@y 0& 8 < 2  8@q 4& < !@   @ ( @ ! !@   @ ( @ z" `"0@ s   \)@ 753/-+  a h@ \= @ 8 ,`:`@ S @ 8 ,`:`@ JbЀ2  "    @ =#  <@,`:`@ 4H  < ,`:`@ )p 2    ,`:`@ c @  4, !a  " @ #ؤ h`!@HȒ!@CȐ'`LX'P'T7'@{d! usage: disklabel [-nv] [-r|-cd] [-t] disk%s (read) disklabel [-nv] [-r|-cd] -e disk%s (edit) disklabel [-nv] [-r|-cd] [-f temp] -E disk%.*s (simple editor) disklabel [-nv] [-r]%s -R disk proto (restore) disklabel [-nv] [-r]%s -w disk dtab [id] (write) disklabel [-nv] [-N|-W] disk%s (protect) `disk' may be of the forms: sd0 or /dev/rsd0%c. `dtab' is an entry from %s, see disktab(5) for more info. /etc/disktab`proto' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s installboot(8)x'8cؔ @@^#a,c@r`@m`8@h! p@I?@_`@Z`@Ua(@Pa` c@Kؒa@Ea@Ab(@;`@J  (   @*`2 RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsout of memoryYou need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.This platform requires that partition offsets/sizes be on cylinder boundaries. Partition offsets/sizes will be rounded to the nearest cylinder automatically. Initial label editor (enter '?' for help at any prompt)> unable to get default partition tableThis option is not valid when run without the -F flag. PAGER/usr/bin/lesswunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?yunable to write labelRecalculated free space.FilenameName of the file to save label into.cannot open %sNothing to undo!Last change undone.%s expert mode EnteringExitingUnknown option: %c ('?' for help) 'P0@!P   @˒   @Œ    @  2a(@ a8@,@1((@w$@y@   ah@  䀢 2@`!`8$  7$ l'$ , 4 , @P!`' z'z 2 7z@;"p`@}!05@N$@'@?   ?`$ * &@M  q/0/1"@ɒ @Ð @*`:` p=* @€ ! @uȒ!@8@4!@9@6@@xR! @!ِȒ!@!@@#@x6! 2АȒ!@!@@v@x! 2uȒ!@!@e`r@ @\@"Ȓ!@ʐ@Ɣ!@ː@Ȓ@<@w! @!3kȒ!@!@@ @wȔ! 2bȒ!@!@,(@q@w! 2IȒ!@u@q!@v@s@ٔ@w! @Y! "@Mfa@R@O@<@k "@B  L@ @ @># L #(c8@Ӑ !"@ @ބ@C#@@@n K#`#XP@K@w! )#@ݰ %# #@cؠ   `*  R  y n   *`@ R` y C" @! @d# @ m@g#4  `(@ L $c8@XȐ  P@K@lm@v! Ȁ @ @1 `Ȓ!@q!@m!@i@ "@k@ xK#`@#XP@@vw! C@#"e @#@1!;`?`"  @ Ȓ@!@!@L@@ ``````````````````````````````````````````````````````````````````````````````````Dd`T````P``|`0`,No space left, you need to shrink a partition Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' exists. Delete it first. partitionThe letter of the new partition, a - p.Partition '%c' already exists. Partition must be between 'a' and '%c'. Please re-enter an offset and size for partition %c. 㻘 "H@KNa0 N    , !bx@ p0 `E  `A!@ b0 -` +   , @`2  "    a//%)'@@ p@-b N,  ` @ @ג#    6 ,     6 & &&& & @ &.  . $  &. 6@ " {&$&@ .   +  ". +      "  +  2  `+ . @[  2N& ϐ@J #p@ a&&@ 28&@c 21&;"؀`" 2@ 2"&@ 2&@ 2&;" &Ԑ @ ? @Cpartition to nameThe letter of the partition to name, a - p.Command aborted Partition '%c' is not in use. You cannot name a filesystem of type %s. 㿘#ؒc@; 2J @Ja07*   & !c@@ݔ`0&    `!`8@ϔ0 `   * a*@ !@`X0@partition to modifyThe letter of the partition to modify, a - p.Warning, need %u sectors but there are only %u free. Setting size to %u. Please re-enter an offset and size㿈!a@ 2J @Ia0,`    `' ' '' @&  !c@@Y`0    !`8@K0@ w    `  " ` `      a!@ , &" &@d D@ 2T$ N$@ڔ @"H$ $@ #;"؀`"'   2! @L @   2 @  $$ $ $  ;bԐ @? @ϐpartition to deleteThe letter of the partition to delete, a - p, or '*'.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. 㿘!a@ 2J @Ha0q*!  j" `  " "``""` &"`"`"`"` `0O   .!c@@8`:` `  ` !@&`8(`  !@H?a` ;bԀ;"Ѐ      ` &" " " " ` .@ @&@device: %s type: %s disk: %.*s label: %.*s bytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld free sectors: %u rpm: %ld %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] sizeoffset㿐K".@3  !* @+ ”  @& ”  @!  (@  ,@! 0@!( 8@!@ 4@ !X <@ !h@! H@! @!>ϐ b#\’!@  #`> 㿐@ ;b";bЀ;"Ԙ `@@   * @  8? @ ?   + @@  @  #@S    "&@+  "@ @    +  +   `+ &@@dpartition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk 㿐Ð!@a`@ 2Jj   ,!c@@\`0o `  !`8@P0c@@!@!ؚ ` `!#\`  #`@ڒ??/ 2@)"8 9 `   # @ Ð!@bH0'" &@"@ @ &@ ` < "p@F a0`;bԐ  $@@˔? @㿐@  @;;"Жb  @ # `@@Z@"@%s: [%s] 㿘: Ĥ!*b@'ꀦ! @IPb@$@~ 2b@ ` ,b@ X ?4  " X* $ X @E4 $ b@@p $L@?L ", L@ ?@@> Lb@ Lb@@]K#,#Lb@ ?b@%s: [%u] Rounding to nearest cylinder: %u 㻐 8` \@s  P/+Ē@bؐ$@  ` /X ?4  "X* $X @DҐ Ӱ?@ ?L@ O ,@O ?O@~ܐO ? *`O `tr p`&? @   *`@ `?* : ` Ő#*` € 8 (,@  ($ ( (@,@O + -   ! "'$!@! "4?J` $!-? ' B" '@Đ ' " 7ā@' B'-:  + -"'`@?> '"B 8' "B"B"7ƅB' B' @"8@" @"Đ"@ Error, partitions %c and %c overlap: size offset fstype [fsize bsize cpg]Disable which one? (^D to abort) [%c %c] 㻐@ܒ  0@ @`@ s  ő-`,`@@   `l?l""@2 2``a`aP@@}#x  荚   膚 Ŧ/Ť -ꀢ`'%"$* @m㰠P/$@ O X` ?"` X* $ X@C^ # O` ڐ?*  *  @ @ @;&`@ -`(2 @@) Changing device parameters for %s: disk typeWhat kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).IDE"%s" is not a valid disk type. Valid types are: "%s", label name15 char string that describes this label, usually the disk name.sectors/trackThe Numer of sectors per track.tracks/cylinderThe number of tracks per cylinder.sectors/cylinderThe number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.total sectorsThe total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %u sectors (only %u sectors left) rpmThe rotational speed of the disk in revolutions per minute.interleaveThe physical sector interleave, set when formatting. Almost always 1.`!@K@9"0 ;975/ *`X Ғbh "I@A"    a  , @A 2  )@Ȑ@Bਠ #)Ʀa%Ƒ, @# @B`  , `` ?"``* $`@A   6 #c  2  @Baa0" &@a@BX @:!0ޒ@Z . ')'%# ,#\#` #hxŚ ?〤?8@B:a ,& ,)'%# 0#\#` # ?ˀ?8@B"a 0& 0)'%# 8#\#` #Ж ??8@B a 8& 8)'%# 4#\#`  8P} ??8@Aa 4& 4)'ǀ >bԀ <"@ ǐ!@` <  4 @>  4@: #\#`L ?j?2  <"8@Aa <#;ΔbԀˀ @$ @&@@{L bԀ8$b& <)'%# H#\#` !@H ?@z;!`@!xa )%;97!Ƒ.`@@#` #@@``.``? "` * $ E6 @? '/-Ɛa! "a@?  ᴑ.`@? ",6 ``(.`@ΐȐ@@Q !Ƒ.`@@Đ#` #@@E``.`` ?"`* $@? ŐaStarting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).㿐)'%;!##\ < P#` x`2 < @?a0' -+#;')bԚ"@Д" #\#` \`2 < @?Ғ!0 "@bԐ $b$А@i㿐W 2;";;b@"b@" " L"   ` 1;;"Д"@&"@  " 64"@;b;"@(@ *2 @ *@``  #``#  *@` ##  *2 &ّ*"@( "@& @א <;; ԁ"";;К Ԅ "@ @    "  "  bЀ* @ "@ `@ The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'g' command is used select which disk geometry to use, the disk, BIOS, or user geometry. It takes as an optional argument ``d'', ``b'', or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'x' command exits the label editor without saving any changes to the on-disk label. The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. Available commands: p [unit] - print label. M - show entire OpenBSD man page for disklabel. e - edit drive parameters. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. d [part] - delete partition. D - set label to default. g [d|b] - Use [d]isk or [b]ios geometry. m [part] - modify existing partition. n [part] - set the mount point for a partition. r - recalculate free space. u - undo last change. s [path] - save label to file. w - write label to disk. q - quit and save changes. x - exit without saving changes. X - toggle expert mode. z - zero out partition table. ? [cmnd] - this message or command specific help.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help.㿘?* : `6S*`ѐ# €@ru 00@rq!`0@rm"`0@ri#0@re 0{@ra#h0w@r]"0s@rY"0o@rU#0k@rQ 0g@rM"0c@rI#0_@rE h0[@rA!0W@r="0S@r9"0O@r5# 0K@r1#0G@r- 80C@r) @r& @r# @r !8@r!`@r!@r!@r!@r!@r" @r "P@r"x@r"@r"@q"@q# @q#H@q#p@q#@q#@q#@q (FFFFFFFFFEFFFFFFFFFFFFFFFFFFFEEEFEFF$FFFFFF4FDFEFFTFtFFdFFFFFĝ㿘'  @ "@@@ @ $@(@ @7 @ ` "`@e$@`<@㿘   `" `2 @S ` ``  /dev/%s%s%s%c %s %s rw 1 %d x @ |   , @ " "@ "    `eҢ!ؐ@S5  N r Ҕ@a$@, / "`N@`r2G Ҕ.@$@a`.@@@?,֒ ἐ@Oz @Cc8  )  "!bH|   @*  ` a*@ @#\#\@u.  `@ 2@@W Starting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. This architecture requires that partition 'a' start at sector 0. 㿐.` Ӵb !-+)'% ` #\`   #`<  @6!% 2;b8@6! ` "Ѐ !@t ( ` ;"Ԁ !@tx ` `!@top ` $` Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors 㿐.` %%#Ӏ``2   < 7"p  "N$ " @&E$Ӑ!@sc  b#\``  #`? ? @6a&  "8@5a " Ӑ!@sɒb  ;bԖ Ӑ!@sc  $ fragment sizeSize of fs block fragments. Usually 1024 or 512.Zero fragment size implies zero block size㿐.` -+)%'`#\#`a, ?? @5 8@5` 2$`@o3!$` block sizeSize of filesystem blocks. Usually 8192 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. 㿐.` ` 9, J  @5>aC 7)5/-+ @@#\#`"淪ؠ?߀?8@P^: @PY!@r @  P@ c@5! @,  cpgNumber of filesystem cylinders per group. Usually 16 or 8.㿐.` ժa(!0)#%   #\#`R ?? @4ɒa  24 8@4’a  FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).㿐.`  ` `(!*` Ր"b   , @@3 2 ,` 'Ւ@ܐ"P !,`  @4Za +)'% ` #\#`b"Κ ?ꀤ?8@4C ` ,`  mount pointWhere to mount this filesystem (ie: / /var /usr)noneMount points must start with '/' 㿘. `E A ? = ;.#!ր /@ @r@3. *&@a(@  h@3a@` (֔ `   @3a ``@3. 2N@  @F&@ 㿘 2 @@ 2  2@ `?@OuCan't stat deviceioctl DIOCGDINFO8@? ֒b @ @qs! #ea(@ `r@G 6 &@`e@@ 6&@֒b8@Ӑ &[d]isk, [b]ios, or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.dBIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd', 'b', or 'u'. 㿘  ֐"cH 2 g ?* : `3dא"L*` €2(U#& (,& ,0& 04& 48& 8<Q& <`2`(B#& (`,& ,`0& 0`4& 4`8& 8`<>& <2(/#Ȁ`& (,& ,0& 04& 48& 8<*& <(`(@%,`,@ 0`0@4`4@8`8@<`<@ #@2a0 @2a\^0]^0^0^0^0^0^0^0^0^0^0^0^0^0^0^0^0]T^0^0^0^0^0^0^0^0^0^0^0^0\^0]^0^0^0^0^0^0^0^0^0^0^0^0^0^0^0^0]T㿘 " " " "  ;;"bԐ" &  & 㿘@8Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s`"쀢?"@ ?LLL $""!"# "` r#bِ"X( € א#"a$" @e !  $" "!ה@H "쀢R!l`N @ K"쀦  א# "a$"&@d!  $" "!הЖ@H̐ " $"쀢+!l`' @t $"쀦  א# "a$" @d! $" "!ה@H  "ؐ  """쀢 ?1!Ȁ "L@  "!!Ȕ@H L "@ 6   "!!ؔ0@Hv "< @ !ؒ`H@H: "@/??$"$@2 "a@   @" $  @ ?2 $2 $ "!`2$ `2$  `! ""bs#!|iِ"D*` €c?  `!"#Z"a|` @>c? !"!|"a| ! !|>"#?;"c !!  : `@a# 0@%!?"!|%1>$!|!|  : `@a  0@!|   $!| ?!| &#&#""c"|% $ eHdddda a ab0b%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. cpio%qu blocks tar%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. 㿀b쀢   LL"!`"`"a # "`#!`'?`" * " @/͐ !@n#bp@#c L @v  <    4 0 @Za$c `!܀` !# @ #@Κ @!`"`2 L! @0" @"aL ?$L  "ࠀ`"b "b! f"!`!`'?`" * " @/Q $!` !!aؖऒb@m@>"a`!@Kn"Ѐ  b؀   @^M% @mz0!@KO"耢 %`!bbᘘ?`#\#`#d@m`#h@B$`?c"`b   %#?@? 4$Unable to truncate archive file㿘""b 1"  @    "@NI    "!ڔx@FD ?Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s spec㿘"`Lے` @E ?!` !|!ؒ`X@Eݐ ? Failed read on archive volume %dEnd of archive volume %d reached㿘" 3" b@t |L  "" !"|L"!b@b L "` $" "!"@E 0"ےa0@E Write failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWED㿘" b @  L"`"6$"$"" @ & : !b  @ .  > b b@M: $  $"  "!?倢` E0  "!  ےbH@D $"C    $"  "L "`  ےbx@Dڐ 0' "ےa0@Dѐ 0  "!"@D 0 ``"@y ےb@D 0c@D Cannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.㿐L `g?b b `? WaL L "`" 4=# 9L  # 2$b7  a'@- 6&$% # b %"%  @  > @]@ d@   $#  ܒb@D'  ܒa@D! ?Foward positioning operation on archive failed㿘  >2@ `(= " 45"`21 !"  @o   L @ 0C 4 2 > 4(>0@ b >0  "@R    "!ܐ @C?$b?Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %d blocks.㿐" 6" K  { `(y$ @Cna@p? !n `(l$"  @ْ    "!ݐ @CpX?b "`ݐ @CGaI?    "@ B  "!ݐ @Cc7?@r 1 "!|0 `(.$ :`@\@ @Ca? 7@Z' a@    "! @C- ?$?$ Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %d pad blocks?c" `'?c @p? 4   "!ޔ@BӐ }?  7'!  @q!    "!ޔ@B h?7'!@`  ? "!ޔ@B W?#@7?   "!ޔ@B F?@)? 4   "!ޔ@B 6? 7'# a@,   "!ޔ@By #?!%b@w ݒa@B> ? 7@'a@    "!8@BW ?Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again 㳈a @  "!ޔ@Aj  @ܔ  L "!ޔ@A[ L`  "`ؤ @E"耢 @@  @Ec a@Ec {" w u  "a@@ΐ @@@ː h "a@@Đ @@ `?  @@  ;ߐ $# @@!;75/߰9!+3')@@a@@@@@h@@ᐐ@@, @Ea  O ?%ؐa@@'""!`O 2!Ѐ`Y `s`S!0 `y!a a@@m@@i"'ߐ!@@d"@@]"8'!ߐ# @@V@@SX@@Q"@@`, ߒa@EU O ?ߐ!%@@<#"8"! 2@@3"ؒb@E; @@)"@>,@@ "Q !# @a$#@( X$a? "%c@@1 ?could not pipecould not fork-c-dccould not exec㿐@ c@ڇ @`"#c@| @ڰ0@ڬ@@0" @ڢ @ڟ  c@ښ @ڗ c@@@# c@L ?#p@f@ \ `D T``  N!` @  E@  @@.  x %@ (`@+ #`@0g @+C `@, `2@Δ @B ``(a @ *@*Cannot chdir to %sCan't fchdir to starting directory?#p@@  `D ``  @7 !쀢`@5@ @ f/@/  x @#a ?!`8?#@[l 0a a 8 #@ ( xq@a  ? `@(  `` `8 V`@* `@+Ӑ ` @3c x E@at  !x`B?#@[ 9at !x`8 +@ ( %x@at  ? `@( `8  `@`x @ @B0!   @ǐ  @' "a  "  "@   " @>   6 4? @@ x @ @ @fB`@2ɐᴀ n!`j  `?"`@* "@@&֐ Y$!@ѐ ` x @ @ @9B@20F? < @ᴀ `!`  `?"`@* "@@& $!`2 ?# x @ @B     @a䀢  "!@> @א `@) ``(ᤔ @h t@6@)9Unable to open %s to read㿈 ?`'@1 @m   `,  쀢` 0@3 @  /5@Ґ@1       @Y  ' "! @=0@*Q @w@1` !d` @  @d@1ΐ0!   @  @&]  "a``ŀ"` @A|` a !`  `?"`@* "@@% $a@"0H  @ @a  !`  `?"`@* "@@% $a 6耢   @耢 ( x`  ` x @ `@ `@- !?+'@2 $` `4@9ᤔ @F R @5@Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done.  ?cp@    b@@7 9@3 4!쀢`@1` +@G50!??"'@, % 2 `!`? `* :  /@`?"  a@;8`0`@ @<#@  *l@W| !-@ a  8@ @@ a  @@ 8@ @T@/ ɒ@' Ē?c@ @) at  !x`(`@W8 2"!t !x` 8@ @@ !t  @@ 8@ a    @#` "a`!̒`"`@ @6 ! f!`b  `?R"`0U @  ? @А @Ӑ !@/ ! @ @V ?b  ' "!@ @:0 @ 6@@.0"@@H@s! !`  `?"`@* "@@" $!@p  @ߐ @3E@Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.㿐 L` ? ' 5-19 "b?  @ `P  A @9Ғ# @䀥 ` $€ #`` ``8 % `   @9 H `@ Ӑ` "`8@ 0c= ?` @9 ?a`  "a`Cannot identify format. Searching...Sorry, unable to determine archive format.㿘#"` !*` * & 6@ Lo?@* @*`@"@Yc a " 97瀦 T@ N"  a K? @9(` @ 4 c@ !cL!@*` *  . `@  2  ? @8`  @ϔ""@Ơ"a¤ b@8 ?Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portable㿘a M! "a `&!!? `  !a    "" aX  @8?0a""a|  !0 ! ?!  @8"a#!  Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multiple㿘 Ma"!!? b c "@81?04a   ?a|!  #! :#a M? "!|"cCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.㿘!Ѐ``@ ᄀ  !|"ᄪ "c|"#  s !  " c  @ :; F@O@R&  @c :@ D" E@d (!`%!c@$ @ %! | - ! $  "  : c $ %!c$ @ %!a@cb  %|;a88   "` `x @7^?Unable to append when there are archive read errors.Archive read error limit (%d) reached㿘#`L  `c@73 C? ! 7? ;  !B@ "!8"a (   :!#  : !Fc    c8@6 0p ! ?㿘a " "a @㿐  p?a  " :   2 @!   ! @fU%! !| :`@P" @N@Q  :?@ f @ B D (8. ! "@:`   ` @:   2@! !   d%! a!  㿘#a a !! "@a !c@$a 㿘`$" '#%a "@  @@ @?a @Ka &@@$a ` 㿘`$'#a "@  @N &@ a @!a &@$a 㿘' ! "  @ec &!?< 2 @   @  @ < f $ ` Read fault on %sFile changed size during read %sFailed stat on %sFile %s was modified during copy to archive8 H@' ! "  @c &G>: 2 @    @T   @ :d $ 4`8   "!  a @5q !>@zВ   "!H@5 >?8 a`@5Q > Unable to obtain block size for file %sActual crc does not match expected crc %s( H@  '@z "  ؀ 2   O> "!8 @5G  >'/0- :2 @    #\@ !d` :!   #!   : $   @ d `  "@%@ Ē   H`4   `@ 4 ` !d ?!d`2   @c` @4  Failed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %s(HP  * 2`  *` '     "2  @   @y  "؀ 2  '!8 @4x'#'a@ #\@ښ <@ Ea@㐠 怦! "  @4K 0 H    @   b @4  @yj   8 " @@4)   bX @3   H`4 `@Ғ㿘c  )  $% # !~   :a#  "a? a> B@"!8"a User specified archive volume byte limit reached.㿘!! ` 4+  1%!!!  !'% @3'a@3w ,     =ai"#!   "a@=a] && %'   =a M "a&& 㐢@ `a <`B=a !@B㐐 &"a $  "! a@ <`C &!=a@%$! ` @$! @gْ  "aа?Unable to allocate memory for user id cache table㿘!#䀢  1# 2?!=@Yޒ  $#  # &#`h@2ِ ?Unable to allocate memory for group id cache table㿘!#耢  1# 2? @Y  $#  # &#a@2 ?Unable to allocate memory for user name cache table㿘!#쀢  1# 2?!=@Y  $#  # &#a@2 ?Unable to allocate memory for group name cache table㿘!#  1 2?!=@Y_  $#    & b`@2Z ?%lu㿘#`Y >1!=@fi#* @ "!`$! $2 !`29 `2'14 #܀  @ #ܒ`$#܀ @| (@5   & & $@E_ `21#2& $  @2ߔ  &. #㿘#`* >1 @f#* @ "!`$! $2 !`29 `2'14 #  @Z #`$# @|7 (@   & & $@E `21#2& $  @2  &. #㿘@ "\?N Wc쀢   &O?@*!=* @ #  @6]  # 8?! $c܀  @Ր cܒ`$c܀  @*͔!=@{Ґ (, "@  @ ?` &@ @2/ @ , #  $` $ $&@ $?㿘@' "\?N Wc   &O?@* * @ #  @5  # 8?! $c  @ c`$c  @*k @{p (, "@  @$ ?` &@ @1͐ @, #  $` $ $&@ $?㿘@$TRAILER!!!㿘a@5   ? H`@  ?㿘 <    < & +& $")40,H'H#"H(0  #&  &  &  &  &  & H   o @6 &  <@$t ? %?p#` @~T $a`" 4 ` $a ` `t` $$, $ 4 0@Cpio file name length %d is out of rangeCpio file name in header is corrupted㿘lc@0 ? 2 L 2N   c@0 ?Cpio link name length is invalid: %quCpio link name read errorCpio link name is corrupt㿘 H   @   4!  H H@ @/Β`h? H,   @"&, `,@ N,  `@/ ?070707㿘`K a@4a   ?㿘 L h! x   :` @  & `  @  & ` @  6` @  $& ` @  (& `$ @  "6 `* @y  ,& `0 @s  @&  H 8&  0& `A@Ԓ : `;@b ` &0 < (  @ &,., W z?  W㿘@%File is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %sHc@&, ư?``x   :`,& ",    A4  #`H  A @  `c A @   !ǒ @  ~#`   @   t`   @   k`    @   b`$   @ ߖ  Y`(   @ ֖  P`"   $@ ͖  G`,   *@ Ė  >`8   0@   5 ; @   -  L  `  ``c     2 ,, 6 ``@.:  ? `8@.2  070701㿘`m c@2ݔ   ?070702㿘`m c@2͔   ?㿘 @!"ad㿘!d` n ђ n ! x  :` @   & ` @   6` @   $& ` @   (& `. @   @&  8&  0& `6 @ D  H:`& @ є  "6 `> @ ˔ `F @ Ɣ ,`@ &`N @  `V @  ,`@ ,&`f @   &`^ @   ??&x 8 n ` "  .< (  @   @  b  `:&,.,    @  b  ` ?  |㿘 @$"adFile is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %s(?@$O? #?` ``,&!d`!’ @ P  `   ! @ C    @ ;  ` "(`x  (x% #x#`H   `  b `x ;@ 6 @   `c0,   ;x   ;@ 6 @   %   @       @   $   @   (   @ ؖ  8   .@ ϖ  x"   &@ Ɩ  o `  >@   e F  @   \, `  N@   R V  @   I ^ @   A n    n  $ /  "cX    # 2! ,ǐ, & , $    6 c@,   ? c@,  ` (:`((!Dž0: 2`(0 ?(   (?㿘ڒ  !(! x   S;` `*  & ` `*`@& ` `* 6 `  $`*`@& `  (` *  & `  "` *` 6 ` ,`*`@& ` 8`*  & `* `*`@  & ` H`*  :`*`+ 2 *  @ :`R`` `*  & ` `*`@& ` `* 6 ` $` *`@& `  (` *  & `  "` *` 6 ` ,`*`@& ` 8`*  & `* `*`@  & ` H`*  ;`*`+ 2 *  @ :``*#`8`@`0& `B&& :` 2 3` < @ (@ `H   &,.,   `  b`x ;    @  b  ` ?  &File is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sx?c@!ٔ !D?  ?  ,& ؀ J  `x] [x  H * 2` * 2` `@  c * 2`  x  ` `+=  `-5@ *   - @ (`(`(`(``-) a, x; ;  , ; *  ` **   : .`.`.`.` )x   :(`(`(`(`)  q :  *   ǀ(@(`(`(`  2 *   (`(`  *`2`*  2`@(`(` $ 2 *   (`(`  ( 2 *   (` |(`  " *`2`*  2`@(` n(`  , : *   (`a(` 8: ::*` @ `*  * (`(`(`J(`<  *` @ (` ?(`K  E       "a8    $ 2" ,&,   , "  l 6  a`@)j  ? a@)a  Unable to create %s㿘%   c*`.@E4` 6*@ !?! " a ( $ @А  @)[  ?&@Eg4 &Unable to close file descriptor on %s㿘`@ @v   "! @)4 !耢`  ( $ @, a  ``  36   @m  ` ` 08  @ Unable to link to %s from %sA hard link to the directory %s is not allowed8, @E   "!  @(ې ?<   @g a@@( ?㿘`    @P  Unable to copy %s, file would overwrite itself8 @DÒ !`  2    bX@(Y   Unable to link file %s to itselfUnable to remove %sCould not link to %s from %s8@D >% "!`2Q @@`@ c@(! @?<   @i % "  "@;. % "+  "!@@(1 "?X@() ?#  ` @`   @ a԰ %s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)8  c# !!  @ ``!Ԁ`  $ ( @3  P@' ް? ` >!*` € ,2`@CŐ 75  ,  *2` @ ,  *2` @ ,2`@   ` , @H  a(@'F ? "!耢`` $( @( @[`ra  !  36 !  @%`H)!@+!h @@h  )!@CJ  "! p@'*`2`@s  c@ma!  6 @ )    ` @  2 `"  08 @  `< << %s 8!` a @H@d0o `@>1 !2  ` ;!@@!!@Q` @ߡ @ /` : ` ` #` #\a(@H ` ?   `a@ `@Hv`0aP@HoaX@Hi `  `a`2ah, @HX0?`& * & @ @d,%s%s %s @!  8;a @ 4!!%8@ݐ@- @ "/  @=#h@   * ` " J@ @ " *  **   J " 0" * 1 Є *`(8*`8( Ʉ*`8(  0(Ѕ8   J`/ `7$(@    8W0*2   0*2    0* :* ? 㿘@  @ O@ "`0"`A@I@Є  2`.* >а*`>@F.> +.>2`* ` >F *`@`@*@2`* >а*`@>F`@ O@/@7$. 㿘@  (  `0 8W.W.* 2`@2   * 2` ` 02 .   0.:. ? %s: unknown option %c %s: %c argument missing 㿘!@ " "a`4`I?"@J@ - aD *aD "aJ!D`@Af3@ . :  "@"@'?@ q  :2J @!` :2. ሀ @!`@F  ?*@$"ሱ. > ustartarsv4crcsv4cpiocpiobcpiopax㿘@@: /`"!`@$!!@$H"P @0!@$>"h @:0"x$!ؐ@Wab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLPT:U:XYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedP  5O-`8J <*` €E# "a@!$!`=acX@ @X5 "ah/ "a* "!"a$ "a  "a@ "a "a "a@  0 "!-* : `#*` €"  " ""# "   "a  "aLcp@ @ L  ӤѤ "@ !a ɤ "!ä  "!   "! @! "!!'" @@ H "`!c@E  #@ga '+@!@E>  `H!@Yc0P#"al! "@Q!: !  ac@ @a a c @ "@] "!W ! "! @"ؐ  ?J"c@߫! D"c` @ 0 "@a 7 "!1   "!+ @"!&  "@,a  "@a  "!p  "!t   "!x @$@?O(??B  sې "` !%qȐ   @@  !  @  ! " % @@א@  `#8"``A#*` €!!!7! *@@ !@! $!0&!@`H@> @?. @"a!! *H@ !@! $!"#L  @ @ @  @ @ @ @ @ @ @  @  0   P h               , L   l              4  H \  p    x        b:cef:hmopqruts:vwxzBC:HLOPXZ014578write_opt=nodircompress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8The -O/-o options are only valid when writing an archive-C-TrUnable to open file '%s' for readProblem with file '%s'TAPE㿘 "   %)/-`J!4*` €# "a@!` $!acX@` @X!* $! }$z"# " aJ@ -2 J` "!k "!g d" @!H ^ @0Z  "aT" P"aܐ M$ "@a H@DA$a <"a 8"a " 3$# "!+"a '"a #"a!%` "ap!X"al!h !x !!!!"a@! ?c?ሀ*`@ &  2! %?  @iӐ ?  " "`#8 "`a@ @   X '5/-+<):`@ q 2-@`@ >`@ƒ %@ @b @y %@Ȁ `@p@ @$_H` @@h"H@` @` `@V@  `@ 5 2@`@ 2$Ȁ`he"!!Ȁ P#\  K#@7H@S  6C@@.?@@@ b 20@`@ B`@bb %@b @ @ %0 @ @ @#H`@bH@ @  ` 6@@@ "$c@Βb 2`@ 2`$c!! "J @f"` $!J !h$!@Tdt| ddp 4/%s8"`%+ "@J@lL `?,@6 a @6! h@Z ?<  h @{  ?` /,`ϐ abcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdinP !?#$! ""a#a"#!     /9ڀ`D *` € "a"&! "ah %` "a̐ &" "`%` %` "a "`%`& "aw#А ~%`z"a "@yat"a! "!@b  %!b @ @ %@ @A @"H`V!bH@ @O "aJ - J !B%!?%! "!!'" @;ʖ H /"`!c@r  #@a %)@@@k  `H@#@ "a!X "al!"`@@:h?@?!`* `G@ *` €@ ? @t` 6@@@ 2@01@  `H@ @x@"a `@o@ @i"#%!  @ P H  c@ @T@R  $8888888888DP`8x8L8888888@888888888888t@8888@88@ (8888%s: Invalid combination of options: -%c㿘!!a@?!  !J 6 a@?!@g 2@ !`?"`! * $!@" 㿘@Q@Ȁ   ȁThese format options are not supported %s = %s 㿘!Ȁ`b@P !1!@?O" 2@ Invalid option nameUnable to allocate space for option listInvalid options format㿘 N  ch@q c@ :?cc@  @b0?L@ ", '@Œ , 2,@ = @bf 䀤,"@ "`"` Ȁ "" `$L@ ې 㿐 @O  "a 2\ `(Y "V J k" m b /J w)J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& @8"  'J`x 4 ``*2   @1 @  㿐@   2  J?` '@a  @d\@* "aH  usage: pax [-cdnvz] [-E limit] [-f archive] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdiknuvzDYZ] [-E limit] [-f archive] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [pattern ...] pax -w [-dituvzHLPX] [-b blocksize] [ [-a] [-f archive] ] [-x format] [-B bytes] [-s replstr] ... [-o options] ... [-U user] ...[-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-diklntuvDHLPXYZ] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [file ...] directory 㿘!! @#h @#% @# cؒ@ @# @  @ 8 @ X @ @ @  @}  @y  @u! @q!@@n# a`@i @e! @a! @]! @Y!@V " @R@d? usage: tar -{txru}[cevfbmopqswzBHLPXZ014578] [tapefile] [blocksize] [replstr] [-C directory] [-T file] file1 file2... 㿘!! @)#  @%@d usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list 㿘!! @ǐ  @Ð  @! @!H !@@c Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %s㻘  N`  b8@  \bX@_  ` bx@< i?,@K  @H$ b@( @_S?,N @ 2 *@@;@_ *bX$@ `$`J@ + @% *:  P"` g G" `0  p"`0` $` $`@@_,@ ?`J@  @c耢 $`c " "c"#"c Empty pattern stringUnable to allocate memory for pattern string㿘  N  a(@_"   a@@ ?$@b$ $ $ `$ $ c " "c"#" WARNING! These patterns were not matched:%s 㿘#  ) '%   2 `2 @r"  @;sP  2 Pattern select out of memoryPattern list inconsistant㿘#`  !܀`   \$  W !`22# 2 *`2)#2*@   $ b@%  ` /*@6$  ` /*@$ @b?$ J / * $ $ & #       2    @^" & b@ ?㿘c  &!܀`/!h`4?2   #@.         J@ /2 @u 2  ahah`? `&  T &?& 㿘&N ?  [  **`:N@-*`6N@N@ !`2/1?&. N@ ߲`(? N *`"   N@Δ `N@ ?N@` `@ 2N?:  `?J!`?   82J! -(J  ] 4  @$  (8 "   ](  Removing leading / from absolute path names in the archive㿘 `! N  /N    . .  @`@aڐ&ࠀ    $ࠒc@ ࠀ )N, /% `N, 2,  . ., , @`@a,&,ࠀ 4   $ࠒc@Ð #耢` @D  )     , ,@4 !쀢`@j     ,, @ , ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s 㳐!@"0-+)'#!@h@b@"@, %@Ѐ @b0@_,O@#0〢  .@ڐ# "  O  @ϐ#0 ?#X@Ȓ @%,&,`? 㿘 @ ? ` ,, @ ? File name %s/%s, too long㿘N@`/ "@l$&@aH@ ?  ?*@  * . ?*@ .  Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s ?#Pc@PPA X/ @D? .\  ,@` @* @ @e 6 @ U@? X d@\"  L  ΐ2ƨ?@0,@` @@L  @,@L  $b8@  % OP OP  !b`@8 OP!bx@7OP  ޔ,&., 㿘 C:  & \"*L@ / 94 *?Ѐ.`, @*:  \2 .L@ \ @ &2. `. ` `  " ' 4  ?:& @* `&.Can't open current working directory.can not gzip while appending㿘@(5 @,"  "a "! @ 3@x +@  % `#*` €i!l`bH@  Ԗg!ЁClC CC,C\Cpu time limit reached, cleaning up.Signal caught, cleaning up.㿘 "a "c@ 0c@ @ !`@@^ LC_TIMEUnable to set up signal maskUnable to set up signal handlerh @\Ւ   ?@ @\ʒ   ?@ @\   ?@ @\ 2?@ސ @Z X   "@   ?؄ܒؔ"!  '''@\V   Ȁ    @\K Z " @\D  Ȁ    @\9 H " @\2  Ȁ    @\' 6 " @\   Ȁ    @\ $ " @\  Ȁ    @\  " 'ؐ @[ @[     "!@i ?㿘 `@ 2  `@ 2   耢`" @B   Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memory㿘 "S?N #`   !=@5  $`8`N # \N  #" @ 2 `H@ΐ ,?  @ @C!=@B`, @ " 2@Y!  ``h@ ?, "  "" 㿘 $!=@B`* `"  @ 2` `2@ Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memory㿘 "S?N #`   !=@5M  $`8bXN # \N  #" @wn 2 b@: ,?  @s @w!=@BS`, @ " 2@X  `b@ ?, "  "" 㿘 (!=@B*`* `"  @ 2` `2@ Empty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]㿘  N `@W / "N,@`N & ?А , *: * :  .2` 2` @ n J 2 @WՐ  `` L@ 2$  *$ L@ & @*:  M"  c C"  L@ m2 L@   $   $ a@ 5 S`L@  @@誐 N$`$ @ 6  a@ $ (L $@~  6   a`@ @W$  $  @ a@  @W?`耢 $ " "`  ` " "`a@ ߐ ?耢`A@8` "$ #  @ &)  `$   @    @   ` ` `2` `?㿘@L@ R . "$@, @Zr 2a?L?Г* @L *`В@ `=$@T?@Z`?`8N?#ܓ*` €N?Г* @N *`А@ D$` d$` N?Г* @N *`А@ $`?$` N?Г* @N *`В@`$`  N?Г* @N *`В@`$` N?Г* @N *`В@ `;$`@N&@?? SRS\RS,RRRRCannot allocate memory for hard link table㿘1!4 2 )@2  &!4 `@  ?Hard link table out of memory㿘!4`o%`"`d )@@a4-  `7` ````@ 2``@ 2``, @꫔,&,`,   & ` ? $` `$@V;@@V9$ @V  @  $@``$` `"$` - a4 $` @ $` "@ @V`@  ?㿘!!4 8#`"`3` / - +`@?)!4*  "  2  `   @ 2  @ 2   #@U@Uא㿘a4   4*@  "@`@U@U`24Cannot allocate memory for file time table/tmp/paxXXXXXXXXXXCannot allocate memory for temporary file nameUnable to create temporary file: %s㿘!!8 2 1!G@1  $!8c@  %?@8    @ ݒ`0!8@Uq?0@U "aL@@Uf   "!`@  @U[?Failed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memory㳐!8`  1@G8- @`;+ "-@2&``!!L  @W ` ` !Lah@  [?@W&E@ ```2@`  8`  ?$`= @T  .!!L  @W  <`!L@V " 8- 8 $`$@ $`" ! "!@ P  ` "!a@  `?@T?Cannot allocate memory for interactive rename table㿘1!< 2 "@0  &!< `0@  ?No interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory㿘!<``@ Đ I @&"a<, @`0` `@@ 2```@ + @T9`@ &``@T @ &@@  &`a<,   &` " @T@@Ta@ | ?㿘!!< @@ؔ"!<* @ @F 2   T&@. 2Cannot allocate memory for device mapping table㿘1!@ 2 !=@0<  &!@ c@ : ?㿘` @  ? Device map table out of memory㿘!@`-!=@=>a@, @` `2` " @Sp  a@, ""  "" c@  Unable to fix truncated inode/device field when storing %sArchive may create improper hard links when extracted㿘!@ ` }  @ 2  " *     +2$`& `W& `R y  B`25"5@R 9"" "$ 5P  &PP\  P @!S  `  &PaP @RԐ  aP"" "$  &   &` @Q `@M  Cannot allocate space for directory access time table㿘1!D 2 !=@/,  &!D c@@* ?㿘aD   D*@       2<DDirectory access time reset table ran out of memory㿘!D`6!=@<D,`@     2  2  @RK  @+  $D,`$ $ $ $  $ " @R^`@@Ð 㿘!!D &!=@;ސ!D*      "  2  2     "@ & &@R1@R/0?Cannot allocate memory for temporary filenameUnable to create temporary file for directory times: %s㿘!!H?  @Ɛ  b@k ?@  $!HbH@_ @Q?@w@Q Unable to store mode and times for directory: %sUnable to store mode and times for created directory: %sx!H /  @T  ?c@% 0"`' !H7'' @S'؀ !H@S aP "aPcP@ Unable to set mode and times for created directoriespaH R  9'@S >ؖ !H @TX 6!H @SЀ .ؖ !H @TH &!`쀢 I ` `ࠖ P !H??@T$  !H@S!HP? $!H`h@ 㿐`@  @6` `   *  `'  * @:㿘 _$ $  J" ?`   " @ 2(* * * *( ( 0(2    0( :( ?   @  2*( ( ( (* * + 3` ` 03 *   0*:* ?  !    ustar㿘a$?N ap!@ i    䵔 Ғ"? ?write_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.㿘-)'+/$%@ J ! @ D   b@] 8 "`? h @P  ? %X ۢ! 㿘" #? `& `"6`& ,#&,`d 4  /` 6`l - `$& `t ' `(&  `|䍒 `H :  ``@& `   ;`8&`0& `x:N` `1`21``5"",., ` , & `ݔ,&,,(` &  , 6`Δ,&,,  96@` & 6 6., .&,., &,L /`  `"` &  6 6 `H@`  a"@   b  `` & `x6 a : :L /2 ,?& Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %s㾐 ` -"*` €!X`$%ǰ  b( bX b b, d, b%   c b  c x : ,`c d@Q,? /,  2  1,, ؔ c, l   g"! d @Q,H l  Vc" @  b a:!   `dp < $  `lg 3 (  `t^ * 8  `U  !!` K  1!  |  ?       c @p  s|sstssssst㿘 ?  ?㿘a ?І  ?㿘a$?N ap!@  2?  ? \"? ?㿘ߒ"  ?# `"6  `& `& &NaY   aY+ /,  , "&,`d   /` 6 `| k `H :  ``@& `8& `0& `(.aHa)ѥ 6`$`t  &`$.a(a 6 ``l ٔ &``x  ;@ :`,& ., &,N``7h#*` €  @ 6 s&     "  &6  6 L /2b &^,N` 4 `  ` `  ` & 6 aI ፔ  aQሔ , `,<& N` 2 `  (` &  6 `   `"` &  6 6 , `N,&,,`H@`  a"@   b  6` `x& ` a: : { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { zzzzyy{ Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00Ustar header field is too small for %s㽠`  `0``    , c, #` @. `x   @ :,@Y  /,@`Y @O  c` ?` a, c "*` € 5,   d@O :,!I ` 4 3,   d@Ov `, !I *  !Q  !  (  6,   d@OZ ,!I ` 1 2, ,  c? ,!,!I,!J,!K,!L,!M,!N,!O,!P,!Q,!R,!S,!T,!U,!V,!W,!X  |   9 `  0 7,  d @O% #`H @" a  b `x ;@,!I,!J,!K,!L,!M,!N,!O,!P,!Q,!R,!S,!T,!U,!V,!W,!X |   `b`ap !` !#`    d  J`$ l   A`( t   8`8     2/w  ߸! ɒ  ߱!)!  s  Y!  ʤ `?       `@  ~D~d~d ~  `c`  H /" J J/2 J" `4 ` /dev/ttywrFatal error, cannot open %s㿘 "@   @@b!  $! b@8  "a@ 0!@M6!쀢`  bb@3 ?㿘!!'H'L'P'T'X H@'@C !Ё㿘` !Ԁ@ 2. ?@ϒ 2* %s: 㿘'L'P'T'X L "a!` !1! @B`!@#n &!!ؠ!!`X@&@'S@#_  <%s>㿘'P'T'X P "a!` 1!! @B`!@#A $!!ذ!!`X@&@'&` !!!@@&@#( 㿘@Ӕicmpunknown protocol icmpsocketDI:LRS:c:dfh:i:l:np:qrs:T:t:vw:bad number of packets to transmit: %s%sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1sbad preload value: %sbad packet size: %spacket size too large: %sbad tos value: %sbad ttl value: %sttl value too large: %sbad maxwait value: %sunknown host: %s-f and -i options are incompatiblemallocbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptPING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrom@  !//"@Lc''/ '!b@q   @  "cd!b(@ @: @u# "@6%@,+b Ȕ'|'X'\'`'d'h'P/;'x'T'l'p't 3%* 8@€a @ʔ  #cl!abP@q L $/$LL @$L@  L!!"x@ @q `$L@ !a@* L@a 2 !ab@qy  / -  -  - L"$La@7P  =bbȁ !ab@qX "Ё b@  b!!"@M @qF b؁)=bL ~$L/ y%@ " a!!"x@1 @q*  @@ g!!ab@q L ]$LLa@ >$LV!L Q$LL M$LL I$La @ 'b!ab@p ?#@9!!ac@p L $La@ )'!ac0@p L $La@ /!acH@pӐ L!$La @   "!acx@p @ !@%0??a* & @ @ bD"͖`"`""P’    H`D" @K[@ *P-`@5 #c`@ѐ 2 !c@p -` @JL @ "#`/L  b!c@pl ` "` @G' L!c@   b @,`@@I?cL ̀""(`< 8 㐐 %#cx dcx+cx *" "" @M  L!c@X L @?dc @ L ?dc @ L <` 8 㐐 %$LL d $ d!c@o %d  @˘ #<* @ *@@ "cc, `4 4 4 , ` $ , $ L <` 8  "`(@oŐ   '///d | @ ( 6"@u `@J 㐀 d X @  "`x@֐ 㐀 d \ @s  "`@Ɛ 㐀 d  @c   "`@  'd!?#`#d@z` "`@ @d#h`@B  d"`@ ?hc@4  ```c`'@qP"`b@*`"b@*`@H{ %#@Hw %@Hs @2L 2d@d 2 * @FV  !c@Q t#'L  @ ''@Iѐd 2 * +  & x  @ L 'd T@l  p "᐀ L"@䩐a0L'@IJ T@Y @IB #l`Lh L@F'@@I XXXX<XXpXXXXX$<XXXXXXXXXXXXXXXXXXXXX4DX$㿘 "!@D%c@Gɐ cl#H@  ͒` @rs $#h`  @  `" *"*`@G @qS$㿘! "!@M $!ping: sendtoping: wrote %s %d chars, ret=%d 㿈+b -- "|H* 5 `5 "H, 4 5 #̢c@/Ő: @/   @*@* ,@ @?''b** * * * * **"`@cL  5 #`5 @5 cd#P @՚  @L`6%@㩐##`& @EL  b @GB packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xx @ `*`@ #La !&'"@ґ@0&@  (@ hc   V"h  / / / / / / //?" "@ ''Вb@ ??*`" * "* *Ⱚ :@B:Ⱄ@Pb " "B;b(8" "1 @"|:1"|#@.: L@. <  t #h`?"t'#h@.u: "|@.q   *@ , #L`j`b @F9 y!&'@"0@&&@""Pc`!&"X #@J  @ؖ# @  `&@"p"  `E& @ b@"xb  7)&#&  2 @" @bb  &  ޒ`#La  *  @&@ !&@"@@s#L+)&  "&   & `E "&& @"ؠ   ` '&#&'` ?"`* "@ነ     *   @ *   *  @o@@hb`Ӥz    nb 'b@  '#L  '&@A# S%'b$b@E&$b&@/#  '&#&`'3` ?"`* "@"     *   @ *   *  @@?@b𤄿Բ`@#(@"  `@#0   ?5 #L  ``?"`  * $ @ܐ @; `  ` `? (?888* 2 --- %s ping statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's printing up packets!%d%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms 㿀 `"@  * $@k @: !#`)@Y !#H)@T 8h) @N X ct`)@F p#H#h ")@< *` *  !)  @b|7 8b|@3 -͠"  @:o  @:kb ͠"  @:^  @:Zb  @^ "  2@b @b| Βx`@ b`@:`  "a 12 2@b84 Βx` @ b` @9` 2@ԐbH@;! 㿘#`H?!@9" @  $"?$`H$`HsocketSIOCGIFFLAGSSIOCGIFMETRIC㿘`<͢" !04`@L !@9 6V 4@ !?"bxb!@9 6 4@ "!T"!Tb0a~@9 6 "!"! getifaddrs%s: no such interface 㿐@k   4a@  `{ Φ!x `@F  2m@`@e ,` ` ͠!X @:{!  `"!!$ $ $ $ $ $ $ ` @J`  @9u @` ` 2 ``y &?@@ 9 @4 25@` `΀`!t`"*@!t  2` T   @ ` `\ `\` T   2 $ @  $ 2` ` ` " @` @l􀤠 4ΐ!a@x@:& 㿘X !`"X" 4""|!t8  2`error in parsing address string: %ssource and destination address families do not matchSIOCSIFPHYADDRaddress family not supported㾸ΐ  t????R'ܐ@ " !5@=N @^  @ " !5@=@ @^  `  @`5`@^ܐ `508 @@9Δ ax@o@!/ @!* b   x@!Δ ax@W0@! L@! b @8@aF 5@+ 0@(!@@invalid SAmissing SPIinvalid security protocolbad SPIbad security protocolSIOCSENCDSTSASIOCSENCSRCSASIOCSENCCLEARSAX 4@ՐΒax @ݐ@ / 5c@^` ,@`L@ /5c@^V @ڒ / 2,5c@^M L 5c @^D   @ז " !5@< @^6 @ @x @,'J  /5c@@^ @ `/J@  @8u 2 5cH@^ /b@7  !K "54!L!J50  50 @x#`0@u#p0@r#㿘 !Jo㿘 !Kh㿘 !La㿘!t` € 㿘!t` € 㿘@  ͐ ""|"`4㿘!X`!!  `6$!!t` ` @7m `$!͒ ""|"4""|Note: trailers are no longer sent, but always received 㿘6@# 㿘!t aX #aXSIOCSIFFLAGSxΒ!@ɔ b 0a@6 4`@ Βax @W͔`""x @@"xx  7a@6ה 6c@k ` ̈́d dd d㿘1#p@㿘1#h@invalid %s%s not allowed for the AF㿐@H @ @7a@\ !tR`17a@\ ch@ 1͐#@" p " h@cp ͐#@" t" lSIOCSIFMETRIC㿘!Π!Βax @k@D$ b @6[a 7@F"SIOCSIFMTU㿘!Π!Βax @P@)$ b @6@a 7@+"xSIOCS80211NWIDx  ???? @/!Π!Βax @(b0$ @6a怢 7@" nwid %s pΠ!"!Βax $ $ $ $ $ $ $ @b0a@5/ 7#@SGIOCGIFMEDIA%s: no link type?p!``#Ζ  ?????Βax @ِb0 @5̒a6   "!`8`@Z "!\!\ 8Β` x@\ SIOCSIFMEDIA㿘!``"#a\b * !Π!$a\Βax @預a\b$ 0a5@5 8a@% only one `media' command may be issuedmay not issue `media' after `mediaopt' commands㿘!`  8a@[̐ %8a@[Ɛ \ `4`@,`$\only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'㿘W!`  8bx@[ 8b@[ a\@ "bonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'㿘%!`  8c@@[e 8cp@[_ a\@R "bonly one `instance' command may be issuedmust specify `media' before `instance'invalid media instance: %s㿘!`  9`@[- '9`8@[' \?# @ ` `@`9``@[ *` $\  @x@p`hXIEEE802.11FDDItokenTokenRingetherEthernet ####$$$$%%%%&&x'h'`(P(H)8)0* *++,,,---..//00x1h1`CPCHD8D0E EFFccddeeDS11DS5DS2DS1FH2FH1CDDIMMFMulti-modeSMFSingle-mode16UTPUTP/16Mbit4UTPUTP/4Mbit16STPDB9/16Mbit4STPDB9/4MbitHPNA1HomePNA11000TX1000baseTX1000CX1000baseCX1000LX1000baseLX10FLFL10baseFL10STPSTP10baseSTP1000SX1000baseSX100T2100baseT2100VG100baseVG100T4100baseT4100FX100baseFX100TX100baseTX10AUIAUI10base5/AUI10base510BNCBNC10base2/BNC10base210UTPUTP10baseT/UTP10baseTnonemanualautoautoselect  xphXH@@(@ @@@@``adhocdasdual-attachALLRAllRoutesSRCRTSourceRoutingETREarlyTokenReleaseloophw-loopbackloopbackflag2flag1flag0hdxhalf-duplexfdxfull-duplex9 ` @2```2@:#9`";  @2` 2```2@; unknown %s media subtype: %s㿘9!@D? !; @Y strdup,unknown %s media option: %s㿘@  ;a@4 #;",@?2 !;!@X  @_)a :@0=㿘  "?` 2   @  2   2?%s %s%smedia %smediaopt instance %d㿘`  !;"HF@ ;"P;"X;"`P@:b,  -?# #;-;+;);`2  @ 2 ` Phbpb`@P`!b`@  @@    26 `;@Ɛ"6 physical address inet%s %s --> %s p;ج"`//! @Βax @  @ 0ΨaH!@10HaHaG!"@1͔ 3 ` `@ ` ! #\! @4ɚ ``";#"@1  ` 2 `@ɐ `#\! @4 ;#@c `@no networkinsertedno ringactiveno carrier%s: flagsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %d mtu %d%s: no media types?mallocSIOCGIFMEDIA media: status: , unknown supported media: p΢ <ax@"z<<" @(!T`<@Ր"!`<@ΐ" ``?"` * $@Ɛ @ ax'͐  ????? @#0 a6@0ߔ  <"@퀦`@.i*  <b@~d a6@0' 6<<b@~Y @" m @;`?"`` * $@u `?"`` (* $@c ( A `?"`` )* $@M )`?"` * $@? 耊 U-<@0#<l @ 7   '<t )*!l;<; @2 @2 bP`  ` ` @  *@`2іt <@#`?"` * $@ P )   @  /<-<+<  2@Ȑ  @Ő8  @c@`@ $ݢ @-`!t 2 @ 0 \` \Π!  ,  € $ 2 ߐ  inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %s㿀͐ b    "!`+4`@}: #Ϊ!ax @㝐!>  ''''@ '@M @㆐"0a%@/z  "!`1>@` $$ $$a8" 'bx . #$aa$ 0"$ $ a"@/S? 6 "!`12>$a$ $ $ @4 ᠒ax @F`!> '@@8 >@ x`0#$aa$ 0"$ $ a#@/? 6 "!`1>$a$ $ $ @ ᠒ax@    '!> @@ɐ`?"`਒ * "@ 㿘!t`€  "`@`??` *` "`*`  inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime %s0infty vltime p b    "!`+C4`@|    ! #\ ! @1 "?; "`/?@1 bx؀ H)Β ! @/!x @` 0H a"' ' ' ' $' (''@.F  "!`1" ?@+   ?  ?//?'P !#\! @14 "?; "`/? @ ! @/@!x @ 0H a%' ' ' ' $' (''@.  !? "!`1 ?@    Ȓ @@ ! @/!x @ 0H aI' ' ' ' $' (''@-Ҕ   "!`1?@ ` ?@ 耊 ?@!耊 ?@!耊 ?@y! `?!0@s D`b ! @.ʐ!x @ᤐ (0H ' aQ' ' ' ' $'@-' 6  "!`1"@<?@n!@;< 耢 "4<@ ?@9!X`@?!h@U"@?!p@*??@%!x?@"!`@?!h@>"@?!p@<?@!x<@ #@㿘!XSIOCGIFADDR AppleTalk %d.%d range %d-%d phase %d--> %d.%d broadcast %d.%d㿈> b    "!`+4`@z Π!"! ax $ $ $ $ $ $ $ @0a!@, 6! "! 1 /2 @ ] $ " " " @א"! x@  ?? ` `@ " @ bx # 0a"@,ʔ 6! "!`1>& $ $ $ @ !x@པ  "@ # @x bx  Π! @ #0@l `?"`਒ * "@e  ns %s 㿈 b    "!`+4`@z Π!"! ax $ $ $ $ $ $ $ @t0a!@,h a "! 1 /2 @ c $ " " " @D"a !x@V` 7 !A7 !7 7 7 @'Y7@bx .0a"@,1 a "!`12>$`& & & @ a!x @$  !>7  7 7 7 7 @'(7@Ӑ`?"`਒ * "@̐  0 ipx %s SNAPframe %s X b    "!`+4`@yu Π!"! ax $ $ $ $ $ $ $ @ѐ0a!@+Ŕ a "! 1 /2 @  $ " " " @"a !x@߳` / !A/ #/ / / / / / / / / @*0/@Ubx :0a"@+ a "!`12>$`& & & @c a!x @u  !>/  / / / / / / / / / / @)/@ '1c0 '' 1c '1('̐ ''1cB !7'ܔ''''` # " ``` "`@2```B@ ``?"`` * $`@ݐ SIOCGIFADDR_ISO iso %s SIOCGIFNETMASK_ISO netmask %s SIOCGIFDSTADDR_ISOh b    "!`+4`@x{ Τ  Ȫ ax?????? @ِ"0 a!@*͔  "! 1 /2 B g????@# ax@޼!B#@)%@w"0 a%@* 6!B "!`1 B  ??? ?@# ͠#@)@Y"x`""0 a"@* ax "!`12 B  ????@e#ax @x!> @(@4`?"`਒ * "@- %s: bad value㿐 L.`  `, ,  @O @_ @*o 0@,   #@ @*$ Cbh@P %s=%o%s=%x㿘  N  C.`C#@@ٕ2C, #H@ҕ2r ``?"``` <* &`@Đ * &`@g >㿘 \.`  `*@ *`` @B Cbh@O 㿘 \.`  @  Cbh@Oϐ `, ,    @* 0$ $ $ $  * "@  * *      " 2 $ " 0   8 2 `8 씂8 2  &  AppleTalk does not use netmasks%u.%u%s: illegal address㿐͒ "*"`,`Dc@OY Dc@V D` ?#@  (`Dc@O<  4`,`%hu-%hu%s: illegal net range: %u-%u㿐 {77E`@VR  E@ E`@O !h2 2 12%s: illegal phase㿘Ea8@ Eΐ *aha@@ Eΐ *ahaH@N  atalk %d.%d range %d-%d phase %d AppleTalk address is not in range㿘# ah ah ,ah  2  4 4  E !  @ ah   8E  Ea@N ah6  6  6 Attempt to set XNS netmask will be ineffectual 㿈 l.`   ,, #@@# 耦`4 4 4 4 4 4 E@~ސ"ȁAttempt to set IPX netmask will be ineffectual 㿈 |.`   , ,#@@& , 逦`, , , , , , , , , , , 24 E@~#㿘.`  @% @( `  ,,  , ,㿘@"`negative NSEL length is absurdsetting NSEL length valid only for iso㿘@ "`8F`@M !t FR  a@M  ;* 㿘!    usage: ifconfig [ -m ] [ -a ] [ -A ] [ interface ] [ [af] [ address [ dest_addr ] ] [ up ] [ down ] [ netmask mask ] ] [media media_type] [mediaopt media_option] [ metric n ] [ mtu n ] [ nwid netword_id ] [ dstsa address/spi/protocol ] [ srcsa address/spi/protocol ] [ clearsa address/spi/protocol ] [ giftunnel srcaddress dstaddress ] [ vlan n vlandev interface ] [ arp | -arp ] [ -802.2 | -802.3 | -802.2tr | -snap | -EtherII ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] ifconfig [-a | -A | -am | -Am] [ af ] ifconfig -m interface [af] 㿘Fa@!@(  vlan: %d parent interface: %s 㿀 @bΖ0a: @&"?` G PG p@}} SIOCGETVLANSIOCSETVLAN㿀@,2  ""ࠐ@f ΰ!#b0& a:@&?bGa@t$  7a9@&?Ga@t must specify both vlan tag and device㿀 `Ga@Lΐ @1 ΢!%0a:$`@&\?Ga@s  @Y`7 a9@&J?Ga@sސ 㿀@  ΢!%0a:$`@&4? Ga@sǐ @ a9@&%7?Ga@s %dd%dh%dm%ds%lu㿘!͠ XGx@삒!㿘@㿘 @@`@㿘 @@`@㿘`< < ` 4   ? $`$  ?㿘`< < ` 4?    $`$ ? 㿘`< < ` 4   ? `  ?㿘`< < ` 4?    ` ? 㿘`< < (`( 4   ? ,`,  ?|㿘`< < (`( 4?    ,`, ? i㿘`< <00@4 2  <44@( < `<00@4? 44@?>㿘`< <00@4?2  <44@( <?`<00@4  44@ COLUMNS1ACFLRSTWacdfgiklmnopqrstux㿀'H@   !'H@#O#x @"a`h @$ `"!Β "!"<9ΐ "b -@r   "a'Δ#)71/3;+'~%΀ GyJ* @€ '"%!$b8 %%!'"$j$b8 $b8&%!'"$b% %!$%\'" $%!'"$b8U% &$b8'"O% &!K%, %,G&! C"a ?@  =&b   8" "3&b  /"b$ +"$ 'b&' ""b  " "< "b %a "  "@ %a "b(@HH@ ?~?!H*b8'H`& b b8 b8쀢  b8b b8a " b8  䀢  b(쀢 " b( 2 b8  ΀b@Bbb &!: 'bb $a H  ">  ": G42, H,a$! H&H#\ H  "  " GcP, H ! HaG$" Lx O b8 M`d"! O"aN"ȀH@f!@_ @$b0 $ & & & & & & & & & & & & & & & % & $ & & %| & & & & & % & & & & & % &@ &\ & & &x & & & & & & & & & % & %\ % & % & & % & % $ % %D & & & &0 &L &l %l & & %( %s: %s: %s: directory causes a cycle%s: %sfts_read㿘"$` L"t@BA   @p @D@r !䀢`d" ` `  @L5 " ":J  "N`@0B6 "5`0= . !V`2 !耢`3!Ѐ J`@y"  J`@y" $!В@DB@0  @D* 0"@w`@0 `!J@(#`@@wΐ "b0@BӐ 2`4 Jc@pF %u-%lu%qu'H'D`H "` 'h"8` !`H 'hH''' ''|'x't'p  'l4 D@۠@J@wQ $ ""0 2 L@2&!䀢`2&$ .2 &!耢`2& $  8'h  <`8`< (``<` 8'`  8'`08 `0`4`0"8` v'!`K! `   @荐K! ` @膔  ` @2 `@2 @#p4'p@# t 4'tb  @/S`DM K!(@"x@ 4'x    @q    @om  @.$   @($ `<    '| `  $ @M`-"$@l$l 'l2-4l`L'h'H 0'|#K''̢a0 @@"'t x''@@"' @@"'K 8@@"p?!ȟ@"8ΐ  "aH@㿘`4"2 @ 4`+ `  ` #   ? < R`2 !䀢`2 ΀`  ?!̒ €㿘@ 㿘  "  @ ` ?"`* "@ʐ   2 total %lu %*u %*qd %s %*u %-*s %-*s %-*s %3d, %3d %*s%*qd xR 2`""8`!` b!M  @@w+M)<9M5M7M/M3M-M ""`<  @wo`!` ; `8 @ 8@두C @wZ``@<  ` #\ $ , @wK#`b 8 @wC `  2  `@@w6 `΀    (`0"@ `P@w+` (`@w%`0",`@<`0 !`@5`(0@2` @v@a쀢  "` `  2`@``(  @*` ?"`* "@ 2n 㿘"`   !`  !쀢`2"`!`*  @א&@@Ӑܐ 㿐͒ # a܀@!!@*` @tƐ 0| &$a` !` .`"```2` @@ 2R 2`"8`!` b!M @ؐ@vf B7)     `?`$``@  * % @O ؓ,  @ِ ` ?"` * % @. Ĥ㿘Τ" `<M` @v!`!M?`8  ;` ; @@3  @u@]@a쀢 "` <`  @`㿘'D@,D#`  L?`&  @  `* $` @В  $ "@`   L?`&  @  `* $` @  $ U`D;!@y    L?`&  @  `* $` @  $ 0```?"``` * $`@t    L?`&  @  `* $` @]  $ ``?"``` * $`@G total %llu 㿐R mR 2`"8`!`b!O "@  @u  >' 6􀥀` ? "`* $@   ٬􀥀    `?`$``@ * $@ 2 `?"`਒ * $@ϐ 㿘"`   !`  !쀢`2 `M%` E >` ,?"``* $@ , `&a ` ?"`* $@  ` ?"``* $@s   H ``2` `?"` * $@[ 㿘<(@- @@ I0L0@-8@8 I0D`?"``M /F /`?"``@ |9 |`?"``3 @, @`?"``% = =`?"`` % %`?"`` *਒ ** "@  %s%s/%s ls: %s: %s -> 㷘V 2 2  P @@t$  P @@j$@̔#P "a!#P!@Jc@ 0, @s#@㿘N *%#LJ `*b<  ?*:  `?"``  * # @~  N  usage: ls [-1ACFLRSTWacdfiklmnopqrstux] [file ...] 㿘Qa8@!@ΐ 㿘@{$OpenBSD: sysctl.c,v 1.53 2000/06/30 16:00:10 millert Exp $vfsddbusermachdephwdebugnetfsvmkernmsgbufsizearandomsysvshmsysvsemsysvmsgfsyncnosuidcoredumprandomusermountsominconnsomaxconnosversiontimexntptimerawpartitionmaxpartitionsdomainnameboottimesaved_idsjob_controlngroupsposix1versionprofilingfileprocvnodeclockratehostidhostnamesecurelevelargmaxmaxfilesmaxprocmaxvnodesversionosrevisionosreleaseostypeswapencryptuvmexppsstringsloadavgvmmeterposixkeysipencapnatmisdnpipinet6ipxrtipcntcoipxtplink_layerrouteappletalkhylinklatdec_dlidecnetibm_snaccittdatakitemcaisoxerox_nschaospupimplinkinetunixdiskstatsdisknamespagesizeusermemphysmembyteorderncpumodelmachinetzname_maxstream_maxposix2_upeposix2_sw_devposix2_localedefposix2_fort_runposix2_fort_devposix2_char_termposix2_c_devposix2_c_bindposix2_versionre_dup_maxline_maxexpr_nest_maxcoll_weights_maxbc_string_maxbc_scale_maxbc_dim_maxbc_base_maxcs_pathvsyncblankled_blinkconsolepanictab_stop_widthmax_linemax_widthradixAanw㿘@#)'%!R+"  n A 0 w  0  $b %" $$@ =@ﻔ#?〢 aa* @ b "  @β @ " Pb @@ `@ 2 @@ @@A `@ 2@@ 㻘@ ##@η/@` . , `!@. @`"`@"@` &@must specify -w to set variablestop%s: class is not implementedsecond%s: kernel is not compiled for profiling%s = %s offrunninguse pstat to view %s informationuse ps to view %s informationuse xntpdc to view %s information%s = %.2f %.2f %.2f can't find ps strings%p use vmstat or systat to view %s informationuse netstat to view %s informationuse nfsstat to view %s informationnfsillegal top level value: %dname %s in %s is unknown%s: illegal value: %s%s: value %s out of range%qd%s: value is not available%s: specification is incomplete%s: type is unknown to this program%stick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s = %s%ld 0x%x %u %s: %u -> %qu %qu %qu %qu %qu %qu %qu %qu %qu %qu %qu %qu %qu %qu %qu %qu %qu %s%s: = %s%hd, -> %d %s: %d -> %s: %s -> %qd %s: %qd -> %s: unknown structure returned%s: unknown type returned㺘Ȓ''#@̀'/ǐ@` =  '%S*!"` =Sa@?ʐ @N**`L'   ` ' @ `  @Y''"@A?I '@ @'",   "S@n !01 Sb@e 0'aؐ@? , @'Ȕ `? ''X |* €̒?`X *` € ''АȒ  @[ ?π`"`SS!@oS@͐!0"`S`"S" S"({ `Sϐ"0`Sʐ"X`SŐ"x״ մ Ӵ Ѵ"̀   @4b S"@oqS"@oe#\0)  'Ȓ  @ ?π`"`SS!@oLS@n"0"`SS"@o@S@o<"0} `Ȗ@!; rSi"̀ * Ȓ@ b'Ѐ``Ԁ `fԀ c` ] "#\@R Ȗ@ 9'E `Ȗ@̘ +S"#  '1'Ȗ@ ('0̀  Ȗ@^'Ȗ@'  `SS#0@lҒcX0S#`@l͒ 0`S#@lŔ0 7  )$2 ""!@3 '@E 'J`S #! "S#@l0  'Sc@E@ ''$'Ȗ` @Ȁ?$` "! "T  T H -2TS#T  @ T H@lg0"`TS"@n6T̐ P@n.0o"` T!T'| @m|@n0^@n 0Z  "`2TS"@n T"`TȐ @mT@m 0:_"`@S"@m@;?p0;8?h;;h;`h;p ;x;;; ;(;;Tp t l%T@m#\HH, @ @m   ,  ,  @m   ,  ,  @m   , T@m!0ڀ nb  T`!T!T!  @m ") 1T-T%T, 2~2 * Ȓ `@.@  +  !(08@mj2 *`2 #  ) T!@@ޒ  " 3T1T-T, 2~2 *  `.  +  a(!08@m?2 *`2 #  `?"`  * o% @2 0k?`cW#*` €  "`2TS"@mT"`TȐ!P@mT@m!H0C  "`S"@l@05"`T!`@l@0*  "`S"@lܒT"`TȐ!x@lВT@!p @lɔ 0 T!@jޒ0T!@jْ _ ^t ^ _P _ T T T T T S X( X( X( X( T X( X( X( T X( X( X( X( X( T X( X( X( X( X( T S T Wl V< WX X( X( X( X( Wkernel does contain bad dynamic port tables, cannot mix +/- with full listinvalid port, range is %d to %d㿐@ɒ + !@Ɍ - ]!ΐ @'"H @ ?`\ XS!@lPX@r 0s ;X%X-5X + -@;ڐ @T`~* 2 ! + "@;̖# *`2 >2* ,@@ $ 2 >2`*` ,@*$  ;`@c 7bHJ@  @1bH"H @g @@ * 2 !*Xa "@;#22*bH  * @#   X`@cʐ bHJ@ bH& @'㿀" (`(Hb# ( β "' ' $ %''  @Y ?$$&cHconfmaxtypenumdoasyncfreedoreallocblksdoclusterwritedoclusterreadiothreadsnfsstatsvfsinitffsmountsX" P`   ''''  @ !ϒ`*`@6' $" @*!@**  $"@K0 @*!@*  $"@<@:0n @*  ( cH' N'# θc4" 5Y3Y1S?'  @ƚ   "!`-/@i?@ b0@@P`Ѐ  ""`@E#X  ""`ԑ- ⠠"@@ub "@@"`@:  bY"cH ؔ ""#?b# "P"Tthirdvfs print%s has %d mounted instance%s sh ";0>"Yc@6 &&  ('̐& Ж̘ @I   "!`-"Y@h#0耢"`Y cY#T!8 @0T aH@ ?No variables defined for file system %s㿘"* @  @$Z!@h| ? Yؒ ?@c?b* + &&@   '?setuid㿘 Yc\?!c@d#\  &#\*`  '?keysdeletedkeyscreatedenable㿘 Yc|?!c@:#|  &#|*`  '?etheripmobileipahespgreudpegptcpipipggpigmpicmpipmtudisctimeoutmtudiscipsec-auth-algipsec-enc-algipsec-firstuseipsec-soft-firstuseipsec-soft-timeoutipsec-timeoutipsec-bytesipsec-soft-bytesipsec-allocsipsec-soft-allocsipsec-pfsipsec-invalid-lifeipsec-expire-acquireencdebugmaxqueueporthilastporthifirstportlastportfirstdirected-broadcastsourceroutettlredirectforwardingerrppslimitbmcastechomaskreplallowrstppslimitmssdfltsackidentsendspacerecvspacebaddynamicslowhzkeepintvlkeepidlekeepinittimerfc1323checksum%s: no variables defined for this protocolfourth㿘@ Y`9?c@F.`a & *`  @  [@g"8?@ [p?bh@!  & *`  '?pim6icmp6ipsec6ip6udp6tcp6rr_pruneuse_deprecatedkame_versiondefmcasthlimauto_flowlabeldad_counthdrnestlimitlog_intervalkeepfaithaccept_rtadvsourcecheck_logintsourcecheckmaxfragpacketsmrtprotoforwsrcrtmtuhlimnd6_maxnudhintnodeinfond6_useloopbacknd6_mmaxtriesnd6_umaxtriesnd6_delaynd6_pruneredirtimeoutrediraccept㿘@ Y`49?c4@.`g & <*`  @  [@f_"8?@ [?bh@l  & *`  '?spxnetbios㿘@ Yc9?c@H.` &#*`  @  [@f"8?@ [r?bh@#  & *`  '?.%s: incomplete specification%s level name %s in %s is invalid㿘  \@_cx  \#@eՒ? . @`" @ 2 \#@e?usage: %s %s %s %s sysctl [-n] variable ...sysctl [-n] -w variable=value ...sysctl [-n] -asysctl [-n] -A㿘]]]]]`xఘ ؚ`@Ԑ!@ 㿘@sumo:12illegal argument to -o option%sstdin㿐@c'D]aX@ `8]@ȁa` ^__" a_#aC͚}-4pw0Gm=K9V'#C.=* rOx ͻK} x|VqiuԍkoRlbf^FZ^[W}S`fM0cIZ-D @Ɨd 'NK`#%▒+/l6/A ]h@D+f{*uP6&;>k;qv2PUMƼ_}>1ֆոy4:Zi mY`ۀdO7z2~ɋs\wKO VKF68BG+\{Xf=U@QC]S%;!&),(^G6MB2P?v,;Zk&ˑ HVнMR#/VKm`lp+ =eh 'ޥdo#j͡`볽>~ɴ}:̣y{6`Ɵ}q[uF2 -tq0]YK.TPɶ@NEJOG +C{}!C`rFOv[h lGJa0e-$KZV^pm0=5^ [7Q3R>?:Ѐ$Ѝ V:-)Tũ&yh;+֭PlM/kv|`v#d'sĉ yྀ:gК՞}b> q 2+ߢ6hfmu{ڵ6]@?c` 8"`  !] #4`0 @ * *` ,`(  $ ?@ 4ߤ  &]# 4`@3`*` * ,`+`4  8&@  8% %lu %lu %s 㿘_!(@eg "__!0@e`_@e]!8㿘_!(@eT2 "__!0@eM_@eJ!8㿘_!(@eA2 "__!0@e:_@e7!8?c  ?#@`2@ 4`  ?@3 4  &@& ?c    @@`?@ 4  ?# @4`@ @4` &@&  㿘@tsetJ뀠0 J@, @`L  * PJ ( P"J@"2  J` J@ @ `L (P* 8 @`L@ *`P"(8"tset: 㿘!!`H'H'L'P'T'Xa@А@=`@Ȓa@א 㿘`a@!@@͐ write to stderr㻘 @   @ K?2`ߐ!@ Y$ Ԑ@ 㿘!`? "`` *:  ! * #!@ Terminal type? [%s] Terminal type? 㿘 P @`@ba@q %'+`)`-``b@U@P"@1P!@?P 2 `2@?@N @ 2*LP `"b ( 2 K n  , X   `  % K K K  23040011520057600384001920096004800240018001200600300200150134.513411075500unknown baud rate %s㿘N B  `#` ` 2  `2 a!0ڒ malloc><@=!:illegal -m option format: %s㿘@@   aҐ!` $"`" `""`a$ a@v$  $ K$ @2$  @?ߑ* : `a#*` € : $  4 $     $ `*:  : "a `@ : .@u`$ ` $ , 8 $    "$ a!N$   , , , , , , , , , , , , , , , , , , , , , , , , , , , 㿘 G  " @Ӓ 2; `1b!*` €+ R` @$`?R  @  R  @  R  @    R  @    `"  2  L p ,TERMunknownTERMCAPTERMCAP=tset: unknown terminal type %s tset: can't initialize terminal type %s (error %d) 㿐 2bb@ ! @e  " b@`~@$p "b !tb@ !Ȁ .J /"+N' "ሢ `"$N+b a@  ሒ`",` `` "@N ``N ? !N    !%b#b!@00!@,b  @q 㿘Р P @  "  `,    ,   `,    ,   `,    ,   `,    ,   `,    ,   ,  ? ?  c @ # k!, $$ $ $  @6F 㿘1 J `"  ܀ "  @  2   `J㿘Р P ` & `P ,  `, `P  a & `Pa a  `*`P  a  a a  `*ДPP ! P`Ȅ" " H  `H`Ȅ >"# P`H*  P  P  㿘@I a$!  a耢 `0@b    a쀢 `0@bu    a `̀ " d   a`?"``! * $!@ @!@h# 㿘 Ȧ`b I ` E a`?"``! * $!@} `  `0@b `  #d!@`Ȓ  @b"0 !!`?"``! * $!@N  %s %s isset todelete. backspace. control-%c (^%c). %c. 㿘В`|В` @ P  @: d!耢ad!d! @r `d@kb0" `܀`` @@ `J` `d@Xb0 d`@b @O 0db8@I-q-e^H-i^C-k^U㿘 >'d%d#d!dJ@ -  J 2J@(h -2)   "J`J -2! J` e i k2 J` 2 J i" cx k ep  # @R&  2usage: %s [-IQVrs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] 㿘e`!@@   "H^ aH?  aHstandard errorreseta:d:e:Ii:k:m:np:qQSrsVarpanetdialupplugboard%s Terminal type is %s. EraseKillInterrupt%s No termcap entry for %s, only terminfo.SHELLcshset noglob histchars=; setenv TERM %s; setenv TERMCAP set noglob histchars=; setenv TERM %s; unset noglob histchars; TERM=%s; TERMCAP=export TERMCAP TERM; TERM=%s; export TERMCAP; '; 㻐Р P@  @ `Pe!X`P  |" | "` "` "`  "` "` "` "` $"`  ("`("`$@2`@]/@e@ ah   *a      L!e`4Gg t*` €B  "!em!< "!ef!5)* : -"a+  * : $"a* : "a "!I  "!eB!      @$I @ݙL@@t!p??!*`& @ @3@@ &/ <'1 !R`R@ & $ `h @|`       `77`g@f "`JВ |`P@ͼ ,  @3 @@ e!@^e!a@ke!Ȓ Ք e!В Д e!ؒ ˔ O  e!@]@fe!mAe@d" "e@#e?@b  eO e"(e"`e"e"b@]O`! `?"``  '* $ @ '@%e#@+ @(   |  ( D ` ( ()%'&*+#   $ "!$"#%&!     tsr2  u0kbok p r3iv4jzj`% w.-/f l43n5m+, 601279:O=SW;<@?ABCDEFGH    IJKLVMNTPcQRU>8Z[\]^_`abcd1vwxPJOIQKRMHdLg*)hstuiN!\~]ye"}qAB&()C*Xe|~+,z{|DEFG@lmnoZ-S[6hg/x.'7y8TUVpWXqY9Yf{}#$:;<=>^?_5 !"#$%&'(a%#&(*  )$ '+!"$ "% !  #&tsr0123b ku  v4jzw56789:;{!"} <#=>$?%&'()@*ABC|~D+EF,G-./f0123+,456789:;<=>?@ABCDEFGH    IJKLMNOPcQRSTUVWXYZ[\]^_`abcdefHIJKLMdgN*)hijkOlmnoPpQqrRstiuvwxyez{|}~Slmnohg/TUx-.VpyWqXYZ[\]^_` !"#$%&'(a() !"#$%    '&*+  $"#%&  !hgn ijk    fl+,copqdpez{|}~mq/.rrytuvwx0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abs&5 k  j%)*./ 024361ABDEFGHIJKCN9;?TPM<>QRU@V87=XLOSY:WZ[]^_`abcd\' fe!"g*)hwstxvuz{|~}ylmno+#-( !"#$%&'(,$- i㿘     @& & @ @& * 㿘`na& 0@ג㿘@ @}R ",  "R  0! 0R ! `"! `  R " `"ԓ*  SVr1SVR1UltrixHPAIXBSD, , :\ :%s: sorting by term structure order %s: sorting by terminfo name order %s: sorting by C variable order %s: sorting by termcap name order %s: width = %d, tversion = %d, outform = %d 㿘Т*`"̀ 5" xnb@ nb@ nb@ n b@ؐ n b@ϐ n  @ƒb А "` к" а`I" o#.` €cXІ!# #` nalxLІ!# #` n#n#n# "ann"`Ԗ# !#` #$!Ѐ"  0E- 0@>!n!@c(7 !n!@tcPggg!Ha  !n!@dcxiii! aX!n!@Uckkk Вa"# #`  !n`x!`c@=  $ l $    0  0 H ? *` P? ?  *` ? Pp(" ` 0A 0>`< : `"` 1 ````(& "瀢`݀ `   0  0         |  @㿘!! А "Ȑ $ ā㿘@Тa@  Ā`  x@ @ !!Р ԒאԐĐ$ā%?%pe%? %%%%c without %%?%%; without %%?㿘pb@n    @F 2pb@b@ N +Ц` 7p*`:  e"$  p ;"j  ? % 9 \  9 t   `a    9`pb *?@є   -p  #p bD ? = 9 n  -p%p` - ? & " N ?~`P`2NNN@INA9Ѐ` `  *? -p3p b ?   0+p@ܐ" 9Ѐ``-p  *?#p` bڔ ?  Ӕ  9В  ˔ N F@%s@%s#%dim=ei=%s=!!! %s WILL NOT CONVERT !!!..%s=%s=%s=meml=%smemu=%slqkxjmwuvtnbox1=x?#?'Tc*@  "@` o"! c!Р Ԑ !  " ? ܶ"P5?#7q +  ` -  +  " " $ * @ ,    (  "(`  L O L T"  @@6 @804X    +Ā " =  V?#+q%q &  ` -  &  $  "" $  * @ ,    *  "(`  L O L T"  @?,  R@@b@0@~H 4    &`Ā -@o 2  2  &,`"  Ȁ "  @O 2  "  a쀢 "  @Cf, 2  "!  ?#ж !  ` -  !  & "" $$@   * !,   2    "(` L OL T"  )   Ѐ`ᰀ   ,  |@   q "P਀@    q"X ^' @?/  ,    ?  ?c@"@ qb@@7   ^"V4 m, RT @@} <  ?qb`@6  c qb@@ @*` ,!` \L : \, ,2 @ @ ,` @ *` ,`  qb@^   @_@֐,  T@`? qb Ѐ` #   ` @@5 `  ? *   &l ?#qb@  &pDq?#b@09 ;` "H?5 3q?#@  `L@`  @H " , ,q"?"ccc7  ' T`?@ @H `9Ж    ԐJ?`  J?  ?"  Ԓ J :J J  J \ ?" А` `* "?ܖ@`ԁolder termcapterminfo# (untranslatable capabilities removed to fit entry within %d bytes) # (sgr removed to fit entry within %d bytes) # (acsc removed to fit entry within %d bytes) # (terminfo-only capabilities suppressed to fit entry within %d bytes) warning: %s entry is %d bytes long # WARNING: this entry, %d bytes long, may core-dump %s libraries! 㿘 ` t!# @y t"#   V` St@O" Ftb "`bH"b @O t"bH"@O #3` &`t@O"{ #!ta@q0#@ۖt#0@Or&`"" "bH`@`%s%suse=tc=Р   ?#`u`aXu!`u!h@ ?#  @Ȓ` ` comparing booleans. comparing numbers. comparing strings. use㿘2`u!@`` 5 +  ` ,  + `"`" #`* @ +   ` "(`  J OJ T"`  ` р +2`u"@f`` 7 &  ` ,  & `$``"" # `* @ +   ` "(`  J OJ T"`  ` π &2` u"0@%``  9u!  ` ,  !`&` `$" `"#@  `* !+   ` "(`  J OJ T"`   `  ̀!uH   㿘  ? " @s *  @ld `"  2 D !? " @_ *  @lP `"  2 F f(? 2  `Ȁ? " "f( "  f,? 2 a쀢" a耢? 2  a? 2 "f, "! R`B?2 R`? `  ? 22`B  !  `v@(!`?, )  8? " @ *  @k `"  2 H "? @ *  @kݐ ` 2 J㾘 "H?[ Y  * :     "H J` 2J *  `< !@  H `H J@ +@   HJ `2H  ,`K@ "  "H*@   H *@  (K@  "H*@   "H*@ TERMCAPTERMPATHHOME%s/%s.termcap /usr/share/misc/termcap@x >w@Ð! wL /.w@! @E>$)$@w@! "L "@j !# wwa@Y$@wa@E$*@E$$@`O  J@  :2`*@`J@  "` :"`  $@`@ܒ`J@ 瀢 $@L  / @= +?'t@=t t t@DԔ$@C : ?L 2,? t ? ?@? ?termcap names not colon terminated| %s%s:\E\040\041\054\042\047\140㿐'D@ : 'x@CK Px*x`'D)x!-x x`@ 2  x @L` @D@ 2N `?"``  :* L @ `   N  `2 oWN倢`E?x#*` €x@L% x@L" FNx@L ANx@L 8!@1p"@03.2 + ( & # !              ؐ 2`Ԑ ے ~ݐ ?'ٚ #"T"''//aa (' ' ' ' ' ' ' ' ' $''`@͒ ?2$WARNING: terminal cannot %s㿐!@`  Ѐ`{'#p@/kLINESliCOLUMNSco㿐`䀢?  z#@U  $  $   @`h  {"!@$#Ѐ "{@f@ #"aa   "a `h@  {򀢠"! @# "{@f@ #"a a  P"a krklkukdkPkNkh@7kDhЮ|!H'@   1Т"ؒ@ܐ@  ,@  ,@ @ϒ@  ,@ |!P'@ o "ؒ@@o  ,@  ,@ @@b  ,@ |!X'@ P 3Т"ؒ@@O  ,@aH@@E  ,  |!`'@ 3 "ؒ@@3  ,@aH@@w@)` , `|!h'@   aH@@d@` ,@`|!p'@   aH@@R@` ,@`|!x'@   "ؐ@@@  ,@ |!'@   "ؐ@.@  ,@ |!@ '̦ "ؐ //Ҧђ@@ʐ  ,  , @ @  , a˨ //ђ/@@ a ,a쀢   //@@ , aH@@@UTERMunknowndumb:hc:hcamxndadbsgpcksketitececlear to end of linecdclear to end of screenclclear screen cmsoseusuemdmembvbbsbchohome cursor|^llmove cursor to lower left of screen alsrscroll backwards㷐}@X!؀ }!@ ܐ 4 }} /?}@ !@.,}@ ""a}@ ""a}@ ""a} @ ""a\} @ " ؀ "`"``#!"a#a"h "  l"!Dђh} '@ Ð"(Ҁ`" h @* }@ "0Ҁ "`}"8"`}@ "@Ҁ "`}"8"`!!Ҁ`# Ѐ`2  }@ "H$ }"P@ $` `}"8$ ` 2}}"8$`}@ ~"XҠ " `}J@ 2 }}V"`}"8$ }@ g"x!\Ҁ`"  }J 2 }}<"}"8$ }@ M"Ҡ " |`}J@ 2 }}%"}"$ |}@ 6"Ҩ " x`}J@ }"8% x"ap "ap}@ "Ң" `2}}"8$`}@ "ȒҠ" `2}}"8$ }@ "Ҁ"` 2}`"`}@ "Ҁ"` } "`}"@ Ҁ" }` " "@ Ӑ"Ҁ "`}"8"`}"@ ȒҀ"ࠀ 2}` " "@ "Ҁ "`}"8"`}@ "Ҁ"` 2}}"8"`}@ I# }#}@ #Ҁ "`J }}#"`}#@ ` x}"8 xJ@ }"8  @0 @Đ@u @'}} @r0"`l}#8@ \` x}"8 xJ@ }"8! @ @@H @'}}@@Eh"`t}#p@ /`}}"8}#x@ # a}"8aЀ  " p}}@8"`p  pJ`"!| 㿘!!@Ff$  㿘N  N@ 2Nϐ "N@  ݐ6㿘!``#!#a@F8`@F3a "`㿘!`% `#!#a@F`@Fa$㿘`l@F 㿘`p@F㿘`t@E 㿘`x@? @E 㿘!`@@*Y 㿘 J`! @EՔ㿘`|@E˔㿘`@E’ 㿘!\``@E 0`@E 㿘`@E 㿘`@E 㿘`@E 㿘`@E 㿘`@E 㿘`@Ew 㿘`@En 㿘`@Ee 㿘#!#` @E[@)ϐ `@EU 㿘`@EL Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracket㿘 ?@*?@  "!  !@v ? 0񀦠@  #H @) 0#   @A ?@D$?쀢 @)Ò seek errorread errorWaiting for data㿘Ң  `$  2 `( @+` 2 `  ?`a0    !耢 `@ 2$!0` $ & & `Ȥ  $ *` @ @Ҧ ? 4`2?@(?``2``` 2` y ?@쇖 ? `Ȁ2 : "p@)E g?:  ?   $`Ȓ # @'   `  ?*#  ?怤  "@)! j  Ԁ   `@z `Ȓ <  B;  & !` ; 0 "@)? @w  !Ā`2?`` "` "& &" "`  ( j`Ȑ  ch_ungetchar overrun㿘? ! ?"@(ɒ $ Finishing logfile㿘`Ԁ $  # `0?`4? ""X@( !@?!Ā @RԒ?$$`܁Warning: log file is incomplete㿘 Ȫ`cB  gB 3` +    )'``Ȁ@2 ` #@(m    2@` @ʒ``ȁ"  2  2 㿘@ U? 4Y @ 8T  cF  Ȣ3` + @ 1 @*`Ð %```42 `8,  `@?!Ā```2 `@ `Ș  $+   cF + 3` @* @ ( 㿘1 ` @`  :0@;? 1  2 @B?!İ 㿘 w   2  `Ș@&  2`Ȱ "`("`$?0?$(( 8㿘 Ƞ$@ (  ?  ?`(#4`$ "`("`( "`$㿘 Ȱ`( ?"`(`$$#?`     ?# $" (" $ $@ ( @ Cannot allocate %d buffers㿐!#  @6 @I   Ȑ`` & @''  `2    seek error to 0㿘`  ??#:0  ?"  2"  @`  Ș :0  :"$"(  @ ?!8@&ޒ 㿘 @Ï$  Ȓ?   " """"@" 㿘 @   # @" @  `" 㿘  @ۖ ?  㿘#@$`Ҡ  "`Ȓ 8@E ?  ??" : " : 0$ " "" " " $" (Ր  ` "``@  ` ?""` d㿘 Ȣ`  `Ƞ `` 2   2`@ ` `Ȑ?"`  @``$`@֒ ȁ8bcccbcc18b95.bb125.bbnext8bcccbcc18b95.b128.koi8-r8bcccbcc12bc5b95.b.dos8bcccbcc18b95.33b.latin18bcccbcc18b95.basciiinvalid chardefchardef longer than 256㿘N ؀` : +*:  9   06,  . a0 b ca0     * N?? @% R Ҧ!%@*,@@%ے G ,@? ` N Ґ!؀@,@`@*,@invalid charset name㿘 "  N   0 `  @E "   2"h@%  㿘c@M  L  `ؔ  J ` * "* *  *s<%X> J*J*"J ksd  , u ,  ,  ,  ,  ,  (LESSBINFMTLESSCHARSETLESSCHARDEF㿘@ X@ hv @ x  J@  0Ґ  Ґ  %cESC^%c㿘   !a0 !a8@   @ܐ  !a@@  !(!Ҕ@ а Ё҄""T("bP"X㿘@y!؁㿘Ҧ bT!؀@J !$TJ"P@c"PT"@$"P. N 2 P@jP@TN *: @$8@@ N@`P@LP@!p`  T!؀@M!؀   㿘1"TJ " f"T`@$ &"T@P @"P㿘Ҡ"T a؀ ("TJ? "T "TJ? 0؀ J?   o"TJ?  㿘bTJ  "TJ@ 0 "TJ@   㿘%TҐ!؀@!bT$bTJ@箰"P"@$"PN  TbT 㿘J!؀`  bT4*!p `?㿘1"TJ " "T`@#t&"T@|P @"P㿘TҐ!؀@"TJ!@g"P"@$"PyN    p㿘!p`̰ 08 !p ` @" !p ` "Ґ!"bTN %bT *bTuJ@@%P@$P@#bT $bTN`T *㿘ap * Ҥ@ !؀ #apap  @؀ 2apap  ap$ $`$ `""`ap"`㿘!p @?a4  `@ Đ`#X*` €@"!0R"!0"T"a0J``  "T,"TJ@  "TJ` { "TJ@  0rT a"!0  K? "T "TaJ? "Ta؀ U J? %  "T(K J? E "!0@T"!0J@  "TJ@  0/"!0, "!0'"!0"G"!0*"!0l"!0Ґ "bX"!0  @ "!0  " " ! ! " " "D "X " " # # #4 #D #4 #4 # 㿘Ҩ!@ uK!"P_@"P   $"P@P "@|$P0G@T  , T? : T* $TTJ?`%?0L@a @@ @ؐP$@@ P@VG 0@! L P@ ӢP@ 㿘 *`:   (L   㿘bTJ   !Ҁ "T"TJ@  !@ "Ta؀  J " "T!؀@  N?   ? N? 2?㿘%\ @ $\ '`Ҁ`""d@ !"T " "T"@;$`"T @@ *@"T$\*@?㿘   1 # @"l@"l㿘!0` !"\`2  ""hҐ"l@N$a0 Ґ"bh "hː$"h%T bd  "T"d@h b`$a09 $a0d 㿘bX "bX@<      㿘@X!؁㿘@ @乐P@"Pҁ!㿘@ q㿘O""G܀ @ @*!/?㿘b   Ґ ("b"!!" !" @!" !!aD!done|done㿘bܒ`*e *` €"@:0YL@!L@ +"` "` "L@@L@ D$ @$ "!L"@m8,"" L`WL@00" L@PL`0)@0&L@ ! !!| @@ 9$!|!| @p"@l"@ G 0 Jb@ْ"@ >  + ,x ,x ,x + + ,x ,x ,x ,x + ,x ,x ,x ,x ,x ,x ,x ,x ,x ,x ,x + ,x ,x ,x ,x ,x ,x ,x + + ,X ,x ,x ,x ,x ,x ,x ,x ,x ,x +㿐"܀`/#*` €?Ѐ v@  dr "b$ !Ȁ d!T `ҢJ"耢  + -X + -! "Ґ "bҐ "b쀢 ,b@  Lb"@bP Lb耢 + -1,b@  -/// / 8   *  @ !0 0 @! b  "b0  M   ?݀    ̰  - /< /< /< /< . -\ /< /< /< /< /< /< /< /< . /< /< /< /< /< /< - /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< -[Press 'h' for instructions.] [Press space to continue, 'q' to quit.]㿘!x`Ґ"x@Z@ I    ?    @ ٖ  @  `!! @+$!$!!` !` @ %`Ā a E!!  T@ `X$!@# @e :0C@w!`@p Aless version %s㿐a'"@@㿘x`Ґ"x@"xJ"x @ "܀   g   0 @(ungetcc overflow㿘!!x !xҐ"x$!x!xҐ"܀@ # @}  !x* $!x㿘@? Lݠ?:LPattern not found㿘Ң b Āa `@ @ 0b  >$b%@Ɛ  @ؐ  ` @%  b 逊 `#@&  @ 튐 :%s helpExamine: -Cannot edit standard inputCannot edit file processed with LESSOPEN(N-th) No %snext fileNo %sprevious fileNo such file_+mark: goto mark: |mark: Brackets: 㿈aҐ 2  ؑ:    ""H+%3)ٮ1Z%b!$䀢  .b@&!`#?!Ā !Ā b܀ "/  b܀ "/[  '/'@D쀢 ` ``c/ t*` €a l !䀢`"!t䀢 @M$U @ Y 0䀢`"!t䀢 @:$B @  0}䀢  $6=䀢  $-?䀢  $$+ 䀢  $, @ !ِ ؠ " "a  @  !Ā  A$!䀢 4%HH @  05䀢 4%HH @ G 0* @@ p䀢  $@ ўH䀢 &$䀢 d d$@ 0䀢 @ 䀢 &$ؒ :@ -d0@ 'Ő!   $$ `$ $  $` $& 0  ?  ? "   ?  ? "@ $` $[ $@!$L!`x0@!F@  0!Xa D 0!@  @גa0 2[!8#$`T!X'a4@ @F@ Ā ]댐 0Y䀢  $@䀢 P!`!`w 䀢 $!"'!䀢  $@䀢 0䀢 !"'!@0"䀢  $@䀢 !@ْ 0a0 /֔ Ґ $"baȔ ͐  aȠ !T b@ 0aА  0!la 0aؔ  aȠ !T ؀ ր @0a  aȠ !T   @0a z %aȠ !T    .@i !l*a] %0aW 0b܀  bN m0! ؐ |"a 8 84 9 : 7 >4 @X 9 8l 7 9` : :L 9 ? < < : @$ =| : 9 > > : 8 8 :  @X @X 9 :l @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X @X 6\㿘!@)!L"@= C@O㿘  @z  @&""" ?Warning: some commands disabled㿘#ߔ "@ Warning: some edit commands disabled㿘#ǔ "@ @ 4J@K)`J@ g`"#!" ?J`g2J@ fJ@`J@`J@2``@ И  d㿘 d     d"㿘c㿘cH"H("@㿘@J J ?l 㿐@N E26?N n22?N d2.? ' J `e'`x`c0 0ĐC S'@6?  㿘@Ӓ H @z  @}    @ ?  @ @k)?@.@c< "N@? N  M N  +N  Glz .lessCannot use lesskey file "%s"㿐@:#H   #P'@p@Ðx!Ȥ I !T C `` ܲ` `$--,   ` 6 d` "  d   d  d ܀  M`0 㿘z@ܽ&@@  & N@ ".@ `@*N@㿘`@ܥ@ @   N@ "`@  `2 @ J"?8J?   ?J?8?㿈`Ā " @耢?쀢?@7@L#c$ " $@%b@@c$$c$$ā㿘  @0 @-%s"%s" may be a binary file. See it anyway? 㿈 Ā `Ā  " @'@   S c@ #  H'@ϐ '# @Q@ؤ쀤`@@؜@_r @<  '@'# @4@؇䀤`!x`@ @s #('@s쀢 y Y@Ȁ`" "#$"b@%``@`ؒ "8f ܀`#a @  !y ̀@X`?a `$ @@ @  !`'# @Ғ 㿈#`Ē  @    @' Ħ @   @ Ā     㿘" @  㿘" @ 㿘 Ā`  @? ` 㿘 Ā`  @?Ґ ` 㿘 @z "  @Missing filename ("less -\?" for help)㿘@c "  p@+ 旐 #㿘0@?@Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"㿐 H@ @ٞ  ؀` O!'@1!? 0$* "@€!@F"` @ƒ !$ Ԓ  @ ? Ԁ @o Ԓ? $ " !P@ א? Ԁ '!@ RD R R R R R R R R R R R R R R( R R R R R R R R R R R R R R R R R RD R R R R R R R R R R R R R R( R R%s/%s㿘 % L@ !@@  @   c@t@P @֢ @HOME㿘@% XВ  LESSHELP/usr/share/misc/more.help㿘@  d㿘L@ # @'%*`:  # %2 Ā 0 Ȁ G4@x`@٨`L@  @ I L@  @1'*`:  # %2, @W`@sҐ@ل `L@  @,%s*㿘@s  @tdb8@@Z @  @ X  !  @ ?2    @ @  y @   㿘  @ؽ ??? 㿘 dɒ  d@ ,,佐@s[@չ@ , ? $@W  $` ݒ$,SHELL%s -c "%s"r㿘@`@" @ܐ 䃒 @s̖@  P N `h@ǐ@Đ k `X@s@d`h@葐@\echo %s㿘!` |@N`@@0@=LESSOPEN-㿐 ?@վ!ࠒ " !@n ". L |    `T @9  @軐 O&&@ 2@謐N@` LESSCLOSE㿘"@@y" P@8@| @)'!x`# < @   @ Ð @rac(@ @  㵐 @rSc8@}78@v Đ 㿘!`gq㿘!`!Ā`@??  @ a "a㿘a @<"a...skipping... 㿘    a?4 !  a?   F)!`a?Ea@   #P Ѷ 0#)@G? @ @ '@ @Wa  '7?#P '@J!('-?@> &#P 3ـ?a a  #` a#`aؐ  "aa @x? ` ͢ @?Ǣ Ő¤ @ߐ ?ጀ "! !Ā`a "a %#P"%#P@i%#P@ ?㿘@   a?ش "!@Ғ`&@? @1? `@)@ܐ?㿘!`!` w  E[ 0A@d??5 3` ! @ )!`@   @E     @=??  ra  "a 㿘@! ?  `@?@PU|   #?Cannot find help file-%s -m -H -+E -+s '-PmHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when done ' %sEnd of help㿘+ #x@O 0@#@a ᘐ a@pc@ґ@[  @4 @҇X   " 2 㿘`2@#X@ && @" `&@& c "c㿘 ?" "c?"c㿘 (I 4& ??> & ʐ㿘 ! Ā@#$ Ӑ@. @, XX  X X 㿘 2  㿘#X#X "   @> 22  㿘  "   @: `:  :@ :` "   " 㿘?؀%!D`#*` : @ F @, @@? @?Z? +#٤ (#B? @ ! `! ?  B? aĀ ̀ ?y!ذ  @`! 0aĀ p  ?[ 㿘 `!D`#*` :  @ @ f   @|F? q!`'-42US  -%Ā ZF  ?-0N `B Ā D0 ? = 2 @Ǩ@Ғ1/B? @   2" @Ð D@?Ā @? ?D  @Cannot seek to end of file㿘W  `@4 0I?   !  @”0!  @Cannot seek to beginning of fileCannot seek to line number %d㿐@x?  粒  !d@0,  X@d!@ 0'!0@ݒ㿈@@@rDetermining length of fileDon't know length of file㿘!?  "0@ ?  "P@ 0> @ɖ @. d   2@ 8ؚD?!d @ 㿘=  ?  @Cannot seek to that file position㿘@@Z & @ΐ?   ?@Ɛ   g  #@< 0}@  @??   @ @8;'+ـa@8 "?   0N#? ހ@a"a""%?  0/+ـ4 @  0a? h? 瀤@ " @sa?   "# "c"*%6d㿘!؀`B@q1#!ؔ!xb@m>#@Bcِ   "cҚ#c * ?`#c! ؐ #!!!xc1Ӣ !##&# , , @$# ##"#      0   0  l      0   0  h㿘 &? ! #`  Ґ#J ` `#`Ґ#J 㿘#Ҕ#J ؖx##J !#"@$#㿘`B @% 2 !``ؒ@ @@ 4J Ӷ## B %#Ҁ`?xJ ` cN `Y   ?." `5ӒcJ   `2 cT  ?&c* x*  &㿘J#` #  @ ",   !`,:# @㿘#c  /!#!xJ . :`@$c   _ _   - Uؐ G  # $# $ !     0|8y  * r l#`k   f$c a   $a!1Ӑ    N#`$##@a  J ڐ 7!``ɖڐa,{@Ёؒ@@ @@4' N "!ӑ*: і #  $#N`   c "c 㿘J#` ` Ӏ 2 #  2 c !` !` !`؀` Ҙax + *"ax*@*~ "@X H ҄H "@x ӄ  㿘??  ?ذ? ?!x, `   !w B?,ax&㿘 42 ?`ÐF? ٰ??  !x?<,, ?8?a`B 2&ӆH Ӓ  #H՘& c    @#c   8"& 8ӄ   @ b ; 㿘# # Oc   4 #@ 8 #@  @5##@!"!"`:`"@"`$  &@ #c c   `   4 2  8` 2 #a " "@Calculating line numbers㿘#@   "c㿘!!   d$!@ $!` ?$!㿘!؀`?   2 `#  # # #  4 @8 x@ u@ # Հ "a   b@ f 46 4 2Y "! Ġ8 ?"E @"#421@.0+q 2( "! Ġ ? T@"#ې㿘`Ӱ a # #   & R @ # "     "@$@ !   25? 6 %ِ İ& ? "!?"  2?  %ِ( İ ??? ?q㿘@ ⃢ ? ? ?a  @ ?   !& ?Ò@"?! /dev/ttySHELL%s -c "%s"sh㿘N -  ,@ t!@ r@ o! G ް@ 8W @ @ @u !@ 6@@ʘ!Т  L@  N @K@H  aؔ@h7  N 2!@@ڐ@9 @a@5@\   Hؐ "` ݐ @; 㿘@͐ 7?@ א ?   @ ̐? .   4 ??   @Cannot seek to start positionwCannot create pipe㿘ʒ   `@܏  @  {?Q@!@@!ٰ?@a؀ @̐  @"  `E 4' @# P?  ?` $  @ . :    * $@g&Ӏ #?!+? ?` $  @ . :    * $@g߀ @ܙ @ɐ @n  Z  " @T ՄА?? 38֐"??: Invalid mark letter㿘? . 1ӑ*  ? #@^  . 1ԑ* "Cannot seek to end of fileMark not set㿘 '"3 . $0.! ^+ İ  > & 3"K ) İa> & #aհ> & ""  ?  ? @@  㿘`?㿈  @ 0> &> 㿈@ $耢?쀢?  "#";`;`㿈 &֐b ?2  ?2  `!d"b  ; #  ? ?`Ā@"& EMark not in current file㿘T   @ "@ ??Input is not a pipeLog file is already in useNo log fileLog file "%s"㿐 %  0-0*)"  #P Ԁ`#hֶQ]"޿< Ԁ`#@C 0 '#@<㿘 "`ؐÒLine number is required after -l㿐  l'@d 2`  @ 0"c蛐Cannot use lesskey file "%s"㿐  ' '!@@㿘  0)'"#L@N!䀢` > @?   L  : 0!d e Tags file "%s"㿐   ""!0"a!'"`@/㿘   "#(%"%s㿐 )  "N@0,+N@ M" m = !$ ذ!( `!,`!`!$@ծ &aؐ!$* '#@`㿘   !)!$!㿘   @ 㿘   x զ Use "h" for help㿘!`    @" 0հ ب@T "`Ձ t4There is no %s flag ("less -\?" for help)㿐 'D֦" " J@ € $$Ⰰ  DJ ?`0+'D#ԓ*` €DJ@ +`?`f`d'D D"J + 'D"`M D@O'DD z?'D@ 2  @'!X@    "`   `, # D&     `?"N   @[`? J@  @'DD@  "@  €DJ`2J 0  There is no %s flagCannot change the %s flagCannot query the %s flagCan't use "-+" or "--" for a string flagCan't use "--" for a numeric flag㿐'H@f @'  ` @ @ڐ'  2 ! @ΐ' @0   HJ`"  ` @ V "m``  "&   a`> 5[`"Q` "` R`" `N` `?H"` `?C"@":` "N@;`" N@7`` @`@b`?` )"@4(`$ "`  ``H@ 2 ``  "`"@! @c 05`  €H`  @ `  "`   ``  *@> '@7`` ؐ "`` @  ` -%s㿘!#"`@b㿘@n    S@ 㿘@b  ` 2`@ String is required after %s㿐͐'!@㿘"J@㿘N A $2``*@J@  @ Number is required after %s㿐 L -2    ?А  &%?'"`@   А  * .  @*`: В@ Ѐ$&`2 Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminalTab stops every %d spacesTab stops: Display ~ for lines after end-of-fileDisplay nothing for lines after end-of-filePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modetags file: tag: Chop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters as ^XDisplay control characters directlyNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Log file: log file: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileBe helpful in promptsBe less helpful in promptsRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffers%d buffersBuffers: Search skips displayed screenSearch includes displayed screenH  "    J2 H㨒J   ( P  J򀠀  㿘'D'H'L@" @!ؐ $ D?H@L $ " @햐 ?㿘֐"@Ӓ 㿐@R%s: %s㿘 "a@jT@@ П `@_#?㿘!  `@   @Ė d<   . `@   d@ . 6` .`@B2`* @ *`B2*@ *@ 㿐!Ā`ؐ m"`  M>    0  l z ֈN       D R `&  `v@9D 2   0  0 .>㿘%֠"ࢢ@ ̀`  @ؐ "`$㿘! א"@ a<  ս"a< * $ 㿘N  * : N`㿈6 2 @Ւ 0,@   -, $?L?㿘N) *`:  % `N d  s2N@L`  *`:  L`  N@ `@N 㿘!#`̒`"! J] `̀`q 0' U! @ $@  q F   ?@! ؐ "`2㿘$T 0%!ؐ "a<㿘! ̀ q@  ̀   0 ԧ!  @ ؐ "`??? P 08P*   P:a P(8  P*: P8  P??( ;㿈ᜢ b$ `P  @c@t Pa???ak a$ P$耢?쀢? P*  :?P4 ?   6?P42 ( ?㿘! @  P*     @ P 2`"``"@??: ᜐ $ ᜀ6?㿘Ԑ X!$!$!$ΐ $ ʐ $ Ɛ!H"a#H c"cH c%qd㿘cc@] %d㿘c@\c㿘cה"͇ ?( 㿘? ? ?a  ?   a& ?} -㿘?. > `6U"*` €#גb耢@ J@ 7 C!o`@xa88!!؀`3 L!?8  $* 0(&!8? 7 4 ` , ?2    `Ā@   D L h x D l㿘?`6!*` €4? V0ta0ph``8 Aո B 8 4`2  -?0Lߞ՜ ? 4ȞՈ   0$Оה"耢@ J  c? "cJ? c0 -`Ā r  h x  d  J:" ?." \ J2 02 0?㿘N l"   p b" 0"! ?* : `2#*` €&@?&@? &@? &@ad&@&@? t h `㿐צא""N` 1T N :( ? %' .2c* \c* ($c c*@`!$c N n 2 E N ?Zs N Ā :؀@ "!8  `*@@ "㿘a 㿘!! `ؒ"@$*"@  J@ @&   倢  L`* *` @2* (**`J@ @*J L   J  @ 㿘#耦 `4 %#!p`*%#a ?# ڐ   А @  ݒdAa?%#No previous regular expression㿘  x, 0  `?"Invalid pattern㿘 n @  1@f    ?! "&!@&! 㿘!! "$!@$!㿈a @ `? &@ & 㿘! "?@+ ??:$a:D- 耠2' "" 42 2" 4 2 ( 2 㿘`@@ 2 ` @` ` 42` " `4 >`2`` 8>``>` ` @ 4 >`2`` 8>``>```@4 `` @8@0&@#㿐    6    >    2 J@ 2J@> J@ `'@`J`C '`JC `Ҁ J ̀ 㿀'PD'T A'PT  B PT "@@ 8 F :`@ F :`:`HT(N  ٶP۔T P!`` 1@'&!`2@㿘 `!L"`㿈耢?쀢? ? @g 㿘!D׀"c㿘   ( ?"  э!P`  ? ad    㿈\`/Ā ? 4 2(<y      ? ـ !؀??<S!؀` @, $J `   @ "0쒏 @ 2 `  "Ā  ĺ`!D` 쀥2= Nothing to search㿈`N@ , 2R x!D`% !D 3c耢 "5&c&c1&cؠaL  Ȕ h O? " L " L" !D` "#!D ߐ???2 #\`%"R  ?#\#`??  !D  Đ 0 !d!D    㿈#c #? `?#??" #@ #`@##? @??O*  ; B?D #?#?? #2` (*  ; B  ?? #`*` :  c@*   * @ :`@ f #?Dc:  2 #@c  #: @ c @? @ 2#=(=#\#`  @? @4 2=(===#㿘`@ ` "㿘`\@x ` "㿘`@g ` "㿘  `@S `\@O `@K 0 @H  @E  @B Line numbers turned off㿘!Ā Q ""!Ē @/ I aƀ  @$  @! @@s `\@ p ˬؐ "` #%a ^a  ؐ 2  : ؒ "H" c ؀ "cؐ "`"ؐ!P tagsrNo tags fileNo such tag in tags file㿐a@abЦ " {"!@3)f-ؒ@p 2aL  2[ت "`Ф @%!"Ԓ'J@ K %!'J   *` Ż''J`3 `)$$J@`'J@ ^`'%`J \`'  *'J@  2J@J $"*@tѐ0 @- @tƐ" %!Tag not found㿐 Ԁ "  w5 !0 ?/?Œ   /-+Ā 韔   ؀" "`@~@pH ā/dev/tty㿘 @"@؀ "`ؐ "`؁㿐#ؠ `ؒ1 ? ?O O "/ `㿘@ ِ ـ x p h ` X P H @ 8 0 (     @      ظ  ذ@nfsv2porttcpsoftnqnfsresvportmntudprdirplusnfsv3intrdumbtimerconnbgupdateforceunionrdonlysuidexecdevautorwrogroupquotauserquota23a:bcdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -a value -- %sillegal -D value -- %sillegal -I value -- %sillegal -L value -- %sconflicting version optionsnqnfs only available with v3port=illegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %snfs%s: Filesystem not supported by kernel%snqnfs 1/mount_nfs:nfssvc err %m@! #$"b'x't@< X)'! "|+xt97; F* @€"耢  a@P w$쀢 "`a@F   =%"j$`!@]V |J@ 6`!a@/ @$`8S$`bؐ O%b` K$`!@]7 |J@ 4`!b@ @$`@4$``(0$`!@] |J@ 4`!b @ @$`($`` @$`!@] |J@ 4`!b8@ڐ @$`<$``@ $`!@іt`bؐ %b؀`t` $`t t`($`t t` @$`t  "耢  bP@ܥ $t@ 쀢 "`bP@ܘ   =%"$`t @@` $`t 2'"$ "耢 "`bp@  !$$`t(t` $`t@  $` &t@!@Q4b@*ߐ 2b't"耢 "`bp@W  !${$`!@\g |J@ !b@@ g"!@\S |J@ 4`!b@, $`$ Q$`` M$`  $` H&!@\4 |J@ 4`!b@  $`, 2$`!@\ |J@ 4`!b@ $`  $`!@\ |J@ 4`!b@ $`0 $`'"@@>᠀?s?a* & @ @@@` 2@ x@  "!`-c@ۮ c@@ސ `%4b؀ @  ?cH@͐ @p @i@M @K @I @cPX @#H ' !᐀ Q @!Ւh!@߻  "@K ( D ݰ  \ ܸ 4 ݠ h < no : or @ speccan't resolve hostname for address %scan't resolve address for host %sNFS PortmapCannot MNT PRCMNT RPCbad MNT RPCnqnfs 2can't access %s: %sh?!'ܠ"P Z@h, Z@hn @ @hh : @ Z / ٢!*@w `$ @c  2  @ 2!@ 8  @ "耢` ' ` Ԑ =$b&`'   'خ ٢";'b `'b5٬+a)b 7"  o- 5`   ؐ@ ub,  "؀ 2}b@WC!8xb"2`''` 2  bܘ @R  ''b@Pܠ  "؀ 2Rb@W!HMb@;$`'耊$'  $$'' #\b@bԐ  " "؀ "쀢`paX@U_a@ڒ@"؀ 2ba`@UR@@ b @ @$bb? #$b!"؀  ?@$"؀  ?ap@ @ @ݷ@ @ @ @#P"ؒ`$"@U <b Ebb"؀` "@ "!!!x@YĐ @; ِ!2  &`&`&` ِP&`D&` 㿘'HH@c $㿐@a/ J @ "`E    >  &` `@bI 6@`` "1 `  ?+@b;` &@` ! @@` `@"` `2  ` P`  P&@ usage: mount_nfs %s %s %s %s [-23bcdiKklMPqsT] [-a maxreadahead] [-D deadthresh] [-g maxgroups] [-L leaseterm] [-m realm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node㿘` @x `@ϐ!@ސ ,-o %s: option not supported㿘@N  @& ;' n L  o  @fj = 2*`"@N 2    @2   "*@ "#`2 aX@ظ  @P 2L@㿘@eMemory exhausted㿘@V @FH"Ё㿘@Ð @F>"Ё㿘@ @F3"Ё2 (@  (2 *@  ("@ 2 (@  (*"@    ("  `8 `     㿘#H` 6HcH, @ cH" `cHH``, `* "`H*`H"@H@"ڄ #cP L"T+#XL   L   L   L   L   DL   L   L   L J  L   L     :blank:]:cntrl:]:graph:]:print:]:alnum:]:punct:]:space:]:xdigit:]:digit:]:lower:]:upper:]:alpha:]㿘@#d@ #`@h`? Unfinished \ escapeunfinished repeat countmalformed repeat countUnbalanced [X  -dD#` @?`"#`r%d!x* € d  @Dڐ#   #L` !ch?!! ڐ!"h! #L]d`Y``J `)` `J@ \2LJ` )GL @d `J `|  `J@ \LJ` |1L(d `J$` #L }ڐ!"ch"lȰ! r#L nڐ!"ch! e#L aڐ!"ch! X#L Tڐ!"ch! K#L Gڐ!"ch! >#L :ڐ!"ch! 1#L -ڐ!"chz!#Ld#ڑ2` ڀ`#l`ڐ!"chc! #L`#l`ڐ! "chQ! #Ldڑ2` ڀ`#l`ڐ! "ch:! #L2   ڀ#l`U`?d?@*`: +` *  ?АВ`@ ". J@?Ѐ  @@ "& J@ ,2! `@ J@?Ѐ  @* : +  *  ?АВ`@  J@?Ѐ  @@ @ J@ }ڀ`#4ڀ  ~dڢ` "#t# @Co`d ?А &` "%d $ctct*` * ?$ctd  `# "?@CQ`d  ?&` %d ,@CB  ,Gctd  `# "o?@C4`d ?А &` %dڐ?0"cx"#x #x*` * ?$#xd  `# "N?@C`d  ?&` %d#x` ct@ L@B L"#xL@ } \@B d  `# "#?@B`d  &`%d }@Bא ڐ! "h"cl$! #L$2ڑ2    #L$2ڀ 2ڀ(ڒ ڐ! "l"h! cL2   #pڐ  ڒ!##p#cl"h!cL2`   #p2@ڔڐ!##p"ch"lװ! ڠrx#cL @  cXTcL "ڐ M"#l e#L aڠؐP %#`L @ ` _2 $  `L W2n$l?j$l ?ڠ/d   ( @B/`d @?`&` ^%d  ` ( o@B` ' @d`?&`%d'93/ڀ [T \cL N   H# a!)+ړ, Ң 4#T @ !    @#`@@%#`cd"@`%cd ( " ?@A#`cd  %#`%cd,`ē, \dcL d  c` ( "?@Ac`d  &c`%dd  c` ( "?@Ac`d @?`&c`-A%d  c` ( "А?@Ac`d  &c` ]%d?&`+%d \dcL  c` ( "?@Aic`d  &c`%dd  c` ( "?@AXc`d  &c`%d////ɰ Т//@} 4) @}Ȁ 4# #T` L  `  * @ R`    *@ R`  $/ ] [  #La cX+"#l#TڀO"cl%L @ `GǒL@ `  ,`@ R`  ,`@ R`!%"#h  d@"h"h"h  "h"hڐ?"ch?  $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ d 4 $ $  $ $          $ $ $ $ $ \ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ ( $ $ X $ ( $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ 㿘#H``!`* "`cH *`cH"` cH?  *`"` " +  €#?cH` "`# $#cH#@4"               Unbalanced (㿘!#| !!! ! !!!!!c|$c|$#|@ #|!@?Đ `$#|!㿘#H` ,  ?! !  ! !  ?  ? $ 㿘` . !#H Z@ 㿘!#|> H+#|! 8cH`cH`x `";! ct  4!t 6 #x˒*! t #x !! #x Q%|K$#|#|> #|㿘ڠ#|! #|!!  㿘c|!  #$#| ߐ!#|ې! #|! No syntax specifiedUnbalanced )㿘#Pڒ?ڐ  \"d##h"l#H ` #cp@>#!$#|"# #|?" @>ې  8!   !  & `  @+ @ "@@"`&@` ` ` @@: `  + @* `@+ @2 ` " `#h#l#`@+ @@#` h#d"@l"`#h`d#l#㿘 `` ; ) +`@.`  ` `% :``@.`  ` `@( `  `@.``  ``6` &@`6 @) `.`@`&`'  `` &@ +`.`@`&`'  ` &   6 "    *@2 # *@  "  "  &㿘@ `@    @?@  ( 8 $  @2, ``&K` 2# K` @2    @@@   `Ј  ,@  . *`$ ,@* @ $:*`$ $ $* "@`(*  $@"` $@` $ @*`  $*  $@*` $*  $@"``6p (   @  * @ V!  @` `24 $@` `2% $` `2 $` $ `2 $  $" $ $@ ` *` $ `2`@  *`  "2 ` $ *  $@ *``` ( $ (㿀` * `6  , $@`  ,   a,  ` *@ T!R!4Q ' '' ''* @ `?;  $@ ` *` >`Ő"*` €      ' ,  '''ƒ `0*  * ?  &@      h & 4* '  * '  * ' Г*`  * ' * '  *`̑*   @ .`% `@ &.`  * ' ג  @  & 0 .`  ?` ǐ!|*` €` %$%@ ''@6`,` 0*` *` ? ` * * %  *` ? 6 ** 0*`  0*`"  0*` @ϡ,` a  %?`'' * ?@ 6'ȡ,`@ 0*` E@*` ? `@ * * % @ *` ? 6@ @** 0*`] @ 0*`" @ 0*`Ē @ϡ,`? " %* ?  $*  ,` @@""?* $?  ?@ %?3 @%$? ? "%? %?`? !`?"$%@$?' $' %  0.`" ` ` @&   @6+' .`@ !!$  0.`=' 0 @ 6 0* 0"@ 0*@ `@& ' @' .'`@      `2  `0 2  & ,& (} & $ @`@^@\@Z@X@V@T  @ @ @ @ @ @ @    @   ?b؝c0'D ?#t'H'L" "c0 '!%L `@ ``_2`S``$L cXK#!?#ؤbD#@*#H  $D *  `@6H##l"#p"? c`@"@#h"cL@#P"@#D? *  ,`@ #@ ?P" `?cp@@H"`  *` ?# ?!H?a* ? #ؐ ?#l ?Hh`$ J `  ? cX?#ג ?Hh`$?l J ` @ ??!ِ#ؘ#     "?Hh`$?l J `  ??ْcؘ"     *@" ?Hh$?#l J `   ??ْcؘ"      "?L   ?ؔ   - `"  ??#t ?+ ? ?  #   #d #  ?c H*  @ ? x?? #؄  @   @`"  `??cH?@㘐#ض   "@ @,@*   * #  `"?@ ?㸐@ H  * ?t*$  *?t?t"?#H?+ @ @"@?#d? cH#`@@  "@?t ` ` r ?t 9??#`?*L ?LH f* ?t*"  "  ??t??tcP"@@@ ?p## ?H#@ $`D *  @ =DH!?0* #H% ** #H% 4 T  $ `     2  0 2  2   2 ?# H u ` H m  ?cH  a  L ` `,``_ L``"@  X*  "@L? "? 6"?#t @ Q?#?#\?"T??X?"#8"#?#H"?\,`"?<?,`#D "` :" 3?@ H0*` `!?ccc@,*`   &&H@ 0*   &@?cH@@@ ͪ`H4 "?$ `??〠ㄤ`- @ @$`$H $`&`?X?< cX @ ?\ ?T?#    `2  `0 2 ???٘#X#<  @ ?#8     @"  ?c   ??` ` 2  ` 2   ?㐠 H @ ` H 8  ?#H  ,  L??#<  -L- - @   - :  X@ " `L_L*"@4*L" L??D#t@ ??#t @!?,` @P`?ct@@@ ,`!?#@E #@B㿘`<#+`8 @6&`<`@,` "`H@. `@ "`8@&`H"`8`@&`@&`<`<. ``L&`<"`$* @J`  ``$ `$*` J ` 2`L `$"`$`L@ "@`$*` J ` @`$`$*` J ` 2`L `$"`$`L@ "@`$*` J ` @0* J ` 2`L0`L@ "@Ð$h ,``8` -*&`8  `D`ﵓ*``8`H&`@*`&`D&`H`8`L﨓*`&`L`8`P*``8  &`P`@, " `H " `8&`@`Η,` cX?* `P*"@ cX* $`$@ ` "`@`H"㿘 & 8& < a & @ 8 Z& D 8& Ha*` 8& L]*`& P 㿘 #X4  "4 L4  `*_   4( " `8 2`@`@٨#4   .* @ .`` * @, `  `.``H ` `L* @   `.`$* @J` @ &'@@   ? '` `@? , `P@㿘 & ̐ && & ǐ & & T& & & & & 4& 8out of memory㿘#T`;@t  @4 ( $cT L`  `* , ,  * А@u@Đ& &&&& $cTa0 @U㿘@S @Q  (6 $  $ @`@F` (& $ $@?  6 0 0, @ " @3  & 0 0@+  86 D @,  " H@  8 " 8@ 8 & @ D " H@  H " P@ P " L@ L " T@ T   @ @ 2 㿘` @:   @0 @@ @` `@;i㿘ِ 㿘@ @W۔  N  㿘 @㿘    @$  㿘 "B ɐ 2.@9     * ` ,` &$`"` 2@b@?`@v*`  ,`&" @R0 㿘  `"< @  22$5 *`:`@Sj   N J  N J " 8 *` @SM:`  ` " N 㿘 `  ,`@  @Qg `㿘  `2 @Ő  2&+ A'   "@ ",@ Ɛ)@ː `@ 2,`2@㿘   **@*㿘  c@*    `#8`#8   "@"`"`"` `  @( @e $@b $ @_ $ @\  @$  <  8`6`*@**" @ ߠ   @( -`@! " !!!?~ 0 !!   ! ?0瀤?0    @V " * @ * : `"+J@2 + `J`"+J@"`+@p@m   @  JJ  `@JJ@"`  $ * *  @@$ *`"  @"@@`@ 2 @V "} 0{ y p$J " J`" ݐ a \@$@ O J`"   D$ J`* 8$ J@    J@ ")* "$ "*% #!   **@+ * *`* $ `@ܤ@ " @ $@@  @8$  T& T$   @`us q o  @ @word-regexpwith-filenameversionunix-byte-offsetsbinarytextsilentinvert-matchregexprecursivequietnull-datanullno-messagesno-filenamemmapline-regexpline-numberignore-casehelpfixed-stringsfixed-regexpfiles-without-matchfiles-with-matchesfileextended-regexpdirectoriescountcontextbyte-offsetbinary-filesbefore-contextbasic-regexpafter-context%s: %s: %s %s: %s 㿘` !#Ѡ!`P@C6@v  !``@vې "` 㿘ߒ@ memory exhausted㿘@B  ѐ! 㿘 @s`@-` ѐ!Ւ 㿘 NА   ?N c@Z &@㿘 8  @ @A @  &@ 8@   8@ 8"@  fstatlseek㿘 8`#`(@{ `(@w @8  8`(@o @"@ " $9@S $8@@ * @k )8@d8"@@ , %ۀ% $ $(@D  (   `ۀ  "` ѐ!?  "`4",@z  "! "0C ` < <7 < /ۀ`ې  :@  @h :@@  @ "! "0@ :`P  8   @h; @`?" H" H 㿐`4ۺ $"  "  5!#%a7%8@Ԑ 8@ϐ8"@ <  ?@ 88@ d@g`$ @C @C   @ " !#%7$*  :% $% $ $*` @  $% $ $ @* (  (  `$ (` $` ѐ!v  $`  `"@@,$0 ( $H`I"8 @ b `@  `@`<8"@U&@` ,`   $@#\@ ? P P@&H @@@ `, @   "! "@'! "`  $,@ ! ` `6  @ $` B >@"`4㿘 !`B : #`@V& 2$`X/ @g( `0. @e  $ @2 %s%cwriting output㿘 h`  \!@9  l`ࠔ`B :"  p` 0&  :@ C!  &@@ `@ "!k!" 㿘 ` 0$ `   %`  `$`@Ӕ& `  -`   `--㿘 c` ``-  `ɐ ` G+  0 t 6t ,@   ; @  L 2 @ t c x`@c  @@@@o#x@,&@r< D -@*&@ ,<@_&@   ` 2* :@   & `   : `  x  "%c㿐ۤ #` ')   g  `  0) \ &@ d@-`N: @d@dd  ;Binary file %s matches 㿘 #` c` ` <   @I  "!M@?  : "`   ;`#  o     "! ``& Ұ  X  ``- `- ۀ` 0 ? 4 @" 2 ` X  `@""`  #!s/ۖ"  J- : @"  4@  4N 2 4"& ``l    d`f ` t  `0  - :   J 2   22$`0  4" "@lC > ɒ 2`0 "! `#`  ``0 %$ 4" @ `*`0 "$ 4`` 4 `""@8%@  ' `  @"(standard input)%d 㿘  1 "ې#("` F @g{ !  81 "!  `ې@g]` !"_ @rZ `V  `2  @gB`  `<  = "  2  |` h` \Ӑ!@ :Ր#@@ۀ `?.  "  ` \Ӑ!@p ` 3 "@ a`Ð%s: warning: %s: %s recursive directory loopMemory exhausted0@   ` @2`@2 2e `p@q!] 2 `<   @+   "!  `2Gt B! @V  J /@  ۴`h b?'"`hL   /@< `@2@@2{,@@N@` h B?`%h@ʐ@ȐUsage: %s [OPTION]... PATTERN [FILE]... Try `%s --help' for more information. Usage: %s [OPTION]... PATTERN [FILE] ... Search for PATTERN in each FILE or standard input. Example: %s -i 'hello world' menu.h main.c Regexp selection and interpretation: -E, --extended-regexp PATTERN is an extended regular expression -F, --fixed-strings PATTERN is a set of newline-separated strings -G, --basic-regexp PATTERN is a basic regular expression -e, --regexp=PATTERN use PATTERN as a regular expression -f, --file=FILE obtain PATTERN from FILE -i, --ignore-case ignore case distinctions -w, --word-regexp force PATTERN to match only whole words -x, --line-regexp force PATTERN to match only whole lines -z, --null-data a data line ends in 0 byte, not newline Miscellaneous: -s, --no-messages suppress error messages -v, --invert-match select non-matching lines -V, --version print version information and exit --help display this help and exit --mmap use memory-mapped input if possible Output control: -b, --byte-offset print the byte offset with output lines -n, --line-number print line number with output lines -H, --with-filename print the filename for each match -h, --no-filename suppress the prefixing filename on output -q, --quiet, --silent suppress all normal output --binary-files=TYPE assume that binary files are TYPE TYPE is 'binary', 'text', or 'without-match'. -a, --text equivalent to --binary-files=text -I equivalent to --binary-files=without-match -d, --directories=ACTION how to handle directories ACTION is 'read', 'recurse', or 'skip'. -r, --recursive equivalent to --directories=recurse. -L, --files-without-match only print FILE names containing no match -l, --files-with-matches only print FILE names containing matches -c, --count only print a count of matching lines per FILE -Z, --null print 0 byte after FILE name Context control: -B, --before-context=NUM print NUM lines of leading context -A, --after-context=NUM print NUM lines of trailing context -C, --context[=NUM] print NUM (default 2) lines of output context unless overridden by -A or -B -NUM same as --context=NUM -U, --binary do not strip CR characters at EOL (MSDOS) -u, --unix-byte-offsets report offsets as if CRs were not there (MSDOS) `egrep' means `grep -E'. `fgrep' means `grep -F'. With no FILE, or when FILE is -, read standard input. If less than two FILEs given, assume -h. Exit status is 0 if match, 1 if no match, and 2 if trouble. Report bugs to . 㿘 #!!`֒c@nB`@n=c0! @Ӑ  @ϐ 8@̐ @ɐ!@Ɛ#@Ð H@ p@꽐# @0conflicting matchers specified㿘۠#l " $#l@K "$#lڐ ! 㿘#`" %#@KА 2    $`$ 2   `L " J`L 2J# + "  L2*@ (8*@\`J *J *@̒`㿘 (@ʐ  @  * &@&$ * $`$  GREP_OPTIONSinvalid context length argumentegrepfgrepgrepreadskiprecurseunknown directories method-rwithout-matchunknown binary-files type%s (GNU grep) %s 2.4.1 Copyright 1988, 1992-1999, 2000 Free Software Foundation, Inc. This is free software; see the source for copying conditions. There is NO warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. default㿐'D@]'HH  "`@དྷ / `@ි / "? '!#%,`$`x'$ \$t@ "D=H  ' %۸'-+;7%/!ݐ `* €.*  ?' x ڐ"ْ   t ڐ"̒  "   ڐ" 'b" ' "cv "p # |%`@JTЀ %`@JL"؀ ڐ %`@JC { ڐ"~ @F @- -@J)# @: P` c "Y 8, (, h ?2` , ]`   $  @弖 4`P@@@M@]J?` Y .V  R" N##x ?'`&H%` &%`C'` ?"`l %`;&ଐ 8%` 4" 0# d ,"c| ("t%# \"*#`@I $X@I" ڐ $X@I ڐ $X#(Ӓ k ##D @HӀ`x "`xt "t#l `##l #lڔ`@'#H!ڠ#h@#@ #p@#@@ c  ,  2?d "dD H* %@H Z#l  T`H @ €D" `   # hD@6ڢ H* @I  ے# @D`@%#ϐ @M`?2 " !`  @ q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q m8 m8 m8 m8 m8 m8 m8 m8 m8 m8 q q q q q q q mT m m q m n n n4 q q q px q q q q q q q q q n@ q nP q q q q q q q q qd n` np n n o0 q pX ph q q p q p q q p p p q q p p q ph q q q q q q q( J(8  J  㿘3aༀ@.@,(`'@ @'@/`/ @ &@`@ / @&@ `@@ۆ'@` " "`POSIXLY_CORRECT㿘!"`"# @F#" N - +ې "` `"   " ې "`--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument 㿘!۪'D'P"c!#h ۀD %aDT $#h۬ "J P a@ $ `  $`` ( ` @   a 2$`DD "  *@J`-2J  $ aD@ !*`@ @G`X aa`  @  %a` D` @Da$`D$ %aaD  *` @2%aR?@J`-J 2P C?"%a> J   -`?`%P a* @J `- `"J  X  P L ?L  =2P` @@Fu$ 2`@@$2 `@   !` a*`@ !@@h``@ ?a@%%a"ga%aL , M"c!`*?J`- @!@hq` @!J`@hh@J ? @%" &D *@"#%a!` *@@!@hE`@( @%"N ? :"{ :0y@ @%'`2- l `a* @J`-J '!`a* @J`- @!@h a a@!Ja(@haޒaH %%a"9 ? @`. :%iJ a %a :2J!` ` @!aP@gі . @!ap@gɖ. : "b ? W `;ő*`J    aې "c$%aaD*!`@!a@g""N`:۰ ?ٰ :, @"#%ac%L@  =2`P  @E0$@ 2@[$@݀2    !` a*`@ !@@gXa@: ?a@%%a"P%L@  `6"!`@!@g6a@ ?@r% !aD *@"#%a!` *@@!@g`@ ?@%N@ @%'`"D   @"@> W*`:  :28. J : J@  a+"#J@ aې ""%aaD*!` ޗ. @!a@fї:. : "bN:  ? :@"#%a%. > 㿘   㿘 㿘 㿘%H Fk "@  $ , "@` 6 @    $  ( $ (    *  " " $ $  $ 0 $ # 0"  0"` 0?"  0"` 0"  0"`$ 4$ 8$%D$%<@O memory exhausted8@( 0%D`@ @@''   @  Ȕ  "@ :" "@  ` ` 2"@ 2  " 6 @v     &  ( & (    *  " " & &  (& $$   " 6 @Q    &  ( & (    *  " " & &  & $ 1İ#@# "  "` ,`"  "`  " "`, ,    "@ "``,`,` J`   2@  ` ? `  *`  J` `g,`   *` *  2Y `*`Q* J` ? `0=`*     0  "#+ /*  `@*   `""`*` * ` ""`"#J " *` J 8`?+ * @c@a* `""    ,*  $ , & , 4@&& 4 8@4& 8 㿘    @" &@㿘 . `"# ``  `  :`@`"` ` `"``#``2` " 㿘   @*.㿘`2@&  "! `   `  @  ` :     ` @ 㿘     * &@㺐 4    < 7*@   ( 7  ,  < *@   (*@  , 2Z 0%D 2V 0   4" 6 @   &  ( & (    *  " " & &  &%< 4& ?  0`%< *@ `?  4 6 4%<  @  7 " (  4 &%@%<@ J K@2 " &%@  &J u%D'`5!<` 4$` 4$``.``` 0` "`  5` 2 @`  " &$ @ "  `  " 4$   2 ` `2` 0 ` `` @4$``` 4$`` `2` +   "@ 0%%D + *   #@  %D    " %D  +@   ( 0  *@   (  㿘 42 %<%<J@q&(@%@*  <@K@" @G? @ ? @# ? @ ? @ ? @ ? @ ? @ ? @  ? @ ? @ ? @?2Ӱ 4A&?@   & @ " 4/&? @ @ 4'  ? @ @?2 4?@   & @ "  @߰  㿘 4 a%D!< <   0X)  M K"@@?@@@@@@ @*@`@ 21"@(!`@@@  :  @ 2  8"@ W  8"@4"@ C @ 2:"@(3"`@@@"   :   @@ @   "@ "@6‚@`0#@#`#`㿘 , %D   && 4&(㿘@  @㿘" `"/ ( * & & `& && ( $`& "@`& & @&@& &` (* *@& ( 㿘" `"/ (  & &  & && $& (`& "@`& & @&@& &` (* *@& ( 㿘  "@<@`d@    ( 6  € $@ 2& "@& $ & $   4 ? `*  * #? +`€ $! (  `   *   (2  2  (`$  ( &  @ (@* & (& &   : *@ 㿘    € $ ( @  (@& (: (* (`& & & & @1㿘    € $ ( @  (@& (: (* (`& & & & @  memory exhausted㿘!!@"ؐ!x@]3 @b 㿘b  !ۢ Ȕ!@  L   `2,@   Ȓ  * _$d d,Hex D_alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit"'D'L@'̀    '' & **  '*@ L&'& &&  @ &@ &  @ 0 &    '̐  ?`r !4*` €D̐@ L2  @ Ԕ *   р`$@  (%@@ *`&&@ & $@$@@ %@ %@`%@@$@  ݀@ M ̀ L`2 L@ *   `$@  (%@@ R*`&&@\ ^& $@$@@ %@ %@`%@@$@  ݀@  L a`  L   X``+@ `? ̐@   =    '̐  *#L` + ?` \̀   '̐` ` + ?2'̐?'̒ `+@ `? ̐@ @ @ǘ  +` l$@  *%@@ ȑ*`&&@ & $@$@@ %@ %@`%@@$@  ݀@ ?M J?`.M.@`&%#`/` "K M M `%`L @ `% @ {`  `% @ r$@  *%@@ ^*`&&@h j& $@$@@ %@ %@`%@@$@  ݀@  $@@ G/`   `$@  (%@@ $*`&&@. 0& $@$@@ %@ %@`%@@$@  ݀@ @  ̢`$@  )%@@*`&&@ & $@$@@ %@ %@`%@@$@  ݀@ ̀ $@ "  +%@@*`&&@ & $$@@@ %@ %@`"%@@$@ "  ڐ$@  )%@@*`&&@ & $@$@@ %@ %@`%@@$@  ݀@̔J``^  *J@ ^2`'$@̐  )'%@@K*`&&@U W& $@$@@ %@ %@`%@@$@  ݀@ ,@` @ ` L@ ` ,`̀@` @'̐ L  \]` `'̐` `2` @ ` * ,@ ]Ȑ`2 -#K ]耢-2KD? DK? ["K? * KK? [2KK? ^K ]LK -LK  ] '̐L@ J @0ꀊ[22K :22 '̀ ̀@` @'̐  :J` ]` `  +`/:v,J`]2r⠒ @:`?/"@:`?/ @:`?/⸒ @:`?/"@:`?/Ȓ @:`?/"В@:`?/ؒ @:x`?/"@:p`?/"@:h`?/w"@:``?"/o@:X`?/g@:P K̒@:J E̒@:D > @:= 7"@:6 1̒@:0 +̒@:* $ؒ @:# ̒@: Ȓ @: "@:  @: ̀ ' '\'X      o wg  \`L @ ` X `L @ `    `L @ `  ` 2  @ (@,@ ``L @  ` `L   `` `L @   `L @J  2 @ (  ,@``L @  `L @  `L @   `L   `D` 2 @ (  ,@`L"  @  22` 2` @ `(  ,@  h\  `   ̒ `  ' `  `` ,` ,`2 @  * @,@ ִ  ,  ?` @L@7 `LÀ`L`L`L @YL`L" @р`0̀"   ـ`U'#ܓ*` €L׀`' 쀢 &**@@~*` '* '*` $ * "*` * % ""* @*` Đ$@" * * Ē@?"`* * $@ @"`$@  &%@@O*`&&@~Y [& $@@%@ %@`%@@$@  ߀@ ,@Ģ`,@`,@`  '  L@M @EE:$@  * 3@@*`&&@~  & $@$@@ %@ %@`%@@$@  ݀@ ,@`$@  @ݒ  ?L`@} 0* @*` '  ?  *` * ` ~Đ"* $@  (%@@*`&&@} & $@$@@ %@ %@`%@@$@  ݀@ ,@`,@`,@D`L!L$`$@  *$@%@@^*`&&@}h j& $@$@@ %@ %@`%@@$@  ݀@$@@I  `$@@3 $@  '%@@!*`&&@}+ -& $@@%@ %@`%@@$@  ߀@` ΦLb+" @@&D ̀@̰?? ?L    ' @`'̀ А  & . * ̐ @?Ѐ,2'̀  ' '̀ А  & , *  ̐ ?Ѐ  #  #LLL@ \ẁ|  '̐  } L @|g 0  L _  6 $@  (%@@Z*`&&@|d f& $@$@@ %@ %@`%@@$@  ݀@$@ @F`  $@ (%@@#*`&&@|- /&@ $@$@@ %@ %@`%@@$@ ݀@ `$ $? @ @  ˢ`?% @`$@ @` '  '̐ L`D@ `J \`0L@`$@  )%@@*`&&@{ & $@$@@ %@ %@`%@@$@  ݀@n L`$@  )%@@{*`&&@{ & $@$@@ %@ %@`%@@$@  ݀@9 L`$@  (%@@G*`&&@{Q S& $@$@@ %@ %@`%@@$@  ݀@ L@U`$@  (%@@*`&&@{ & $@$@@ %@ %@`%@@$@  ݀@ѐ L!`$@  (%@@ߑ*`&&@z & $@$@@ %@ %@`%@@$@  ݀@ L퀥`$@  (%@@*`&&@z & $@$@@ %@ %@`%@@$@  ݀@i L@`$@  (%@@w*`&&@z & $@$@@ %@ %@`%@@$@  ݀@5 L`$@  (%@@C*`&&@zM O& $@$@@ %@ %@`%@@$@  ݀@ ,@`LO`Ē`@ '?@Б*  ?`$@  )%@@*`&&@z & $@$@@ %@ %@`%@@$@  ݀@ ,@`,@`L`  `"4 @@  2.`*J`*&`^#L `\ LK  + ?0`+`?LEK { ? \2;K  {27$@  )3@@*`&&@y & $@$@@ %@ %@`%@@$@  ݀@ ,@`,@`$@  (*,@3@@X*`&&@yb d& $@$@@ %@ %@`%@@$@  ݀@,@` @ -@̀r$@ @, #@y 0Y@y 0V@y 0S@y  0O@y 0K@y 0G@x 0CB @x 0=< L@2$@  ( %@@*`&&@x & $@@%@ %@`%@@$@  ߀@ ,@`@x $@& Ť L t ǰ Ǡ ǰ ǰ ǰ ǰ ǰ | | | | | | | | | ǰ ǰ ǰ d Ǡ ǰ ǰ  ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ 4 ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ ǰ $ D | H 8  8  H *@*`:*`*@*`:*`*`:*`㿘   .㿘   ??? /ِ H\`?J`(  2 2  `| 2 2 J  \`?     )` J@)"  `J|"  0 `J@|"   * (   㿀@2 C `// @@&//    //@I 4(`@Iݒ耢 4"``:`:   :    !"@ ?",* ``(/㿈    ` '? '' @zn! @  *@&  ``  2* * @& *' ߠ "*` €   &   ,@ * ? ͠   : *  " : 2,@  *    ,@ $,@ * ?   : *  " : ",@  ے Ȗ J@ ",@   ۘ Ȗ   K`2,@  ~ L`  `*? 6* @2 n,` u oL  *  g  b  L *   W*@PM'L  *   "쀢#*@ *`"@ 8;?*#*@x` '* '* "  '   & `    L * @` ?Ī     @v  2* * @&   ֬ d t ֤ ֤ P   դ դ    p  ֜ T Ԍ ̀ `(#`"`"@ "``(#`"`"@"`㿈#\#`#d @ 㿐\ `d4?  4$  `   `  ` 4? ``2   `j?`r?`KJ  E 3 &$&@` # @O@ ? # @O@  #? # O@`#&@&`" @J   2 #\`"#\ 6?#\#`@- ? " ?$ ? ??㿐#\#` @ 㿐\`#\#`@@'D ! `'''H 'L@`''T'X'Բ!'' ` ' '쀢`2'*  ?#`#`#`#`#`#`#`#`#`'''''`}' zx v t`r p`nX^?'''''ȸ  ' XQ?LT K̰ 7!Ȅc;=#c0 İ """"  "̀ T` LHL 'T'H'LLH T '''L" 'L X XH XL "؀@2 @UL`  H  ܔ ܒ@ `? @  `k̖ '' c   " " V`2\H (̰      "" \`D2` X2` # ̒`* \*`#@s'\@#`@s*`\ $  `D`* @ D "\\  :@"*@s'\#`@`@s*`\ $  i`Z?\@ `X@ "\ H$ L$"@ ۆ?3 Ț @   \\  " ""@ L  H @"@L" " \L`  H"L" "@  \  *̀ X?\.    " "  \X܀@ $L& "@H"@ `w`!*` € @Ѐ``k@ Ц  @@]`? W@LL@@K`?  -@  "@`4@D` @ Ѐ"L J` "Ѐ " L K`    -@  "@`j  `?  @@Ѐ`" @ @ *`  2  :@ `2 Ӣ@ ̖ Ȕ-@  "@`/ ' @* 2``2 @ؔ'@@ @0* * * @%  @*` 2   @ !Ȁ @ $ @*  @ @ *  % @*` * %  @`' @*` 2    !Ȁ  Ā" @* ' @ *` * % @!!` @`?  `*` 2  " !!+  2  Ԑ2 ؀ ' ' `  ` `  ` J *  ''䀦 '  2 ` 2 ` @@2} *` 2` &@*@% @ `*" @:" @ `  `' `J* `' *  " @ #c*` * " L*#'*@s` B'* '" c-@*" '@*" '@*`" '`*`"`'*`"`'* # `'* " `' @ە-@ !Ȁ@ ` ~L   H@ L L   -H@ @`? -܀  - %@@K@%@$4Ѐ ''@ ''@9 * ɦ Ŕ-@  "@`LH T`2LD 2  D `  D2  f2LN 퀢 D  TL`HIT C ?L` @* &@`*`  " !`%*` * " -*#''*@rӐ` !'* '" @-@*" '@*" '@*`" '`*"@'*"'*`# L` @* `'؀@  @  `ؒ@ ' @ `؀  &@  &@   &@ * @`" :"@ %*` * " *#''*@rW` '* '" @-@*" '@*" '@*`" '`*"@'*"'*`# '* " L` @* `ؐ    ?    @  @'  D ` / .   `     "  ,u  o *``? `  2  :@ ` `?V V `  *  I2  :@ `C     6 "   "(*  @  @@   @ `@ @@@ @ `  "`@  @2 ,   .,'*  *`' @  +`?'*  @#'*` # *`' # ? L` @* `x@&@ * @`" " %*` * " m*#''*@q` a'* '" -@*" '@*" '@*`" '`*"@'*"'*`# '* " '&@ * @`" % %*` * " *#''*@p` '* '?" -@*" '@*" '@*`" '`*"@'*"'*`# '* " 'L` `*  ?`,@> ,``,`,`L` `* ?,`> &,``L` @* `@' @L`* `*> *`LH T`@@ے Ȁ@@2 JȐ `? 2 J `? ]L H T ے Ȁ@@2 JȐ `? 2 J `? (ے Ȁ2 J@ L H T  @@@2 J L H T}Tzے Ȁ@@2 J 2k2 J@  0WV@ۀ 2 J@ B : 6-@  "@` ,@ۀ 2 J@    -@  "@`t @mVg* ' 2'*  '*  * ' @ `+`?'*  @#'*` #'*` #?`ʈ ؀@ :'H @    H H `' `J *` `@' @ "H @  ؀(  @ H? ݼ $ 8 @     8  < P  @ ` ( \㿐 R' ? A' J *` ?'' J`* '  2'   @/*  (@' @ J? ?*` @*    '& @/*  " 􀢀*  㿐'  @*   'J  *` '*  㿐@'  `B'!t*` € q, 2` 2,*0*@* &%*J  *`  ' #'' K * '' J*  ' *` 2      ' $@ ` H H H H H ` H ( ` ` ` ` H H H H H H H H P H H ` ` ` ` @ JJ` 2  㿘** @@ #d"%  "X*` 1" 㿘"@"$$ $ @jҐ!$ @j͐! $ H 6  L @ `   *@  L6$ @  ?$ ! @*@$   `**` $ @n͖ "     ?@j $ h@m 2`  @  *@ * 7   ` * *`  ' * ' (''''' ''@jO. '' .@'? Ȁ         & & @jM6 㿘 @j. bX@ "@m @l*@l㿘 " @j$ &&  & @j  *@& & @j & 㿘@"S`D @iِ ?@#F #0 . J )   $@m<&@@  `2@0D 4d@8d@i "@@ @ @& 2J.@@# 0@# @i fgrepawkegrepgrepdefault㿘/ memory exhausted㿘#x`! L`!Ж  `*   (  x !А M $#T 0 㿘۠b T @ ) Tb' X #T$X@l{ "ڒ 2b T 2#T@la " 2*#T ζ ^\(\(^\|[^[:alnum:]_]\)\(\)\([^[:alnum:]_]\|$\)\)$㿘+x `+۔4 %Ώ | 't E@hԐ`2 " ,@t  "( ` "(,@ `,` `,`,`| b0@kY @l4@@kR|`bH@@kI t  @ "`"` ,@ +  + + @l ې 0 D^((^|[^[:alnum:]_])()([^[:alnum:]_]|$))$㿘cl@"`  !.!x x `7  n#x `-#۔4` % | 't A@hK`2 " ,@t    ,@ ,`,`| `@jҔ @k@@j˔|`` @@j” t  @ 8 8 ,@ + + @k ېɕ 0ɏ 㿀ۦ #`'L۴#4*`;#T 2$ e谒 ? @S$ " N? ?#XN? 2?#X bܒ  ȳ䀢 ,# bܔ  Ȥ䰒 ,? @R͔$ "N? ?N? 2?pۤbж ?c $&    Yct"#|`TO#|`D?)#` @ ? L ` _5@  L ` _+ @$@ oД`@` $$@ `@"`ŀ` >  L@"@㿘!ے@@ J@  `@ #TN@ 2`#Tc&@ @’ *`@ )#T ̵ 㿈۔ [ #` ,: +ۨcT$ d谒 M#t`,N?2?  B,N :@26 : #|`4+3뀦 ?* `L `2cT_  cT,   ?`L `_ސ    ,:`@Q$  &N?  ?N? 2? @*J@ `?㿘@㿘@3?`X@m `@j@ N ( /@` /?"``* "@ /` ?"`* "@u @i Հ ` N 2 ?N /"? .@?*N /2?  @i@i@ "@  ".@>b@i usage: basename string [suffix] 㿘b@B!@i 㿘@aFfh:t:vonly one -t option may be specified.nfs㿘@3$ @\/+)-# "5'%7%9 0 * L@€  %c%#a %4 b@ @a $@@<p?ؐ?ሓ* @   @  4  @" "@@E   @@ 2 `@ @i  l l l l l l l l l l l l l l l l l l l l l l l l l l  l l l l  l $ l l l l l l l l l l l 4 l `/㿐@  2 @= " ,`* * * % T@t Z @g D @, T 2 >X%s: not currently mounted%s: not a directory or special device%s: unmount from %s %sCannot MNT PRCBad MNT RPCx@8' @6 h< @   @ٔh  h!)@!#h @ǒ  2! @   @ 2 @  !@ 2@  b@  !ې@ @  ,@ @,@ޒ :  @, :, @! #`"@#`2f !#@Ӑ "0@Y "@  2S O#@L ,  ? ?/7  @h ?`'\'`'ab''d @\ @ А"8( @>$ '`'x'|'d #\"0  @bH   @ @ getmntinfo㿐@   @Q"7 @64  ``@Z ` `D@f~  T2`@D T 2` `D@fh  @Ҡ! 㿘!4  c`?  #@    2c@ empty type list㿘 N  nc@^  N  oې "c "# %  @В , ` @cv*  $4 @r $@ , `$@  @ , 2*@, $@㿘 ۠# "- @Y "( @ . " *#@L 2  @E " @ . "  *#@8   # 㿘'HH@W$usage: %s %s umount [-fv] [-t fstypelist] special | nodeumount -a[fv] [-h host] [-t fstypelist]㿘a@?!@f 㿘@Grsh8KLdel:nwrlogin/usr/bin/rloginrsh: can't exec %s. rsh: must be setuid root. rsh: unknown user id. shelltcprsh: shell/tcp: unknown service. RSHrsh: can't establish stderr. rsh: setsockopt: %s. rsh: fork: %s. 㿈@/ @ ''@ /       @bh@ " ' ,` `J@ -",`' `?  ,*`    "! @y,`@ p@9&??!!  $!*@$!`'@`!* @ "&@@r!@"@n@d@>!b@>Ք@e @g@ !@>ʒb@eِ @T@֤  !@>b@eː "@@ِ"@̒b 2 !@>b@e @#  )@#\@Z# #@e   !@>c(@e *'? @   # "!!#!@ cH@>u# @    ! "!#!@ cH@>b@@@ΐ  @c˒   `@cŐ  @c’   `@c  @c   `@c `2@ 6 "!!#!@ kc`@>,@e; ! #"~@c"~@c@O`@c  $X $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $X $X $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $P $4 $X $P $P $P $P $P $P $< $P $H $P $P $P $P $P $P $P $P $Xrsh: select: %s. 8 PM@c# ""! @cx$ <  @d6* @ *@$@  @ɘ 6@ "! "!# !@ բa0@=@d : ؐ@c/ & "Ĥ΢! #ɐ@ @d @ؒ  @dq# 2 * +@6$ * +  $ ؒ@cg '㠀     @u  "! "K6@  !@=Ca0@dR 2*  :  5 "&@b$  #㠐 2`*@ `* *&@ @b 6* : % "$@b̔$   #  @**@&@@b 6* : 㠓2 *` :@`؁㿐! "!/#@b $!rsh: %s. 㿘@   @@c `@`@`8 !# !`@  @<@cА @ @@@@L 2 `  , `@ 2@usage: rsh [-nd%s]%s[-l login] host [command] 㿘   a(0@<!@c 㿘@mkfifom:invalid file mode.㿘@-"  b@gc `8 @@b`?) "% + m@p! 2 b@ @p!@_ߐ@@6?倢 ?a* @ @&@ѐ `  `J`p   &``@`"!@ ,@{2@c(@&2@c"node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%s㿐`J c b  `@@ `@ `@" J@  ``@ ` @ ` @" J@  `@ .@ 2 2 ",  `@ @@=2`  @`@  㿘@  .! @@26 6`@@R  `@ usage: %s [-m mode] fifoname ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p 㿘  # 8 !@;`b`0 !!`8 b@;X `8@;Sb@bb 㿘@,hms:t:/dev/%s%stcsetattrTIOCSDTRTIOCSETD%sslip.%s.pid/var/run/w%d Failed to create pid file %s: %m`@+#'+! -/ ; 597Ā`5 #*` €@@,@ "@յa $0 "@a%c4@@5#`??* & @ @@h@   !ܠ# p@'" @0  6k@Ȑ@aސ  '0/'''/@/}@C   cx@$ `y@`   c@ `@`{c4  c@ @ c@a @`  @`  @`~&@avN@ /`4N@ /"` # @ ##$@&ǐ  @. #@  & @:nc@V ' cؔ@ /#'@Đ0 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4X 4 4 4 4 4d 4 4 4 4 4 4p 4unable to delete pid file: %m㿘J#`#@&1 6 ,# "!` c@̞ ,#@a slipstrip㿘`X@ڐ   @Ғ``  @usage: slattach [-t ldisc] [-hm] [-s baudrate] ttyname 㿘`@9ސ!@` 㿘@o_block_size_block_count_block_tableusage: installboot [-n] [-v] [-h] [-s isofsblk -e isofseblk] [-a ] 㿘a`@9!@` a:vnhs:e:sysctlSUN-4sun4csun4boot: %s proto: %s device: %s architecture: %s sun4mUnsupported architectureopen: %sproto bootblocks too biglseek bootstrapwrite bootstrap㿈@*!+7)#%5-'/%耢` "*` € "!$ p %`t &ؐ %# "@a "ch "@a"cl@3הa耢?ؒ?& ~* @`` p&%d %$|#   '''  @`O ?a@u   b@  ""$ p#Ԁ @"d@"(|@"8 p@"H p@ %`t p@b  p@b`  %`tbh@ d@ƒ |@_ؐ  @- |b@( @ڒ @_Ɛ @^؀`2"@|b@ސ  @-ݔ |b@  "@_  2bb@ @x@^*耢 b@ @^q ;0 ; ; ; ;| ; ; ;@ ; ; ; ; ; ;L ; ; ; ; ;d ; ; ;Xnlist: %s: symbols not foundnlist: %s: wrong typefstat: %smalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x %s: a.out header %s left onstripped offproto bootblock size %ld room for %d filesystem blocks at %#x 8#8@r "   8  "   #@ 0@- "@ @V8 # @0HȚaB + cB + 3`  *`  @7  #0@s01@]s: Ȁ̀@n#H0@]`t      a,c?   ?# ! ? ?#   F?2B  ?  ?# !  ?0@! *? ?c@  ̀@ ?@ ̐ ? ?c@ ! @  @!   #?9 ?  ?# !  ?/@! (? ?c@  ̀@ ?@ ̐ ? ?c@ ! @   @!  2 ? ?# !??? ?c@ ! @ ?%" @!  ?" "  ?c@ ! @  @!  #? "? ?c@ ! @  " @! @" " 8     @ # l" h"c#X` #  #@P@Z@\|3 cԠ" x @# t`#  @  @ 8 x 8@&@ t@a &&  `  %s: devread: lseek%s: devread: read㿘. >@\ 2@c0@ @[cH@ statfs: %s%s: Too many blocks%s: %d block numbers: %d ffsufs%s: must be on an FFS filesystemfsync: %ssuperblockNo memory for filesystem blockinode%s: block numbers: %s: block numbers (indirect): indirect block㽐@+ b@A @o c@7 ch F #ܒ""l#h" `h * "`hx c@ #Ԁ` @@ `h @'%#h, ԑ* l`"  @, `h @#hԀ @  (04`0@0   `8@)  `@@ @5I `h@ѐ @S c @Ȑ @[Lܦc x  @X0 `@ ฐ@RO@Q༠@RH* @Q @BR@R<x`* d0 , ߒ@BBxcܑ* 0@"0 ;  @ C@(8  x @ c@?  h"@Ԁ   @ ( (  `3/,dԛ*`l`"  @    `2Ԁ `@p (`>Ԁ  @g X0 }t "+)d,* `l "  @K t  `2dԀ `@8 (`c@͐  㿘@eroute: botched keyword: %s usage: route [ -nqv ] cmd [[ - ] args ] keywords: get, add, change, delete, show, flush, monitor. 㿘 !bX@4]!!bx@4X@4Tb@[c route: %s: %s 㿘 "a!c8@4D c@@4=!#H@t@45@[D nqdtv/dev/nullsocket㿐@$ ' /+)'!%#795;-怢 * P@€ %`H  % @  $  $ 8 $ @.c??ሓ* @ @Y۰&@}'" 8`&Ԑc@)" %$  @ %$$ 6@c@ @H?`)*` €&Ԑ@9'&Ԑ@[0 @ D@0U@@Z QX Q QX Q QX Q Q Q Q Q QT Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Ql Px P P P P P P P P P PH P P PT P P Pl P P`must be root to alter routing tableroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) route: write to routing socket: %s got only %d for rlen %-20.20s done x"Ԁ`  " "aߐ"c$ @) B >`@J@ -9@`?`3#*` € ,"c ("c $"c  "c "c "c "c "a#!a@(#P@2#x@0@   ?''''   @Z 6"܀ @V/ 2t"  @Y 6g"ܪc  @D#c @#8@;`` [-# " @  ,J#` L ` 2C ` >"̀`2; , $@X$  @`*# @ d# #`@l@S@ @ `? @`@Z@c@ # @Uϐ T@ TP Tp T T T T T T T T T T T T T T T T T T T T T T T T T T`  Q( o:* ` 0  .*  ?** *`defaultinvalidiso %s(%d) %s``4  "`4"p@ ! 2 ,p@  . @ ` ,p  2  :ap?`#*` €  ' ` ` H`̒ @  @ e . bp@z` ",@!p`̐@'@ h k, H`  !  ???ؒ'@W  /Ѐ/؀``ِ  `!ِ    耢 !/'/! Ф!p#\! @Z3 -`@ $!(!p@l$@ @T! @U #ap@}!! #ap@o!!!p Yt [ [ [ [\ [ [ [ [ [ [ [ [ [ [ [ [| [ [ [ [ [l ZLaf %d: %sh ?` #4*` €  (! H`$! 0?    ??   !:@ 2:@` 2``2 @X  2  #p'@@  k, H`  !  ???ؒ'@V  /Ѐ/؀``ِ  `!ِ    耢 !/'/! Ф#p#\! @Ye -`@ V!(#p@$@ @T-! @T #cp@! ! XA#cp@!#p \ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ]㿐 `$' *` €# # # # #  #  # @#И <`L "<؀ c "c؀ 2"@ʮ$ _ `< `< `< `< `< _ `< `< `< `< `< `< `< `< `< `< `< `< `< `< _ `< `< `< `< `< `< `< _ `< ` `0 `< ` `< `0%s,%sold usage of trailing 0assuming route to if old usage of trailing digit, assuming route via gateway %s %s %shostnet: gateway %s (%s) not in tableentry in userouting table overflow: %s 㿐"a8 ('7 " &4"@M g"?c$@z ? )5'9`@J@ -@ ې`?`-!*` €          *   ,   """Ȑ %"Ƣ wĢd "c "`L &`@ @@abh?2`@ `@ ?2`@ `@ ?2`@ `@  ?2`@ `@ @Ŕ }??2`@~ `@ @@n?2`@p `@ @ 4 _$4`@@?  $4U $4R ?2`@T `@yG?@K B? D    @7  @y1?@M ? @ @@ ha@  !HaP@"h   %"Ȁ   @ 2%"@!@!%"@ @I ? 4` 2 4 2 ``"Ȁ "` )'# 2$MM@ " M`"M` "`  @TD &M@ ᐀ 3߀ #M g @@U; /!!!ؐ @M@` !@  #` !! @  @! `" `7`"0 "0 """ @@|"8@  c e d e d e e d d e c e c c d8 d` c4 c@ c c c c c c e e e eH e c c eX d d e c e e ch e e e d0 cT c| d(D  D '  ? ( ?* ??* ? *  ? ???"`"`(*``H 8 *@64128㿈    2   2   2    2 !@    ?? @}  "Ȗ"ЀD `@"DInternal Error%s: bad value route: %s: bad value H#`'  $"`D?㬢 "`D#* €#T #"#   c(,# ,`,@ Đ ? "',   0n  0k4 "4  b ,`"*` €  ?ؐ ??? '''a@@  ` `  !c@,@S ` @R? ? ? ?    $4  @ 0  >` >2`D *ܖ2 $`D2 2 2 2 2 2 * #@@N Ȱ 444Γ*`4Ѐ`4 4     J J 2 `D2` 2` **`$`D*`*`*`2`2`2` 2` 2`*`#@@P  ,,,,,, , , , , ,`,  @P@R   2   ,@"@ J@ ""@ ,@O;} @   @sq ,,@j "&@ /   @@,@?   @`N ,@@? 2$ 4` $'@R8  7 @Ӑ? #`@S   !   @ '& `  ,`` @Q0 !c@+t@R  q q q q nl pL q q p q q q q q q p p q q q q o8 m` lP l\ l lh l l l lt l l l l l l l l l l l l l l l l l l l l l l l l㿘@ D ` " D!c@+'@R6  *ܒܔ `*`"`>  $`$` $`  @R ?#:,D ޒ   "D  (*( (܁ *.**.0x%xany*0x%02x%02x%02x%02x%02x%02x.0x%x0x%x.%s%sH 7  7 7 * 77777+  2+` 2 2,2 211D  p`@쐐0= >@   Ȑ 8@ؔ  2  Р #` `    #\ `@j,2 `@`/К1 p@!2*.0x%XH%02X%02X%02X%02X%02X%02XH.%XH%XH.%s%sx ? / / // 7  / / / / / / // ////2 2 2씓211Z !b@0S J@V  ,  Ȑ D@K  2  , 1#'%# b #` b  #\ `@ؐLb,`01#%    K 0 *  2b@뼐b!,b!b@!2actual retrieval of interface tablex   ?''''   @P 6d"܀ &@M 2X"  @Pۚ 6K!@ܢ @*@Mgot message of size %d on %s㷐" "c @P )'#$@O"(@ݐ '@J@p@X#$uwriting to routing socketroute: read from routing socket: %s 㿘 " "a  @P5"L a c  g  #    5D  &D *+#5 < P `$ D``" ` " `* `" `" $`" (` " ," 0" 4" 8" <" @" D" H*  " @D % #T ?   cT@Nc   @rc D   ?   `@N̔ `@Xc D  #܀ ?   cܐ@N `@>c D  " ?   b@N `@$c D  # ?   c@N~ `@ c D  #( ?   c(@Nd `@c  P% 5P@H"̀`25 c$ @M  @3#('?2% %$@M"L   `@$`Ѐ@$ !!#!@WcH@( @ ܐ?(܀@J@@"@ +#D8T t(cT #ܖ 4U # (? * #܆#ܔ#V@  ? @@ *@cT"( l l l l l lRTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routerouting message version %d not understood %s: len %d, if# %d, flags:metric %d, flags:pid: %d, seq %d, errno %d, flags:㿘# `D `"  @#0;P* !@   "  2  !@   @@ @ T0 !@q 0  @ @ 0 !  H@a   @֔@r route to: %s message length mismatch, in packet %d, returned %d RTM_GET: %s (errno %d) destination: %s mask: %s gateway: %s interface: %.*s flags: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8d%c %8d%c sockaddrs: 㿘!!!q#T@      !@&Rc0!!a@&H   !#!!@{a @&;0  L 3!9-/!5!7!+;!  #" "  @" ` @  2 @ ` 2 @ ?` @` ܀ `` `,` !!"@ #`H $`H!!"@$`H`   !!"0@v ! "H@o @mb` @ x@fp $ 4   L@] $  8 L@U $  < L@M @#@B! $ @  L@A D#@B! $   L@5 $  , L@- $  ( L@% 0`" $@  0"@& 0 $b 0   L@ # `" @%0?H!@"ؠ  @{ ?`$   * ' @  locks: inits: 㿘"@#0!# $ `@X"@ڐ#@ @Q @  L sockaddrs: %s㿘`@"@Ő#` @8 ?`$ ` * $`@淐  %""@ ?  @ ``?"`` * $`@擐 @@ѐ`㿘`Y ?>@ 6  , < ?`&  @  * & @o !  ?`&  @  * & @X 4  8  ?`&  @ >* &@4 >㿘! " @^ 2  %s: link %s; %s: iso %s; %s: inet %s; %s: inet6 %s; %s: xns %s; %s: ipx %s; 㾀 ?`Z*`$ t €!#"@H*!#"@H $ !#'"@բ!#"  @Ԯ! !# " 7 7 7 777@E@ƒ# !# " / / / / / / / / / ///@H@@?  D ` ` ` , ` ` ` ` ` ` ` ` ` `  ` ` ` ` d㿘@@ @J    `А *`: ?А *`: ? *`: ?ɀ`2    $!,  €* ,`  *  **".@ $OpenBSD: show.c,v 1.18 2000/09/24 01:02:24 millert Exp $UGHRBD M@dmCXLS1@2route-sysctl-estimateout of space sysctl of routing tableRouting tables x   ?''''   @J  $@I"@J_ ܀ "$@F 2$@ސ"@JQ   @Jy 6$@-"@JC @$@ʐ"Ѐ` @ @- @F%-*.*s %-*.*s %-6.6s DestinationGatewayFlags㿐%%`08%%#\#`     @ %-6.6s 㿘 L   @P" 2  @ $ @  L ?  M@ P @  % @G``?"`਒ * "@g InternetInternet6XNSIPXISOX.25AppleTalk %s: Protocol Family %d: 㿘?`%"*` €%!%!%!% !% !%!%! `%@!0%!@  l l l 0 H l l T l l l l l ` l l l l l l < $link#%d%s%x:default(%d) %02x%02x%s %-*s %-*.*s  x x  "9 u "C o     2  % c@   `  % @ wc)%'%@@# `@ `h@EƐd `%^# XT `  `  `   `ܐ%# @ : 4@H/@H*&%  @㡒c( z:)%'%@㔒#0  @㌒8 *%#@@;0 H`%#H@20%#P@+ p$R"JЀ` "JR@"` `*`R@  *@  xresolvexnsx25staticssthreshshowsendpipesarttvarrttrejectrecvpipeproto2proto1prefixlenosinostaticnetmasknetmtumonitormasklockrestlockllinfolinkisoipxinet6inetifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpiredstdeletecloningchangeblackholeadd㿘 @G *  *.`.@L p r h2*LN p"L rL h p h r .`2 ` .` L p h r p h뀢 pL ,r  L`N `,`%`* :  . :2 ^ @_6`  .` А 20 .L ` `,* L A 6` L``* @8``6`L   ,V` "6`L 2V`!  `   L`,@L   V` 2 &6` J\2 J/7$ !*@J ЄД ** 8?А ?Ї+ 8* Ѐ4*@*@ 㿘@4c/LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ] Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %s㿘 !!@("@ג`x( `(" @ʒ` (` "(@ $  "(`@ 5"!İ#`"@` 2  2  "(`@`?"aĀ (J (( @    @   @೐#  "!"aXinternal error: unknown type %d.㿘! ! %4# `"$!##` "2  ("@0(#XJ#X ((@   @  "$$!type㿘( ``"`H 㿘( p`"`> 㿘( 8`"`4 We only support %s mode, sorry. 㿘")`@@8?"aāWe only support %s format, sorry. 㿘")`@?"aāWe only support %s structure, sorry. 㿘")`@Ҕ(?"aālocal-fileremote-fileusage: %s local-file [ remote-file ] STOUSTORAPPE㿘 'D'H ` 'D&` D  )PD@=H D  D)`D@<H D $ HH")@ap ``@>` H?D"a`"H`""`H@J a " )!)!)!  #  @`H"`   H@q H"`H  @  @!̐H @Alocal-filesusage: %s local-files Continue withmput%s: not found`'H 'D)D@# "@ g @  " )!)!@   Ȁ  @ N #a\ 2  ! Ȕ ))$ Ȑ#@X)-b@Z#)"!-##Ф#,|aL@%"!.#xp @."`0f!d! . X(#@% ."@" x  P."@ @` `"!āusage: %s [ on | off ] %s %s. 㿘  `? & -`@Ca   & -`@7a  &"/@@`? "!/ @Bell mode㿘/"aāEPSV/EPRT on IPv4㿘/d"a"Packet tracing㿘/Dh"aāusage: %s [ on | off | bytecount ] %s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark). 㿐  # `?:"#"/@)b-`@ٲa - ("c`@٨a 2`"#@䀔 #@J  "/`b@?!"a "#,"31"!/c_"@ c /#,"@c"/@# c"!āVerbose mode㿘0 "aāUse of PORT/LPRT cmds㿘0x"aāProgress bar㿘0L("aāInteractive mode㿘0ٖh"aāusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. 㿘  "0@@a?a"aĀ  !` `?-"!` -`@a    "a` -`@a  "!`!@ض`"c(!"` @8 "ah"`, !!` !h "J "0@Ga$!`"-"X!`!hJ 2-"#(@2!`"!āGlobbing㿘0A"aāPreserve modification times㿘1H-"aāusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). 㿐 "1@'``+-`@Pa - $"c`@Fa 2`"#@ J "1``@?#"a# `?"#1# a aؐ ?"a"!1# #@#   "!āremote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %s㿘'H  'D1 D@4ВH HD  H"1@cb8?%"aH1`@"X``!Ā!`!䀢 H"1@i"`H1`@"` "cusage: %s local-directory Local directory now %s getcwd: %s㻘  # &`  "1@@c`@6*` ?("a@gP`  `+@ǐ"?"aĐ@y$  1"c@1`@#"!`@9yusage: %s remote-file DELE %s㿘'H  'D)`D@44H HD  H"2@ǒ`?"aH2`@!mdelete㿐'H 'D,D@4H HH",@c?I"aH "\,##0b@;  '@F!-H !&"!\!\ "H@5L 2!@ڒ!\ H 1 Ȕ )2& Ȑ#@55a !\ $!\& H @49 2N@:ѐ "!\from-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s㿘'H  'D2 D@3H HD  20D@3H D  HH"2@#c8? "a2`@w#X H2`@p#`-usage: %s remote-directory local-file nlistNLSTLISToutput to local-file:㿘   &`  3 8&`   "3@@`@3@@`h 33 p x`!3@ 8 " `@4` 2`?1"aĒ 8@ +`J |"`@4А` 3`@4| +? "a``X @A @0"`@8.@8)usage: %s remote-files local-file 㿈'H  'D,D@2H HD 3)PD@2גH  DH"3@mb(!3H*  ?`8''"?@9耢 HJ |H@4l 3@4 H?P"a "\,##0b@9 '@D!!\+  a w/H,`@3 x @Ě 3a\  1 Ȑ H& @)@3ߐ#Ѐ a\ &a\& !\` D?@Ҁ`@9x "!\耢@@7 SHELL/bin/shsh-c%sTry again later㻐 @9Z  @9V @F T @9̐   @9H  @9E 4@7 4 @ / " -/ @픔#4`@/  +/#  !"@ː"@& @/"  4#@ 4@ 4 @R?"a@: @t7@8 @8 ?4@; "!"!āusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. H'H 'D 4D@1HD?  H"4@:b?U"aH4`@" 7 D  H4@S֐#H"`D 'DH4`@y# # D H!"4@3#@."P O@ߐ@9?,H" D 'DH4` @W#(  "4@#00  D 2 ?H4` @B#(?"bPWDPWD command not recognized, trying XPWD. XPWD㿘!! 5$!@$! 2$!!Ā!2 $!"5@ݐ!5@!8$!Local directory %s getcwd㻘@"$  5"a@5@\!"!ādirectory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD. XMKD %s㿘'H  'D5(D@0ВH HD  H"5@cb8?"aH5`@"X !Ā!!䀢 H"5@l"`H5`@"RMD %sRMD command not recognized, trying XRMD. XRMD %s㿘'H  'D5(D@0H HD  H"5@b8?"aH5`@n#x !Ā!!䀢 H"5@$#H5`@Y#command line to sendusage: %s line-to-send 㿘'H 'D6D@0DH (H"6@ڒ`?"a(D#@.Harguments to SITE commandSITE㿘'H 'D6HD@0H 6H"6@`?"a6D!h@H㻘@x#`/@8  #" @j @8s/    *@ . 4 /@֒ @Z modefile-nameusage: %s mode file-name SITE CHMOD %s %s㿘'H  'D6D@/H HD  6ȐD@/H D  HH"6@:b?"a6`"@`SITE UMASKSITE UMASK %s㿘!!  $!6#6#@t`$!SITE IDLESITE IDLE %s㿘!!  $!7 07 @@Z`$!HELPHELP %s㿘!!  $!7 7 @D`$!㿘!"  @ @!~ "  @ @7 QUIT㿘#b 7@$!8!# "@#H?"`$#$b" usage: %s [password] Account:㿘  "7@@a? "a27`@QG!Ȓ4@#(㿘@5s #H @!+ "  "a"!@!  @A commandusage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. 㿐'H 'D7D@.H  HH"7@GbPH@' ? '!"7@\"@,"h"! !"7@M"@, "2J`  !"7@@"@,"%@@ ؀  7b8@5 @  J " !"-@!"@+"@  @5l ?("aIJ"`7c@a  `@6ΐ"@7DH? €`"  "a"!@ t @5B Case mapping㿘8lP"aāCarriage Return stripping㿘8͖"aāNtrans off. 㿘  "!8!@ѻ$##"!` !!""㤐@c  ,  *#|!#|`@W , c| 瀠&cؖJ!$J J@` J2`@  c| @* 2  * J *cNmap off. mapoutusage: %s [mapin mapout] 㿘'H  'D"!8#`@P$  C"!Ā  D8pD@-H D   H"8@cx?*"a1"a# @"cH`  L " &#@蹒 ,##@̐"H L " !X@”#nmap: unbalanced brackets. "H   *``` NLC *`:  $ \2%J*J!: J 0$JKJ@J?ϕ+`   "@  K`J 2 " K@2 K 2 J 2 K J   K +`" JaX1耢 #.#aXJ [  \ $+2+J ٖ +J $1  L   "* J 0?L  @`+J@  f +` ` @ "Z  +@  Q  *`A: :  \ $921J L   ")JJ 0?L & @`+J@  J+`  @ "J +@   J  + J  , ]*`J ^  J2J 2J  ]`\J <EJ ,b ]"4^ L   ")+J 0?L ! @`+J@  +`  @ "  +@   J  +N#؀ #0"9@Ϝ Passive mode㿘!`!:" "aāStore unique㿘:t"aāReceive unique㿘:@d@"aāCDUPCDUP command not recognized, trying XCUP. XCUP㿘:@#``!Ā!`!䀢 ":":@;#:@r#` "crestart: offset not specified. restart: invalid offset. Restarting at %qd. Execute get, put orappend to initiate transfer 㿐 ";@ H0` @V1 > J ";@ h0";`@ ǖ> SYST㿘;@!pLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. 㿘! 'H 'D";!  D;D@*͒H D  H";@ `a Ȁ  ";@w! #*`H cP*  @# *` * `*   "@ ";@Z"(x"!" " `$ o"Ē*`  * @  "@  cP* * ` @'%P`? "`@N P  "P?Α. :  .@ cP*` *   @ȐN "Ɩ.@`Ȁ@3`P`? "`@$ `P  &`P ?23ꀦ?`P`?  "`@  3`P  ` &`P";"P@?"aāfilenameusage: %s filename %s %qd 㿘'H  'D<D@*H HD  H"<@ a?"aH @+ ?  H<"a@ "!ā%s %s㿐'H  'D<D@)ВH HD  H"<@ ca?"aH @, ?'H"!<`"@@/@ I"!āSTAT %sSTAT㿘 <#p<#x@ `Local file "%s" is newer than remote file "%s". 㿘+X? <"c`@ `PAGERmoreCan't allocate memory for $PAGER|%s㿘'H  'D<D@)[H HD  H"<@ a H @*  =??"a@/ 0 =L = 8@1@.<  ==`@@W `h@̥%H !#` # a++  0"<$a@L$#@.@H<<$#@ $a@.5 ?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestartresetrenameregetrecvquotequitpwdputproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendmputmoremodtimemodemlsmkdirmgetmdirmdeletemacdeflslpwdlesslcdimageidlehelphashglobgategetftpformexitepsv4disconnectdirdeletedebugcrclosechmodcdupcdcasebyebinarybellasciiappendaccount$!macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. 'H 'D  >D@((H   H">`  1  HcP  @b 2  0H">`@ ?"ab`@ɐ/P,`* ` @ Ѐ#`L  2 N+ Tb`*`:  $ \"B A `L@  %*`    * ,  * :`  ?D?#?H,  @ʀH :  i2D  H,@nH@0@.@`N 2 N @ .@#b@ c `">@> Q"!2N` "> ! "  ">! @'?9"a!䀢 !"@b`"@v b!` €"H# N`  "`?"``@* "@@y @"`@ ?"Hb'D@'HP* `@2 6#뀦D#/unknownCan't allocate memory to parse URLhttp://ftp://file:url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %s-Can't open %sWriting %sReading from fileSuccessfully retrieved file. host %s, port %s, path %s, save as %s. %d%s: %sTrying %s... socketconnect%sRequesting %s (via %s) GET %s HTTP/1.0 Requesting %s Can't allocate memory.GET /%s HTTP/1.0 Host: [%s]%s%s :GET /%s HTTP/1.0 Host: %s%s%s Writing HTTP request200Error retrieving file: %sContent-Length: Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %s??!'@? ?#" ` ?a@S ??a@9  ??+?a@)   ?? ?a@   ??  #?a@S @4 /  L@ 2,@ 2@?,"` L@  2@?"8?c@"@@V6?"? H  ` g@?"`@0vJ@ȇ? "?b@Sf ??a@ȱ  2??# ?a@ȡ  ???L  /?"@0<,@༒ / ?L@ 2,@?#@( 'Ԁ???"@0#P@@%<?2 0??:??@䧒b耢 ?&@!?c@  "@?R  ?c" @7$! 2?Eb8@, c, ?c:#   ;bP@(8?Q?P@B :P& ?c@@@,-? 2# 7!L 24?"P +"P2 @&" #`?"``@* "@@ ##, :P@ F P@(@"0"?#ؒ@Ԓ@+ 2# H!L C"P`"P<  8#,"P :` "P2 "?`"@  #* "@Ǯ #"?`" * " @Ǟ @!"?@#0+@' L [@y ] " J ``:2* @y : , #  ??"cH@Řؐ @,  ''#!?#$@`#`#0?p  P@@h  !?#x@0 @E0Q?#$?'ԀJ)??cؠ  #\  @.X"?c@q@w 'Ԁ??'#@д ? "! @+I??'c㸔   #\ @.'  )??)?#$@Ԁ ??#@0j# !䀢 ?"c@ #?@@bQ?!䀢 ?"c@ @Ȓ : +#@T ?c@Q6 @޺ % 2*#ؒ@@ @ (@ 0#\@ 0#\ @,@(q?@@ 8@ (@ 0#\@ 0#\ @?#ؠ@@+Ԓ@*_@@z `0 @+??#ؒ@&0:./Ԓ@*_  @L   ./@V ̠ @`x@C  @ @@0Ð @+ Ԓ@*7  @L  2 `    ?#ؐ/ ?cؐ */L   * R  c2 @`@ܔ  2 L (  @?c  w' * @Ќ : !:!!Ѐ ?h@  c?# J ^@???:??@b耢 ?&@J!?c@ "@??@~Ő"0<R  ?c" @4i!  E?#@ '@ @)] 0"a@)Y c, ?c:#   ;bP@%s?Q?P@B :P& ?c@@@)h? 2# 7!L 24?"P +"P2 @&" #`?"``@* "@@? ##, :P@ F P@(@k"?#ؒ@Ԓ@)9 2# H!L C"P`"P<  8#,"P :` "P2 "?`"@  #* "@ #"?`" * " @ِ @"@@} 0f@$Ɛ !Ѐ!?"P"P @ !䀢 M"@@0 0G!䀢 "?"?@&#(?#@@(r @(?R ?@(?# ?c@@&t@?@&o/ @} 0????@}#0@!(@}}Ԁ??@(??c@@&F@?@&A? http fetch aborted. 㿘@' !"E@!@"!@3!  file fetch aborted. 㿘@'s !"E@Ĭ" @l"!@3  ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'cd/*?[]{}Retrieving %s/%s %s/%sgetmgetp'D'H'L"'@2  "  f  ^a,@' ^aH@' E@&G"pE@&C"{ ܪ H* @@g   Eb@NG ?aؐ@Õ   ?a@Î   ?L/?P0La@  O L??0; /@ۡ @@۝ :@ۙ $`!@``,`   *@L `J`  `EH*` @|m"0 `@o : `. @_ :`L@ `.@``N@  @uI /  * #  E"b#\#`@v#ؐ@J 8@"    8'''耦  N !'' !  $  @"  $  @ 2 E"@{0  EE# c(? '귒#  #  ` N@ Ec0@@  `L Ec0@ 2 `N@ `E# ' ''ꃒ# K"J?L D?!䀢  "E`#8@ 0 @ޖ` EP@$E#X''䀤` '耥  L!E Ȑ#`'$ Ȑ i $ Ȁ " ''  -!@c d ܰ @$:ܐ '܀ D 6 ܒ :H* @V x" ? ᅭ :/㿘?a@  ?aؐ@  ?a@  G@vbX   unknownftp%dftpgatehttp%s: bad port number `%s'%s: %sTrying %s... socketconnect to address %sconnect%sgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopt@G""a)  @' ؒ  @'  ''''@ۖ.`Gb/@ܐ Gb@֐  GG @> Oc@Ȑ  OG @0 PO @` !GG#@z #(@*Z@z?"a ` @ٗ! ؒ@ّ! %$* G?     #\! @( G"c0@  @ʡ 6 G%#@@   "! " ``     #\! @(X G#H@z5G@%ac`?  `6  G@z%#h?@"w   @%` @'b'@ʐ 6 G@z #pE G '  @M  GG@y#Gc@!$#Gc@## $c`2G@yՐ##!䀢 G"c@@ # "c@c @?"aĐ '?c!@    # G@y#!@$ڐ 㿘@#Ɛ !"?`" * " @v @"` `""@/M ---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT㿘#!'H'L'P'T'X 7$ 3bI@!xIH!@B  IIb@!b!@5  bIb@!b@b?`" * " @  @Ib3c  II@y!?"a& `@#ɐ c@HcI@n!@.c "4I@a@%`? ƀ @# %c%c%c421 Service not available, remote server has closed connection. %s:㻘"H @%$9I @#     "!İ ֦ '@#`΀` `@#!I#c  4!@#!I#c  @@#!` @ !䀢 !I"@#@"!"a ` >!䀢`45 541"@ ,!܀  ` "J"`@"`? "`` ,`:  @* "@@-  L `   đ*` * ?А"Ā  !Đ?    !Ā " d   L `  2   d` `)"---  d`("  `- "!Ĭ "!,!@#` '`!䀢 4 !? 5"@ !"`?"``@* "@@@"$d8$!"0@Ԕ, !Ā`"# 1,"#4 @"[!Ā!a@   쀥@`"?П@  ?Ĵ@"@  "aİ 㿐''   @ߘ send aborted waiting for remote to finish abort. 㿘@! !"K"\"@Ð!@""X@-$ sentlocal: %s remote: %s -local: %s%s: not a plain file. STORAPPEREST %ldr+w%s %snetout#,L :K'!  ??#<"P8'D'H'L?`'  LJ -K"b @JL`K"b0@AL#H DH@ L0yaX!   Gc'p"X''x't@,'| ,K #4 ! x@"?$ x @! t @!y | @!s ?"!L:"Ēa@!i 'xXb@!d '|KH@Ēb@  HL P`a'_"LJ@ |'G @!L H'tGc@2 'G#h@vx@!; t@!8 |@!5 aL ""aL!|6'H@c 'HK@vn"Hx@! |@! *R` '@ <  "HK"@bXx@  |@  @p:@q x@  |@  t @  ?"!"L€0@+Ր"X ax!  `@LKD@.bp  KD@'bx @L!?` @o     R` @!  !HK@u"H  :J"L  Ky"    < ;"LK < 'pLDKc" 2x@ v |@ s "!Lt @ j `4@00GH#h x@ [ |@ X t"!L @ O  @0@ $p '@i? @ > a`;'t`` ""!R "P <`B;"P` R@ O 4$@# ;!L !Ѐ 4"P"P *   !" #`?"``@* "@@ ##, : B?"P@P"R@ $ # M`!L !Ѐ C`"P`"P<`  8`#,"P :` "P2 "?`"@  #* "@ː #"?`" * " @ @"` KH@tϐ"H  "!_#3 "P"P 49   0" #`?"``@* "@@ #@"#, :# B?  !L !Ѐ ` @= `?`"@@* "@@S P`B :P ? "` ,`:  @* "@@5P`B :P@6` # B!L !Ѐ ;"P"P   "?`"@  #* "@ #"?`" * " @ @%" @KH@s"H @  "! K@s"??:P@Ð "!L€@ x@ |@ t @ "P`"PJ  F@ 0Bx@r |@o t"!L @f #4 !?+"a @?$ @Ő  ?"a `€ "P`"P  @B  receive aborted waiting for remote to finish abort. 㿘@ !"O"\"@Ɛ!@""0@)' receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %s#,? :L?'pH'l?O'D  :!O ;P'H'L'P'Xb'@`?''h 'd '\!䀢  H X`2J -K"b @&HLK"@b0#H   DH@ L0Q '` 'X'T @ '@(u"0 )O #4 ! X@?$ X @\ \  @V p"aLl?"H"Ēa@I 'XXb@D X '\KH@աb@ hHJ |dH@   UH@ku / "!  HK@ro"HlX 2,H  O " O"(@   /, HK@rP"HMX#@  "! H@H! HK@r;"H8X#@  "! @ wH  'H)X#@ @ lH 'H  !   0aX!  ݒ L@ :@6  X@ \@ ?y"a@'"0 *p   ` K" eL  DK"xL  X0%Gq#h  XG@a# 'dX`XKH@ݒb@ X 'h6"aH%PHJ |  @d H'T Gc@- 'hG#h@qpaL ""aLa|"!H'`@ H 'hKH@q"Hp* '`hR`@!  !$'!!؀@#a܀ @@@ $aO@qi"0$!$!<  aL ""aL"!H@0?! ", * (   h R@ 6 "HK@q8"Hp"!Ll` "aH`@h0 ""!^  !ܔh@@R2  "!   $ PbP <`#B <;bP!L !Ѐ 4"P"P *  䀢 !" #`?"``@* "@@ ##, : B?"P@"!d@S  # M`!L !Ѐ C`"P`"P<`  8`#,"P :` "P2 "?`"@  #* "@g #"?`" * " @W @"` "! O@ph"8??:P> OKH@p["H06H@pK"@02   @h @ø H `  @.h? "  h @â  HK@p0"Hpl`"!L "aHh0p`  'k` #3 "P"P 49  䀢 0" #`?"``@* "@@ِ #@"#, :# B?  !L !Ѐ bPBd@:bP` h ` ` @> `h?`"@hh* #@ `!` h`? "`h ,`:  h* #@|P`B :P@}dm` 쀢  !O"bP@O"@"# B!L !Ѐ ;d"P"P  䀢 "?`"@  #* "@1 #"?`" * " @! @^"d` @  "! O@o1"8??:Ph @KH@o%"H@ p"!Ll` "aH`@hX@Ɛ \@Ð T @ @1d* "P`"P }`  @ !H n*` iL@̒ ?d't@ t?xH@%ؒx?Z"!O"@Ȑt@H@ 0Lp"!Ll"aHT` @t  @q #4  d?"aX@f \@c 0.@c#`?`"!@֐ $``hd€ d "@վ "P`"P X  @I X@8 \@5 use of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)bindlistenEPRT |%d|%s|%d|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d㾸  't` '` ? ?@T?@T@m!a耢 & @  @ " G@m#@- @`?" $!!؀  ?c t@ܘ  T@m!b   7 S!d ,#a 'T!aĶ@Y    " T@!؀# `$a"T@"!T"(T!ߐaĶ@0    " T@!؀T"0ǐ!!Ȁ  @S? "!d$!"T@w"8!`Tb(@& DTb  2!Ē @   "T@W"v!#\#`T"Hb@EĀ   @*`* @*ÖǕ*@  ( @ 4 , )$ b0@ސ T!Ē @ 2  "T@"4!"  ? !Ęh#\#`#d#hT#l"Hc pl@E< Pp ^l Zh V  @ * *` *Ö Ǖ* *b 6.&ĘȚ̄ІԞؠܢh#\#`#d#hT#l#p#t;x;;;;"Hc@pl@D "T@"!p  l h "T@"P!  @b˦ϗ*ۅ(ߕ*+ *  Ó*`ӡ, @+`@(+(@+ @ǐ (, @$ @6.&$Q$a@ m!!'@ג   "T@<![!#\T"Hc@Dv OO@ O@O@"T@#;!"`@ 4  "!  !!Ȁ G@k#`$!!` "@-" "  "  't'b@Д )#x 24 #`?" @  @’   $`G@kt#@` %#x#x ` ?c t@  `T@k]#!@   T@kR#!!؀ `?c t@   T@k@! 'd`@d `G@k3#p!@A  6#xT@k)##x ` ``  6!d /! ,      •x #\ . @#   T#В#` "!"T@M" A"    9  T# #\*   T##\#`#d #h #l#p #t #x #| # ## # # ##C #x? %#x'`&@ ` %#x    't`  t@ژ   G@j# !@ `?$  "cx acceptp "a耢 '' #`@@Ԡ  X@j]!`@ ?$`@`ـ $` 'А  @  6`G@jC#`@j㿘"P# "a`"P2 $a  ($a@ $a㿘@I ` "`㿘'Xb$@̐   H  "H#h H !ch"H"%&@""  @  .!. `! $ @1! a @- !" @'!a @#&!<a<"&!@a@!X"&!DaD#!X&!HaH4"&!LaL""4&!PaPc@#"&!TaTl#c@&!XaX!"l&!\a\!" @!`a`@.!p!#| @ȷ!qaq@ .!`!&!a"H"`#@Ȩ!a@.%!!X#@Ȟ%e.)@ @2଀ $ଟ 㿘@ !"?`" * " @F @ "`"#!\"ଐ"@ STOUproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s aborthO"'D'H'L'@C ' '#@ Y"0K"p'!X  1!  "( 2 1!"TՒ T"( "Y@\"80 ڐ "  !"Y@O"pΐ ?"aĀγ Y"ybH @"Ѐ ; Ya@ Kb'DfL @y  0@!  `'SH  !  `$  ϐ @[  Y"$ Hb@L0@N " OD@˭b  #H On !OD@˞b  !#H #4^ !#4 2! 2 !KȐ" H &0#4 "@ #HA`?#4 2#! 2!KȐ"H "!/ #4 @ ' " ?"a@ 0J#4 "@ #H`?#4 )В  @a# R 2* + @ $  6Y@h"" ?"a@{* ( #H ߐ ݐ " ?"a@ resetxؐ @! # R 2*@ + @ $@  TZ  c@g?@A"a   runique: can't find unique file name. 㿘@` / ` 1,@@`O" O"(@D ` /,@+K@g"H; " [@ x03`@@ .*&`  d,,@: ` 9,@ 0`@ ,:  02 L .  1,`,"ߨ 1 Lost control connection for abort.%cABOR x!# [@g8" " ?"a@Ic   @P#R  @~  "#Y@g("#[bH@a @C#ؒ  @U# R  2`* `*   $ V 2 * *@$ ~ 4 6Y@f"" ?"a@e V 2 *` :@` V @۔$ 4V  !Ā"(  ftphttpFTPSERVERPORTftpgateFTPMODEpassiveactivegateautounknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpTERMdumbemacssuAadegimno:pP:r:tvV--r requires numeric argumentRetrying... 㻀'D@f'H\\`HP\"##@ʐ X   "c(\ h"c( $3#%"c,#c "H"#!L&a$a@$`"b\"ad"@ p ")\@S`x 2\&a$aȒ`@J 2\&a$aȒ`@A 2\$``@9 \$a&a @f  8\@+` 2\ "a`\@j  "ahJ !\ "ah!!`  \!hJ 2\\@e $!`\@M!0  \@a8 \a@@ \@aH 2  P@T  "` "a XR@"b k`j\@ * d a"aL`5\^ T*` "!T"a P"ap㐐 `"G"D"#A" ?="aL:"  "!\ah@ȥ 2\!-"b "!&" "!!"# "! L    @a!$"@\ap@6ߐ   "cD "a"!@W\DP@7H!"#xH+  D"@  'H#c4"H"@+'D @O1 @^@P @"@3 lc@ِ DEH@  "!pDH &9@c@" "^@[ a,@ ^aH@ H 8?'''D1`@t"@ !"  "\"@H!@"@" D""@@"`?  ^a,@ ^aH@ @  t v v v v v v v v v v v v v v u v v v v v v v v v v v v v v v v t v v t v v u v u v v v u u, u8 up v u v u v u㿘@ "@W 㿘' "@ #b !# " !R @9 @˥#$#! & $b@9 @ ?$ $bO b  !# " $bR @9 @ˉ#$#$b"!< $ᐁftp> ^"(sorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. 㿘 "?`" * " @ {L dƀ`"^, "^@u"@ P`? "`@ʇ  P  & P` v Ps^@#bH P1"@r? "^@M"`B2 L "^@D"x9  "  ""^@6"+""c €bH# " L  " `?"``@* "@@  `!d@^ " Q!@"@""`1$@ P   @ n^a,@> ^aH@:  -    `"J@ KJJ@J`J2  "  " `2J@?㿘%"`ax""#!#`#$bH $bH@@ bH!$aJ@ `!$ 쀠 J@ `"#aJ@!__fd" J@ "` ?`쀠  J@ "" J@ ' @"" 0 \2 *` `J@ @ *` J@ @"2*ݒ``  " `* ` #a!쀠    "!"! 㴐 %sommands may be abbreviated. Commands are: Proxy cC?Ambiguous help command %s ?Invalid help command %s %-*s %s 㿘 U?@)%"H`` `!`! @籒 3c1"* ` H L c@c"*   *@ @( 0!@Ȑ? `"a `"a8@z ?`"aX  @q? `usage: %s [-adegimnptvV] [-r ] [host [port]] %s host:path[/] %s ftp://host[:port]/path[/] %s http://host[:port]/file 㿘 8`   b@:!@I macdefmachineaccountpasswdpasswordlogindefaultHOME%s/.netrc%s/.netrc: %sr%sanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.Remove account or make file unreadable by others.Missing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. 4K macro buffer exceeded. Unknown .netrc keyword %s8`@ ڐ#࢒   @  # !`#@ ?@a] `c@}a`@Ӑ  "` "! a @aQ @z! &/@A . \aZ  0T F@{ L'@ܒ :#a@֒ 4a@ . "@̒ a@$ a$L @ . #@ $@Ȕ L@ 0"'@   aD `a@, @  ! @ @  @D&@0@`؀ a@`   @_R   ?a@  ! @ Ԑ@ W @&0 @AR   ?a@  ! @ @ 9 @&0#H )@n  ") ")  '"a@ѐ `%*` * P *    ``@E   L   ",  ,@2  sP`  "@ P*` * ?`"-$*` P* @ * * `"%* @P *` #@ E*:  ,L? , `Ȁ Ȁ "a@X!P7!p@_`@7    @,   @_Ӑ 0a@_А  @ 0"a@0 "a@)! @_ 0a@_ ` @?㿘!  T @   ` `,3#`"`02.@ . @ `"`\.,`2.@t . @o  ` ` ` `,퀢`\.L`  !` !@‚` "    stringlist: %m㿘@ 2 cb@W & & @ P &cb@W 㿘  @2 *@#&  &cb@Wܐ  * "  & 㿘  `  @ .` @` @*@@ݐ㿘  : , @ 2  * Already connected to %s, use close first. tousage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s asciinon-printstreamfile8SYSTRemote system type is %s. 215 UNIX Type: L8binaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. 㿘#b'H  'D"cc DcD@ HD  H"cc@?"a!!` #(#H !` H!h"dJ d`@/ W  S  !` Hd`ʐ @ !䀢 d"`P@ah +d`x $b@ ac ")d` "@ W%!X"d` @ O#8"Xd` @ G!(d ` #X"aP+#X *"H  @ #' ?$dz #!`!d%4@ђ  @˒  L? ."? ,"d`@4 2,!d`А"0@  #H  "b( "ac d%!X`@ ` d"`@ٔ$#H ""("!`d"0a@{ 2$"d@!($anonymous%s@ftpName (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$init0'L`'H  'HLΖ H?"a԰ H L - !p ' ! @ l !@ g@#  'H@U@Hu 2e!'H!@v~eH@Ξ! e!'L'H 2e!/'H@#  @U@HS 2 e"a@5 e"a@-P/ O@|@ ?.@O 2'H'HH eHr!в`L 2ee@"!'LeLc!`` `e@"!'eS"`e``eF" e@\" 25 !p \  #H  0'eb  @א"`= ""H@05? @ "b cPe"@ `@  sorry, arguments too long. (%s) 㿘"`@$ "f@!"f@ጒa ,@ $"@P@|X @` ?L@ ",@  "H@$ $"&@TMPDIR/tmp/unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %swNLSTarcan't find list of remote files, oops. can't find list of remote files, oops.㻘!\ # !?"!`",  @$",# +` ""```"`` ""`0b, 2f@" f"@ܐJ? /  $d !f#@ ?@[ @ ?L /" /, fc( @֐;@D f#8@[j @1񀦠!?&!&!'㘀`$#HS`?`@f`#`@f#h > `@f`#p!@L d "0&`#H-`?fcx&!$@%b,@̘b, 2 f"f@# #&!!`",@{?$ ",@M $",@ 2.%s %s? Interactive mode: off. Prompting off for duration of %s. n, y, p, a, are the only acceptable commands! 㻘%Ȁ B#c 2? !g"c @)@ "P@z$ , `*  R  n"$  p ag" yg"g"$@%#(  g$c"c@@ @ch! %s: not foundh# ! Ȓ  ,@ڐ@, @ 2@Ȁ  @h@Z @U  @$@@MSIZE %s㿐#%c䀢 ???$h !x  "0@g $  @[ J   L@  2$??"$c 2 $!"@"0"@ $MDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. H#'-c䀢 ?$h੐" a`1L"0"0   " L   2 hb@  2"h@*b  2 0, ,, #\#`"0hĖb@2Ȓ  ,@ ?'''Ę?x''''@?쀦`c  h"b@$"$c 2 $!"@"0"@] $䀦?"%ā㿐!"0?@/$"0`w @? "0 `?㿘# "a !L?2$a@N $a %3d%% |%.*s%*s|********************************************************************************************************************************************************** %5qd %c%c %2d: %02d:%02d --:-- ETA - stalled -%02d:%02d ETAh!!x @Ӯ`!x d"d# :p@ӡ !L +aЀ a15"P@ B `5- -@B2`* @ *`B2*@ *@a  d & d4 diȐ!@e ?․`@@Ē d@@ib!"@ii#\И!@H$@  4`  <    4  a"@ , @ː@Ȑb8J@!"@i` "#\ B#\@d d"@'" 'А"@''!p!p`d"d" ;!pxx  "x@ # '!x!x" `'" `'А"@@''"@` 腠DA?؅B.'@2 @_@\!"@i@ɺ.@Q@N!"@i@ɭ.@'@A@>!$@!i" <@ <@@ɒ%"P "P` "H  aЀa`(@@ !"@i@j^% a@@!"@i@ZN% @Fb "P!@A?ؒ. ЅąB'@ @ڐ@א!"@i@5.@̐@ɐ!"@i@(.@ꢐ@@!$@!i"ؒ <@ <@ꐐ@ %R @@[ `ia@& @ 0@ ?`" * " @@ @~%qd byte%s %s in %.2f seconds (%.2f %sB/s) sMK ETA: %02d:%02d:%02d !䀢  @ǒ !x!x" `'" `'А"@@''"P!"P 腠D@Γ?xxX B3? ?  @  k(k k"P" "P` "P  ki"k"P ̒x#\@`;``"`h B`;hk"Xk"`#p@V d V"P "PQ ` M xX EЀ`A "P@ D 4: 3В@ @ b !@?px. pąB'@.@閐@@ d$@!k"h <@t <@鄐@  "R @@K㿘  @ ,`@@4 `@* ?`@A "  @? @I 6C`@,` "@  " `?"`@* ("@@ %`@C-`"   ?`"@ * "@ 逤Ħ`@ 㿐"# "aR `h@?   P"  P"`$a㿈'''' @+A 㿘@K/etc/dhclient.conf/var/db/dhclient.leases/var/run/dhclient.piddhclient-pbinding to user-specified port %d-d-u-1specified_interfaceInsufficient memory to %s %srecord interfacedhcpcudpNBIPREINITalias_㿘@s m  @n b! * m@@` 2m`@@@u\! ** m4"@F2`D@@v` m + 9"c@@l`耢 m0"#@@@c` 2@ , &"cDJ -m@ ``@DŐ ` 2  mm@!@E̒a0  `@f@ @O  +  $$ L"#" `m! *" 2 "mm!H@laP 2  D4"" ,! ,4#H@#l#H ,X?"  *X * 2  +##$@Ȑ @% +@5@   maX @  @ @4 #c m L 2m @ a` P mah@ Ȑ@  2#c` @  "  P "`@& 2 P d -@+"a  Usage: dhclient [-1] [-c] [-p ] [interface]㿘n@E: ȁ㿘@# 㿘 P@  02  ""`@ 0 P@o@ P@ ", Pc@  ,#l P" 0 P@ "4 P@X"`8㿘 P@@ P@ ", Pc@  P "` ,#l P" 0 P@ @"4ARPCHECKcheck_㿘n"p@ s X@  P  ! ` ,nbX@ ڐnbh@ $@ C $@@ے@@ 値` P`"  P "`0@a܀ ! P ," cl  P""` P c@   " P   @ @ "  P@"`0 c@.  P "` ,#l P" 0 P& @# 4 P@@ s",@DHCPACK in wrong transaction.DHCPACK in wrong state.DHCPACK from %spacket_to_lease failed.㿀 ( P, o@Dؐ P0j    o@Dʐ p0\!o   @ې@5@D@ 2Po@D 0Gt"`#(@WP @5!P`"`P  "@5P`"`2  : "P  "@5P` "` 2`@ : @:@" P ,cl @ "P`@ "P` @ @" REBOOTREBINDRENEWBOUNDold_new_bound to %s -- renewal in %d seconds.㿀 P`8`"`, P@ ` P   2oo ""o"o" ,@  P o  ob@  Po b@  P mah@ @  P " P@ Pp`" P"  P@\  P!o` "@@4 P ,@`l" @Cǐ P @"`@ Q㿘 P@@ P`@"`, Pa䀤 2 a @  P"  c@  ,#l Pb" 0 P  "4 P@"`  BOOTREPLY from %s rejected.h * (`P",f@   @Ȧ @@4k   @@4yp@C`!X0@DHCPOFFERDHCPNACKDHCPACK%s from %s rejected due to bogus yiaddr of 0.0.0.0.%s from %s rejected.` oq0Qr0Np  b8p"bHp bX"'Ē`@Ê  2 (#p  b`@Q@4   "@G@4@B0  (`P",f@  @3Ȧ @-@3 2!pBOOTREPLY%s in wrong transaction.%s from %s%s isn't satisfactory.%s already seen.ARPSEND㿀!܀  (p"8q (P` q`, @q 8!q   X@@3@BP&  & 4 * @ w 2&P    2  `@  gq 2 @ 2!o@Bg 0e 2P 0 $ 0Pq 8` $ ,@nbh@ I@ hPb@?  0@  @±  P $P" P   ,#l4 $P` 2"`@ 2@"@ ,#l$@ &@`nΐ0q h@B0  @B60 bp@s X@Ւdhcpoffer: no memory to record lease. dhcpoffer: no memory for option %d Invalid lease option - ignoring offerdhcpoffer: no memory for filename.Bogus server name %s㿘@t(4 q@A#{  @(4 , 4@ "@`  8W$ 8 @@@ 4"*@ @  L, & ` @ߔ !Ԁ "! 2!J , "!@1 A & $r.  @@Œ`, $* @@  $ 2! $r@AK 00 "! "J l @  & (r  q@A1#0q#@A,@  @`l (* DHCPNAK in wrong transaction.DHCPNAK in wrong state.DHCPNAK from %sDHCPNAK with no active lease. 㿀 ( P, r@AP"h01    r@AB"0#!r  "@S@2"@A P r@A"0@Pt"@#(@̒P "`No valid media types for %s!Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %ldsend_discover/send_packet: %m㿈 P' ,0lb"@  @0 6 b 1   P`8 " P "`8 P 8 2 P`" Pr#@@9  P"@ "8 Pr`8`@@# Ps 8`@4@ 2 P + P4 b  "4@“ P2 `4@ϓ, $`4 P"f`4@$ P@ P2 f@4  `4@ṡ<  $`44 2 Pb "4 P"@l40@ "@  "44 P P2 D 2`D# ,cX`'!s @ǐ P`4`@@+  + P#$'<#\@"% 6 Ps@? 8 Psl`X 4@No DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping. FAIL㿀 Ps@@?ؐ#X P` 2Z P`s , P' ,l I!s #p@@0ѐ@? Psc ,@Z Pob@ P mah@@ 2% P Pl   " Ps@#`@?"@  Pp` @ 0s"@?#Đ@@ 8 P` "%@ P @ 2@ "@" P` "@ P` "`  P" 2 P ,#D s@ "`  P"@?O#t @` P mah@9@X P "` Pf" @ ,lnaؐ @@EXPIREDHCPREQUEST on %s to %s port %dsend_request/send_packet: %mx P! ,#l0"@2b $  P "`t#(@Ӓ0: 2 P8 2 P ,s`@@ 2 P P`," 8 P !#l @tb@  Pob@ʐ P mah@@ P "`X04 b  "4@ P2 `4@, $`4 P"f`4@$ P@ P2 f@4  `4@< $`4 P`   ,#l@ `4 "  "`4 P  ,#l @$?' , P #H 7//   4 2D2D'!t"@ @>_쀢? * P'"<#\ @!  P'<#\ @ K耢 6 ,t@># , Pt#lc(4@DHCPDECLINE on %s to %s port %dsend_decline/send_packet: %m㿈# ,cX`'!u "@`@> + P#$'<#\@  u@=ؐ"DHCPRELEASE on %s to %s port %dsend_release/send_packet: %m㿈# ,cX`'!u #@z`@= + P#$'<#\@ڒ u@=#??c  /  @ $@ P %@ < Ԑ$@ $@  " @ ?" @  " @ "  P($@ & $(& `@ "  P& @ " @ " @ "  P` @͐% Ȑ$@ `$@ `"`@ `" @ " @ "  P"%   @ 2" P(, ? @#@?, "@, @"  P&, @" @" @" ښ` P`<   @*g  P"e Pe!+4 !,"e P *`< P *`= P *`> P@I* ? P "@ P2 D P2 F P" H P" L P" P P" T P @` X?c  /  $@E P %@@ <? Ԑ$@ $@  " @ ?" @  " @ "  P($@ & $(& @ "  P& @ " @ " @ "  P  2 Pa ؐ$@ $!`4@  "`@  " @ " @ "  P ``2"%` @% Ȑ$@ `$@ `"``@ "`@ " @ "    @ 2" P(, ? @#@?, "@, @"  P&, @" @" @" ښ` P`<   @)  P"e Pe!+ !,"e P *`< P *`= P *`> P* ? P`,"`@ P2 D P2 F P`? 8"`H`H`@` P P " L P" P P" T P @ X0 / $@y P %@t < Ԑ$ '  "  ?"   "  " a!$ '`4@   # @ ` "  "  " $ ' `"`` "  "  "  Pf-耢  $ f-'f- "  P&- "  "  "  P`<   @)  P"e Pe!+4 P!,"e P * < P *= P *> P* ? P,"@ P2 D P2 F P" H P" L P" P P" T P @  XH / $@ P %@ < Ԑ$ '  "  ?"   "  `4" a$'!@  # @   "` "` "` P@(`< P"e Pe!+4 P!,"e P* < P *`= P *`> P@* ? P`"@ P2 D P2 F P`@ H P " L P" P P" T P @ X㿘 $ " (@* (  @$,  4  8@   , @wcan't create /var/db/dhclient.leases: %m㿘% * "@W#x@bx $x@:" +# ` +`P " @z `P`"@@o@`2`P +#``P " @^ `P`"@@S@`2`P@ lease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } p`0 ' *∀ 2x#x@bx $x@:&"x@Œc`02  "yx@μcy∔ @η`!y`  @@+@Ω`(y@΢`8`$ y−`P@Κ`(`,y−`h@Β ,`4 !, `8 ∖ @( y`x@{,@_`! * y`l #\#`"@c#d@K` y `l #\#`"@P#d@8`y`l  #\#`"@=#dy"@9a@"script_set_env: no memory for variablescript_set_env: no memory for variable assignment%s=%s㿘@%D   cD@ cDcDJ =cD  D, @DH `2"H@ $Dy@9A#D" @Đ@@C #cD, "@y@9-#cD@@@z`@ 㿘#cD   cD@FcD"  cDscript_init: no memory for environment initializationinterfacemediumreason㿘 d"#H@!! $#Dz@8!#D "z"i z"cz" _%sip_address%snetwork_number%sbroadcast_address%sfilename%sserver_nameno space to %s %sprepend optionappend option%s%s%sexpiry%d@z$@ @A@*< 8P(@@4<' @- @(#@@)B耢 5z$@Z @@) 2$( @ @А#@@)xЀ zؒ$@5 @@)ʐ(  z$@#($  z$@$   P& V4N, "  P P  &0N&`I@  !, zz#@89c( P @ P8&@@@,  !, zz#@8c8 P8@ P&@@@{  4 8 ,!@@zH$@ @& 5`zP$@z$`@ Can't fork script: %mscript_go: exec: %mgot wrong pid㿈  % P&b  `X" @@?Ғ /  '@@t' {@7e#  #D@?{@7[#?@,쀢?{@7P#쐎   "?> ?option %s name is larger than static buffer.㿘@ !|@7.  @ "1J@ - @ # _#* J@  -1#. Can't fork daemon: %m㿘 +# @(XL  "L@@"c |@6!0@ @@Can't create %s: %mCan't fdopen %s: %m%ld 㿘!# &@! x|# @7 "H0@\bx 2!||# @7"`0 @P"x@b@JInvalid IP address in option: %sBogus name option: %sunknown dhcp option value 0x%x㿘 4.`  8  @% `} ,.` @L 2 | #@ 2 |#0@6 0  |#H@6#@                                           J .( J.  .`.`Ѐ   Ѐ -2 `2J 㿐   N .А ( N   N " @R "N /sbin/dhclient-scriptrCan't open %s: %mno memory for client state.no memory for client config.㿐3c@5 %@2X!"0 @"@ " <$@" !,$@" x$@"! """$~$@ !p" $@$@$@ $@@ + $@  + $@  + $@  + $@  + $@  + $@  + c$@  , @@ ~$m$m@a ~c@4!@p? @X@> +# .  P 2&@졐& $ P~@4! P @(&  P& 2`2 P%@쌐0  %~@4y! %`X0@ P"& 2 P % P`?Corrupt lease file - possible data loss!㿐!@C##~@/a @? !@Ȓ @4 X@hardware address parameter %snot allowed here.nested interface declaration.expecting a statement.semicolon expected.㿐@>`I*`  @20@.  * "@@$  *  ~"@ x *  s"@ m *  h"b @ 0``@,`0Z @4Òa@0R!!@  "K&! @\!@0@b b  bbbb @E0+@5b && `@4!0@G0@ 0@ 0@0@4{!P@Ȑ@! ;@4q!h@  $ ` x p 0 < H  D expecting hexadecimal constant.hexadecimal constant too long.string constant too long.expecting string or hexadecimal data㿐@͐~   @> .@ @ʖ ) @`:@`: 'a@}@d  !x@}0 !!8!X@3 @ expected option name.%s: expected option name.%s: too many options.expecting semicolon.㿐 @A !!? &"耤  !,  @ 2 !.@ ! @  ,"ۤ ; 0#@3h# 0#8@3d@ expecting interface name (in quotes).expecting left brace.unterminated interface declaration.?#T@!! H@I P 2&@z P& 2 L@ L ?$ L "c@ʒ { ? p@3@e0@3 0#T@ޒ? } Pf?@Insufficient memory to record interface %s㿘 +#  @p 2   +#  @d 2 @ `  !@1ْ  `@s @;  +c$"cno memory for state on %s 㿘@ΐ& & P"@1  P @T& no memory for config for %s 㿘!@鴐"0 P"f P& 2 P#(@1  P"0& @4 P&@<no memory for lease. unterminated lease declaration.㿐@ {@2k p@0@(4 2 @1l# @(4 0 * .`@$ 0'@$?a }@u@ `2`PP0^ ` ` PT"   P `  2 @   2`  P"` (``P $`P/"  P& ,#l 6  @ޒ    P@1#0  P " P@"`  P"expecting lease declaration.㿐@ }>`:@*`# `0 ;&`0@ l!@1 H@ 0+&`@ /0$`,@{ 0(@D%&`(@@!&`$@~&`@z&` @v&`@’`40@1"H@ڐ@ 3 ;@1#8@А $  t                         4                     D T d        expecting identifier after option keyword.no memory for vendor information.expecting identifier after '.'no vendor named %s.no option named %sno option named %s for vendor %sexpecting string.option data buffer %soverflowexpecting number.expecting identifier.trueonfalseoffexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.pԐ@ w   !!? @0 ;"F @B @H@ː  2@/ @@ x .' +@ K@ H !!?2  ,@0! ;" @ڐ #@. 2  !0#8'  @.Ԥ  Ԁ@2!Hؒ!`@0k0@稐* : `2#*` $@"W@ !@Ԕ  $Ԑ;@ @y؀ ؒܠ $@;{@ ؒ!" @0&!Ȁ ;" @p Ԕ @  @ !Ԕ @ є @ !Ԕ @ٖ  @  !!? @/! ;"p @1l @a @b  /@b @b /@/"ۀ ; L@@/"00"`L@` @`AK?@ WL@`A ," ;@/!h0 @/!0a!@/@ @樐 *`@ "` * @  2 @."X * @ @1 * &@hThtExpecting media options.no memory for string list entry.㿐@   2 @/ @k0- ,# ;@ !2@@$  @. @` $@$&@@ ߠ ;@.#8@>expecting IP address.no memory for reject list!x@ @.֐"@#0@  2@-א"( @~ b,@ &@ $@ j , ;@.#8@㿐 @  } {`@ P0 ; ` ` @ >0@ :?ޠsemicolon expected.㿐@ + ; @.y#Ɛ filename must be a stringno memory for string %s.㿐@ ! @.Z# @@k  @-X @)Ő  expecting an identifier in hostnamecan't allocate temp space for hostname.can't allocate space for hostname.㿐  @ ǒ !!? ! @.  ZD @@  2@-  @ܐ@ې@芐 @ Ò .@  ."̤@ 2@,!?`,`@m@@$@狐@@@? .,2`㿘 &@` . @ @ expecting a network hardware typehardware address too longexpecting semicolon.㿐@ E!!$0  .@ .@@-"ِ0('  : @t   ( `@丐@-u# ` `.`@%@䬐@  ;@-d#0Expecting numeric lease time㿐@!@-M H0 @% can't allocate space for numeric aggregatetoo few numbers.unexpected end of fileexpecting numeric value.no temp space for number.can't allocate space for numeric aggregate.㿐   "@; & @:   @,  @,!^ !@@ N`}`{"@@,֐ `;"m  i @x@uӀa a `@,!  S ` @``: @@=@  @+!@@~@}  )@Ȓ & @㣑:  @+!```: "@&@U`&`:` @< `а (  >m >m@0 ( .(.(.( .( "  |@` >m(@  || ( 2(8 >m@ @ $ " & &  $& ( `.(>m T  l@€    $ l(܀ " l |>m } ~!(#\@ޒ <@€ .(8 >m!P@ϒ `ې >(`.(8!>a!@   l.(`  (!t`" ((܀ 2(( .(( 0 >m!`@ v 03  2>m 2>m@!x `*`" *  ~'`>s#4*` €8!>a!@|   l.(`    2(>m! >m!( , , (`.(8 >f" @X @8!>a!@Q  l .(`  (( @`@.(r.(>!t`" l( @€  c l@€  ~ `>m`! | }#`#\@# 8a>a!@  l .(`  8 >f" @  8!>a!@  l .(`  ((`@ .({.(8!>a!@   l.(`   >!t`" (Ѐ >m } ~"` ``#\#`@Ғ    $ `! *@  4 &(@ &(D.(&( }"H ~ @ 8a" l>a!@  l .(    ( f  | `.(>m }" ~@  l@€    l@€  ?` ? l@€  ? l@€ ,H l@€ 8 @>m H"@i >m ! ( $D" ( .("@U 8!" >a!@M   l.(`  (>m(#@ƒ ( 2>m2(>m@# 8  " @i @ >n 08! >n 0>n 08 @>m@#0&( @" |>m@#H |&&(8!>a!@  l .(`  (` .(8!" >a!@   l.(`  j(Ԁ>m( 2 (>m }#` ~ @Ғ ( `.(U( }# ~ @Œ M(>m -#@< l@€  8!" l>a!@  l .(    >!t`I-< l&(&(`' (̔(П@ l    l`  u @ l` 8!>a!@v  l .(`  8!" l>a!@f  l .(`   l @" < @ - l   `<@ 8!>a!@A   l.(`   &(8 @>m(@/#8!>a!@(  l .(   ((耢@8 l ('( @)&(>n@  (܀ 2(8!>a!@  l.(   ((耢@8 l' (( @ &(  ~$  l    l`  u @ l` 8!>a!@ɒ  l .(`  8! >a`!  @   .( l   `  l @6  @>n@ (`.(8!" l>a!@  l .(   &(   .(o (@&? 2 l@ 2` l D$$Dncr53c9x_abort: not NEXUS 㿘` 'Д @&`&`  @.( 2 >!>!8 >f" @: !8!>a!@3  l .(`  ((`@ .(.(>X``@%#@}02 (`@` >s@# ( DMA active%s: timed out [ecb %p (flags 0x%x, dleft %x, stat %x)], AGAIN sync negotiation disabled p  `*"@ ` *`g@k  l € l  @ >t >t (>t#\  #`#d( #h(#l(#p (#t ( #x D#|@ HH /d4 * % @  >t@!`b 0!>t@!h $,4   ( @>t@q!p`  p`*  $ pH 0㿘 l@€  l. }@€  l . ~@€  l. |`$`" |@ | 2! } &(>!8`>b ~"8 |@6 }leam7990_config: weird memory size %d: address %s %s: %d receive buffers, %d transmit buffers am7990_config: can't establish shutdownhook㿘@   Di >y">z>y? 0`d"& & & 6 d& 0@@ X @ !@ 8&!@!@ @!  @ @" !>u@ @@@" >u@ " >u        &!D&!H!@@@ !>u @h @@!D>u!H @ P>z"P@  &!0>u@) !D *&!`!H *`&!d*  * &!h&!l&!\㿘H o*@ g@ H 0h d! 77 ۤ ݛ+` ٗ* ڙ+  ܒ@  ؐ  77ސ 0@7!<&!L!`&!X@!D3`7&!T&!P?* !<@!d!H 3`77?*  7!\ !D 6!H  !h, !<!`@ 3`: /7Ԑ7/7֒П !D f!H  0!l, !<!d@ 3` /ː7/77Βȟ !H f㿘!  %s: controller failed to initialize 㿘!  R d!`"!4@!4! b!\!<  !, 2!4  5 d!  a"  € !"? € !! !B d6 b @ ;6 d@. 0!>v @ !`@㿘 >"8>ݦ`#p%>-> +> 2P H /f * ' V* ?4 H p@  "/V$`@'VH /f * '  a "@2` ?*  *  H"`  `$H$` H 0 V* @V@H /f * ' V* ?4 H p@  "/V$`@'VH /f * '  a "@2` ?*  *  H"`  `$H$` H 0 V* @2[ ; < " <㿐>ݬ#p  @ܐ ! 4 H /f * ' >8 2H p@   $ 4 $$ $  @  2  @ 0 0 $ $ $  ^'􀦠>"8 +p  @  4 H /f * '   5 H p@  $ $$ 4  @*  Ť l`EH /f#>͐* '#>aH   @ aH$ > !>" a 2  *  %  $aHH 0 . .. catchmodqchgrpq cp dd df edexprqhostnameB ln lsmkdirq mt mv pax tarcpioq rm ksh shsttyqsleepqsyncq ... . ..chflags ftp gzipۀ gunzip gzcatۀ sed  sortۀ tip  buildۀ vi@  basename cksumۀ sum cut getopt grepۀ egrepۀ fgrepۀ netstat rsh strings tsetۀ resetۀ lessۀ moreۀ ...r4X}4X4X4`4`4`44444 4 |4"4.4 =4 I4LW4i4v44 4 4 X54p4484@$4_4_dvma_mapin_block_count.urem_devopen_obp_close.udiv_pgofset__udiv_sprintf_netif_debug_freelist__urem_printf_putchar_obp_strategystart_prom0_iclose_io_twiddle_prom_ioctl_promvec_prom0_close_closeall_vprintf_block_size_prom0_strategy__rtt_dvma_init_dvma_free_prom_boothow_prom_si_prom_bootdevice_memset_memcpy_cputyp_pgshift_prom0_iopen_panic_progname_prom_open_etext_donottwiddle_bzero_prom_init_block_table_ndevs_dvma_mapout_loadboot_nbpg_exit_main_free_debug_alloc_edata_end_dvma_alloc___main_prom_bootfile_devswsrt0.obootxx.ogcc2_compiled.___gnu_compiled_ccloseall.ogcc2_compiled.___gnu_compiled_cdvma.ogcc2_compiled.___gnu_compiled_cpromdev.ogcc2_compiled.___gnu_compiled_c_filestore.9_bootstore.10_prom0_fake_saveecho_pv_putchar_promdev_inuse_prom_mapin_prom_mapinfo_prom_mapinfo_cnt_prom_devmap_promvecstore.47/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/alloc.o/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/exit.o/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/printf.o/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/memcpy.o/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/memset.o/usr/src/sys/arch/sparc/stand/bootxx/../libkern/obj/__main.o/usr/src/sys/arch/sparc/stand/bootxx/../libkern/obj/bzero.o/usr/src/sys/arch/sparc/stand/bootxx/../libkern/obj/urem.o/usr/src/sys/arch/sparc/stand/bootxx/../libkern/obj/udiv.o\4 `@# ` "" $@` `T@   b@w"@H*/+  "bH  0  "  "  * " !` " @ %s: can't open device㿐@K#@  b("b( @ "   @`@)  @   "H@@%s: alloc failed%s: block table corrupt%s: read failure%s: short read㿐 `@    !@`  @ D ? c' / - + ,`2 @      @@ @`a@@?@2 @a aa @` @Ȳ@  ? Ċ`Ī@` Ē`IJ@` @ dvma_mapin㿘? #@(1? @@#1?dvma_mapout㿘 #@(1 @. 1㿘@ " ْ㿘 @  promprom0㿘  ` @ "H `  "  ` ""J  *@J` )*@Can't open device `%s' 㿘@   ` @ "H `  €b  $€b 2$   " @!X0   $   $`$` 㿘# bH`   ``*  `bH   '@`2`0`,6 * '@ 㿘  2& `& $& (   €5 " '@ 㿘 "H  @@ 0(@  㿘  @ $ ? `$ *㿐 "H/  0T@㿘  㿘 "H`t€Invalid controller number prom_iopen: "%s" error=%d 㿘) " ?N  @  "bPbP$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $`  @ `+  " * @F $`0 "$`4 " @$` @ 2" &  %"   @  㿘# b  @ 4 "$b  & 4$b prom_mapin: length=%dprom_mapin: invalid maptype %d㿘  *`@   "H@ Ę    L         "`@{` `  @   8 <?*  Ș آ&@  `   Ȱ@㿘?( ,1 \&"H H L` T ` X P d l$ p  t @  .@ ДЖ ? * `:```?  `Ԕ "`"     А?"  㿘 b'H'L'P'T 'X "b@0H @  exit㿘 !@ ( 㿘!  !X'L'P'T'X$"@L"*㿘 'H'L'P'T'X @ H㿘  @8N@`N@`%` N@`|`  `*` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @L N@ @C N@ @: N@ 0 x  @, N@ % w ls4l404x444444444444444d44444444444@444444440123456789abcdef㿈  @ @,@"  ?L?|/-\㿘  ؀`  "  a8J@ #" @ @   @ *0   @ *`( `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" bootxx4444444H44\4   4444#4p,4\74=4F4M4 pV 4 c4m4t4 |4 4H44 4(4@4 4H44X4 444H 4`4t! 4L/ 4P8 4I4Q4Y4a4 j4w4 ~44444@44 4H4 444 H44  44  4 44H#48+ 4:4 A4H4Q4`4dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: unknown|unknown terminal type:\ :gn:tc=dumb: pcvtXX|pcvt vt200 emulator (DEC VT220):\ :am:km:mi:ms:xn:\ :it#8:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:SF=\E[%dS:\ :SR=\E[%dT:UP=\E[%dA:\ :ac=++,,--..00``aaffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:im=\E[4h:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:\ :k8=\E[20~:k9=\E[21~:k;=\E[29~:kD=\E[3~:kH=\E[4~:kI=\E[2~:\ :kN=\E[6~:kP=\E[5~:kb=\177:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=\EE:\ :r1=\Ec\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/share/tabset/vt100:sc=\E7:se=\E[27m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m:\ :ve=\E[?25h:vi=\E[?25l: pcvt25|dec vt220 emulation with 25 lines:\ :co#80:li#25:\ :is=\E[1;25r\E[25;1H:tc=pcvtXX:tc=ecma+color: pcvt28|dec vt220 emulation with 28 lines:\ :co#80:li#28:\ :is=\E[1;28r\E[28;1H:tc=pcvtXX: pcvt35|dec vt220 emulation with 35 lines:\ :co#80:li#35:\ :is=\E[1;35r\E[35;1H:tc=pcvtXX: pcvt40|dec vt220 emulation with 40 lines:\ :co#80:li#40:\ :is=\E[1;40r\E[40;1H:tc=pcvtXX: pcvt43|dec vt220 emulation with 43 lines:\ :co#80:li#43:\ :is=\E[1;43r\E[43;1H:tc=pcvtXX: pcvt50|dec vt220 emulation with 50 lines:\ :co#80:li#50:\ :is=\E[1;50r\E[50;1H:tc=pcvtXX: pcvt25w|dec vt220 emulation with 25 lines and 132 cols:\ :co#132:li#25:\ :is=\E[1;25r\E[25;1H:tc=pcvtXX: pcvt28w|dec vt220 emulation with 28 lines and 132 cols:\ :co#132:li#28:\ :is=\E[1;28r\E[28;1H:tc=pcvtXX: pcvt35w|dec vt220 emulation with 35 lines and 132 cols:\ :co#132:li#35:\ :is=\E[1;35r\E[35;1H:tc=pcvtXX: pcvt40w|dec vt220 emulation with 40 lines and 132 cols:\ :co#132:li#40:\ :is=\E[1;40r\E[40;1H:tc=pcvtXX: pcvt43w|dec vt220 emulation with 43 lines and 132 cols:\ :co#132:li#43:\ :is=\E[1;43r\E[43;1H:tc=pcvtXX: pcvt50w|dec vt220 emulation with 50 lines and 132 cols:\ :co#132:li#50:\ :is=\E[1;50r\E[50;1H:tc=pcvtXX: pc3|BSD/OS on the PC Console:\ :tc=bsdos-pc-nobold: vt52|dec vt52:\ :bs:\ :co#80:it#8:li#24:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\EG:as=\EF:bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :\ :cr=^M:do=\EB:ho=\EH:kb=^H:kd=\EB:kl=\ED:kr=\EC:ku=\EA:\ :le=\ED:nd=\EC:nw=^M^J:sf=^J:sr=\EI:ta=^I:up=\EA: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt100nam|vt100-nam|vt100 no automargins:\ :am@:xn@:tc=vt100-am: vt100-vb|dec vt100 (w/advanced video) & no beep:\ :bl@:vb=\E[?5h\E[?5l:tc=vt100: vt100-w|vt100-w-am|dec vt100 132 cols (w/advanced video):\ :co#132:li#24:\ :rs=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=vt100-am: vt100-w-nam|vt100-nam-w|dec vt100 132 cols (w/advanced video no automargin):\ :co#132:li#14:vt@:\ :rs=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=vt100-nam: vt100-nav|vt100 without advanced video option:\ :sg#1:\ :mb@:md@:me@:mr@:sa@:se=\E[m:so=\E[7m:ue@:us@:tc=vt100: vt100-nav-w|vt100-w-nav|dec vt100 132 cols 14 lines (no advanced video option):\ :co#132:li#14:tc=vt100-nav: vt100-s|vt100-s-top|vt100-top-s|vt100 for use with top sysline:\ :es:hs:\ :li#23:\ :cl=\E[2;1H\E[J:cm=\E[%i%+^A;%dH:cs=\E[%i%i%d;%dr:\ :ds=\E7\E[1;24r\E8:fs=\E8:ho=\E[2;1H:is=\E7\E[2;24r\E8:\ :ts=\E7\E[1;%p1%dH\E[1K:tc=vt100-am: vt100-s-bot|vt100-bot-s|vt100 for use with bottom sysline:\ :es:hs:\ :li#23:\ :ds=\E7\E[1;24r\E8:fs=\E8:is=\E[1;23r\E[23;1H:\ :ts=\E7\E[24;%p1%dH\E[1K:tc=vt100-am: vt102|dec vt102:\ :mi:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4l:im=\E[4h:tc=vt100: vt102-w|dec vt102 in wide mode:\ :co#132:\ :r3=\E[?3h:tc=vt102: vt102-nsgr|vt102 no sgr (use if you see snowflakes after highlight changes):\ :me=\E[m:sa@:tc=vt102: vt125|vt125 graphics terminal:\ :cl=\E[H\E[2J\EPpS(E)\E\\:tc=vt100: vt131|dec vt131:\ :am:bs:xn:\ :co#80:it#8:li#24:vt#3:\ :RA=\E[?7h:SA=\E[?7h:bl=^G:cd=50\E[J:ce=3\E[K:\ :cl=50\E[;H\E[2J:cm=5\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :do=^J:ho=\E[H:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=2\E[5m:md=2\E[1m:\ :me=2\E[m:mr=2\E[7m:nd=2\E[C:nw=^M^J:\ :r1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:sc=\E7:\ :se=2\E[m:so=2\E[7m:sr=5\EM:ta=^I:ue=2\E[m:up=2\E[A:\ :us=2\E[4m: vt132|DEC vt132:\ :xn:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4h:im=\E[4l:ip=:sf=\n:\ :tc=vt100: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\EOB:kh=\E[1~:kl=\EOD:kr=\EOC:ku=\EOA:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: vt220-new|vt200-new|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:ae=^O:al=\E[L:as=^N:bl=^G:cb=\E[1K:\ :cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:eA=\E)0:\ :ec=\E[%dX:ei=\E[4l:ho=\E[H:if=/usr/share/tabset/vt100:\ :im=\E[4h:is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:kd=\EOB:\ :kh=\E[H:kl=\EOD:kr=\EOC:ku=\EOA:l1=pf1:l2=pf2:l3=pf3:\ :l4=pf4:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :nw=\EE:pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l: vt220-w|vt200-w|DEC vt220 in wide mode:\ :co#132:\ :r3=\E[?3h:tc=vt220: vt220-8bit|vt220-8|vt200-8bit|vt200-8|dec vt220/200 in 8-bit mode:\ :am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\233%dL:DC=\233%dP:DL=\233%dM:DO=\233%dB:IC=\233%d@:\ :LE=\233%dD:RI=\233%dC:UP=\233%dA:ae=^O:al=\233L:as=^N:\ :bl=^G:cd=\233J:ce=\233K:cl=\233H\233J:cm=\233%i%d;%dH:\ :cr=^M:cs=\233%i%d;%dr:ct=\2333g:dc=\233P:dl=\233M:do=^J:\ :ec=\233%dX:ei=\2334l:ho=\233H:\ :if=/usr/share/tabset/vt100:im=\2334h:\ :is=\233?7h\233>\233?1h\E F\233?4l:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:k6=\23317~:k7=\23318~:k8=\23319~:\ :k9=\23320~:kI=\2332~:kN=\2336~:kP=\2335~:kb=\177:\ :kd=\233B:kh=\233H:kl=\233D:kr=\233C:ku=\233A:le=^H:\ :mb=\2335m:md=\2331m:me=\233m:mr=\2337m:nd=\233C:nw=\EE:\ :rc=\E8:sc=\E7:se=\23327m:sf=\ED:so=\2337m:sr=\EM:st=\EH:\ :ta=^I:ue=\23324m:up=\233A:us=\2334m:vb=\233?5h\233?5l: vt220d|DEC VT220 in vt100 mode with DEC function key labeling:\ :F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:\ :F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:k5@:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:\ :tc=vt220: vt220-nam|v200-nam|VT220 in vt100 mode with no auto margins:\ :am@:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7l\E[?8h:tc=vt220: vt200-js|vt220-js|dec vt200 series with jump scroll:\ :am:\ :co#80:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:dm=:do=^J:ed=:\ :ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E[61"p\E[H\E[?3l\E[?4l\E[?1l\E[?5l\E[?6l\E[?7h\E[?8h\E[?25h\E>\E[m:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kb=\177:kd=\EOB:\ :ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:\ :nw=^M\ED:r1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/share/tabset/vt100:sc=\E7:se=5\E[27m:sf=\ED:\ :so=5\E[7m:sr=\EM:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m: vt320nam|v320n|DEC VT320 in vt100 emul. mode with NO AUTO WRAP mode:\ :am@:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7l\E[?8h:tc=vt220: vt320|vt300|dec vt320 7 bit terminal:\ :am:es:hs:mi:ms:xn:\ :co#80:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOu:K3=\EOy:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ec=\E[%dX:\ :ei=\E[4l:fs=\E[0$}:ho=\E[H:im=\E[4h:\ :is=\E>\E[?3l\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:kl=\EOD:kr=\EOC:\ :ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:nw=\EE:rc=\E8:\ :rs=\E>\E[?3l\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[1$}\E[H\E[K:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[?25h:\ :vi=\E[?25l: vt320-nam|vt300-nam|dec vt320 7 bit terminal with no am to make SAS happy:\ :am@:\ :is=\E>\E[?3l\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :rs=\E>\E[?3l\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320: vt320-w|vt300-w|dec vt320 wide 7 bit terminal:\ :co#132:ws#132:\ :is=\E>\E[?3h\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :rs=\E>\E[?3h\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320: vt320-w-nam|vt300-w-nam|dec vt320 wide 7 bit terminal with no am:\ :am@:\ :is=\E>\E[?3h\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :rs=\E>\E[?3h\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320-w: vt340|dec-vt340|vt330|dec-vt330|dec vt340 graphics terminal with 24 line page:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:al=\E[L:as=^N:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:\ :fs=\E[$}:ho=\E[H:im=\E[4h:\ :is=\E<\E F\E>\E[?1h\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=\177:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:\ :r1=\E[?3l:rc=\E8:rf=/usr/share/tabset/vt300:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[2$~\E[1$}\E[1;%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=200\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: vt400|vt400-24|dec-vt400|dec vt400 24x80 column autowrap:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:ae=^O:\ :al=\E[L:as=^N:cd=10\E[J:ce=4\E[K:cl=10\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:\ :fs=\E[$}:ho=\E[H:ic=\E[@:im=\E[4h:\ :is=\E<\E F\E>\E[?1h\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=\177:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:\ :r1=\E<\E[?3l\E[!p\E[?7h:rc=\E8:\ :rf=/usr/share/tabset/vt300:sc=\E7:se=\E[27m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ts=\E[2$~\E[1$}\E[1;%dH:\ :ue=\E[24m:up=\E[A:us=\E[4m:vb=200\E[?5h\E[?5l:\ :ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: vt420|DEC VT420:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\E[B:ke=\E>:kl=\E[D:kr=\E[C:ks=\E=:ku=\E[A:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :r3=\E[?67h\E[64;1"p:rc=\E8:rf=/usr/share/tabset/vt300:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt420pc|DEC VT420 w/PC keyboard:\ :@7=\E[4~:F1=\E[23~:F2=\E[24~:F3=\E[11;2~:F4=\E[12;2~:\ :F5=\E[13;2~:F6=\E[14;2~:F7=\E[15;2~:F8=\E[17;2~:\ :F9=\E[18;2~:FA=\E[19;2~:FB=\E[20;2~:FC=\E[21;2~:\ :FD=\E[23;2~:FE=\E[24;2~:FF=\E[23~:FG=\E[24~:FH=\E[25~:\ :FI=\E[26~:FJ=\E[28~:FK=\E[29~:FL=\E[31~:FM=\E[32~:\ :FN=\E[33~:FO=\E[34~:FP=\E[35~:FQ=\E[36~:FR=\E[23;2~:\ :FS=\E[24;2~:FT=\E[25;2~:FU=\E[26;2~:FV=\E[28;2~:\ :FW=\E[29;2~:FX=\E[31;2~:FY=\E[32;2~:FZ=\E[33;2~:\ :Fa=\E[34;2~:Fb=\E[35;2~:Fc=\E[36;2~:\ :S6=USR_TERM\:vt420pcdos\::k1=\E[11~:k2=\E[12~:\ :k3=\E[13~:k4=\E[14~:k5=\E[15~:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:k;=\E[21~:kD=\177:kh=\E[H:\ :..px=\EP1;1|%?%{16}%p1%>%t%{0}%e%{21}%p1%>%t%{1}%e%{25}%p1%>%t%{2}%e%{27}%p1%>%t%{3}%e%{30}%p1%>%t%{4}%e%{5}%;%p1%+%d/%p2%s\E\\:\ :tc=vt420: vt420pcdos|DEC VT420 w/PC for DOS Merge:\ :li#25:\ :S1=%?%p1%{19}%=%t\E\023\021%e%p1%{32}%<%t\E%p1%c%e%p1%{127}%=%t\E\177%e%p1%c%;:\ :S4=\E[?1;2r\E[34h:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:S6@:\ :me=\E[m:sa@:tc=vt420pc: vt420f|DEC VT420 with VT kbd; VT400 mode; F1-F5 used as Fkeys:\ :F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:\ :F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:\ :k1=\E[11~:k2=\E[12~:k3=\E[13~:k4=\E[14~:k5=\E[15~:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:\ :kD=\177:kh=\E[H:l1=\EOP:l2=\EOQ:l3=\EOR:l4=\EOS:tc=vt420: vt510|DEC VT510:\ :tc=vt420: vt510pc|DEC VT510 w/PC keyboard:\ :tc=vt420pc: vt510pcdos|DEC VT510 w/PC for DOS Merge:\ :tc=vt420pcdos: vt520|DEC VT520:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :..px=\EP1;1|%?%{16}%p1%>%t%{0}%e%{21}%p1%>%t%{1}%e%{25}%p1%>%t%{2}%e%{27}%p1%>%t%{3}%e%{30}%p1%>%t%{4}%e%{5}%;%p1%+%d/%p2%s\E\\:\ :r3=\E[?67h\E[64;1"p:rc=\E8:rf=/usr/share/tabset/vt300:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt525|DEC VT525:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :..px=\EP1;1|%?%{16}%p1%>%t%{0}%e%{21}%p1%>%t%{1}%e%{25}%p1%>%t%{2}%e%{27}%p1%>%t%{3}%e%{30}%p1%>%t%{4}%e%{5}%;%p1%+%d/%p2%s\E\\:\ :r3=\E[?67h\E[64;1"p:rc=\E8:rf=/usr/share/tabset/vt300:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: sun-il|Sun Microsystems console with working insert-line:\ :am:km:ms:\ :co#80:li#34:\ :%7=\E[194z:&5=\E[193z:&8=\E[195z:@7=\E[220z:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:F1=\E[234z:F2=\E[235z:IC=\E[%d@:\ :K2=\E[218z:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=^L:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=:ic=\E[@:im=:\ :k1=\E[224z:k2=\E[225z:k3=\E[226z:k4=\E[227z:k5=\E[228z:\ :k6=\E[229z:k7=\E[230z:k8=\E[231z:k9=\E[232z:k;=\E[233z:\ :kD=\177:kN=\E[222z:kP=\E[216z:kb=^H:kd=\E[B:kh=\E[214z:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:md@:me=\E[m:mr=\E[7m:nd=\E[C:\ :rs=\E[s:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;m:\ :se=\E[m:sf=^J:so=\E[7m:ta=^I:u8=\E[1t:u9=\E[11t:ue@:\ :up=\E[A:us@: sun-cgsix|sun-ss5|Sun SparcStation 5 console:\ :AL@:al@:tc=sun-il: sun|sun1|sun2|Sun Microsystems Inc. workstation console:\ :tc=sun-il: sun-s|Sun Microsystems Workstation window with status line:\ :hs:\ :ds=\E]l\E\\:fs=\E\\:ts=\E]l:tc=sun: sun-e-s|sun-s-e|Sun Microsystems Workstation with status hacked for emacs:\ :hs:\ :ds=\E]l\E\\:fs=\E\\:ts=\E]l:tc=sun-e: sun-48|Sun 48-line window:\ :co#80:li#48:tc=sun: sun-34|Sun 34-line window:\ :co#80:li#34:tc=sun: sun-24|Sun 24-line window:\ :co#80:li#24:tc=sun: sun-17|Sun 17-line window:\ :co#80:li#17:tc=sun: sun-12|Sun 12-line window:\ :co#80:li#12:tc=sun: sun-1|Sun 1-line window for sysline:\ :es:hs:\ :co#80:li#1:\ :ds=^L:fs=\E[K:ts=^M:tc=sun: sun-e|sun-nic|sune|Sun Microsystems Workstation without insert character:\ :ei@:ic@:im@:tc=sun: sun-c|sun-cmd|Sun Microsystems Workstation console with scrollable history:\ :li#35:\ :te=\E[>4h:ti=\E[>4l:tc=sun: vt320-k3|MS-Kermit 3.00's vt320 emulation:\ :am:es:hs:km:mi:ms:xn:\ :co#80:it#8:li#49:pb#9600:vt#3:\ :AL=\E[%dL:CC=\E:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SR=\E[%dL:UP=\E[%dA:ae=\E(B:al=\E[L:\ :as=\E(0:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ds=\E[0$~:ec=\E[%dX:ei=\E[4l:fs=\E[0$}:ho=\E[H:im=\E[4h:\ :is=\E>\E F\E[?1l\E[?7h\E[r\E[2$~:k0=\E[21~:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:\ :k9=\E[20~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\EOB:\ :ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M^J:rc=\E8:\ :sc=\E7:se=\E[27m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[1$}\r\E[K:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l\E[?5h\E[?5l\E[?5h\E[?5l:ve=\E[?25h:\ :vi=\E[?25l: vt320-k311|dec vt320 series as defined by kermit 3.11:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:al=3\E[L:as=^N:bl=^G:cd=\E[J:ce=\E[K:cl=\E[;H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:\ :fs=\E[$}:ho=\E[H:im=\E[4h:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:\ :r1=\E[?3l:rc=\E8:rf=/usr/share/tabset/vt100:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[2$~\E[1$}\E[1;%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: vt50|dec vt50:\ :bs:\ :co#80:li#12:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cr=^M:do=^J:le=^H:nd=\EC:\ :sf=^J:ta=^I:up=\EA: vt50h|dec vt50h:\ :bs:\ :co#80:li#12:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=^M:do=^J:\ :le=^H:nd=\EC:sf=^J:sr=\EI:ta=^I:up=\EA: vt61|vt-61|vt61.5|dec vt61:\ :co#80:li#24:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=\r:do=^J:\ :kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:sf=\n:sr=\EI:ta=^I:\ :up=\EA:  @ :    @@: LI@@P^<@`bT U: ;K((A: : *Q: *Qs48A: C: C: C DjA: p: 2: 2 )(cA: 8: 8: e ^is : ;3: ;3: ;3../../instbin/\ : : : ../../instbinFMT : w: w: w../../instbin+ f : !: !: !../../instbinuo : : : ../../instbinBbJ : I : I : I ../../instbin^- : ܓ: ܓ: ܓ../../instbinnlC : p: p: p../../instbinǔ` : : : ../../instbin@p : : : ../../instbin : ,: ,: ,../../instbin;  : ': : ../../instbinu+\ : S+: S+: S+../../instbinj : 沀: 沀: 沀../../instbin3  : z9: z9: z9../../instbin h :  :  :  ../../instbinY : : G: G../../instbin? : 4΀: 4΀: 4΀../../instbinF9 : U: U: U../../instbin d : $[܀: $[܀: $[܀../../instbinZ\ : 'c: 'c: 'c../../instbin= : +: +: +../../instbin ״ : /q: /q: /q../../instbin`i7 : 2: 2: 2../../instbin\a: %8C: %8C: &&6d`!: %9: %9: &&6{a: &1-: &1-: &&6 da!: &: &: &&6{ a: &w: &w: &&6 !: &X;: &X;: &&6{ Q`]a: & S+: & S+: &&6 g!: & : & : &&6{ Ia: &߀: &߀: &&6 UP!: &z9: &z9: &&6{ /a: &u*: &u*: &&6 !: &>: &>: &&6{ ٽa: &9: &9: &&6ޓ!: &: &: &&6{Na: &: &: &&6ó!: & U: & U: &&6{q$a: &.}: &.}: (^B!: &0G: &0G: ({ ԑa: &3B: &3B: ("!: &5: &5: ({qya: &8C: &8C: (K!: &:i: &:i: ({Ka: 'À: 'À: (p=!: ': ': ({O>a: 'w: 'w: (n!: 'X;: 'X;: ({Ba: ' S+: ' S+: ( !: ' : ' : ({qa: 'v: 'v: (!: ': ': ({Aza: 'ܓ: 'ܓ: (0'!: ' : ' : ({߃a: 'p: 'p: (Mǂ!: '9: '9: ({ga: '8: '8: (.+.!: 'e: 'e: ({k%a: '!`: '!`: (rY3!: '": '": ({a: ''V: ''V: (_La!: ') : ') : ({4<a: '+: '+: (&љ!: ',: ',: ({Ca: '/: '/: (Һ!: '05: '05: ({-3a: '3%: '3%: (E!: '5 R: '5 R: ({@_{a: '8C: '8C: (#Ǜ!: '98p: '98p: ({ja: ( : ( : )C _!: ( : ( : )C{ if/a: (N: (N: )C! 8!: (߀: (߀: )C{!a: (z9: (z9: )C"R!: (C: (C: )C{""a: (W: (W: )C#MT!: (p: (p: )C{#q 6a: (t: (t: )C$+ !: (8: (8: )C{$"a: (: (: )C%!: ( U: ( U: )C{%GIa: (#*: (#*: )C&'[7!: ($s: ($s: )C{&5ra: ('V: ('V: )C'1x!: () : () : )C{'za: (+: (+: )C(!: (-L: (-L: )C{(V1a: (/: (/: )C) $!: (1xˀ: (1xˀ: )C{)ڹ|a: (3%: (3%: )C*zr!: (5: (5: )C{*-W~a: (8C: (8C: )C+Ш!: (98p: (98p: )C{+ara: ): ): )C,*PTi!: )À: )À: )C{,ZFa: )Ĵ: )Ĵ: )C-R1d!: ): ): )C{-B!a: )р: )р: )C.~!: ) !: ) !: )C{.a: ) : ) : )C/!: )N: )N: )C{/a#a: )k : )k : *&60lm!: )8: )8: *&6{00Ka: ): ): *&61D#!: ) U: ) U: *&6{1ba: )#*: )#*: *&62o!: )$s: )$s: *&6{2̌a: )'V: )'V: *&63/ !: )) : )) : *&6{3LQ5a: )+: )+: *&64G !: )-L: )-L: *&6{4"a: )/: )/: *&65I!: )1xˀ: )1xˀ: *&6{5a: )3%: )3%: *&66"!: )6=: )6=: *&6{6'ua: )8ـ: )8ـ: *&67B3!: ):i: ):i: *&6{7E/a: *1-: *1-: *&68!: *: *: *&6{8a: *]J: *]J: *&69DR)!: *': *': *&6{96Fa: * !: * !: *&6:ʁ!: * : * : *&6{:Wwa: *N: *N: *&6;!: *߀: *߀: *&6{;Zs`a: *z9: *z9: *&6<iM!: *C: *C: *&6{<ꙣa: *W: *W: *&6=ʆ!: *p: *p: *&6{=a: *t: *t: *&6>G5!: *8: *8: *&6{>0+na: *: *: *&6?Yr!: * U: * U: *&6{?_Q!: *0G: *0G: *2biY(_!: *8C: *8C: *98pi!: +: +: +Ĵi !: + : + : + iV!: +: +: +finl!: +: +: +tir|j!: + U: + U: +!id!: +'c: +'c: +)'i'!: +/q: +/q: +05i[#!: +6: +6: +8Ci >f!: ,: ,: ,;^]!: , h: , h: , h;$7!: , : , : , ;ɢ!: , X: , X: , X;fy!: ,>: ,>: ,ycB!: ,4΀: ,4΀: ,e:8r!: ,#*: ,#*: ,$s7&jh!: ,) : ,) : ,*Q'ъS,!: ,.}: ,.}: ,0GCl8gu!: ,9: ,9: ,;3@(ǫ!: -,: -,: -]Jc)^!: - h: - h: - m!: -C: -C: -ׄp!: -: -: -% wO !: -e: -e: -% wG !: -: -: -% w !: - U: - U: -% w^C!: -!: -!: -% wgF!!: -2b: -2b: -3%3n8mK: ~:: .'V 0 8 @ H P X `r`m&: :: .'c 3/SRc: .5: 4 : 4  (*#H&: 4f: 9f: 9f h p x `M E: 98: 9 U: 9 UX` $SI: 9$s: 9$s: 9$s/tmp/disktab.shadow;yi: 9(: 9(: 9(/tmp/fstab.shadow : 9,: 9,: 9,/tmp/resolv.conf.shadow٩ : 9/: 9/: 9//tmp/hosts@Xg 9: 93%: 95: 95 *m/o: 98ـ: 998p: 998phF`mK: :: ; /: ; /pxor:r(%%} =y73i: ";# 0EX}KBpYtx&!Q1P.xZXeoqo<Ͽ"%"Sd1QrǜL XeW z" m 1vBkIgtY.  6  !'Ġ#@@ntĒ@( `?icmp_echoreply: %mp  'Ԓ%ܖ @,Ԁ  /@( 80?쀢`'  '' @ԐCan't create addrlist socketrealloc: %mioctl: SIOCGIFCONF: %mCan't get interface flags for %s: %mdiscover_interfacesInsufficient memory to %s %srecord interfaceno space to remember ifp.Multiple %s %s: %s %sinterfaces match thesame subnetInterface %s matches %smultiple shared networkssame shared network%s: not foundNo subnet declaration for %s (%s).fallbackfallback-net(  @u  "@' " '@  0@'!0a$'@%?@'!($@ (,` +#         ˀ  ``   В @0ΐ0a@ !@@'t@ 2! + ! +# `` @ݒ 2@`2 ah@&G `  ` !a@'N` @0 # $`L$@$`X$`\$`T$#     ,` ,` ` @ @ߒ`ig@ה  @]`H 2   @+ @'!@ῐ$`H$` 'Đ@ᶔ  @ᰐ@' 7  $  @ᢔ  ` !ؒa @''` `    "0@'`  $`  $  !ؒaP @'` ; ~' + `R `L @ 2`H ?$`L`H``L 2``L "h@&` 2@ $ $ +c$@*"c@D `   Đ@l'` @&"x`      2  $ $   2 @|@ 2`L +# ` `0` @ɔ@`2`0@! *#"b @/`Ȑ"?"`@ $  4@㿘 +#   *@@  *@ ("  "`No interfaces to select on - exiting.select: %m0  @ἐ @ᷔ  ,P  ,#l   "  "P@  `$"`'' ؐ @ᙔ ) ,#L ? " \   2  *@*@ @$@  4 2 @%ؐ!0ؘ@ ,@n#l?#L@%ǐ!X#L #  2 *`@ :@`" "   \    `@  쀢   2  " receive_packet failed on %s: %sInterface %s appears to no longer be valid@  А/@ $` "!!@V#x @% X`@ & X   T & X "@%# & \ " % -  '@  @ h`  '`' @ސ@ U "& 0  ( & 0 0@ Can't allocate timeout structure!㿘 ,cP   "  2 2"cP  , `耢  "`"@  2$ @$!h$ $  ,P`$ `  $"P"  4$  2"$ ,P " 2  2  "P " can't allocate protocol struct for %s㿘@ܩ   ,#P@$ ,#L$ "#L$ $ $㿘# ,cL  "$cL @ܱ ioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %mP 0   @ @-0a@ː  `@K 4 A A20  T 2,   (@ݐ @-0 a6@ޫ  "!  `8@K] & T` ̐  `   㿘   5 +7   +3 ,P +9 %& &&ch "!"c0*P*' P㿘 ? & @֐  & a 2)"a`  +0  @  !P ,"ch"0   0 "#!* ᤀQ  +c0*?c0*@ᤐ "ᤁ 㿘4:   L    + -  + +"#,"c(@0F L     + +"#,"c(@C06  + + "#,"c("*++  ! !   +#  #  # L     # "@\ 2.  + +"#,"c(@m㿘 a ! +#,  +#0 +"# !##, +"#(  #a +c0 +"c  !$㿘) !  % +,' +(# $a! $!k,%!a  ,#h +"#($,!$a$($!  !&!㿘? eof in string constantstring constant larger than internal buffer㿘  !* %%`@#ې!% !* `\`"  %2 @#Ɛ!% ! "a*!numeric token larger than internal buffer㿘% , ! `x*8 * L   `D  -_`#!  L    D !  L   D  @0^   "a* %%2 @#`"Р% ! "a*token larger than internal buffer㿘! ,!! V-_ L    @0"   "a L   D "! !* %%2 @# h% !* "a@ђppendllowliasbandonedackoff-cutoffootpootingoot-unknown-clientslassiaddrlient-identifierlient-hostnameomainenyefault-lease-timeynamic-bootp-lease-cutoff-lease-lengththernetndsxpireilenameixed-addressroupet-lease-hostnamesostardwareostnamenitial-intervalnterfaceeaseax-lease-timeediaumameserveretmaskext-serverptionne-lease-per-clientrependacketangeequestequireetryenewebindebootejectearchtartsubnethared-networkerver-nameerver-identifierelect-timeoutendcriptupersedeimestampimeoutoken-ringidser-classse-host-decl-namesnknown-clientsendor-class㿘N  *  ?* : `v"Г*`  a@wI h!Fa@wA `!6a@w9 X!=@w1a RP!? a@w' F!@a@w >!7a@w 6!9@waȀ  .!" a@w $!a@v !a@v !*@vb  !I b@v !Cb @vې !8b(@v  N  !: @vƒb0 !b@@vؔ 2ްN  ذ!bP@v ϰ! @vb` ɰǰ!! bp@v !bx@v ! @vb !4 b@v !@v|b ! a@vr !b@vj !%@vbb !' b@vX w!b@vP o!@vHbЀ ig!H b@v> ]!A@v6b耢 WU!1 @v-b NL! c@v# B!c@v5  2; c@v 1!;@v c +)!< c(@v !Bc8@u !@uc@ !# cP@u !@uޒcX !& cp@uԐ !G@u̒cx ! c@u !c@u ٰ!+c@u Ѱ!,c@u ɰ!.c@u !2c@u !3c@u !>@uc !J c@u !Dc@ux ! a@up !c@uh !c@u` !c@uX w!c@uP o!`@uH g!/` @u@ _!)`(@u8 W!0@u0`0 QO!E `@@u& E! `P@u =!-@u`X 75!$ `h@u  +! `p@u #!`@t !(@t` !5 @t`   ! @ta耢 !IIJJKLLdLM4RRM|MN,NNRO$P,QQRRRR/dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %m` `H 2@v @b   "! @|#X` Hbl@ #p @nSending on BPF/%s/%s/%sunattached㿘 +#4 0 & 4 H   @    h@ Can't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %d bytes for bpf input buffer.Can't install packet filter program: %mListening on BPF/%s/%s/%s㿀 'd& 0bq@f 6@   2 0@! 0 bp@P䀢 6 0@Ր!@ 0bf@E < @ː!p@ < & 8@Ð! *"H& @& D"D 0 ' 'bg@)耢 6 +@! +#4 !   @   h@ x\'@o``#\@#`' 4 '''@׶㿀  @ D@2  D 0 8@ < W$ @$ D D @"@  8@ @  @ D <$ @*`2 $ @37 $ @ 8@ 6 @ @%   8" $ @  '@  @  $ @"  ' 8@ɒ@  @$ @ $ @ " @ The standard socket API can only support %shosts with a single network interface.Can't create dhcp socket: %mCan't set SO_REUSEADDR option on dhcp socket: %mCan't set SO_BROADCAST option on dhcp socket: %mCan't bind to dhcp address: %m㿀!!( !@Òa *"   ?/ $!(7'  @|a  @"#?'c @|Z  c@"0c @|N  6@"h@|  @"Sending on Socket/%s/%sunattached㿘 +c4`& 4 #؀ #@ϐ 㿘 4 @| fallback_discard: %mx   4&'ܒ @|܀ @        (@( ??00??:㿈  @־   @׬   @ֲ  @נ (7@@֦  &x<*@ * @`@'   7///''777   7@ @|  * &b7ؐ@777ޒ@o  &㿈@@e @a   .. Bad IP checksum: %x㿘@@ *  `q  !  #8Vg?@0` &@ 6㿘   &%  @?$@    @M "  @ 2@$@ !H &@J !%  2 @ $aH`@@  `@ 2@ $@ !H`@@㿘 #@㿘 #@h`1 ` ")@@  "$@` '`@ @ս@Ȥ @շ@V @ծ  %`  @`2` No shared network for network %s (%s)Address range %s to %s, netmask %s spans %s!multiple subnetsAddress range %s to %s not on net %s/%s!new_address_rangeNo memory for address range %s-%s.No hostname for %sno memory for hostname %s.`'D 'P`$ @L@ @pp!`8 "(@A@ @! #  @M$# c ! @E "# 2@=$#D @`8 @#@@ 2 @ h @P @#@@ @  2)DД @@ @p @@ @p  @ސ@ @p"P@&" @͐`$ @Ȑ@  2/DД @Խ@ @o @Գ@ @oא @ԩ@ x@o͐! "@Ԟ@ m@ @Ԓ @Ԏ@ +D @Ԇ @Ԃ@  @x @t@ &'D@Ȯ 2,DД @`@ /@o @V@ %@oz"@,**@7   "'  @6]-  @6 @2#@@@ o@' P$ 0$ ($ ,$ l$ p $ $  `L'H`L H @ ۔   HL@_\'L@# @@@c  $ `@@O# @@o  ` $ $'  2"  㴒  @D``@ -  T h  @א`8 @ѐP#@@  @Ɛ @@ _ @Ӻ`$ @Ӷ@ n " 4`%@%$* @*`@ `*` &"`` d "`d@1 @ hP #"# Ȓ @~ 8@y#@@ $ @n@ & "Ȱ P  "" Ȓ @V  8@Q#@@ k $ @F@    Ȱ subnet %s/%d conflicts with subnet %s/%dP/ 㠀"t㠢Ȭ $ @! 8@#@@ 6$ @@ Ȓ  < @ 8 @#@@  @@  : <      =  "  : " <   `` <` "  `: "` @̐@ @m @Ð@ #@2&%㠁 " enter_leaseNo memory for lease %s 㿀  @қ@ 2 `@F! !" @Ҋ@ Y@ڐ@ҁ  c& & "c$`` d$`d@ Lease conflict at %scorrupt lease uid.㿀`    2; 4 ,#l , $5 4 4" 4`4`"  4 8`82@w 2 4 2 4 t?`t @ 2  u v@d`v " 4!  "@+@@߰  @a 4 @@ @ϡ & <& 8& 4 t ? t`t @  v u@6`v " t@}  " `(& (`0& 0`4`"& 4`8 @@ & 4& <`@@& 4`<& <&`4&`<@4"`8& <`8 t& 8`h`t& h@Ԕ `  ?@& `4 `@`"  `t " @" `" p"@"``" p "` p`2 p "` p` `2,"` pB" `, $`" , `, 4 , $" p& &("  & "&!"` 6 , `",, & ,`,@6" p&& "  &" & " p" `,  & ,z s@ Released lease for IP address %s` @5 ,#l'ɔ H! # @'@@ސAbandoning IP address %s for %d seconds: %s l` L   &  @  ,#lH'!   @@͐@//'' 㿘  @#㿘 #@㿘 #@㿘 4 8   # 4@ 80` 2`"`㿘 4 8 !  8#@3 4  4#@8 & ` 2` "`& 㿘 v u   # u@–0` 2` "` 㿘 v u # c@ u ` `uc@`v & ` 2`  "` & add_class㿘@#@4@ͷ %  ! @f$#Ā `@_$#Ā`  #Ā  && @k] &#@ @\0 @@S㿘  # #@%s: can't allocate new group㿘@ϐ  `@R@$TCan't rewrite lease databaseCan't commit leases to new database: %m㿘 #`"` "@ u   8  "  2@  2 u@`2` @  Subnet %s netmask %sLast Lease:㿀 #1 #`" `$@Ϛ@i@{В`8 @ϐ@_@q!`` @Z @a!@R %02x㿘 `   #Ȓb@b 1  #b@k-@2 :.  .?1 #ȁ Lease %s%D %H:%M:%S start %s end %s stamp %s hardware addr = %s host %s `!  #@ @@@e (#ؖc @@@#@e , @@@#@e 0 @?@ސ# u! t v#В@Ր h`#`#@ʐ packet length %dop = %d htype = %d hlen = %d hops = %dxid = %x secs = %d flags = %xciaddr = %syiaddr = %ssiaddr = %sgiaddr = %schaddr = %02.2x:%02.2x:%02.2x:%02.2x:%02.2x:%02.2xfilename = %sserver_name = %s %s = %s㿈 @z! ` @!8 `@s ``` !h@m`` '!!@YА@c`!'!@Yǐ@Z`!'!@Y@Q`!'!@Y@H ` `! ` ` `! `@>#\`l@:""@6`,  ,` 8 !,`  4   @ "(@``,`@"8%03x: %02xH  @!/`` "@֐c@i  *@ @iݒc`@ @hash bucket %d:㿘 % !,   @ " ` @  2 ,cSc㿘  4@μ( a`@  " &  `@< !؀  `l@, ! `,@# @Option %s length %d overflows input buffer.Can't allocate storage for option %s.Can't expand storage for option %s.㿘@P@2`J`@  !, @"(E& , 8  4@`  !, @"X`@R. 4"@@ʬ  2 !, @"@<`@7$.@ʺ%`@@ ` @ ` & ` `" `@ * 2 >ꀧa)$!*@8!* @Ȑ 5,@  6,@   3,@   8 ,@ !` !! !,8!(@  !"a@" ?"Ф`y2`@#\`#\#`@e!` &`@Ð` T` *@  N``z 4 * * **?"А`@̧  ' `l@@̚ .  . $.  @`l@̆  ?bА' @y`,?`l *@ * ?`l㻘\'H'P @T$ i P ,`"_` 2[` %@ S`` ! , J t ` A  `<`    '@ 4% H ޖ-* ,@@ @@* ,@@@  @@Ȧ`@Ppretty_print_option: bad code %d %s: Excess information in format string: %s %s: garbage in format string: %s %s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of array %ld%d%xtruefalseUnexpected format code %cp-  ?  @  ,a .    D N! .   @* @?* : `3 `#*` *  x*`*  : t*`*?  !` @ !(@a .  `J € !.  !P@Җ1İ!xa` @ @ǐ 뀤?  !.  &@!  @˒ @ !.  !!@&@ &  @ }` ?* : `6a*`"  " ",@f@Ő  ",M,@֐'@V,Ԓ@fC`!!@Ґ!!@Đ@f3`!!@Ր* : !!@Ð* 2 @f!`N@ a@a@aв`@f|0@ `!!@eÐ0J@&!@p@: , ؐ`,@&| <<<<<< <<`<<<<<<<<<<<<<<<<<<<<<<< <<<<<H<<<<<<<<< ((((((((((((((((((((((((((( ((H (((((((((((㱨@  (4@.6'''В@ '+'̀  " 'Ȁ n0㿀@'@@@֔ 0 ' `  @ *  @  x@'ؒ@ɷ  ?` ؐ8 @  '@ɞ 0<     *  * ۘ?@ɉ  㿀@@@'@{ 0 6  `  @ 2@*   '@d  x ' `  @ *@*  ܒ @J ܁㿘@2  @m``?%s%d.㿘% # c@&  6 ###ؐ  @d@  @㿐@ 㿐@  g( 3f+gf# g( 3f+gSf#㿐'@ޔ 㿐'@֔ 3f g2`* *#3f g2`* *#attempted to reinitialize sysconf protocolunable to create sysconf socket: %m/var/run/sysconfcan't connect to sysconf socket: %msysconf(' + @ ! $  @m # , $ct@ ܐ!a/ @Ȁ@Z ct @m/ ! # @ ct@ "ct@S$ @ ,#l$ <c@螔0ct"(㿘sysconf_message: %msysconf_message: short messagesysconf_message: can't buffer payloadsysconf_message payload read: %msysconf_message payload: short read㿐' ,t@Ҕ   @ #X ,#l  <Pc@ܐ00@ #p ,  @f 2t@ S#t@Ǭ 6@ I#@ C#  `@jconsno memory for cons.㿘a(@   2&@ !0&& tree_cache㿘@ E! " " "" " " tree_host_lookupNo memory for host lookup tree node.㿘@ !а 2 @ ! &@& enter_dns_hostCan't allocate space for new host.㿘"X @ Ē " @W@   $@ Ɛ"h@b$ $ $ $ tree_constNo memory for constant data tree node.㿘#@ ʐ @  & @ # & @C& tree_concatNo memory to concatenate constants.No memory for data tree concatenation node.㿘 `?2@; ,@ 2(``c@ T 2`@ ^#`@```@``@ [`@ X$``` @ 6$`@ d# 2 @ =#ؐ && & tree_limit㿘  4$  @ G!  && &  tree_evaluate㿈 ' ''0 @3$ 쀢$   ! @  '  '@' "@  $$ $ Bad node id in tree: %d.㿘 "  0/ !0*!@A@1̐&@ Ր"1#%s: host unknown.%s: temporary name server failure%s: name server failed%s: no A record associated with addressdo_host_lookup㿘) ,#l@t@ 2* "! "   #l #l@ ##l@ # #l@ |##l@ w##lJ < @ "  `,`@ 2` @W @ @  2   #l <(& "&@ &&   @7,`@ @Ů` @T@#ln&&@㿘" $@@ŋ &eoption-endoption-254option-253option-252option-251option-250option-249option-248option-247option-246option-245option-244option-243option-242option-241option-240option-239option-238option-237option-236option-235option-234option-233option-232option-231option-230option-229option-228option-227option-226option-225option-224option-223option-222option-221option-220option-219option-218option-217option-216option-215option-214option-213option-212option-211option-210option-209option-208option-207option-206option-205option-204option-203option-202option-201option-200option-199option-198option-197option-196option-195option-194option-193option-192option-191option-190option-189option-188option-187option-186option-185option-184option-183option-182option-181option-180option-179option-178option-177option-176option-175option-174option-173option-172option-171option-170option-169option-168option-167option-166option-165option-164option-163option-162option-161option-160option-159option-158option-157option-156option-155option-154option-153option-152option-151option-150option-149option-148option-147option-146option-145option-144option-143option-142option-141option-140option-139option-138option-137option-136option-135option-134option-133option-132option-131option-130option-129option-128option-127option-126option-125option-124option-123option-122option-121option-120option-119option-118option-117option-116option-115option-114option-113option-112option-111option-110option-109option-108option-107option-106option-105option-104option-103option-102option-101option-100option-99option-98option-97option-96option-95option-94option-93option-92option-91option-90option-89option-88nds-contextnds-tree-namends-serversoption-84option-83option-82option-81option-80option-79option-78dhcp-user-class-identifieroption-76option-75option-74option-73option-72option-71option-70option-69option-68option-67option-66option-65option-64option-63option-62dhcp-client-identifierdhcp-class-identifierdhcp-rebinding-timedhcp-renewal-timedhcp-max-message-sizedhcp-messageBAdhcp-parameter-request-listdhcp-server-identifierdhcp-message-typedhcp-option-overloaddhcp-lease-timedhcp-requested-addressx-display-managerfont-serversnetbios-scopenetbios-node-typenetbios-dd-servernetbios-name-serversXvendor-encapsulated-optionsntp-serversnis-serversnis-domaintcp-keepalive-garbagetcp-keepalive-intervaldefault-tcp-ttlieee802-3-encapsulationarp-cache-timeouttrailer-encapsulationstatic-routesrouter-solicitation-addressrouter-discoverymask-supplierperform-mask-discoverybroadcast-addressall-subnets-localinterface-mtuSApath-mtu-plateau-tableLpath-mtu-aging-timeoutBdefault-ip-ttlmax-dgram-reassemblyIIApolicy-filternon-local-source-routingfip-forwardingextensions-pathroot-pathswap-serverdomain-namemerit-dumpSboot-sizethost-nameresource-location-serversimpress-serverslpr-serverscookie-serverslog-serversdomain-name-serversien116-name-serverstime-serversIAroutersltime-offsetIsubnet-maskpadunknown-255unknown-254unknown-253unknown-252unknown-251unknown-250unknown-249unknown-248unknown-247unknown-246unknown-245unknown-244unknown-243unknown-242unknown-241unknown-240unknown-239unknown-238unknown-237unknown-236unknown-235unknown-234unknown-233unknown-232unknown-231unknown-230unknown-229unknown-228unknown-227unknown-226unknown-225unknown-224unknown-223unknown-222unknown-221unknown-220unknown-219unknown-218unknown-217unknown-216unknown-215unknown-214unknown-213unknown-212unknown-211unknown-210unknown-209unknown-208unknown-207unknown-206unknown-205unknown-204unknown-203unknown-202unknown-201unknown-200unknown-199unknown-198unknown-197unknown-196unknown-195unknown-194unknown-193unknown-192unknown-191unknown-190unknown-189unknown-188unknown-187unknown-186unknown-185unknown-184unknown-183unknown-182unknown-181unknown-180unknown-179unknown-178unknown-177unknown-176unknown-175unknown-174unknown-173unknown-172unknown-171unknown-170unknown-169unknown-168unknown-167unknown-166unknown-165unknown-164unknown-163unknown-162unknown-161unknown-160unknown-159unknown-158unknown-157unknown-156unknown-155unknown-154unknown-153unknown-152unknown-151unknown-150unknown-149unknown-148unknown-147unknown-146unknown-145unknown-144unknown-143unknown-142unknown-141unknown-140unknown-139unknown-138unknown-137unknown-136unknown-135unknown-134unknown-133unknown-132unknown-131unknown-130unknown-129unknown-128unknown-127unknown-126unknown-125unknown-124unknown-123unknown-122unknown-121unknown-120unknown-119unknown-118unknown-117unknown-116unknown-115unknown-114unknown-113unknown-112unknown-111unknown-110unknown-109unknown-108unknown-107unknown-106unknown-105unknown-104unknown-103unknown-102unknown-101unknown-100unknown-99unknown-98unknown-97unknown-96unknown-95unknown-94unknown-93unknown-92unknown-91unknown-90unknown-89unknown-88unknown-87unknown-86unknown-85unknown-84unknown-83unknown-82unknown-81unknown-80unknown-79unknown-78unknown-77unknown-76unknown-75unknown-74unknown-73unknown-72unknown-71unknown-70unknown-69unknown-68unknown-67unknown-66unknown-65unknown-64unknown-63unknown-62unknown-61unknown-60unknown-59unknown-58unknown-57unknown-56unknown-55unknown-54unknown-53unknown-52unknown-51unknown-50unknown-49unknown-48unknown-47unknown-46unknown-45unknown-44unknown-43unknown-42unknown-41unknown-40unknown-39unknown-38unknown-37unknown-36unknown-35unknown-34unknown-33unknown-32unknown-31unknown-30unknown-29unknown-28unknown-27unknown-26unknown-25unknown-24unknown-23unknown-22unknown-21unknown-20unknown-19unknown-18unknown-17unknown-16unknown-15unknown-14unknown-13unknown-12unknown-11unknown-10unknown-9unknown-8unknown-7token-ringunknown-5unknown-4unknown-3unknown-2ethernetunknown-0dhcpCan't allocate dhcp option hash table.㿘 % +@'$88 "`@\ ( , a8 , `" @  `@,   , a"#8#@! new_hash㿘`@ a   @є!0 add_hashCan't add %s to hash table.㿘 D ?' :  :??2  @  :  : 2 @[ @;!8 2"!H@"0" ,  @ """@ delete_hash_entry㿘 \  ?' :  :??2  @  :  : 2 @  *   &    @t  2 @d 2 $&@Ob0 2 㿘 Y ?' :  :??2  @  :  : 2 @ *   "#  2  @  "  2    "   @s "  2  No memory for %s.㿘@ !@C@ dfree %s: free on null pointer.㿘 @.!0@#㿘ِ(4㿘Ӑ%㿘͐ unable to allocate tree cache for %s.㿘 *b  "b  "@㿘.  "㿘 㿘. * * 㿘 㿘 P㿘 㿘~ 㿘x$T㿘r 㿘 ,x "xd$4㿘] 㿘W 㿘j㿘d ,x" x㿘Y㿘S㿘M㿘G㿘A㿘;㿘5㿘/ *" 㿘$㿘㿘%s exiting.exiting. 㿘! $ H'H'L'P'T'X@ # H$H@/O *" a@'!# "@j@# aȐ @  @'a#  !!a@o@Q@z 㿘! $ H'H'L'P'T'X@| # H$H@/ *" a@&#  @.@ aȐ @  㿘! $ H'H'L'P'T'X@Q # H$H@. *" a@&#  @@ aȐ @  㿘! $ H'H'L'P'T'X@& # H$H@. *" a@&#  @ؐ@ aȐ @  㿘N@$ `m2. "@`!  @U?@``   N@ %@ .` N@ @.%s line %d: %s%s^^ 㿘 # H'H'L'P'T'XĐ +# # +! $c, H$@H$@.Q1 *"!! @&"3 +c @&c, P  +c("y"  @& a# & %@W@ #aȒ @  c@J@  @  +#(Ē`(@ a @  % "`P attempted to reinitialize dns protocoldomaintcpunable to create dns socket: %mdns㿈! +# #P $##x@EBc  *  *2" 52b  @^# ! , $#To#@#T#ɖ 㿘@.  @ 㿘 `  `      㿘@ `  ` ` ?  `@ߐ@ .. @ @ `@ . in-addrarpa㽘 `  ,@d   ,@@ d 0,    @ ,@@ @  0, @  0,ܠ apax,  $ @5 㽘@ *  @t 7!* ' 4`@s.2` / 2` ,#T $  @]r 82  㽘@ E   @A 7!* '@Bk .2  e     "@?@*`V2` R  N  &4` ,#T @]# 82 icmp_echoreply: %mA record; value is %d.%d.%d.%dDomain name; value is %s unhandled type: %x?!# '    @]耢 6l p0R  @ ѐ`@  ?#@@ Ðʐ Ɛ  , 2`         ] !?! P0 M2`?# @`@ rCan't open %s: %mread_resolv_confNo memory for %sjunk after domain declarationNo memory for nameserver %spick_name_server`Ġ"(ؘ + +%cb@_ |"ے0t> 8!Bi ' *""   @o  2$ " 2$"z$%$ $ 9  ^"Ϋ<:Ħώ +##@` `@},䀢 `2"$`" 2$@Ȓ @;"$@%@`   5,`,`4`$` $`$`mĐŒ? ؾ% +  `"$$@ c 2% *  `"$$@ c 2%cCan't stat %s8# ,1 %cl H@Ġ"(@ "H  H@cl & H +#   㿘@p`XPH80(  @forcereloadupdatesyncasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:ffsmount table fullspecified device does not match mounted devicefilesystem not supported by kernel%s on %s: %s @' "  "!"a' %#- / " oᨒ@e@O@^`? ?a* & @ @@@?'`' ''@, ᐀ "  -  "0  "0     @[aa@۸ @ usage: mount_ffs [-o options] special node 㿘b@m!@| ,-o %s: option not supported㿘@P  @Ē 1' n L  o  @i = 2*`"@P 2   @2    &*@&b@`  @ᜒؠ 2L@㿘@Qhaltdlnpq%sreboot???halted (with powerdown) by %shalted by %srebooted by %s~shutdownSIGTSTP init/etc/rc/dev/consolerevokesetsidopen/bin/shshSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): h'D@v'H 8J`-" @l`0         %!95;71 "3 2* @€a   ` @  @!D 8@.H??@  `! @@Z @ڴ  @ܐ`H@ +@  @@{ P`0 @"W " X x@    H @"G "`@ ڐ ``@Ôఀ @* @ ?2 `@ @  @  Ȑ@Y ?J?@?D @  @p?@P @!?2@P @F ?2 @O  @ @@  $@Ȓ@Y ̔`'̒ @p   a@Ҕ@ @ ?@ ? ! @a" @ @ݸ@  @~,  ?@ ? !  0@la @ @{ ?!H@ 888888888888888888888888888888888888888888888 80usage: %s [-dlnpq] 㿘 8b@i!@x 㿘@ ݔcannot seek temp fileout of memorycannot read temp file㿘 -#` - !P !P -  "aD  @"   -=!P @[^ 6  @O% "rc'  [%#ad  $ad" @ 8ad@O # #  `  `*ad `* `*  `*  `*  `*  `*  `*  ` *  ` *  ` * ` * * * $ad!!p  @" !p 6 @"[ 2 $?$ $ad!!p  @" !p  -@"F  -! @`  !P@N "c0@   >  B=!P+line too longcannot write temp file㿘@  @N #  # N 2 #&@#! ! `  ` * `* `*  `*  `*  `*  `*  `*  ` *  ` *  ` * ` * * @* + -aD ' -ᨒ @Z   @NQ "c @+! -:  N@ @ *`  `,   "@` *  ` .  A  0@N` b B2:` @`' -%*` : , ?$@  N@ @ *` ? `,   ?"@` ,     *` . ,  $|@c des_setkey㿘 -!|`ņ      ` 2``$  . `$ @! #؁des_cipher㿘`0 ! -#P   .``$` ?@ʔ  #P,#P ( (  (  ( ( ( %( - "@͒a. ! -#P  .``$` ?@ Y   @&decryption failed (block corrupted)decryption failed (incomplete block)cannot read file㿐  @# J  / / / / /  / ?//@P   -P   . $ P*P* * * * * * * @2  N  !?@z" ? ?ڐ"@?invalid pattern delimiter㿘# -aJ   "c@ 9?@ aJ@`$a@! -!X -!Xa# ) - !( `    @Ř `?a@ a@  p unexpected end-of-file& no previous commandout of memory㿐!  -a@ea @ޒ ?"a0 "aP @?0!(@%g5!h3 -/ -`"!\ @[  P# - ?4 @#'c@@J?` 2 &?Ā c@@eBa  c@@e8aH `j -@ -Д  X%#ad ̠ $ad" @ 5ad@I3  !h .-  -  - -   -  - -   -  - ad-  - - - k$ad!!p  @I !p B?@ >?%А?$̀ $ad!!p  @4 !p "@t @ -"aM@  @  & @  &  !\@ !  !J`@ : 㿘 -a$% -@   V# -!!d`$!da @d.  8!d@H !h !h `  `*!d `* `*  `*  `*  `*  `*  `*  ` *  ` *  ` * ` * * * $!d1!p  @ !p  ?@ ?$@?$a $!d1!p  @ !p $@ $ a * "  $$㿘) -$ - - @6 -$3 - pap( '  ! `@!  - -጖$  - * @ a$   * @" #!a$ጀ@  - *``"ጁ㿘!!d# -` - - - -a $!d"p"#!$@#a@!d$a ? $!d!!p  @* !p @j rcannot open input filecannot close input file%lu 㿘N !’`@ @j@T`ؠ  @G"` @> 6N+? ! @  !l@g  @G"` @?0!lꀢa!’! @ -a\&newline inserted newline appended 㿘 -a` - -Ŕ@ !0`?( a\  `  #!0"( -"!\Rad -`&ad ad? K&ad1!p  @ !p z?@Ð v?`$`a\ @! dad? +&ad1!p  @c !p Z?@ V?d? $d3ap  @O ap "@ @N 3 :?   "X@Ga(0  (   "p@G a( 0  "    %0"%0(a\`&(  " out of memorycannot read input file㿘 + -l-a8  \/ -'d  $dᤀ" @T 8d@F Ò!P !P `  `*d `* `*  `*  `*  `*  `*  `*  ` *  ` *  ` * ` * * * $d!!p  @ !p ɰ?@ Ű?%a8?%ᤀ $d!!p  @ !p @ڐ ᤓ,`*` - "a(\ " ? & @e  &`  @|` a8  \ -%d a $d " @А 8d@F Ò!P !P `  `*d `* `*  `*  `*  `*  `*  `*  ` *  ` *  ` * ` * * * 7$d!!p  @+ !p E?@k A?%a8?%ᤀ $d!!p  @ !p ` @V ` 2  -!*@ @ @EĐ Ð"a`@͔ ? / -ᤐ *@ - "0  -*(` -!0` ?wcannot open output filecannot close output file㿘N !Ēa@V @-@QŒ` @EĐ"a  @5 6N.? ! @  !l@eW  @EaĐ"a @i?0!lꀢa!’! @S&  㿘]a\  ^`'@&\- -+ -) -  `@ `a( !0 *@ @ 6@?`@\   " cannot write file㿘"# !#%!\  N@O`  N@@n`  @D bX@ ?!\ unexpected end-of-file㿘 -!J ᐤ"@T 'Zᐐ?' a \/#ad  $ad" @V 8ad@D Ò!P !P `  `*ad `* `*  `*  `*  `*  `*  `*  ` *  ` *  ` * ` * * * O$ad!!p  @ !p  @   &a?% $ad!!p  @ !p @ܐ ᐔ@a @*5æ!P ;Ť@ *@ ۰   -#@@ J aa@; ̰  Y-d  %db" @˒ 5d@D  !P . - -  -  -  -  -  -  -  -  - d- - - %d!!p  @) !p  @i  &a?% %d!!p  @ !p "@T #@@ِ`@Z ~a` Z #ad $ad" @c 8ad@C Ò!P !P `  `*ad `* `*  `*  `*  `*  `*  `*  ` *  ` *  ` * ` * * * \$ad!!p  @ !p  @  &a?% $ad!!p  @ !p @ *'stdincannot read stdin㿘-7æ!PP  5 -9 -`? &`@bP  %P?r+ -al` X/ -)!d  @%!d" @ې 5!d@C#  !P .,  , ,,  , ,,  , ,!d,  , , , I%!d1!p  @9 !p M?@y I?%al?%@ %!d1!p  @$ !p @@d @, *`` - "a( 2`!x @'!x*@!@P @ ?@BÐ"ƒb@͔  & 6 ?@6 j`/ -@*@&%ld \  \abfnrtv\㿘 @9! !Ǩ!'ǀ "`@ @B    ^*`: \ `?"``  @B  ` \?"`` * $ @A \N``Ǵ!@Z  "@?M "`   ]* @A ^ 2  0`"@   * $  @AȒ   82  0`"@   * $  @A    0`"@   * $  @A ``N?"``  * $ @A J  `?"`  * $ @Ar  @(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. *usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? invalid filename%s warning: file modifiedscript, line %d: %s unexpected end-of-file8'H@p4'DH @c@H@J?`r `?"!h/- -) "'Ţ !+%"$l x pH aH a! %,$!\@R@a D@yH?• sH*  D'H@'DJ`-DŒ "!l"HD 'H'D@ !ŀ $!x @   <      @ @ $!x@zǐ @ @ ݒb@y ݒ`@u  @r ݒa@n  -@j# a@A!  `  `* `* `*  `*  `*  `*  `*  `* * J* DŐ '"atHJ@ "D@z H@  H!x`2 )J@ !#!Š!@X , Da@@Đ!HJ@  Ȑ"a@ !x`l  ?%#37 -5-+') -;Ȁ   -` Ȓa@~wb -!, @@@R ?+ -ᔀ #!l`a@@~bb@` x`2 ` b0H !x@~Jb%  ?&ᔐ ?5   -#@ J  ȒbPb@<  ? 5  -@\"! ?@  & ?  -a\@  -?a??x,)a a&@@)bb@   x  `a b0H !x@}b0 aH @}bŐ a@@x`a ` b0H !x@}֖b S 㿘 -\ - - -"aX"#X"    -! !&#X$X$!J`,`; #X`;#!$a\@" #X 4  &#X! !$X ?number out of rangeinvalid address㿘 -!\ # -$aa L  ` aJ?`Uː!t*` €a$a L a$a! @   2`   @I  <# - "!`" -ʐ"b|  ^2| z&  `2 - ^2o m?aaa@I}  <#  "!`" ʐ"bO Ga . 4$aJ\?@ / @ ϒ`? <aJ@ `$a+a`$aJ``@$a u +? -a ;X` $a"X - \"a -!`a ? -!`@ ʐ"b0 @?J *----------------------*---, ,-,---*,*, ,D++++++++++-,---,D------------------------------*invalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimiteraw%ld ! unknown command㿘   ! -$!! L  ` *: `p!$!Ԑ!P*` €  -J`n" `p`l   2  $! $! $! !J ` $! -!` -@ -@ a逢  -a\ @q   -J`n" `p`l   2  $! $! $! !J ` $! -!`2 -@k -aX -@ &˰?@ I\ İ? -a\ @2   -J`n" `p`l   2  $! $! $! !J ` $! -!`2 -@, -aX -@ \ -a`   2$\0 -!`!l`"x? -#X`ː"bk ! L @ `ː"c^ @M [ J`n" `p`l   2  $! $! $! !J ` 3$! -!`@  &4?@ &-? 6L@&?  !!Š!@T , L@  @J!` ː"c   Ő! &?@? -" ""` -#X`ː"b ! L @ `ː"cޔ @ "ܰ?L@ ! ː"c8ϔ J`n" `p`l   2  $! $! $! !J ` $!L@ %Š@TM , @@v00 -!`ː"cP  -!`@  g G 3 G V` `#  -J`n" `p`l   2  $! $! $! !J ` S$!`%a9  -#X`ː"bF   -!J`n" `p`l   2  $! $! $! !!J ` $!J8 -#X`ː"b   -J`n" `p`l   2  $! $! $! !J ` $!` " "`Jbb Ȑ!@yb0 -!`ʐ"b0Ԕ   -J`n" `p`l   2  $! $! $! !J ` $! -!`a@Fa@ +?  -a\@    -J`n" `p`l   2  $! $! $! !J ` y$! -!` -@ - -!Xa s@ U ! -J a $!ʐ"b0]  J`n" `p`l   2  $! $! $! !J ` 6$!a@   -a\@ 0  -J`n" `p`l   2  $! $! $! !J ` $! -aX -@    ? -a\@t + -# -aXa  -#X`aː"cp  -!`@ʐ"b0ݔ %aX  $a  ː"cД   -J`n" `p`l   2  $! $! $! !J ` $! -!`@B@   -a\@   -J`n" `p`l   2  $! $! $! !J ` v$! -aX -@   u s? -a\@ k  -J`n" `p`l   2  $! $! $! !J ` C$! -aX -@   B @? -#X`ː"b3   -J`n" `p`l   2  $! $! $! !J `  $! -a,  a, "! 2 "" " -#X`ː"b   -J`n"  `p`l 2 $!!J ` $! -!`ڰ?!l`Հq0! L @ ` -ː"cÔ #X` -!` -"a@  J`n" `p`l   2  $! $! $! !J ` $! -!`@*J!!` L@ !@Q* , L@  @L  ː"c s  -!c &k?i -!` e - b"a#) -'J` @!J`g" `p` "2-`9,`0(!!`r 0!$!! $! $!@CQ # @$b@ "!`"┤ ?$─ŀ! "` ː"c  ""!J@  J` ː"c !dŒ` "!d"@  "d? $d!!p  @  !p ڰ?@ " ְ?@ @ʷ@*"Ő "b%"d? $d#ap  @  ap @   #Œb@ b &? -!`b b ?$bb $bb  ?$b% - -J@ n" p l `2 `` ` ` "$!`\@ q  -J`n" `p`l   2  $! $! $! !J ` I$! @"b@*  -a\@ <+ -# -aX5a 5 -#X`aː"cp)  -!`@6%aXʐ"b0 $a  -J`n" `p`l   2  $! $! $! !J ` $! -!`@@Ӑ׀  -#X`ː"b   -J`n" `p`l   2  $! $! $! !J ` $!@ !J`q`Q! $!?! L @ `ː"c @  -#X` ) -!` !` - -"!"aX!`@  &?  -J`n" `p`l   2  $! $! $! !J ` h$!J!!` L@ !@O , L@  @L  ː"c Q W2## - -a!X u >!` -:"!!`6!l`2`q0.? -#X`ː"b!   -J`n" `p`l   2  $! $! $! !J ` $!_"a\ -!\ - "X@i` ! ?ϐ ! @A # @$b<#@  "!`"  ʐ"b@ $b  -J`n" `p`l   2  $! $! $! !J ` $! -!b -!` @4 @B  ?  -J`n" `p`l   2  $! $! $! !J ` t$! -#Xˀc -! -!`@א 0m -#X`ː"ba @ ^  -J`n" `p`l   2  $! $! $! !J ` 6$!! -!hȐ"@`!h@jI al .@#0* -!\ - "X@`   -a @ ?̐"` ʐ"b@  $bː"bД @?PPPPPPPPPPPPPPPPPPPPPPPOPPPPPPPPPPPPPPPPPPPPPPPPPPPNPPPPPPP3pP68PPPPPPP@PA@PPPP6JLPPPPPPPPP0P1D2@3L5p689:;P?A@BCH@I6JLLPM\㿘 -#X` - -"!X"a!Xa 4 ŀ  -!`   ʐ"b0@H ?no match㿘 -!\F?D?% -) -``  ?,` a\1͢ !( `    @~ a\ڀ`Ԓ# # ` `?* `*  `*  `*  `*  `*  `* * * filename too longout of memory㿐 -!J@ <$!! L  `   Ȑ"a"  $!J@ !`@$! ' 1 -!hȐ"@H`!h  Ր"`ؔ @x '⠀ V%#ad"`$ad@> 8ad@4 Ւ  `  `*ad `* `*  `*  `*  `*  `*  `*  ` *  ` *  ` * ` * * * $ad1!p  @ !p 6 @ِ 2 $⠐?$ $ad1!p  @ !p !@Đ !'J@ ! @b`* '#!J@ !*@@  shell access restrictedno previous command㿐!h`'Ր"c  8 - "a?Ů b  [3#ad  b$ad" @ 8ad@3 Ւ  `  `*ad `* `*  `*  `*  `*  `*  `*  ` *  ` *  ` * ` * * * $ad!!p  @ !p l?@6 h?%⨐?&b $ad!!p  @ !p b@! b !*@J@ ժ 57բ J@ !n %M⨔` V 'd b$d" @* 4d@3r .d ?,`  ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` T$d!!p  @ !p ?@ɐ ?%⨐?&b $d1!p  @t !p @ b *@`J \`% b*@'!Y` d⨐` X)!d  %!db" @ 4!d@3 .!d ?,`  ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` %!d!!p  @ !p ?@Z ?%⨐?&b %!d1!p  @ !p @E b  *% -!h`J` 2 -֐=`a< ⨔@ V%d  b$d" @K 4d@2 .d ?,`  ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` u$d!!p  @ !p  ?@ ?%⨐?&b $d1!p  @ !p !h@Ր !h<  : ⤤*!h<@ `vJa Ŕa@ڐ @⨔@ W''d  b$d" @Ԑ 4d@2 .d ?,`  ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` $d!!p  @3 !p ?@s ?%⨐?&b $d1!p  @ !p @^ ?? ' ⤤*@`??'%J` 5' -t` c) -#ad  !h$ad" @` @ad@1 Ւ  `  `*ad `* `*  `*  `*  `*  `*  `*  ` *  ` *  ` * ` * * * $ad!!p  @ !p 1?@ -?ː"c  @|?0$$t?%!h $ad!!p  @ !p b@ސ b@d!h -!h"!<*@L ! % 㿘 -  P"a\ / -- -'  - ?" ` @ J?`  ` ?5` u s?aN   J ` "ᐔ" dN .dN  dX   $d!l !d? $!d1!p  @1 !p ??@q ;?!\!\$ @  !d? $!d1!p  @ !p ?@Q ?d -? " $d!!p  @ !p {@8 w 㿘 -!`     ⻐@r% -3դ bO - -` X5)!d  %!d" @1 5!d@0y  .b , , , , , , , , , , !d, , , %!d!!p  @ !p ̰?@ϐ Ȱ?%?& %!d!!p  @z !p "@ `@?`@@ % - [5#ad  $ad" @ː 8ad@0 Ւ  `  `*ad `* `*  `*  `*  `*  `*  `*  ` *  ` *  ` * ` * * * 2$ad!!p  @& !p c?@f _?$?& $ad!!p  @ !p @Q  * * @F !<?!d`# -$a\$!d a\ @ _ !d!d? $!d!!p  @ސ !p ?@ ? -? " $!d!!p  @Ȑ !p  @  㿘 -! -a`    -!X Ŕ ad   "ad}z -"a\S @   `   @  ad? %ad!!p  @x !p N?@ J?LX EB>; -@!\$@" "@X $$$ሐ" " -!`ad@楒ad -? " %ad!!p  @/ !p  @o  㿘! -!X  -!X -a " ` U"\ S`& "N  E1) -!d`@*&!d !d࣐\$ @ i !d? &!d!!p  @ !p )?@) %?!d ?%! &!d!!p  @Ӑ !p @  \࢐  ` 㿘%d $d @ % ) -d? $d!!p  @ !p 9?@ 5?!``@  r?o -!`!`!`&@d?$" $` - - %!`"\#!`$d!!p  @p !p  @  㿘   -ʐ"b0@- $?!``@  1.@" # -Ő `$a\ f &?@@ invalid mark character㿘`L` ` ܐ"`@ ? -* a 2" -a "a" 㿘`L  ` ? -a*߾@  ܐ"`@ʔ ? -!  -  ! "!``$ 㿘@      "%:@- Ւ  `  ` * `* `*  `*  `*  `*  `*  `*  ` *  ` *  ` * ` * * * 㿘"  N \2 `?㿘'ⴢ V)%d"`$d"@ 8d@-I Ւ  `  `*d `* `*  `*  `*  `*  `*  `*  ` *  ` *  ` * ` * * * $d!!p  @\ !p . @ * $ⴐ?%" $d!!p  @G !p @ N`\`  `*` "* "㿘!d` Ŕ?p * @"p@㿘!d` Ŕ?p * @"p@Ned.hupHOME㿘!t`ߟ p? ) -!`* * 1"pˤ!Hc   %@ʐ!P  @  @ @+ɒJ /" /.*`@6!` c 㿘!t`Y Ő?p *@*  -"p#@?㿐p? **@! ""p!`h @4  `""`""$!..㿘!h`" N ! ݒc@@H @C /   Ր"c@<  invalid pattern delimiterno previous patternout of memory㿘 -J@  ݒ##`` `;2 : V:  `"J`   H ##";"#`;`< @K 5   "`@ @C  $ @+͐ ݚ##` b` :b2 " "b @x    Ŕ@v!' @G $ unbalanced brackets ([])trailing backslash (\)㿘 -!L@+ ` ()'ޤ"ḑ* :  [ \ L@   Ḱ ` ``=",<{<L a L@ ` * a)Ƥ$ ( E'#ad  $$ad" @  "ad@+R ݆cc bad;b?2` "` $ad!!p  { !p <  8 % (?$$ $ad#ap  f ap a a@,$$ -*@!(%a$ޒ!! `` ``8* : " 2 $   J^" J]! 2 J `.`:`=2  J ]   J]2J 2J J] [J] number out of range㿘&@&# -aJ a -"!H> @L a9?J` @ 1&a $aa @ϐ  @4  @&@<#@  "!`" ߐ"aH@ &@ ?*:  g2 `$a & no previous substitutionout of memory㿘 -a "aJ % J*: @! -!d`%ߐ"b@[ !d%ᐓ*J :` ) -- -3ߠ"b Q %d !d$d" @ې /d@*#  " .b ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` d,` ,` ,` $d1!p  9 !p%?%!d $d1!p  * !p aj a !d* *:`%a` J `\' !d**@: %a  -!` P% - ?6 h " @J?` 2 &j ᐕ>J@ s Z!!d  !d$!d" @K 8!d@) ߒ" " `  `*!d `* `*  `*  `*  `*  `*  `*  ` *  ` *  ` * ` * * * $!d!!p   !p    %?%!d $!d!!p   !p  -ѐ  -!d"!H*@!dno match㿘 -!X - -\a   "\ a +!\` G&!\@ &|?I!\  h -ad!`%ad#} !\(!\$ @ ad? L$ad!!p  6 !p M?v I?ad? %ad!!p    !p !\` !\!aX"@ !\%!\``#P #P ` `?* `*  `*  `*  `*  `*  `* * *  ?`!\ ? infinite substitution loop 㽰R   `  -a(  ` ے `@'  @r^ - -+ -`  @rK   x$4 [%d  a$d" @ 8d@(G ߒ" " `  `*d `* `*  `*  `*  `*  `*  `*  ` *  ` *  ` * ` * * * $d!!p  Z !p .? *?%4?%a $d!!p  E !p ( ( $  a@ @ p$?4 Z %d a$d" @ 8d@'Ӑ ߒ" " `  `*d `* `*  `*  `*  `*  `*  `*  ` *  ` *  ` * ` * * * $d!!p   !p ?& ?%4?%a $d!!p  ѐ !p ( (  ڐ a@$@ L@ "4  Z %d a$d" @ 8d@'_ ߒ" " `  `*d `* `*  `*  `*  `*  `*  `*  ` *  ` *  ` * ` * * * 3$d!!p  r !p F? B?%4?%a $d!!p  ] !p   $@ (` "a@ ?(    a@ a !@*@! @*`  㿘 - -!Had'P1 -'/ -73ߦbM@ &\ \  !4" G -d ᠀%d" @t %d@& b. , ,,  , ,,  , ,d, ? , , , , %d &!4?%᠀ %d!!p  ͐ !p @  @Ɣ` -@ᠢ`*@ -j!4`M@ 0e 94dP?Ѐ ^!4*   !4"@@ G -d ᠀b%d" @  %d@&R b. , ,,  , ,,  , ,d, ? , , , , %d &!4?%᠀ %d!!p  c !p @ @\` -@ᠢ`*@S - I)!d  %!d᠀b" @ %!d@% b. , ,,  , ,,  , ,!d, ? , , , , %!d] &!4?%᠀ %!d!!p    !p K ᠔` @*@ -ad  -H%@ &M@!4 [ #ad ᠀$ad" @Z 9ad@% ߒ" " `  `*ad `* `*  `*  `*  `*  `*  `*  ` *  ` *  ` * ` * * * $ad2'?!!p   !p ? ?&!4?%᠀ $ad!!p   !p ߐ ᠰ*out of memory㿘!%#  `d*@  *`@$  $`*` * "S *`@ *` "J *`@ *` & *$ @%! # # `  ` * `* `*  `*  `*  `*  `*  `*  ` *  ` *  ` * ` * * @* @`$`$nothing to undo㿈 - -న a\ `? `?  "`@ ?`   - "a ad   "adHƓ( @*`@  "   2 4.   `"  @ "`"  " @?" ?@" ?`" ?`"   "@  ?" #`?„ 2  : * 2(@*`8: @@('`'`*'  #@ #` #`# # #  -!`dDd ?%\% %a`$ഀ $d1!p  w !p    㿘` ??!"`)`* @*` @ ଒@ ``@ ^@@@଒??$ -!\ -!`$"`" 㿘@2HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s@R~ `@  m"c'4  /# m! m+' m; m%9 m'0+8 *&* @€ '4   '4  '4   % $c$#`P@~qR`$# $c $㌐ 'c@@\,?Ґ?* & @ @vc    `@  怦`4 `@    2 @? m"c@8 * 2 #'#@2`. @@/#a(@z h@"o@!$ .*h`$,`0%`&@@V]?  "a ?a@@Ԋ <  -  ?@ ?% c 2 @  @ @V1@@@VD@<  2    c " @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@(@4㿘@s / 2N  2  N /"?* N /2? %s: %s%s: directory causes a cycle..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).fts_read8@N   @ӿ  - "   `0 ``!`@,z" @ `@"( ;)T`2 2``"`$o``" @=bH "``J`$`/d"L? / /, Ƥah$#  ,"P@ڷ   @9$,!h@U&?2`<`<1  @2`"x@ڕ`<<`  @ 0<      `"@x!hx  < @@ m @[@O0`@K(@[@iZ #` m#` `@M"ؒ@ǔ I !ha@T͐  ma@@ <  "  m  ""ᐒa@h@ߐ #` `<@ 2! !h`<@0 m#` @z  m#` @I @5 2 @7 2`4 b@Ҫ 4  " @4  `??%soverwrite %s? 8` @TN 2`<`@ΐ  ` - m#``@Kh`2G m#`2B m#`9!`@^h?P`? "`@@! ?P  $?P ? y#`P`? &`@@ `P  $`P` 2` y Yh@r h$ h &@S?2 - @mh'#x )@\@ @>@  @Uh ` `@M    m@w@t 06#`@ʒ 2#  ,  m# @ @|ʒ @ m# o*@ @b  @h @G@E  @h readlink: %sunlink: %ssymlink: %s㻘  @#?` #X,@ 3Ơah@JD #h ah@ #x@ް 0  m#` @ <mkfifo: %s㿘` 3Ơah@J  #hah @  H@ط   m#` @9 mknod: %s㿘` 3Ơah@I  #hah @f   @؎   m#` @ utimes: %schown: %schflags: %s㿘 ! m  /6 $#x #x@{[#$  #$  $@{T#ƒ "`ah@f  !@U `  @    "# "  @# "  "!`!@9h  <! @6 `  @p   $a@h !@!h $a` D@d a0@h  a - D !@h lchown: %s㿘Ơ!h @   "!`#x@  %s %s usage: cp [-R [-H | -L | -P]] [-fip] src target cp [-R [-H | -L | -P]] [-fip] src1 ... srcN directory㿘c@]!@ 㿘@b:c:d:f:snr%sstdin㿘@M'D`@ڐ  o *cȴ 1/! "# m+ o-% o) o'; 9뀢 4* "@€!@ $c!  %c .!@8 $Đ %#@D@WSఀ?ݐ?ađ* ` @c "@@@c c # "@@@ !@@*Œ 2@@ @ @>l`@ 0`P@ PPh, [-cf] list: illegal list value[-cf] list: values may not include zero[-cf] list: %d too large (max %d)㿐'D) m' mDi+J@ -  `' L   @(W   #4%#J -`L @ `@(@ J@ - 㬐`'􀢀 $J` c@  (c@  ocД  @(c &"c m#@    *  c@3 '㬀` o 4"# m#@ 1㿘+ m) o#c  ` "@ , :   * $਒ @!`  ? & @<  &?W 2L B' m#`, ?`? "`` , :  * $@ ? & @<~  &? ܒ`? & @ m#`6 `= ?"`` * $@ L@ ! ?`$@ * $ਐ@`L@ 2L@ 2`` ?"`* $@ߐ @( ,`@}usage: cut -c list [file1 ...] cut -f list [-s] [-d delim] [file ...] cut -b list [-n] [file ...] 㿘c@Z!@ 㿘@ʔ Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. along with this program; if not, write to the Free Software You should have received a copy of the GNU General Public License GNU General Public License for more details. MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the but WITHOUT ANY WARRANTY; without even the implied warranty of This program is distributed in the hope that it will be useful, any later version. the Free Software Foundation; either version 2, or (at your option) it under the terms of the GNU General Public License as published by This program is free software; you can redistribute it and/or modify Copyright (C) 1992-1993 Jean-loup Gaillybitslzwbestfastversionverboseno-timetestsuffixrecursivesilentquietnameno-namelicenselisthelpforceuncompressdecompressstdoutto-stdoutasciiusage: %s [-%scdfhlLnN%stvV19] [-S suffix] [file ...] r㿘 }#!`@@@X x file... files to (de)compress. If none given, use standard input. -9 --best compress better -1 --fast compress faster -V --version display version number -v --verbose verbose mode -t --test test compressed file integrity -S .suf --suffix .suf use suffix .suf on compressed files -r --recursive operate recursively on directories -q --quiet suppress all warnings -N --name save or restore the original name and time stamp -n --no-name do not save or restore the original name and time stamp -L --license display software license -l --list list compressed file contents -h --help give this help -f --force force overwrite of output file and compress links -d --decompress decompress -c --stdout write on standard output, keep original files unchanged%s %s (%s) 1.2.418 Aug 93%s 㿘 }#`Xh p@W! X`  X#@W`  2㿘 }#`Xh p@WҐ!bH  bH#@WȒ`  2Compilation options: %s %s DIRENTUTIMESTDC_HEADERS HAVE_UNISTD_H DYN_ALLOC 㿘 }#!! p`Xh@Wᨒa@Wa@Wa@Wa@W@Wa.exeGZIPunguncatgzcat.gzab:cdfhH?lLmMnNqrS:tvVZ123456789%s: -S suffix too long %s: -Z not supported in this version %s: option --ascii ignored on this system %s: incorrect suffix '%s' insufficient memory㿘'H@G'DH! }@@ @~$#Ԡ  c?@5b cԐ*?H@! D  "``H""Ē @|  @  ~`"#a@|~  @|{  a@|u  @|r  a@|l cԒb@4   cԒb@4  cǐ "b @4b c@4b #  "b"# `hb @0@}! $ #/%1+)59; }7ǀ`Ez"@*` € v$b@a`p"bǐ l"bǐ h"bb c"b "b"Z% U$S$ &"O$$L&"ǒ ""F"ǐ B"b!@}^  $cb@Vp!o@ n   h@0@+,  ""b#""ǒ`"""@ T Dcb@VJ!I@ H  D""?@ > D"Hb@*' y ""$" b"&"bD  " "` cԐ!@Vc   "` $ "`c!@VcP@  "   "`2  "`T @yX @ 'c@ @#p@yP | "c@ 7#p@yG@ } "c@ .#p@y>@ | "c@ %#p@y5 } "c@ #p` "`"`⠀ D@⠠ H* @$  D@ @⠀  "``?@'?@ pppppppppǀǀǀǀǀ ǀǀǀǀǀǀǀǀ ǀǀǀ0D\ǀǀǀǀƐǀǀ(ǀǀǀ@ǀǀǀǀǀǀŴǀǀ ǀǀǀ8Lǀǀhƀǀǀ %s: compressed data not %s a terminal. Use -f to force %scompression. read fromwritten todeFor help, type: %s -h stdinfstat(stdin) OK 㿘"/ǀ`3-⠀ 0ꀢ` P X@qR  $ }#Ԣ #Xa## "#"@ @Tc!@Tc@  b  ⠀  c  }  |  + | c+c c*` ( * *` *` *` *`***** %c"`2 |  R`^@s  @# %c |?@"cǐ  ~" "c |@{cǀ "b@ b⠀  |c@0A# !@fcǀ 9"b }"#Ĕ`PRf TR /   |#` ~ }c܀ |"`" !@T]c0  }c  ~!!" "@@ @TIa-%s: %s is a directory -- ignored %s: %s is not a directory or a regular file - ignored %s: %s has %d other link%c -- unchanged %s: %s: %s compressed to %s %s: %s OK -- replaced with %s8'Dch@1ې  !"$" D@p < @ 4 "` X? (08@HP ?D?????????@ ?D@ے0|"`B }# }!cp@S7ǀ@"`0 }# }!c@S% '1" $"`"` }#Ԇa } #Жc?  s@Sb 5 3"b"  4 | |#""`  " #@"`"`  | ` `* `*  `*  `*  `* * * @3  }# @H~! | ?"c }#`@S8!@/ǐ "b@h" ~"c@ ǀ  "b"`"@@y 0"  R  "` ! |"5@ '  ! |5#  #"` # }# |!`#@Rc# " `?$# c!`(@y  @y  0 8"@@RȔ!#  |#` ~ }c܀@  $" }"#`T€ ?$"@x"` "@x "@E"? " G |@>#0C <"b   !`@@R!b  ~ c }!Đ" "@@0!b } c ~!" "@@#!b  "  ! |`H@RX!!@RTa" @ %s: %s: warning, name truncated 8' |3-+) }/5@ @x& 0L |# &bА*@Ge!# ? $`@@x :%@p{ #Ԓ@Ra@@x @x`@>&&%@  "`"`#ԐaP@Qb     "b@w`@>@0㿘" " "a"`@G"0@G_z-z-gz.tgz.taz.zzp  h@/ah "@x  А@ $&@@ِ@U@x@x@ $@?M`/" @/l$ "@  .Z㿘Ȣ @xg#( } " ?"a#@ :"`  "!`  @Y ǐ '"b@x? b@/, h "`'Ǡ @@cc `@ . h@V@4$  %s: %s: unknown suffix -- ignored .tar%s: %s already has %s suffix -- unchanged 㿘 |! }##@FP"`K -b   "`2h "`2c "`  2Z "`2U "`B }#!c@P#8@aP@. aX@. 26. #ؐ#. .  .  .  ). !"`  }"`"`  }#!c@Pb     "b | "#@`h %s: %s: unknown method %d -- get newer version of gzip %s: %s is encrypted -- get newer version of gzip %s: %s is a a multi-part gzip file -- get newer version of gzip %s: %s has flags 0x%x -- get newer version of gzip %s: %s: part number %u %s: %s: extra field of %u bytes ignored corrupted input -- file name too largePK %s: %s: not in gzip format %s: %s: decompression OK, trailing garbage ignored 㿐"`"` ~ }#܀   }# @ $@H /#܀  0 ~ }#܀   }# @ $@1 /#܀  }# @ $@#/ ~cǖ?  | "  #cb @<   b @;  #܀ }# @ $@ $"   }# }b(!@O ##Ȁ "`T }#  @ $@א   }# }b`!@Oǐ "bܰ? }# }b!@Owbǐ "b  }# }b!@Od bǐ "b#܀ }# @ $@ #܀  }# @ * $@ * #܀  }# @ * $@v * #܀  }# @ * $@f *  "` |"##܀@`$@R #܀@`$@I `,#쀣 }#  @ $@; #܀  }# @ * $@, * "`  }# }!c@N٘ ? #܀ }#  @ $@  #܀  }# @ * $@ * "`  }# }!c0@N? ? #܀@`$@ߐ ??쀤`K"`2! }"`"`! } ! }#܀# $@ *  *` |@5# # }# @#`#܀ }# @ $@ *`,  b `2$b`! }#܀# $@  2h" c&`#@:c  쀢 2c }c @:W  #"`T$@0 2l? B$c@:C   "Ȕ "`T4&"c@:5    !"`T$%&"c@:&   b"Ȗ  "T$&" "`"`2 " 0Ȕ "`T$$&"" %  }# }c!@M:"b"`  }# }!c@Mb ? "bdeflalzh pack comprstoremethod crc date time compressed uncompr. ratio uncompressed_name %9lu %9lu %9ld %9ld (totals) %5s %08lx %11s %s 㿐܀ `"`"@""`23 |@"0. |, |"Ȁ"̀"`"`@ߒ   "` "@Ԓ  `bȔ"̐" @"@@Ȑ"0~# } ~? "#`0"c |#`, |??@s  "$c$c@rǔ  "@* *+`(+  @  *@ $ |@ ؐ# * "` .`Ȑ  "@~c@y"c  ""Ȗ "`$$cbȀ   "bĀ"""$$c̀ &c "cĐ" @p"@ |"@Jc `/ @* `% `   ` 0`0 4`4 `  `  (`(`? 8@sZ` @?` ?`?` ?`(?`0?`8?`@?`H?`P?`X??@A, 2,@ ,name too shortcan't recover suffix .internal error in shorten_name㿘@s" `  @~#Xa*?^ 2,@s#h, | "cc@)?  !P!P,? ,? ,? ,? ?,@ /  L `%@?L 2 L ```  `* ,@``@ . 2L`@$#L` " @ `h%s: %s: cannot %scompress onto itself %s: %s and %s are the same file n%s: %s already exists; do you wish to overwrite (y or n)? not overwritten  ""!% | ?2 W@@ ab     C@@    Ò ' }#@)>  }#⌚a!x#"@  @KQ[#!a@KGQ"`<! }a#Ԧ 7HaА@K3 ~c耢 ?P@hT`  a@K&@gH@ O LH ` Yy b@Kb   @7  } #`@J!@ ǐ "b 㿐` `''@|  <`  1" 2  }#!@JՒ`b " "b"  |@ #%s: time stamp restored 㿘"`% | |#  "` & !ah@J @Ғ o #b 2  }#!@J`b b "bb 2 @ | @  }Ǣc""@6 !" 2  }#!@Jk`b " "b" @ W%s: %s unreadable ..%s: %s/%s: pathname too long 㻘@& 3 }#c!@J>ǐ :"b/-+.)@(   (@(( #@q @q  # }@ M  /,@ @@ E 0 #Ԓ#0a@J  &b@* Ѥ @'㿘 ! @q  ` `"@m $ `!"Ā "! }@mz$"! }#䀢 "! |@mr$#! |# "! }@mj$#! }# "! |@mb$#! |# "! }@mZ$#! }#؀ @mR$#@pϐ㿘"Ѐ` @o` |@5ː# 㿐 | |"## |DŽ  #c"`"77 (# #c *  # #c* |c   `  |#c  *@    $c+  $c2` * $c#@ #``* #$c2 *@ $c`#1* @$c@#c2 * `@$c@ @n  o"cА@ ( "@b@c1 *@ $c@c *@ $c@c) ~ +  }@## *@ &#@L  c@%`c# *$c2 *@ $c 1*@$c@f c2 * `@$c@[c#@ Ж``* $c2 *@ $c`!* @$c@@c2 * `@$c@5c## *$c2 *@ $c# 1*@$c@ c2 * `@$c@ c#@ #``* #$c2 *@ $c`#!* @$c@#c2 * `@$c@`  @%`㿘 |c@n!?  @~ ~c o""cbad pack level㿘? @#( }c@ o"c @o> Ȓa . ```! o@ | } }$# #c "@   ~@ 6@ ~# | } |"c@"㜒 o`"# o o "c $#a"# # o@#!#܀  |#c$cؔ  *  "؁㿘 | | | }bȸ㔲 & |@ a0` } }c!ذ] X @S  `M ` &~ @6'@` @/'@` @('@` @!'@` @@'@` @'@` @ '@` @"ɲ`'@"@  |   ( 2㿘! o | "@"@  ??) o?":) o |c! @mR | } }@"̔"#ؒ"@$# ̚@  @3@3@` }#ؒc     2 2   @#܀  |c ~ c€  %#ܐ $㿘 o# | "c - |5 }#/ o+ |; }9@cc @ؒ@ `*  cؐ * @ @*%2  | 2@#@ b    8 ? |#?@" # oc" $%# |# } |c؂#㜰? o@㜰? ؐ *`@ @*`  #ؕ*3@  2c c@%  %ؒ@ `*  %c c@E #c %#$c̀`c  c @" c&! oc܀   !#܀  oc̀ |#@   @" 㿘 o# ` A o#- |`5 }; o3 |9@) |7 |#c#cؒ@ `*   }cؐ * @ @ @*'c2  | 2@%#  o##@ #@ b # c@ 8 ` #㌐" 8 #H@ F "@@# }`#ؒ"@  | |㼤 o1@ |#$%#㜔 #ؐ *`@ @*`  !#ؕ*3@ ?2 ##` $# 7 ̀`c  # @" #(%̀c  @h ̀`c  # @" #%# $# $# `?$#$c! oc܀   c!#܀ c F# |#  @, ̀ |#@   @" 㿘 s"Z | } { {"c"""Ԁ "Ȅ!` v w!Ƞ      +  #@ "ȱ(+@ ?` ȔȄ!Ԓ*  w"<    v * +  $ @ ȱ**@ ?  *"; Ȅ! w"< * v + "?,  `@ ?ȱ(!*@?  $ s#l 2? 62 r s!ڔcl  .   3 2 ! s#l r`aژ .  2@  3`!! s#l r`aژ .  2@! 3`! r s#l r`aژ .  2@! 3` r!@&! s"X  6`@ђ 6@  `@ o#t060 rt060 sІH060  {(Ő#2$ { {  { {  { { (ĝ㿘 s v.`.`5 v +.(`@./`@/ *  .  ..#.  c.`  .`.` 'c.` 㿐  s #l '   ' 2? 62 v  sc*@ * @"<;2  s#l9 {7 { s- c@,`@* @ `$22@ 4 . @   @7@ $@* @@@`c"Ȁ@ '"Ȑ @`Y@̒@&̨ "< sH s#l-. ` l?. `"?.   ?2 *   2  2 & s#l/ s. @`?% {?-  `* @  " @ @`&Ȓ@$4 `2?. x s #l  ** 0  ` ` ` *` *4 @2 6 㿘` v@ v` "=   "`?"5 s v  @ "2`*#+@  `  *2 - {+ { s vȚ#b̦`   * @   "@ "@ ?* 4@ ,  "  %b% 2  :   &`? 4 s v#`/ v- v* %$ , * $*$ @ +`@ % ,4@ @ @ @` -@+`@, 2 @ 2`$h  Ӥ*`"&>㿘 ?      .`<`;0 sа ``@"-@.6 .6@ 6@` 4HD6D6H        Ͱ 㿘 ?      @P s"д`*`  @@` ` s"Ш,`@32$ `@ ,` @%@ `@@"`B@  4 `H`D@`F@  @`J@      @    @*`㿘" oR#" rM "Ȗ"  s "Д *`   {?  " * `"?"Ȕ *@   #"ȁ㿘>@Ȓ @Œ @’   o s"b  *@ @ &  o#X? r Tblock vanished㿘 { {b w  |c"* ?#@2@[ȨJ"ȦF" { {b { Ȑ "Ԕ 2 2@ #"Ԕ`@   @k ! {"Г,` ? $"А@ 0' @Y  r s!@bX {bР @M "`  {` o r#@` {bР bȐ  "b"@"А $""б6 㿘 }# {b *   "b o#.`  {`92  v"  oa*` ? 2  v r 䀦  *`> ! @* ` > ! *`@ { }b`#0 *2 { { "Ĕ #b +"Ě b"* `+b { { w "Đ"* ` "+b+""`$"/2"" |# } rȤ`" !Գ+   @]U`@? " {b2 6`4@  "#@  {"  㿘 {" `  N  vȺbȸ!` w vaȬ# waԮ"< } w"   }#䀌 @ ,`  @r* {@* @j`" }@c$@ }#-` * 2 `` 2 ! * @ @P@`" {@I$@ {b §4$@A$-l used on binary file o   *   @   o*     2 o*   @ | `?2 { { { 0܀?"b ~ 㿘 {b "=  {! |#. @ # ܀2 | `㈚*@$#㈑2 *@ $## | `c%*@$#@ [#2 c* `@$#@ P" " . 2`:@4 %" {ܓ.  2#b 0`* 2 㿘 {" 2! |## { | c*@$#c2 *@ $#.  { # |c%* $#@ #2 c* `@$#@4܀ ' { |# |c *  #c@4%"㿘M |c#@  |`* $#6`* `$#  |#`*@ #$#@#6`*@ $#@## 8*  $#2`*  $#8 *@ #$#@#6* $#@5 |# |!c *@ &@ %s: %s: not a valid zip file %s: %s: first entry not deflated or stored -- use unzip %s: %s: encrypted file -- use unzip 㿘 ~ }c |#"c }**@  ` #ܐ #c**  @ * @#P@ "  }#  }%`Xǀ` ""` }#  }`x    "`dȑ2  Ȓ " "  }#  }`!@>ǐ "b out of memoryinvalid compressed data--format violatedlen %ld, siz %ld invalid compressed data--length mismatchinternal error, invalid methodinvalid compressed data--crc errorinvalid compressed data--length error%s: %s has more than one entry--rest ignored %s: %s has more than one entry -- unchanged 㿈 | "#"` @O c   5  }# ` `*  `@ `( `( `+  ` ` +`*  "`@   @Y"Hq7 |7 |o9 } @Q"Xk b`a  }c   *` @ ( ( *  d@ +`*@  # # ` `( `+  ` * !b@= @" ?7 |9 }3 ~' }! |% |# c܀# &c@ #* `@$#@ ?@ @"7 |9 } &  ! ~% }# }#܀c $#@ .@  #* +`(*@ (쀢 ,㈰ ! ~% }# }#܀c $#@ .@  #* +`(*@  + *`  @W @ @"#Ā @# D ~# }cܐ = }#Ґ@ #P * * @@  *` 2-%"`"`  }#  }!c@@<b 2% "b }#  }cp!@<ǐ "b%&  %&     'H\'L'P'T'X????????'*`  " H  X "4"@ `   , `" *`@   ,``"8 " *,  @   /`,`@ @  @  '' "@`  ,  *`#`" H`@*  '?'h ɬ / '@H.*`'].  |?!` '+@` " @" `@*8 +@''?@_*   @h # X##" 'X h""  //'&4@, ""4'/  c/L    /7LT" * @ /" P* 74@ *  ?, * ""   *@ @" @4 @2@ *@? @  $*.? @ L 0- x'#\.ɐؘ  Қ  !@7c(#!0&    0 㿘 | |#c  % ~) }' }#܀@` *@@ $@ *@  `?& 4`% ~) }' }#܀@` *@@ $@ *@   `4`?%c %    㿐 | | | "#""c 1 |&# "#8 "&#   ~? ""c@ 㿘 }# " "a ' }) ~?c% }@#cĐ#  @\$cĀ $#܀?c܀?  @v%# Ɇ?`ɖ 0(# 8 | } ~ ~ }"# "c ā"㿘 } " #"a"' |# }% #c$ @\h@ ` #ܐ $##܀  ~ ?@+ ~# ~#ܖ  c###c @㿘! |#  ` |@$ }# "$#㿘! |#`# |cb  } `#@ c }##@ "#$#㿘@@&@[?J L@`  *J2 㿘@ / 2 㿘 .@  @"` _J@ ."*@@ out of memoryargc<=0㿘@@Z4  _ @\@ @9 )@N .N   @ÒN 2@@Y{9  $@@5֐  2@@5 @&@ @, @$` %@$ N `" $@$` $ %s: %s: %s 㿘 }# }aȖ@5!%s: %s: warning: %s%s 㿘"`  }# }!b@5b  "b %s: %s: unexpected end of file 㿘 }c!b@5j "a  }@\#0 }b@5\㿘 }#b@5P! |@F#%2ld.%1ld%%㿘`1  @4 . "* * @R#@R ?`&@& - -* &@ ?`&@&  * &@!#` @R @Bǐ@4㿘@X` I output in compress .Z format not supported 㿘   "!@4ג`Ȁ""  %s: %s: warning, unknown flags 0x%x %s: %s: compressed with %d bits, can only handle %d bits corrupt input.corrupt input. Use zcat to recover some data.㿀 ~c  }Ǡ"'D 'H }# @ $cՐ $b `ʐ "`"`  }# }!a@@4|b ǐ "b  , '耣 " }# }ah!@4b "b] c ' }* ܐ!'`''?' !! }cؔ!@[A  |  c*?c }ܛ<"    } } *   }"#܀ ?  }D@ @Y ?' } ~ "@  }"#` }@A+ }ܒ"@*` }cؔ!@Z !*?@A’$!? ''' }c*  " 쀥 * ?@A$b?'䀢' *@ ?' * ?' }<   * *` :  a |*' ! }  }#?#"@b ǀ   |H* }cĐ"c"`!,   } |# , , # |c ?',c " @ ,?5+ |## }`&4 c@YQ 2  HccĐ$cĨ c"@ &  |㈒@Y2耥6  }c |㼓-2 *2` }    |#H }cĐ"cİ 㿘 |! |*@ 2! %! |! % ~3 }/ }  & *@c܀ 4 $ &! ?"$! $a !! "a2@  5a%!㿘 | "@> 㿘 | | |2!"a " Bad table В  *2@   @ *`   2  7    # * @3@`  ؐ!  "   & :2 ( 3@  ,`  *#@ +2 ,`:@  *  * 6 "  *@@?@5`*     :*1* 6#1 3*  }@  ؑ+`2@ 22`* * @+ 21@*@㿘B  =   {"* &* {#!2? 620>,' {- | * 2 ` 2   2`@`` -@  ? "*   { {"* &* { 㿘    | c*`ac }#c /20R@@' | {#) |!2 * @  { | }! c@ ,   @ 2bt @ ㈀        ?  |c?*`@?*@`@!a  } |c*`ac }! 㿘 {c  r  &#-!  &    ? |! }*`3 #*  |!&# }3 #ؖ @@ ,   !2c @㿘 |! {*2c* @  { }#ؕ2 @ .    3 b @ ? *@@㿘 {"#㿘 | |"!"a㿘 |?  "# {@.@   :"? "r!  | ,"a8?.@ 0#$a&c? ! {$"耢" @.@    "? "0΁㿘 | "#"` |a  1 |!#" a#a # invalid compressed data -- Huffman code > 32 bitstoo many leaves in Huffman tree㿘 | "! ) ~1 }/ |9 |' }  * ##܀@` %# p %@##܀$ }# @ %#_ $$ m#$   |" ' }##܀ %#D $ $@ aL#H$"*   " $  |"( 3 |,  `&a(+ }##܀ c %# `-$, $"* `" |$  | | | |(* :` " " @?!$ 4  c(   |  ` |*#`@ *????*@#` *c*@c@invalid compressed data--length error㿐 | "#&"` |!$ |` |" *`  |' *  | ?##h"dh#`@ |% |d# ~) }' }! |d* c#܀@` $c  #h%@#`  $#h |h#`d" 2@ |# @ `#@33 |" 5 |h, `@ - |d% ~) }' }# |d* #܀@` $ I ch%@ $ch |h.`d"2@ @ h | |a$@.`( | | !(   |c*  "c\ |h""hU |!  }cĀ " J J  J(8  J   |cx( (@   |@"@"`@ *@c|`#x"* (@  ##x@"@"`@ *@`#x* (@  #c|@"@"`@ *@POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c 㿘 ʨ'D"` - |  | |"#|"cx%p% N - + | "ct |"#t @R"؀  |"#t"#tp  |J  |ct -  | ||#x@    #|(#| 2#cxDD "  *@J`-2J  $#| D@%*`@ @ b耢    |  |c| x  % cx Dcx#|@D #cxD$#|%  D * |#x |c|2% e?@J`-ctJ ct V?"`% Q A   -`?`%p * @J`-2pJ  -`pp L@   L@  =2`  p@ $@ 2pq$@Ȁ2    `  *`@ !@@-bpP p @%p% d % L@ ) `G"` `*?J`- @!@,c p@!Jc@@,p p@%p #D ʑ*@" %  ` *@@!@,Ēcppp@%pN :  :pp @%p'`  "@ ` * @J`-pJ %p ` * @J`- @!p@,c  @!Jc@,p #ؒ`%p% \ p @`. :%ppJ `  %  :2J` `@!c@,V" 7 :23. J` :J  '"  ʐ "`%  D* `@!`@,-" N`:   :@" % %p. > 㿘   㿘 㿘@2HLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %sinvalid file mode: %s%s: %s%sfts_read`@ `@V `8 J  o`?#`J  g`?"J  m`?# J? f'Ѐ`??"''''ܢ   )%'; "?'59 00*  D@€ +  (  %  "'ܒ 'ؔ 'ࠀ @*?J`-JJ  $@@&?ǐ?&*  @@܀  Ԁ```@w 2   2@' @?А   @m'aa``@ J`"'`@wY ^ @^Ȁ `@wL  8O'耢 2 @ ?А  'a@S a "'aa a@` J`"'a@w# ( @_ 'a@w   @@ : `@@ . `@*@'@@'@@'̒`@o   @% * ? ;* @€܀ ࠐ@qٔ ࠀ +0w  @֠a  @Lࠀ h    @ò @:0Z Wࠀ TԀ Q   <D "D <D "D < D@{ 83 ࠀ    <@^* 2 4@{ ؀`" ࠀ  Ԁ  @z̀  0 @{`̀  ؀  @!( @p 2q 4a a0@ @Q-uvvvvv0vHvvvHvvtvtr4rrrr@rrrrLrrXrrrrrr|rrrrrrrrrrrrrrdr|rprrrrrrr|rrr|r|r|r|rr|r|%s: invalid user name㿐L ?@ " @ ?a(@+ J`a@u %s: invalid group name㿐L ?@k̐ " @ה ?a(@ J`a@uŐ usage: %s [-R [-H | -L | -P]] %s file ... modeflagsusage: %s [-R [-H | -L | -P]] [-f] [-h] %s file ... [owner][:group]group㿘    ` 8a"X""@)M 0  `8!b"" @): @PI 㿘@usage: chroot newroot [command] .%sSHELL/bin/sh-i㿘@ !@)c@P" @zS` @z-#耢 `c@n ` " @``c@c @M#  @( c@R 㿘@ #lost+found㿘 # X*` @@ `" `  " `@  $  $ " `@*@@      P *@   PJ 2    "   Pwrong type to dirscan %d 㽘L0`"$@a"   B 6+ B+ 3` @; 2* @ * <  `4@D@   = b<8 $ @= "(  @N[$(@  @   @NH", - @ 2  4      DIRECTORY CORRUPTED㿘  (4@D  @P a8  4  4  (/  6+ @}@ 2$  `c@+ @," `@6 "@. . .  ,  ~B?< W$   4  Q   M I @ $   @ b !=< 9   3  /@/ *  ! # ""   <b$ `<  c@+ @˒`@ 6  ,`   x@"". `*41 2. 2 `)  `` 4  `   `J@/`  &J@J@`?㿘@%s NAME=%s %s=%s DIRFILE㻐 @N#@  @#@*h` #x@  #@,0@Ȑ@& <  c # #Ȑ @0 #@UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED) ADJUST㿘 @.`T >`   @ E!`@B 0? ! `<  2  ##"0@Ր @ ,`T : !"@@A  c(  6 ! @6#!@ !@0!c( 2  !@%!  "@4 㾐 (@Me , /`  `   ?   " 67 4   $  X`4  " , ,  ,  ,@L\ 㿘 (   ,@    X `$ " , ,  UNREF %s (RECONNECTED) RECONNECTNO lost+found DIRECTORYCREATE (CREATED) SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY..DIR I=%u CONNECTED. PARENT WAS I=%u `  ???????@<  `?!`# # #@ߐ @ c(     " #( 2 !!@$#Ȁ  ߰ @:# ` G @Q !)c"0  ''/'@ !-$@##( 2!@$Ր# !"4 @   $"0@Ȑ   #( !@# @h #( $ @# "S @ < @@ 2"@d @"@$ ` "4 @Ր  $"' p"0@u  " p@# 8bct /'ġ,'`*`G:`ct@2@  PJ " @, 0N@"@b   " @ "@ 80;#t.  `?32 " @0 @A@  @L4 "ct*  `2 @ "@l!ct.`  2 #(   @`# `  ? !??Ȓc`@ϒ  @'@"@ @  NO SPACE LEFT IN %s (EXPANDED) EXPAND㽘  `@ P ` 4հ -`(@     @ɰ @& 8 2° `+`$$` 0 ; B<``  0h: @$h`` P*@ :`   @  `0  <D @L@ @ @1  2r.` "@I`@"0  c.` @I"` `0 #ʐb8@I۔  "`0    , .``   `P*@:`     `0  <D @L@ @ @ސ   2.` b8@I ##@ #(`"##@,#0 @"#@  @,  .` $$   0 :`@ c <0h:` " $h@&8㿘 @֐  X`""P"h&` &@@ ``4@ ( 3@IP ``4@ #ʐb8@IB b`4 @  . @4   3  #t  @2& `P @? @ @`P *`PJ@   #t.  ,2@ @  2@ @  @i4 㿘@ @\2 @ʐ㿘 #x` @?  ?$, @/ 0?,@?ܒ  #,㿘! #  ?"@"$# DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS @ 2&@&`$ <>` ('7  e( :`Ӗ ` ̀`x h ư @3` %b> @ ! @"c` x @Ho`0?  ;`; @@Ъ @ Y p 9%5%/%2  <@ :@L@ B 8T @ @ &`  8&`@`&N`0 20``&-``@%s !@@@!| 2 `@` 0@><: > @ @|"c`` &``@ o &`@   8 &` p 05%*` * :  @ :`c /%@  &`@6 "&N`0 2`@% @@!%Ḩ O  `t @%;  d Ѫ` PARTIALLY TRUNCATED INODE I=%u㷐M`0  `@ 2`0"$`@`  !    0@!` 0` : t@<`?   `t @ە; 8 2   `t@"  %b: @a @"c`qF@B@ `1"@**  `t6%* @@ 1&  " `!@@%' " $- * c\@!:49% `%`@e "M`0 2`@$J %a@@ R!`"`f *  ?%blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > sblock.fs_fpg %d 㿘 "耦q@n   `@>o@=B``@==, ` 8@=4@=., @K  d`E#'`@=@=, ` @% #'``@=  @=,  `! @<@   d`#' `a@< @<,  `@  '`!0@  bad inode number %d to ginode 㿘  #x  '#@@  )    `x 3%   @=2@< @=+ * @<  @@ @-5@= x  ` `T* @ ?"@ 30$T`x@= @<%`  x@-T * bad inode number %d to nextinode 㿘 #, ` "#, #x ) ( @#l E # ``'  @<$̒@J   P *   0` ;  B`B #c ` c(  d`u7 `/!h @ n/c(  </@e!x 2` 4  ;`a<`h4@`0`? ;`@  E@ ;  `-  d`=7 /! @}6/ 2`@@((o7  "`>`` 8 872`h`;2`h - "Ē` ?d# `(```* @ " /@ {! d` ` /, `!@6R` @=`($`h e(`:` `` `7 `h `B*2@  7      (`t@3?   4`( /, ` d "/@!/  , 􀤠    (`t@4   `X /, ` d "/@͐!/  , @< |   ct"`. 3T``@:  2 /@ -"/@h"0 2 //"@@ ڒbH"""""P`` @P  *@͒  *@ "5 * "`" `?" <c``$`p$`t4`B4`  " "`&`*` 4`$@3R:` &`$`h //"P@ ( //@T"0@" j`$" h0/"@ ÒP /*@!` PU*@ c@< BADEXCESSIVE BAD BLKS I=%u (SKIPPING) DUPEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.㿘    %1 b8 `  "` 1@ "@ #(`/1@"X @"0  //"@@ bH `$) ' +/-///5171 t   n    ":`K *$:@ `2  #$  %#$ * @ +  Uhcഒ ` $ @ 9p #(`1@db0 G @@ ؒH@9m  2  1@ "@Tb0 7 @@ ȒH h`"  h"#"@ ""@h@ `   h@@ h`2@h@2 $`2 h $  & $` phase 1b, inode %d/%d㿘   (!2`Ġ!,@2:@`   ??2 '/ ?????2`,ː!   "`"p +  `@6+ )  %`2   P'J@  ʒ ` @  `,&&"pDUP㿘  3 3   2 `-  ) +2   h c $ " $ h h 2  h @ Ң`phase 2, directory %d/%d㿘   3`Ȑ@Yphase 2, parent directory %d/%d㿘   3`Ȑ@DPROOT INODE UNALLOCATEDALLOCATE%sCANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODEDIRECTORY TOO SHORTDIRECTORY %s: LENGTH %d NOT MULTIPLE OF %d (ADJUSTED) ADJUSTMISSING '..'..BAD INODE NUMBER FOR '..' P `?* : `f 4#|*` €3@  3@  33 @ R`В !퀢 "S 3@ I 3@  3@ɐ! 3G   !퀢 "> 3@ 4 @! 26 33 @ *`3@ o!03@! 3(   ߔ!퀢 " 3@  @!P 33 @ `  o@ 2    P3J@ !X  X` P * b *! # #X7c@= c #X*`  53 ?̓:``?  " /' p?????耤c#̬8@533313  `R%̀`a 죒x"$ @7aP 1     @: ( % @  !@ "# c( 3@]! c(! >`$ 3@!Ѐ   l    :   @:7@  $  ?H @9h ' '̤*#X3 p&pJ%̬)3'3# 13/3  9%  "6  1?/   !F$ @ǐ!P $   ct*` ?2  4@!P  ct*  3  * ?3    $ *j&pL$Ψ$.BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED) BAD TYPE VALUEBAD STATE %d FOR INODE I=%d㶀 " ` (  #x  "  @ , $   (!4#@h 2#    4 Ec 3$@ؐ!P "`  X`"` $  [4 1c 3O, 4)c  X `' // /#7  3a@* 4#@f2 $ 6,`5@\ ( $ 7 @8?37 @88 $ `& $ #t*  ?2 @934@v!P "` $ 4F    X`' //3!  !/ $7 /   ?  w "74 $  & $ #t* ?2 @8ސ4 @ﴐ 2X U%   Q5 ꍒ`P 3,@ !P "F`E 4c@  3  ꊔ5 h@˒?   3 |5@ ?%  3%  o7 @73@!P "` $ & $`  #t*` ?2  "` `  $L .2`2L  5`+3$@!P "`` .2 5`& $ cx  5 >  X`!  2    2  5   3$,@!P "`  P @ * : ` 7"*` € $ 5  (5@e! $ `PJ `2 5!8#(`z 5!@ ̒ 5@L!o < P @ @  *  #t *`2     & $ $  @ @55!Xh@ #(`"55@S!  $@ !/ $ X % X ! " J @ 5  p"3!P @, "` #t*` ?2 *5!@V:`` $` XX@$$"@phase 3, directory %d/%d㿘   7c@ȁ㿘 # X*` 7ː"  L"p1  А &  >? )  PJ `6cX PJ@ 0?  - / J@ 2  #  T `   PJ ` $  = t*`$ $   P?2 -*@cX &pphase 4, inode %d/%d㿘   8c@8UNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%d`    88? ?   /'#bp@????V?  P "`' * : `?8"Г*` €` #t,`R ` ѐ5`"ؘ`02"`"  @3&#"8`А  8`C  @ 288`8` `*8 :`@G@ $pHT|㿘  `B ' +    4    b:  J* $:@`$   2 & @2$ `  :"* $  * *+ c$%c$`Ġphase 5, cg %d/%d㿘   9`@YDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATEXPANDCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d CG %d: BAD MAGIC NUMBER BAD STATE %d FOR INODE I=%ldFREE BLK COUNT(S) WRONG IN SUPERBLKBLK(S) MISSING IN BIT MAPSSUMMARY INFORMATION BAD?b  " ` ` P?*cH ࠒ @5 ?c#4"຀5`X $ ! #( 9@ P#( 2 %$9@ ې p "X%$  ,`"bX $  9   9  $ %$P@**  ณ, @,: ତ@@*ג|@+ , $:`0@*ǣ*`@+, , :`@!  #(! 9 @OH%$#( 9@ y ?#( 9 @>P@**  ณ,@: ଢ@ @*|@+ , $:`@*@*`@+, , :`@@L %   * "L? " o9?༘#<? Tc8@#""@ , @"U%c?P4:`" !W%P%`Tഡ,  %`XP@*?഑* %`\ฐ`,`: %``$` @*/@+V| , ``:`  @*$@+K| , ``:@ %`h$ * @%`l@*|`@+6* , :`%`d@`\"U`d%``T?"@ c8?" @#<#@ "L@;   @4_@?0" "?c @#@  p  *@"@  8?`8  ??$8   6,    :b*% +@ * , 9" `""p   "` @)" @).  ࠒ @ w`@"U@ " cԀ 9!@༒@)$@4`%` %`,?2@5`5`&%`$ $%`8@* %`p%`%`$%`%` `(`@6%`(%`(`,`@6%`,%`,U``0@6%`0%`0`@"U@%`4%`8%`<%`@%`D%`H%`L%`P`T`T@?#8 @3L2@"U%cฒ@)/?c$?ؚ@c(?#@`@, "@@" `P @* : `)=#*` €` %`` ? %`  `@"U@:@`\@   ? % *@  *( ณ*9!(:`@,ศ Ĭ%@"U    ` :`b@`\@   ? %*@*`  ? %` ɨ @"U8 4 @"U   :`J *`" : 28 `:`c@``@   ? "+@@* 8ז8e ``%`@(t|@)`@-T@`T@ `"|@(`@@)@(X@(T@@@(N@P@(H@)o* `- Ԑ@ `X@@(8*  2$`$>88@)T &``l:`@8@)K &` ?"@  *@ &,$`$ %`$ `:`c@``@  8 " ?% ::@ `4@ 8=$ 4 `l`p@`h @@      $4*@   #@  *   `p 瀈  ?$4*@  #@ ?c(@@?`$#$@ '` @ '` @ '` 'pl> *` . *@B 9aH@@   `$``$ `  $ `$$ * b @0 |`@"U@b`\@`@"U@b`\@ @ 9ap@ǐx @`"U@b`\@`@"U@"`\bԒ@ @0Ŕ ⠐ *`?#<@ 9`@"U@`T`T@`@"U@`T`T@?c8 @@@ (9a@ "?<@0`@"U@`T`T@`@"U@`T`T@?#8 @0| b *`?c,@,@&LLˀ?"p?4%P??#0c @@@  9@@BaH   = =--+ |ppp|  ˁˁ㿘'H'L'P'T'X!@ H@13 %s: %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. 㿘  !` =@#@ !` >@ !`  8>@ @0 㿘'H'L'P'T'X ͔H㿘'H'L'P'T'X H%s (%s)㿘 "a!>@!Hݒ㿘 'H'L'P'T'XH@0Ő 8@}m / @ݒ <  L  r @͐ /r㿘@}Q / 1  ,@ʽ />b,@՟ @՜0 /Can't stat root Can't stat %s %s is not a character device x>""a @  >@"0M8@  @>"@>'< @@#L@! %!@g؀  f>@Ȑ"!  >@"@ `gâ @TҐ `2 malloc failed㿘@,k ?``@|g realloc failed㿘@, ?`@|V strdup failed㿘@0 ?`@|G RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsCan't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE) cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d clean = %d %sile system is clean; not checking f** F** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED) IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKFIXINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%qd IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%qx IN SUPERBLOCKINCORRECT QFMASK=%qx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATBAD SUMMARY INFORMATION%scannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead  J"  ?*#d"\ @G   "a!?@H"h@ <   ?"?@T" "  @/   "`` "a!?@&"@  c(  ?"@x J ` (@   &c\(?`&c\?"?@b"( # ?@["#  !  "`"#p`0? $`$ , $ ,`$`@*$ @*  $````?q"@ "" (  "c|"@  I  b 4 ( 21 ``@0 "* ?@Ր# # \@@"LH@",@ 8 ,$@T "`\@@??????#\#@cX㠘#@c @ (p   d` @J@ې P  `р(@` `@ @ S հ?( 2@J    $1  ,5 "b @"  0 *@ *` t  :` :"x  @l<` @ E   `@ @@M `2 " ,   <`c@ @@;   "`<, ` `$@ @@! ( ` "`@@a!H( 2 0@@ 耢 20* ,`   @ @*@@Ґ!X ( "@@>!H(   @@ 耢 2 0* ,  `0`H @ ! `0( "`H@@!H(   @@ѐ! 2 0* ,  `4`L @ ! `4( "`L@@!H(   @@! 2 0* ,  , $H0204"0@!ؒ a ( `:%0@@ΐ!H(   @@! 2 0* ,  %(`<@C"( < `"(@@!H(   @@e! 2 0* ,   H8%8: @ %< "#%8@ "0   H8  (:;%8@@!H(   @@8! 2 0* ,   L8%@: @ %D # %@@ "X   L8  (:;%@@@U!H(   @@ !   0* ,   & X8  ::8 L8  ::@& X 2 e,.( 2 @@@"  3 " ` " ",` <:%0` "(`H8  ; 88`0 L8: ;%@*`+` ] eLY0( 2 @@@"   y" ` " "L` "P`#\"eT`%`"X`P@ Ɛ*  , @,: @@ `@! | , %$:` *@   ` |@!ϓ*@ , :`@0 L%@  $ * (0L`  "`  `@*`hc\@   9  7@/?3@5?``0"4@Ր - b"@ "@ @ b 8  d* ``@ `2 @ ⠀  c0` 0  Ш  "萂`,`:   ? @  "b@#8@C0M#x @  "`P#x@ #`#x @   "b#x@#@)`03#x @{    "ct#x@`#@*`0$  `#   "b" @d$c! $#Xc@_ #X `"#c@#@*`0@9 0@~  MAGIC NUMBER WRONGNCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEsuperblock mismatches offset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATE㿘-    #| :` @    ``@ 2 !$$ \F!T@Dc0, 4DcH`Dc`@g  `,`@^?` &`hDϒcx! DȒc#|@L`d`4 @ o-@ $#|@ k`$  0 , @8 ,  @0*@  @ h@ @  2  |@"e "% ` " # # # # ""b *` *` *` *` X"`X <"`< "` @"`@ \"`\"@(`b"cT"#T @(V` $\@(Pd\`d" d`" `" eP"%PeH"%H8:8@;%@H"%H0:0@W h $  d`+DD@~# h ?%D@ $ @~:`  `c@  *#d %s: BAD SUPER BLOCK: %s 㿘  #(`" F!F @~|F %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) 㿘 @}?"  ? # L   F! @ `L ``*: :@ ``F!Hː!*` ?! e %h@(z  &4 &8 &&$`0&`,&`8&@z`(&|``4@q8? @l @8?&`&?<``* &@"* &|?@8?@@Ȓ&@’@&$@?@&,`&d <`` &d`(  "#|ioctl (GCINFO): %s %s: can't read disk label 㿘 !e`e@&۔ 6  "  a!G@8 !G ɒbad file type 0%o 㿘< @@"%  (@" 4 0@" 0 @  d@    d`" G@}a  INTERNAL ERROR: GOT TO reply()CONTINUE %s? no %s? yes %s? [yn] 㿘 #(`GG!xGa@uG`?@}2!   J `G #\` G@}!!V J#0`2 G   J `G@}!D  'G@}@M``$`@ថ  $ *`P  ` "P` 2# <  P`? "`@တ 2` <  y Y n N̒@|ѐ!<  y Y cannot allocate buffer pool 㿘  ` 0 "c @#"T 2`G# " ?" " " * c8$ "c8 0@($  /G ?ːТ`$ $ $" $ $8, $ @6#8@#T @#P`0  8`#8" deadlocked buffer pool 㿘 #8#8 %   (`d.  " 2 c8` c8  2 c8H!@c8  $" "$ c8$c8"`$c8  $ 㿘  (`d .@  c\@! h `"h` @b& & & WRITING %sZERO'ED BLOCK %d TO DISK PARTIALLY 㿘N` C`  #|H` @HH""`p``.`` @&`  @$ ` @  ' `,"  8@Ɛ   0"@ d \* @` 0 @ @ CANNOT %s: BLK %dProgram terminated 㿘 #(`2HG@{!H#&Ga! I֐ UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) 㿘 #\`  @$``0   ` J#d`&) #| :`:  @ @ ! #(`! I   #|: @v $\ ,7! "\2 @"+5  #8 + `) 3 @"8\`@"`@" \8 @"%# I"@H  %`T  `р`d #(`II   ؀ " ` * \*``d  #h ,`c* !I @* @z۔@$/`@$-\SEEKREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,㿘 #| >:`@| @$ 6I# I@#IW #@$j 6I#ؒ @$I@z# : ) 9I/I"Đ@#"Ā * <` D @ :C  @$A |"Ā `@N"@t|@p@zU# @h@zN "Ģ@@Ͳ@G@zE!WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:㿘 _ #| >:`@ @# 6I#g J@#J  <"cpX!@#ޖ 6JI#LJ@y! $G' +I|@"| @ < D @ :C  @# #|@@yܐc#|@G@yԐ!㿘 o5 `8j 1 " 6c  8 R    ` b8H('> 2: 6 @``8(H@&@> @6 #$  > b.  @/@.@#$"#$8  "8 &  `?Z/?..`@ ˀ2blK !!bl     P  ``  K !!. M.   ?? $l/'?????#@ .#'̠)̐#\''Ȑ '7'ג "@#[$@@"y / @ ,@Ȁ)#Ka'''ٸ )$l ?,@|@"V" 㿘 "`j @#S returning to single-user after filesystem check 㿘K@x͐#x  "b @! 㿘@/ސ  @!  @! %s (SALVAGED) SALVAGEUNKNOWN INODESC FIX MODE %d 㿘 '   !L#N 0 LԼ    #(` LL@x  & B   & & (/dev/tty: x"p'€$ !L!@  "t'@" 'ܐ La '''@"'Ga '' @!H@!㿘8̄/  (-.`˔x✀  ': ) @@2 8&/@/8 /`/ 8܀ ffs_isblock㿘 8>L0#  L@ `?>@ *  @ *  *@  `?>@ *` @ `?"ffs_clrblock㿘 8 >  L0 L.@>@ *` @ *` * * .@ >@+ * .@R#ffs_setblock㿘 8 >  M0 M .@>@ * @ * * @ .@ >@+  .@# Hffs_isfreeblock㿘 8 ">  M0 M@`?>@*` @*` *   `?>@>   !㿘@㿘 -H $` H c@ "c@`` `   "c@.``H`2`" H @@LH`@@    @ `?  @ "?`^H (&: `@*` @"'@`@*@'@ <@@:C@?`@*@940 )&: `@*`  @"'@`@*@'@ <@s@:@?`@*@   *H n&: `@*` @"'@`@*@'@ <@A@X@?`@*@0N0JH D@"`> ` @2&`@@    @ `?  @ "?`"`*0" *㿐@ '@ @&!̀ 2'@'@ #Hfwrite@$?# #N @LÖ c8@l  @r֖ 㿘cL @ `b ?   G+ #Dc @ +  * `@:6#D` `2  " @ 퀠#@``  `2  " K#`ő+ L $ + #@ *`@  "`"@ ` c@@`" ` ` @) # $  2#H` #?("6 ` *`2   6*2 ` @@ 0#` x#L c* * ' ' '''' "    `2  8 ܀  " ؀@ " "  `2 8 ؚ `  @;@ 0.  "  ` ` `.    ` @* @ . "   * @.   exponent out of bounds㿘  ?      ! "  `2 - 0   0* .   0*  ϐ   * ` / 9 "7` @ /  9@*`"7` ``~ @P.@rC  `=4 = `` " `@"  `<*# `     #@ `*  ," )#А   @ " @7* 02 0"    ` .  * 0  " @  # @ 0+  *@ ̂< # ҆ R *# .   Є?*"c""    * * ``  c< @6c<  ਔ " (* `@" c<`  ਔ `" + `*㿐!@`'T 6.``-̓.`@ !ȓ*`@@Ä@&`?` ?"!%%!? aȑ*  ' -̮ *a' @* @*` !$p + `p``? "`@׹ @  "@?, !̀  !@* @*` !  .% ` ` @ *` * @āpp @o ! @3`p2! @lpp @oؔ "!! `&T% + `p``? "`@[ @  "@?,$ `p  @@oK`p??%?@o !"@`%!.` aȑ*    @`p r%slast character not record delimiterfcloseline too long: ignoring %s...㿘?#@@'La   !  t@'  t%Ḓ' @ .  * a);R5R !  %!! @!!L@*`h?@ R@Ӓ؀  %!!R* @@h ! $!@@!!`? "`@־ @  "@ ,,@#<:  7`@ !@    %"`t+?2.hR@p ̐#<  ,@"66@7!? a@h %!%@o "66 line too long: ignoring %.100s...㿘!Ȧ` @ $Ȓ`'n %̀ .  !ȕ* Sa " x$$\?Ā  !!@6S?*`@ R@5`؀  $!R* @`@h_ !S a $!"x  x# ` Ĕ| ?? "@  '* 2 $Ȁ ? `@ֲĀ? Ra@h- $ē. @ !ȓ*`" R*`<`@oi# 㿘J̀  ' "?*̒c$ &@?#%%̑*`<:  < 3#̀2 &` ?,@"5? ? & @վ  &c< ? & @ծ  &2,R?  @o  #? , $&`fwrite㿘@G˒  Sc0@g 㿘 `" @G  Sc0@g 㿘.  * aȸ?@  @m 2@$@?'   N@mR?$@$ Za@9 #@`2D?@#̀ "bZa@9 D .`@ *`!m@ j!Ȩ #8UTX@:&4 D"  "/Z1Z- @ $!(@`   P\#ז@<@  - * @ P\@&  :`*` * &`&: " DS#'P'D SP @0 ?#)",` '@2 #    `@W ' 'ƀ?逤``@ך`9 #?' c2 "'Rƀ?2 .`@`2 @     `㿘5 @:   '̐2  : , `@֒` H "?H  `@` 5 .@+@ $&@ %4` H  `@` &?H   .%*@ @ $found disorder: %sfound non-uniqueness: %s㿐#@` ?@w#̀ "bZa@8= !@l#̀`""Za@81 c@#?  c @ "#  ` ̀`"   """" '? @ 0'$'@. $ H[*  c @7  `2 \*  ` @7 '? @ ֒@ 㿘 `*@H`` "@``@@  @@ *"@ 2` /var/tmp/cannot allocate memoryTMPDIRbcdfik:mHno:rR:t:T:uy:multiple field delimitersrecord/field delimiter clashmultiple record delimiterstoo many input files for -c option-otoo many input files for -m option-ignoring extra "%s" in file list%s1%sstdout/dev/%sXXXXXXXXXXwcannot link %s: output left in %s(@ۺ'DcP   @*  "c ' ///   P $@  \b@7# ! "! @  ,  ,  <"D#c@ D-, @  \@"袒 "#d! ";9#\/''' :_* @€ `$ ϒ       `Ȁ  $ m$k!* P:`@ /` %P@5 $\b@6 *"@ *`@*`@ *`" *  :  $!1DDcD \@'c    `! * * %cDK  * K *D\c(@] < \@ cH!J &<   * * !"d  'cH  / /'"@ D@˔bk*  D @D\ch@6N Dሐ *@\@㐀  D*`?'DD*`  " !p@\c@6) ሀ 6/̢#X+\. \@Ǿ @ǸX 2 \@dD ' $@/  Dc@]2 D ڠ   (` "c@1$`)* P:  2 %P@ T $\b@5ِ *"@ *`@*`@ *`" *  :  \ c$ M$ ?$y $ D  *̐cX "%ሲ "`@c@ R8R̀'K   b]]`@՞ l@ g]@  ^ '   'Є    '' "''''''"'ܐ@  " \c@\ "_b]' @f@8 ,`@82 @Ռ? 8@: a?]@( _\ c@\k @䄐  .   @ . @.  ] (@  \c@\E 'D#\"S#t? @'D"? @@ \c@\! @ː@9\ ]`0@\ @Ծ@ wwwwwwwwwwwwwwwwwwww@wwwwwwwwwwwwwwwuwuwuwwuwv(wwuv wwuwvwwwww̝㿘@@u 㿘 Jb b@t usage: %s [-T dir] [-o output] [-cmubdfinrH] [-t char] [-R char] [-k keydef] ... [files] 㿘 "\@b# 8_!@5c@D %s%s%s/sort.XXXXXXXXXX%sw+㾐!#d_#@#d J?/"__##_cЖ @V?'@ @{ 6__c@[g @c谒 _c@[^ @ @ 㿘@0init: %s init: already running initinitial setsid() failed: %mrootsetlogin() failed: %msfunrecognized flag '-%c'ignoring excess argumentsX@f@[@  !#`!`@ @禒@ @  " ``!@皒a@ !  @{ @7 6``@ѐ!(`@)+!H ``@Ȑ!P` s `b"< "`H͐ "`D!p@`h@?逥 f!"a`@!a! @Q   a#\#`#d"D    @D f  "  @< g"4 @7      #\#l;p#x ';`#h#|    @C  @ ǐ   ?''' @ Ɛ  @  @  @  @   H@ 㿀  ?''L'P'T'X'H'`L?`' '' @   ?`? #####` "   ( ("#㿘 'H'L'P'T'X@yzH@z@w 㿘'H'L'P'T'X @yjH@z㿘'H'L'P'T'X @y\H@z㿘 L `" L@ fatal signal: %s㿘!a@"0ڐ@= @7cannot get kernel security level: %s㿈   ?'  @  ?  "!!a@"x?cannot change kernel security level from %d to %d: %s㿐'DD  ?   D@ | ?  "D!a!@p#㿘㿘  @# acؐ@# can't open %s: %mcan't get %s for controlling terminal: %m㿘@6Z@ @; ?b /@  @#?b 0%@  /bin/sh-sh/dev/consolePATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restarting㷈bb Ц ?' 6 @Y )bs ' @  'bb' `@8- @Wʐ!b!8''@W@ @  %b!`? @E  ?@1b$H (͐?@E ?@?  "! b%!   bj!Ȑ@  ?H H 萊   bbV!@ǐ @  "O1b"<͒ 1c" D!sh/etc/rcautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode~rebootp@Y 5?  ?ؐ ''' @ T  @ P b  D1cc  '耢'c  '' @ / !b В@Vc  @ 7 ?cbc `͔? @E  ?@) \1b@E ?@? "! cbc `C1bԐ  cbc!`@  ?Ԑ?Ԑ     Hg!@?'@50cbc̐!@: 21bcca"D!a@!1e!"<session database close: %ssession database open: %s㿘1 # "  @   "!!d@. 8C    @  &#   "!!d@ X0 insert %d: %s㿈  D# '''' 'D  D " !da@! delete %d: %s㿐  # ''    " !d!@ڠ!㿀 D# '' 'D  @  㿘@ d 2  @* #͐@5`P $   `P@5 . $  㿘@   " @@   @@ @%s%s/dev/㿘 ' -  )@ , @ 0 , &@ & @ ddcPX@& @%    & ( "#& $& $$ (%s %scan't parse getty for port %scan't parse window for port %s㿘` @@`@ `@ @@X $``e@@ƒ`8f`  $``e$ @`@m $``  ` @a@`K$`  $` `e  ``@R $` 㿘%     " ( (K 2 $  1b"<`Y 2@! @#.1f#hcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %m㿐@V? e "80' @  @2k 6 e"h @T@ e@" @  can't fork for getty on port %s: %m01getty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %m㿈@ ` `? @2?w?@Vy? `e^#Pk? g@@  @?0Z@O 1`  R$`  O$` ")`@` @!? "!   2 ecx@u @@  ec@m @@@} ` $ 4 `e`#@p ` B@h ' @K `@T @`e@#`@ T 㿘# c 4 /j   @ ڐ $  $` ("`($c (` $"`$0P?2$ g d"`H@ $  h   g "g dg H H㿘!$ H    #@ & a ( "1  2 (?2& g d$ H 1͒ @AȔ ?" H H ? Hport %s changed utmp index from %d to %d㿘' 㸀 D  ?&  ( 2 0;  ( 2 @ǒ` 2 (  & g  8"& "     ?& ѐ e  @   @& 0y@ @!Q # "1f `2 (`&  @t  ( 2 1f#h  f  (2 f#h    shutdowncan't exec %s for %s %s: %msome processes would not die; ps axl advised㿀 #       @1$  ( 2 g"Pca!@ےc @ ?"> @T?8 *  ? ''' @  @ b2  @Ր !b c `@Rg"`[@ؐ @@ʔ 䀊   :  2g  g"D,  @ې??#  "! "$c@/* ? @@ ?"cac  "! ? "!    $gg."@0K1b"< 㿘 #` c`  "` `(`2` cga!bP@Lذ h .  @??!  "! ""1b$#@.ސ ? @@^ ?"##  "! ? "!   $hg"1b"<㿘@ (   @*`2 ,-o %s: option not supported㿘@Ő  @Rܒ 1'h n L  o  @  = 2*`"@Ȑ 2  h @2    &*@&b@+x  @1x 2L@Ȑupdateasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotamfsinsane maxpartitions value %dNT:Ua:b:c:d:e:f:i:m:o:s:NOS:UT:a:b:c:d:e:f:i:k:l:m:n:o:p:qr:s:t:u:x:z:%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: bad rotational layout count spacetime%s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad total tracksffs%s: bad sectors/track%s: bad spare sectors per cylindernewfs_%s%s/newfs_%s/sbin/usr/sbin%s not foundswap%sr%s/dev/%s%s%s: %s%s: getmntinfo: %s%s is mounted on %s%s: unknown disk type%s: %s: not a character-special device %s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %d%s: no default #tracks%s: no default #sectors/track%s: no default sector sizeWarning: changing optimization to space because minfree is less than %d%% %s (%d) %s (%lu) Warning: calculated sectors per cylinderdisagrees with disk labelmfs:%d`@Si8@`8     ""p"a"h@ i @@ h i `i '` `''''ܖP! "; 9' 75 - ''''@?-? ;%n* (@€  "a  "@x! 'a|i!@!  "a  "@w!̀ "Xi!@k@w!/'"Di!@`񀤠@w!̀ "bHi!@Tᴐ $@w!̀ "\i!@F ׀@w! "i!@:@ˀ@w! &@i!@/p@w! "ai!@#@w!̀ "<i!@@w! "i!@ @w!̀ "L ci!@@wt!̀ "`i!@ h  ͒!5lui!@ i "Tg"bP!@s i"P\""T@Ȑb(Y@w@!̀ R"4i!@hM H"bp@w0! B"Hi!@=@w$! 7&i!@2@w! +"i!@&!i@/ 2 @w! %i!@@v!̀  "8i!@t@t!*`@ &  h&  @b ah 2@`@ *i@ $i(@X$!i#8%iH$@M@NciP$@C@NYiȒc`@O]  ah %icp@  Ԓ @ݔ! $ " @. ''77''/7?''''7@O /   i!xicx@@?2 ic@ ጀ N?@ޒ    "ia@נ@В@   i "@!i#@ic@7  ? %  ri @(  ,  @G `@B  i㰔T@찆?!' ah   "@(! s i@#l@}  ' "ia@v@o@耢   "i@gc@`<    h 2 @i8#@W@@Ғ ?"jJ?`` ?܀@`L `j@@6 @ @L `*: :@ 2 ` j@ 8@M@ ` j@ `@M@ @&@    ah  HjM@ @@ H   H "H."H ᄀ  0 "j@@   a|, %j@@ې a|  ( 'a|j@@ϐ!b= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increasedFilesystem must have at least %d sectors Warning: inode blocks/cyl group (%d) >= data blocks (%d) in last cylinder group. This implies %d sector(s) cannot be allocated. Warning: %d sector(s) in last cylinder unallocated cg summary malloc failed %s: %d sectors in %d %s of %d tracks, %d sectors cylinders %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) super-block backups (for fsck -b #) at: %d, %s/'D'H@    '"a@ @ "ap@ @ "a@ @ "alp@QԐ#X@G @ ah "B @'a@ @I ?2p@#p@- @5 ? @": @  @ j  | @ a ?@@  "a  |@@ S "a@  !  "bX""T?"e,"e(  <"%("%, !` `Ӑ *` ! p#x@Qi @ܐ |@   `!  p@QW#@ʐ p#@QN @ "D"@ 0  4p#@Q@@   p#@Q6 @ a|   q @Q+ @  q P@Q"@  q @Q@  ; ;`8 8 H L888@  P =   "`P 4  " T =   "`T0"`T:   "8  =   "`` 8  q 0 4  @Pڗ:@M "`  0|22 4$%P$ t@$ x$ |`| "`d =   "`dhbd4?@̐8?@ǐ@&@?@@|&@& ?@@?&  &?=  * "`@* "  0 *` * ?: ;%0 `t:`@3<  e0@B?#@k 0 *  "0= X-`*`"X@@"`8`*` "``"8 4 02  8q@O!q@O|!(@ * `: |* # |# 8# `# 4 %P@Y*   ,`@,: @ @L@r | , :`%$ 0 *@<  ` |@a*@ , :`@ !|@+@' @L"?`x @E@$`)q `8  @ "`0=` @,* ?`x@&@x@ q `@O!@ ` 0 8::$ `$ 0$ 8@ @$ P@ڣ,`*  @`,`: @@@ | , %$:` 0@ *@  ` |@*@ , :`@ @`0* ""`0`@ @ǐ"`x?@@$` `0@﹑,`x?@ﴐ@r` 8 0@﨑* ?`x@@vx!q!@o"`0 @* ?`x@@`x@ @Nl``  q@Nc!q!@N_` q@NX!q!@NT ! `! 0bD qq"@NCb(! 4b@ qq"H@N8bp@ "H @["   q"` q"q"Ȑ @N ?@0@a`$  H`@ @"`x?@@$`0 @* x?@ @ !" @$@"x?@@ʒ $ %P@*   ,`@,: @ @@ | , :`%$ 0 *@  ` |@ɓ*@ , :`@ @ a ! 22 : :` 1#! ePἀC`" @r$`@"`x?@@h$` `@b*  `, @,: @`@U@{ | , %$:` 0Ф *@E  ` |@j*@ , :`8`  @2 |@X$ @+ `@e, q@M4"@ q#@M,@ bH0 !`q@M#@ `` `@  q@M#P `"qq@M#x@M#q@L#a`@m P@*  , @,: @@Ԑ@ | , %$:`@ *@  ` |@*@ , :`@L@  $ d|<$$@쫐@ђ@$ఠ@쟐 $ఖ ' 4 q@L#@ ! D"<ehL @ ! L  h XX@xP* #X @r | `@헓* %P  eh`#\%`$%X$%T%``"%X"%T |`਑* * r  rrrr`#\ H@LR p"cXD LX "h *! %P .#\?!L?, TP@* 2%P cXܠ@8 |@@%@@3@@@@(@&@@!P@@`,L?= .#\ T@ΐ* R?eL?2eXe`@@* ,eL?2eXe`@@L?,.#\ TP@룠*  ",L?2T.#\ P@돠* 2`8@쩒@ܸ$, $, x ` @욓:  @ $  ,8 ? 4  @d``@]- `` @V$&)`,#r`@M@G-  @@@f8$8@a@KFr r@K? @ ?@'`$`"@ e @``@, @ $Q2`!r8!8* @|@ @K@ %rh@`'`@, ` @`8$@@ @J!r|!@ڐ@J ,$ , @   "@$ `@`@| $`$`d`$* #! h  %r!`d`|@ꮑ:@ꨐ?`$"@@J ,# p%D*  0  L2  # #  # l  =   "`p @ "bLr@J"0@ "\"LFX ! HT <$%\$ @$ <$ X@$ \bP, $ D$ $"$ $ $ $ *  *`@" h`0"|!r$@L"Pr"H#\@JS`$"`4`r`"`,` &#`&$" HH?'#\@J5bp r@J."@  , 7 1r5r3r/@p`2%`@@. ``d , @G#@I @Ic@?`,p 2 r@I# !` !h @S @e  |@$ h@=` `T`=``0"`d *  bL @&`0` &`T `,D@```@鐒. ` h`d@,`,D *  4" ;* !h `2@ @@Ӑ @ѐ @ϐ r@#Panic: cylinder group too big 㿘 ! @Q $4@H.@@ ༒@9$@5 $4?@R @ "L! .@ࠒ !p@@!p"U$ $ $ ,?2@L4 4 &p4 $ $`@)8$ p p$T`,  $XeP@`* $\``,`: $`e$``@`@ | , `:` '$d@`@ | , `:`p ?$h`h` $`h%$ * @$`l @ `|@*@ , :`$`dpdࠐ" ${@H! @. %  '" @"U  p: ` "`\@@  ? $+@*p ?"  ')  0'   @ḓ,  "l0 2  !@f```@a. ` `d`0,@!`8! x ` @x: Ԁ @"U@j`8p`"``cؒ@@le$ p   l;  +  $  * * p``$`@ |@A * `"`T`T@@ `" |@ @@ @)@ @@5@3@ @.@%P@ p* "X@@ * p Ԓ@@@א@ @%P* @@@ 2@`8`("`(p (" 8 @$ ( 1$@*4  "  8@ "@@'@"U ``p: ` "``@@ `` ? %@+@*p`$@ "$`8@"U@`8p`"``cؒ@@e$ p   l;  +  $  * * p``$`@P |@w * `"`T`T@@ `" |@< @v @_@4 @0@k@i@* @d@%%P@L p* "X@@@* p Ԓ@@@ @3 @%P* @@@ 2@!`86/p&*`4 @ U"    !p: ` "``@@   ? %(@*!p $  "$%$ 7p l hp `       %$4+    #  ( @ `p瀈  %$4+   # p` $`$`̐ $``Đ $` `Ȕ$`'@'` '`$'` @u```@p. `  `d`0@,㿘  !h a"` "`"`#!4a !aȐ `4 Β !͒ "@$aȒ: < ! !a@`4!$(`Le@ :`B *2   $hal`d`4@* @y 㿘  !l "  `` `6` @`?$ @ a, @*` `2` @{"cg 0: bad magic number first cylinder group ran out of space internal error: can't find block in cyl 0 㿘 ! ! d*!p@!p@`"U~+"` 2`~$"ذ ~ ap`!c``@!@8@p !ap 8` &`~#@E 0!@ap"U `> ` @!e$ ap   l: * $  * +* ap ` !?#` L# @ ? "` #` `#  "!@\ |@ ap* @"U@"TT "! |@E @ @h@= @9@t@r@3 @m@.%P@U ap* @"U@"X@!@G* ap Ԓ@@@!@:`@eP* @?2@!`0E`4@* !L`8 "@ " `8`̘#ap@ #`$4 "$`8"@*`   `8 '!@"U , p: `"``@@   ?" +@@*! 8 ! d*@9apfsinit: inode value out of range (%d). 㿘@~@@) !! & l d*@!p!p@"U@" ~@D"@ 6`\?"  ` * @* a d!p@*a "L"?",@t@ !#@D@  @@d @ * @\  @@ @@ x ` d* @,@  0@!@x*  @!0@@i㿘@ getrlimitsetrlimit㿈 !``%% @ @? * "@$` @q @!?@  6@w!"$`*@ 8 " $@ﲐ 㿘    @c@㿘@ݐ @G seek error: %ld rdfsread error: %ld 㿘 !h`   !|@㻐 @@30)| ; @> !  "X  @퐖 6 "X@C#`@ #x@! !@ǔ @C#@#x@ "wtfswrite error: %ld 㿘 !h`  !|@z a@0. !`* | ; @D> !  "T  @J 6 "T@Ck#`@Ő @ې #@i @C] @ @͐ $isblock bad fs_frag %d 㿘 8>># 8 2 8@  `?>@ *  @ *  *@ `?@ *` @ `?!@Ƃa clrblock bad fs_frag %d 㿘 8 >   .@>@ *` @ *` * *.@ >@+ * .@ 8!@Kbsetblock bad fs_frag %d 㿘 8 >    .@>@ * @ * * @.@ >@+  .@ 8!@c`COLUMNS㿐`h @ܔ?   @" 8  @` " P㿘@ -%c %s -%c -- %s 㿘@ ڒ "!% "#!-)/  @Bj``@Bf `@h? ?@B]ሀ@ ! *@BS@ !`@$!@BL@쿐㿘@X            unionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:kernfsFilesystem not supported by kernel㿐@!'#% o  "a@Ha@2@ݔ#? ?a* & @ @#`@   "!`- c@X @8  usage: mount_kernfs [-o options] /kern mount_point 㿘`@ !@ ,-o %s: option not supported㿘@I  @8` 1' n L  o  @ = 2*`"@L 2   @2    &*@&`p@  @8h 2L@L㿘@call completed call aborted call abortedinterruptunknown ACU typecall failedr%s: can't open phone number file unrecognizable host name missing phone number㾐  R#'c' #䀦   #@N@5 c a@ 0(! Ē@Ő @  @"d & @麐  @鷐 @@ܐ!Рc<a  @    $!L"``" @  11! @<cπ "`1"J@ @E Ц#<)!L@ 'J  ,J@ %*@`'  ԟ "b` #䀦   #@Ӑ@z!" @  'J`0! #@b0  #@@b"81"@#<-d+!`'J@@"` J@ v*@ @  L'!`'J@@m" J@ c   'J  , J@ 2*@%  ԟ "b`@c c䀦   #@Z@A @ ! 07b @   '!@^. 2'@=   ca@ 0 `  " @#1 "h@1""call terminated disconnecting...㿘 "``  ca@ ϖ0#2!#`!#< a@ T!N @?#   ca@  `㿘 @_ "d@p 㿘`Ġ  `@   2 v831vadict3000courierhayesventelhourminutesecondLocal file name? %s: cannot creat List command for remote system? 㾘`. ?> "`` * "@8 !!@ $ @@9!# $a!@?0!@ ! @0a@[x[take] usage: from [to] %s: cannot create cat %s;echo 㻘 !"ؒ@ ̔$ *% @[   @>ِ"0$ @m @! 6 @>ʐ#0 $@q@( %d write error lines transferred in 㻐! '#'H'L@@ې a  @"P a8  @絒a #/@Ȕ ! ؒ@穔 ! O ` ` 2  @d  @P"`H@M @vN  aP P д#< '% cؔ @瀒    !`O !P 2/3*`L@:  -O & #*O`  'VN `@>5"@!PH@0"'@>% &!P'!P    H@@> R `  ! @u "@  \@  c  @a@А @LHLocal command? can't establish pipe can't fork! can't execl! 㾈# @ ! M@ @=ѐ#00D@5 @=ɐ#H0<(!@ !  @@@ 0+@ `H@扐 cx @恒 @! 0@4 @ @  @@=#X@ 㿘  "aT @\ r%s: cannot open 㿘`. ?> "`` * "@l #x!@ @$ @@`耢 2! @=N0 #< L@ T!~  @Yc؁ timed out at eol chars transferred in 㿐 a'H@\   `"T@   @   a8  @9a)9 ; N% *`@<: N # @   @    @ "# from [to] cat>%s stty -echo;cat>%s;stty echo 㻘 !" @ $ 8! "@   @<"(0)"$`@"@`褒  @;0R ` `H@$ `P@$bp timeout error (%s) 㿐 ؒ  /@  Ц#@2- @r@ *@:V! @+  @( 0 @$  @! Тc<a\@1e /  a\@ ` @/@:6!@䩐  can't create %s 㿐 a% @S ЦcР#<  a , @/ !%  ?,!% !  ?,!c<   ?R.`*c<  ?R`*@"c<@"c<   2c*   ?*@ 7 h! #@ڌ@b  Ȱ \d$Ȱ \ { ;'"\#ؔ@  !\ @  㿘! ##ؒ`{@Ӕ @﷐ #ؒ`z@͔ 㿘@k. >   @@Ḓ @Y~{[*?$`'"\pipeecho %s/bin/shfork"Echo" failed read"%s": No match Buffer overflow expanding "%s" 㻈'D`@ D@ 5 @} |DD@$@ + ?  @@ᖐ @ @@ᐐ @ p@-@G  @}!@} @{0J@x b@;$@p@,쀢  '쀢 !@oa0 @}a!) $D! a   D!a0@U 0"*N   ( 1  J  81 *"㿘 N@ "N    send breakget this summaryset variablesuspend tip (local only)suspend tip (local+remote)exit from tipchange directoryconnect program to remote hostpipe local command to remote hostpipe remote fileput file to remote UNIXtake file from remote UNIXsend file to remote hostreceive file from remote hostshellusage: cu telno [-t] [-s speed] [-a acu] [-l line] [-#] cu: unsupported speed %s Bad flag %scu%ldall ports busy link down noneConnect failed 㿘  @75!P@ᨐ   $   "c""' 5+ -/)`J@ -  U"#J a"` s 9J 0Gc0 "  t l$ 0<;  ?45c7??$c3`$ `@U`@ `@Q@` @U`$IJ`?`?$#`" #@%`c ` *?#  ?@`# ` *?@6ɐ!? `!!h@ߘ @ߕ @ߒ @ߏ ! Ġ" @]@K ?@6!@ 2 @6! @ aD@  @< @@E@ @!<"!LT`@@ss " T@6}!@8 @ aD@  @@]㿘   "c"@Q `'Da@@6 \' "#@-x /  @ :"aD P R#`Q @!" @͐  RcА#<* R `  @ "c@ ! #؀  @{  "c #`" #@ RcА#<* R `# '#ؔ@  #` @?  @ޒ @ daD@D '@Ґ  c ?ātip: flock???%s (%s) <%s, %s, %s> %s 㿈Ϣ#H 0R @  @{1#(0&@  @,@@ 2#8@m '@w * cHc@c`#\@#`@cHcH @\Racan't open log file %s. 㿘Р#< @8`@π "cH !@`Hparercfoexesdiprpnoeieelcucmdvat/etc/remoteREMOTEtip: unknown host %s tip: can't open host description file tip: possible reference loop in host description file brfsdu%s: missing device spec %s: missing phone number %s: missing acu type hdraecbenbsctbvbnvtantrwdctip.record  dlclet㿐@܌!@ !J /@%Ґ !8!8!0"`"`!8@& 6@# c  N /?$c@  ? c     ##"22c$  $v"c??0!aH@"0 !@a`0!@a@( Т `- + % ' ) /3 5 7 9 ; @ 2 @(~  `Ā  @)a?$$a@)#?T$%#T  4a@%p :@ 42 T!a@˔@ڐ  T cԀ ""cT  #`2 T!a@@ T  #Ȁ`2 !b@@޲ 0@%5 :Uc@  2#c #Ԁ`  T " 4@@c 24@ 4@ "cb8@% : ѐ "`(b@@%  : ѐ "`bH@% : А "cHbP@$ : "#HbX@$ : ѐ "`hb`@$ : ѐ "`xbh@$۔ : ѐ "`bp@$є : " bx@$Ȕ : ѐ "`b@$ : " b@$ : ѐ "a0@$ : ѐ "a(b@$ :   R#Вc<*`  "@ c "&cЀ  "& #`@ z  #`@ s  #`@ l  #`@ e b@(q耢?"&b@(i#܀?"'#b@(ac? 'cHOSTtip: no host specified 㿘!D`1 @Ő! !@a@ݬ , !D#` $!D"# #  @G , 2*#  "c&#  #  &# "##cuusage: tip [-v] [-speed] [system-name] tip: must be interactive tip: %s, unknown option tip: phone number too long (max = %d bytes) tip%ldall ports busy link down PHONES/etc/phoneseventip: bad baud rate %ld %s [EOT] fcntlConnected connected 㿈@٢ @  @"a @)"cx @)"a "a@@@b   ! $!Ln7 9; !@b@ @֐  !@b@ -' +/ 5 7 9(; % ! `J@ -  J 0 9 n vH  $H!  $!@P$Đ@Ȓb? ޲``*`L @ `2$!@ܝ ( !c@ @ܾ @ `J@ 2*@ "c@@ !!h@ @ @ @ Ð ?@2#H@ܒ 2 @2#X @waD@܈  @8  m@@َ#h &#p&@@k#Т#<@`   `@1#@ @PaD@a Rc @Ԑ  % @1ސ#@ @;aD@L T @@R ?@w%#@fؔ ?@F ?a@w#@[a@ӂ   !\"`   a% *`  *`!     : ( $ % $\ $"` """ """"`"`"`"` "`"`"`$"`"`(" "( *`"$*`*`*`*`@T*` @Xc% @U8 `@Q % L`c%@1n@)6 "a@@@א 㿘@ @aD aX aX `@ډ @Ɛ 㿘!  ,  @a $ ,㿘!  ,  @a$ ,㿘 @a @a㿘 \ @ 㿘  @  %s㿈 'H"#|''Lc@ ' @ '"p@1  @ߐ 0 "H3`P:  H*L'LH 'H ? & @`P  &`P2*`H*@ٸ @ٵ  c|  H@  㿘 @٣   "|@0Ő#  0@䮒 %c㿐Р#  %*L@ 2  ! 2  @:`@/p @ L 2L*>  cؔ @쀠  `" J@ @* 8(8`  `" J@ @   J  n r t fEb㿘N (2  ^ ? \KPP/`  `? HH? .@ `@2 .@.@.@ `.@.@`Nְ.@(* 8``   ^(((` @ ?*(((((((%c %2s%-2s %c %s 㿘. :`@/>!Jà %aШ#<' %#  "M oᘀ 2 M oĠaВ@/&N    * @/ N 2 h# c@ؒ@-@. RcИ#<? * @ Rc ' @'Ȕ  >/Ԓ S! :w''Ԁ'/'cؔ@ɒ J H/H/Lost carrier.write㿘 !`   X ?  @*@׺   "!`2Ր#@t#noneoddzeroone%s: unknown parity value 㿘А#<" `""" " ``@Ɛ    ;"a"!`h@    ! `p@  `x@  c@  !!`@@͟ ϖ Xc @  * $ @ 㿘 a )  P @ @p & @+"X0  ?.   &  !V @ N  &   . all 㿘c@  ##<`# :D* ?J`- J  *`J  *`@    $7 !7!@5@5!!J o" x d"!0" !0@D@D@Ҕx* @   !@a@,  @ !@a@  @s  2. "a!#!@f:a@@  ?**9@#b''-?@  P`@ɔ  " @f' @Ӕ(@ܐ?  ""b 'bPR`  b@y?'b " 'b k  @ @!  a  ! !     G 2D  " ! & ! ! @ ̀   ̀  @    "@@   "@ "P@g ?2  " 'b 'b  "b "2  L @J` 2 ",@ `80,@`@ L @J`   ",@@   L @J`  @@PO ,@؀ b(@ @"@0@*0`; ?"`` * $@Zx @v*   L @J`ߒ "`` ?"`* $@ZW  @Td@ 2@@(H4X㿘 b "  "b @ 6#" " `"  `" P`? "`@yu P  "P?usage: strings [-afo] [-n length] [-t {o,d,x}] [file ... ] 㿘c@!@( 㿘@Lshutdown: NOT super-user -dfhknprshutdown: incompatible switches -f and -n. shutdown: incompatible switches -h and -r. shutdown: switch -p must be used with -h. Shutdown at %.24s. Shutdown NOW! ???forkshutdown: [pid %d] shutdown㿘@v@ X   !@`H@ɐ .. 7/+ # - ' % 5 ) !"9 E* (@€  %cP $c@ %D  $T  $\ &L %#H@@' h?ې?a* & @ @c@  \ x@o@#H  D @c@L  D 2 @ @V@x@@%`@ #h$ "@. @@I`@ "  @$@`퀦 .. `#h# #N? * j @1P 2N@#h 8 ` "X @Tc<@0@ @a "c`  c`@ @  0$ ?@  @ S`a8@ Q @}!@@ @X @*є @HTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT TTT$TT0T<TH㿘 c8!, @U Ҧ ""8 @4" 0 8 @& 8@  @ @@p8@@l!,@& @ `2 @ PATH=/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin%s -n/usr/bin/wallwshutdown: can't find %s: %m*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %d minute%s sSystem going down in 30 seconds System going down IMMEDIATELY 㻈 b0  "b0 "8@*!#$@.Ҕ ""!@̟c 'c@(d 0W ##  #` @Ę"8"X !  @S#< @" ; (@c < < P#@ @`X @` #X #h@  @#h b@ @䨐 @@䤐  @ 㿘 #h@ %s by %s: %shaltreboot System shutdown time has arrived but you'll have to do it yourself /sbin/reboot-l-d-nshutdown: can't exec %s: %m./sbin/halt-p/etc/rc/dev/consolerevokesetsidopen/bin/shsh` #Hb #D`" #!X!#"' ! #`  #h@' @Ɛ @" cT " @"@ #@`H@H / #\ #(c b #P`#0 #8% P  c0#\@ # c@@'^@<D % 4 #L c`#( "\  #8P  c0#p\ #8P  c0P c0 #\@#`c` c@@'#@S#x@_ ?K @?E A #@Ґ?@Vr#@?2@Vj#@ ?2 @V`# @  @@  $@KȒ@ ̔`'̒ @Ґ #cX@3 @ @  @ @> nowTZshutdown: that time is already past. 㿐c@U  "#8@HN +  `L `@#@.Đ* "@*`   "#<"8"#L `L@ `2 : @ِ   ,, , @ L 2L@.#@P@ "9N "DN0s  o dNБ* N * ?` $` @`?@6 d`d$` d@`$@$`N?Г* N @*`@ ϰ `$`` $N@NБ*` N * ?А ?`$`  @N?Г* @N *`В@`$` @N?Г* @N *`В@ `;$`@@S$@! ?$#<@#< "  "8!@dc@s @q/fastbootfastboot file for fsck 㿘#&@! c@ @8/etc/nologin NO LOGINS: System going down at 㿘#cp@H! @ @ @ @ &@X! c@ " @P#<  @c @! #h@@@㿘 #T`@#p@ bad time format.㿘`@$ usage: shutdown [-dfhknpr] shutdowntime [ message ] 㿘`@ؐ!@ 㿘@EweofretensionstatusrewofflrewindofflinefsrfsferaseeomeofdensitybsrbsfblocksizeejectTAPE/dev/rst0f:t:%s: unknown command%s%s: illegal count%s: %sioctl MTIOCGETP@=@@E / `"#`@"@pSaЀ Ӑ "`   @!آ ;!% "!+'95Ҭ  t@@!? fa`*@`&  @ `  `@ `? `@`@@k : $@k :,@@` `@/ `  @@ '@`%`@B @o 2    "ఀ @j@   6  "!`  b@ @  4 @`7 @^& ' J` @b@  'ఀ  W@q  '  a@ b0@  @<@Iఐa@q b8@ @;ఀ @@ 76543210WriteProtectMountedSCSI%d: unknown tape drive type %s tape drive, residual=%d ds erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) 㿘R  T`"V@2 V  @ "V  @1" V @,"`? "`਒ * "V@ ΐ"x0@RӐ   "  @  $ 4"  ( ,@  0%s=%o%s=%x㿘  N   @  @ u`sN o ``?"``  <* H$ @R <EN * @:` ` ,?"`` * $ @Rr ,* : %   :?`&  @   * $  @RV* : 4 NN 4N` `?"``  >* $ @R3 >usage: %s [-f] device usage: %s [-f device] command [ count ] 㿘 `  #!@obP0#!@hbh@w 㿘@H@ː ! $#@Q$#cp@Ȑ @) #86 Lost connection to remote host.㿘cP@w shelltcpshell/tcp: unknown servicewho are you?/etc/rmt㿐 ܨ`'#@B;c % c@P @@& $c@E  c @iƒ @  ,@J 2 @ $  @#@   ?"c@ ,'<'$ c?c@Z  c?c@Zݘ $'c  @Z՘ invalid user name: %s㿘N *`:  `L @ `2  _ - @ U   N  O%s %d 㾘!0@{ӐӐ "`ؐ@HcloseC 㿘! ؀ "@8b$ ؁statusS 㿘 ؀` b@'"   c@w`,`7 #I%d %d ioctl㾘`0!@{#8@?㿘 #@@֐@@%s: %sProtocol to remote tape server botched (code "%s").xؠ@M O؀ E F Aؐ@C$#@ O؀ F?" @ߐ@J@ "*@#@ @)ٰ㿐 c @ OOProtocol to remote tape server botched.(rmtgets got "%s").㿘`* :`` ,, ` ! @ j,@ f!Hl㿘@m:pinvalid file mode: %s%s㿘@H a@ @t 8 ! % "'-) p @§ 2b@گ @;!@@@ ?• m* @@`2@@@,` -6 @@ @?` @`J /"*` 4`@@%4  4`@@z  !( @@d?2@@" @ @3/%s: %s8#+-@@L `?,@:  "a  `..`2 @<   /@b?<    /@Z! @? /`, usage: mkdir [-p] [-m mode] dirname ... 㿘a @ǐ!@֐ 㿘@X$OpenBSD: compile.c,v 1.9 1998/09/24 03:00:59 millert Exp $㿘! @"""@; @#  "*` @ j*  $b`*`@ c! $"unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw command%s: %s read commandbranchlabelempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform command㿘 - @<(   b8@  0`` @ ~ L@ ` `` @ ~@ `2`` L@ #"Ր؀ Ґ@  &*  *@$L@"X@f b @   @$ `+ @ ~ L @ ~8L@@ `2`L@ ,2B$` @ ~ L@ `  ` @ ~@ `2`@ P  @$   @ ~ L@ ` "L@` @ ~ @ `2`L@$$+L@ 2 @bh@ n  @,Ma`aL@@" L L  2 L 2 L@b@ S   L@b @ J ` -#@*` €` @ ~ L@ ` 2` @ ~@ `2`2   * * @$` @ ~ L@ ` "$` @ ~@ `2`$L@   $b@ "`"L@ @ ~ L@ ` "L@` @ ~@ `2`L@ ;_ Lb@ʐ آ`"L@ @ ~ L@ ` "L@` @ ~@ `2`L@ \Lc@ `"L@ @ ~ L@ ` "L@` @ ~@ `2`L@ Lc8@ @<f$ !`' @ ~ L @ ~8L@@ `2`L@ #cp@a #@|`$ ?=$& @v!?6$ "a!@Wo#@F +آ`"L@ @ ~ L@ ` "L@` @ ~@ `2`L@ 2cp$c`"L@ @ ~ L@ ` "L@` @ ~@ `2`L@ $ c@N$ ` @ ~8 L @ ~8㸐@ `2`@2$ @ c@א @آ`L@  \c@Ȑ @| @\$ 2`@ @@. "L@ @ ~ L@ ` "L@` @ ~@ `2`L@ ;~$`@ "L@ @ ~ L@ ` "L@` @ ~@ `2`L@ ; d`V`0@k P؁ hl\\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])㿘'D @. `:  h'D \ cp@-  DD] Dc@" DJ Q . : !J [ @JD @D @ #;D \2 JJ [2J.@# \2 JJ2J 'D \2 JJ n2 J .@D``'D \ J \2J.@'D`J".@D @`.@'D`DJ    *@J`^ *@`J] *@`J@ ]=*@ J[(\J . : = \ `*@J` ]*@ "J& `(8]*@ 2J 2Jn*@J` ]*@J]2 "` RE error: %s㷐&  @+ &@@   &@@   !@@(#0@F @ ` *"123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expression㿘   l ,@`$@ @Ѱ c&` "`&`&`@ N =/ : 75/*`:  \$ N@b耢 "N,@N``   @ے`&&` & \2 ,@ ` 2 @ƒ ,@N` $@%h - @k #@Ғ( 2N`H@ more than one number or 'g' in substitute flagsno wfile specifiedbad flag in substitute command: '%c'㷐'D ?&@&` &`&` !%#DD  ~ L@ ` D'D  ~@ `DJ@ g"  p 9 ; 1 j h jJ@dDe  w`^D @>"H [&@ X&` @4"HDD@Tj &@M 'D ! ` ~  L'D  ~8D@ `DJ*'DJ  2 *bx@ @I3"|`&`& @}!? &`  "@Ta@  D J@@bD c'Dtransform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthN  \ap@ ` 2?1ac? T 2%aؐ ~? L@ ` ?  ~?@ `2 ?#@<@@9b@e  @  +@  (+@?O#@`  +@J &@㷐 @ @  ~ L@ ` "J  ~@ `2J `\2 J " J "  +J   # +$(, @@!( @ ,@@unterminated regular expressionexpected context address㿐N 9 \ 06  $ /a( l` 2&@a@ʐ &@ &@ &@@  &`a(@  whitespace after %s㿘L@   L  N  ` 2`.b@ & @E@Oundefined label '%s'㿘. ?* : `##*` € b "b & @k &  b@^ @  2 $$tduplicate label '%s'㿘    `,` ` *`#@ @' 2  @c 2  @  2 @ $$ $ $ $㿘 ` ,`  `,` ` #*` "   2  @c 2 $ 2  unused label '%s'㿘 # *` `'   @ @1`2 `*`$OpenBSD: main.c,v 1.5 1998/06/23 22:40:42 millert Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %s㿘@v +) # ! "' %/5 7;#9 " /8* `@€ %"| !@$b! @    $!@;bp@J @הh?ڐ?b* ` @ @`@ɐ `u@  @@`@ 0@Đ @j@C @f਀ !@QAbД@ @                                    8    D \        tr%s: %s"%s" ..."㿘'` V!  r 0#"% `2`  ""! @!`@Rߒa@ "a " !a@Pנ!H@    "x$` `!ÔP@pҒ   !X!X ` ,  `* `* `* `**    "x"a$`!@@  b  "bN #2Q N  nM  ""I  b!@f:"b$`b   !J`# J  n  "b *b !J  ! @ "$``h@#"*b #b**!b` #!#b`*#!Քstdin㿐 "`?) ' @e`$ ";  ! ĔP`P ""x$Ð a@@R$"x  $"x "a!@P!H@ `? "`@e  @  "@@ "  & c %"`  \%"@R= `@ "! bx!H @O @ @ `ĮP P"# + 31' "@ewb` $b`! $%bx $"x@Qa@  $"x@Oᐖ @!H`? "`@d @  "@@  㿘@& X" " ""@"X㿘@ \" "@" "\$OpenBSD: misc.c,v 1.3 1997/07/25 21:05:41 mickey Exp $%s㿘@   "a!@Of#@> 㿘  @   "a!@OO#@' 㿘# b @ŒH@Ȗ ʠ @$b b sed: %lu: %s: 㿘'L!'P'T'X`L@ސ 4 a    ""x@ђ`a@=Ő@Ȓ`Ѐ @Ԑ $OpenBSD: process.c,v 1.5 1999/06/06 15:42:24 deraadt Exp $%s %s: %s %lu 㿀 ""'  $`/ + @ " ?Ƒ* : `C~ǐ *` €x#  bd  ! **@ ""W*`$"bd*`" * $< " " `I "h`UE < S"`<` N `<@ؔ < `?$ " @'$`; "("(<@Y 2! "( "(ŒaȐ @L "(<`@G  <  <   <@:"( @! @< b  <` `<@Ռ @k<  2$ @ @a< 2 "`   < @l @ <` 2`<@_ <` 2` <@T <`?$$`<`@F  2$` "`  b< b<@2 @@ #  bd  ! **@ ""}*`$"bd *`" * $ $ @x bd$ `}$bd@ l@v"l bl "ro"bl< `2j?< & @v!? $ "a! @M!Ж{ <<@   J "a! @M!Жh ?# b( b(ŒaȐ @Y <<`'`'` '`''b( $b( $< "` "`"`$ "` $ $ $ <` 2`<  @, @!vb  <` `<@Ԃ @a<  2\$ 444$44444444x44444x4 4444444444444444`X44T44 44|Hd44D4X44\%d not defined in the RE㿀  `"< "p <   "ǒa  < @   "P"   @  c- P? -   @x = @   "P @n  `@ޒ@`` `   @ "P@V "P @P  ` $@."P@A )"P`  $ @  @& ?2"P <$@  @% `@  $ @@ "P<   ' " $  <'' "P%"P $  $ " $ " %<"  ''` @_  `"4   20 ` ?2< & @u! ?"`   " !a@K!ЖՐ  <`  @Z<    "  !a@K!Ж  rstdout: %s?c "d  6)+?1 /ȑ, "* @  #d@  @ d@`@M袒 d @  @  @aRdґ,   `@ "!Ȁ a @Ki  ""l%dCOLUMNS\ \ \abfnrtv%03o㿐#t@V#P @$t`h @  < 2$t <$tN g!Ȫ#p)t@#X N L J` \ `?"``  * $ @@ 7 Ȕ?c` \"&  * $ @@ \N@X  "@?M@ " `   * $  @@f @Y# N t `?"``  $* $ @@I $ `?"`  * $ @@;   `@ "!Ȁ a @J first RE may not be emptyRE error: %s㿘,  s@: & \ ? L ` *: ?? $' , :  \2  N \ &2    @   &  &  &,  4& ✣* ? "*?2 ?""  "  "?@* ✔  &  &  &✐@ @ @& ,   @   &  &  &,㿘     & && "&  @ @& * %s: %s㿘?'% "?N  w"!  { s" /"* + ?" @    @I H " ?"& @ "&  @I H& 2N 㿘  `""h  2 y  `"]  2  "( @  ` << `@n  2 _    "` "  U "`"Q  * $  &"h@  ` << `@H  2 9    "` "  / "`"+  @2   "` * &"h $    << `@     "@ `?" 2  `?㿘   "p` ɒbp  ""p J?` "? ""p   ; ; "` @  "p!   "Ր 㿘@iӄx"㿘 Ӣ#x @5cx&allocate bad sizecannot allocate㿘   ː@nb 2   @ ``   :8  2@  `Ȁ`*,`@А  2@ː@nb(Ӑ#x@2@#`#@ &@#@@@" @"@@#` @#` `  #`""`  #` @  allocated object too small㿘ː@nc4 / &`& ""& 2&&`allocation resizing free pointercannot re-allocate㿘  ?`ː@nWb2 < : ?  @ ̐@nE` , @ @@2&`Ӑ#x&$"&̐@n.`H@2&`"`"@$"&` $ $ "`S"` "  ?$` ?` (  2         `$, ?$?$$S??`@ $?` * 8@y@freeing null pointerfreeing memory outside of block (corrupted?)freeing free object㿘 2?̐@mb?  @M0I   *̐@mb  * +`̐@mc  2&`@&?& 2?"?* 2#?@#?#   *   @㿘@2  #x"` "@@&@@vLPrestricted shell - can't cdPWDOLDPWDHOMEno home directory (HOME not set)-no OLDPWDdon't know current directorybad substitutiontoo many argumentsCDPATH%s: bad directory%s - %s%s 㿀 cJ   ! #"   P ?" "@sY`? L"J`* l!@ې! @א!(`@А!0@Ӫc@ 2[ S!8  2 ͒a`@X4 L @Ӫc@ C <!h 8 bJ  0!x@;E '! @"@@ ⨤@@@  `@) @@$⨐@@@@ !@Lt  #$' 'v$' '@`!@/ ' `⨒@u@@u@'  ͐!@L<  "a!@F !@Lx1 @>ʐ J@ @ڔ J@ /  @u 쀤  @u@Ô `@u#쀦`̀  !@L can't get current directory - %s㿘 J## %"   P ?b b@rJ? Lb* `@L!.  "J` @u @D  & ͐ @t)   "a!@E"@K !@L Rnprsu,ne-p: %s-u: %s: %s㿀 J`e3     L - L    L  n e  E`2L  k   f L -b L   \ Φ#6% `63А!<*` €`Φ#) '`%  @M䨒  @K#  ` L`  @L䨒 6 #@Ks @q?ƒ?  `*   @Va`   ?$ *  '  ' '' {`h ?" @k`Z \2Y*L f0  r a"O  b 0".  \ A \B*A \>* c \8*"7  t n \/* v \)*( ( $ "     А  *`: ?Д  А  *`. : @Р? \*L    * 2` *` * T ` "`@I7  "Ф 쀣 "@Ǣ`쀦  `' "@ 6&`@ϐ᐀ 2 @` @ ` @ ==d=d=d=d=d=d=d=d=d=d=d=d=d=d=d=d=d=d<=d=d=d=d=d=d=d=d=d=d=d=d=d=d=d=d=d=d<=d=d=d=d=d=d=d=d<=d<=d<==d=pvpvV%s is a reserved word is an %salias for exported alias %s= is an exported traced undefined (autoload from %s) function is a%s shell builtin special is a tracked %salias for not found%s is *GOK*㿘 J@  w`?  "Т" ! "  v ? V "    "@o?耢 p" *  `2 ?`2Ϯ ΀   ` !  `@@'  ` ! "@@  " @;   `А"(@J/ ?`ѐ#*` €~@J "0z Ѐ`"H"`Ӓ#@J А"p@J@pf _\@I" @I" @I" 2 @I" `@I"@I"<9Ѐ b"Ӓ#@Iѐ + @Iǐ#  Ѐ`#"`Ӓ#@I  @I"( @I#  А#0@IӀ@I#22`- FPEG$FEXE<F㿘L#R#UZ#fi#lprtuxponly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U %s exportreadonly%s[%d]=㿐Jc      r7  s e  " t   "Ѭ# Ѭ#$  "  `"  5`9' Ԑ!*` €" %" % %" %@ " " %  $ % " ` +,- -"@nV?Ȓ?`'@k " `'@k " " ``"* `J`-`+ `J  ` $" ?#@@G#s "* `, ,P @  - "*"* `C `""* `64`"%@@@ʐ@8 ` ! "*" h#X Ҕ   @@Ē  `@ "=`@ Ѐ` `8  @@ "`- +1)̀-- X(`    @ @@H!@ `Lװ 0@G\ 0԰  ϰ @j@ Ģ`"  `` @ "`    "@0"+-5  " U`R`@GÐ H"@G X @G `$@G h @G p@ @G x @ @G @@@G @@G @@G @@G ͐!@G{ ? 07 Ҁ  Ғ @Gj   @Ga -(@G\ - "@@GO  "@GH(@m@GA# "@  2i@ BL5 K<J(J(J(J(J(J(J(J(J(J(J(J(IJ(J(J(J(J(IJ(J(IJ(J(J(J(IJ(J(J(J(J(J(J(J(J(J(J(IJ(J(IJ(J(IJ(J(J(JJ(J J(JJJ(J(J$dprtUxRR-taunaliasalias: -r flag can only be used with -t and without arguments alias %s alias not found 㿈 `   "` ' ''   #Ԁ  - +`9Ր#|*` €  H  '   # ' @la2  * ` " J`-`+2  J      #`?` @Fy"  @kՒ @"ڰ 8@֐`/`;9  =5@ 2"쀢 ' b`@t<#XX`@t8+ `2 @s =0$ * $ @l` @F;`ڤ "5 ) 97  =@L $@@e̔`@~`<`2:`27@ ) $쀢 ' "`@sXX @s+`2`@s =0$` =*@`$`@lP @E#P Ԑ"h@E H'@ܒ`  `$ `" `2(`$ 2"`` $ #@`  " @7  `" @eL#@$ `$ ?$+ $8 @@`$`  2lSS0S0S0S0S0S0S0S0S0S0S0S0S0S0S0S0S0S0S0S0S0S S0S0S0S0S0S0S0S0S0S0S0S0S0S0RS0S0S0S0S0S0S0S0S0S0S0SS0S S0SS0S0S0S,adt㿐 "  ! %"  t ? a" "   H #F "@jh?〢 d"* ` % @~@~ 2  `" $ q@ ?$  2@R    $Yc@ ?$@H 2no arguments㿐   @D<"0  `? @:ٔ   lpnz㿘   % '"  p ? l  z   ?% @j) ?• n* `2 @L 2 @K 2   bgjob control not enabled%%㿘@Oc  cJ` `? # @CȐ#( Ӕ@ib耢 ?b * ` @Jf ` #@J\  J `" %*d %*s %s%*d %*d %s㿐Ԇ ``+  א #\#`@r0  #`#\@rbad signal `%s'--ls:Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %d %s%s%s: arguments must be jobs or process ids%s: %s㿈 ) L -&#   x*    L ` ,%א@  2א!XĒ @NHah # ! # %"  s ?+b"  b@   0b@ip?瀢 lb耦    ,`    גax@q#@B#İ    *԰ d )%@f8  '?  *`" @Cf!  @Caؠ    J#`Ӱ dc '%ב,`@CH``@CA#z  ' `'@  Ԑ `  ' ? @@4'@@4 ?  ט #X̖ @i D  א!X@BZ 0=   6+)L % @H 2& %`@e쀢 @B=a ?  @    "`@N 6 ` "a@; @B#"`,` 2L㿘   J## ``  @h$`$ missing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARG㿐! Ӕ@h"耢 ?" * ` I# B# L  @eJ` ؐ#8@A #`L`2ؒcX@A v  2``?@&  ' *`2@    *`@@ @ؐ#p@A 0N$ @g  `? `   +// /` ?///`?" ؠ#@ {b& " @  `@ 0@ @@  Jc`?    @ ` lm㿘   ! #"  m ? " + "@g>bX?쀢 l"* `2  @ @H = "*@`@ 2   2hR|h5hGh;hHhVHhxchpZhh^ h`ZhX;hP:<h@Hh0Hh XlhC<h[h[hf\bind+fg+bgwhence+unalias=typeset*=readonlypwdprintlet+kill+jobs+getopts+fc*=exportecho+command+cd+aliasHf`?%s: bad numbernothing to shift㿐 ## `Ӕ@fb耢 ?") b*  @7   6 ڒ@@i    +   "   @ " $ $ @@V  Sugorwx%s %#3.3o bad numberaugo=+-rwxugoXsbad mask㿀 ! # S" "@fQa? ?"*  2;@[ * 2 @W,ڞ!a8  =  , *.  .   < " . . .?!@@ ڐ"@@   x* А   * - ВБ:  @N "- "@ * 2 @N8`y +ڀ g  o a" I N u"@NN`@F" 2N" Ib *`@F<` P  ?* : `  ې"D*` €  < <I"N N`@F"( 2 @M<``- `=`+"  N,N-"-N`,  @Fdb "NN 2+N 8ڐ"8@?A - @v2  m4mDmDmDmDmDmDmDmDmDmDmDmDmDmDm mDmDmDmDmDmDmDm,mDmDmmDmDmmDm m@%s: %snot found㿐! Ӕ@e1"耢 ?G"* ` A " @1  "ۀ`"+ +"Л* @  # `#@   `@       @[Ԗ   "a!۠"@8Y@>Ē 㿐! Ӕ@dߒ"耢 ?"  * `  @D  @D `2  " prsu,-p: %s-u: %s: %sREPLY%s%s is read onlyp  'д    # 2+"0' s ?) p b) u" "b @@WԨ b  L   @?Ԩ 6 bԐ @>K' b@di`؀?ʀ rb* `ܐ ?&@>  (@h@E? ?  ,@S ܐ!@> !  '#  ' ''ܶ  '#  '' '   x9 쀤}? #`x#` ``$`  $`@k"` @(`$  @z @ $@ ؐ?$@^'ئ,?$@^  M" 2 @ܐ - @T<  `@T & # ,Ѐ \    * @` 쀤2 `   2  ,  2`   2,쀤 " , ?* @  2?,@$ O#@iܐ!@=\ 08    @ @   @i&  K @h  , T ` "`@<9䀤 @> 8`?㿘! Ӕ@c@"耢 ?  # @R`" * " J`  #X "`l @Z trap -- %s bad signal %s㿘! Ӕ@c"耢 ?"C *   Ԡ `%1 " @=0@c  @=}#@ ) @yU    @<Ð#H `"L@ -2L` "    @y:  "?@z 2 㿐! Ӕ@bÒ"耢 ? = "*  @_ڒ    " lڒ`@-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$[]missing ]-tx !\a<l'''' 'ؤ,`2@DTb ,, @DKb @9"h f ,  ''܀Zؤ V  #+€  ꀤ#  €   @ ؀`ʀ0ܐ?'܀  M `@Cb "'  @ `?`?€  "'ܤ'@3㿘` !N  N@ *`: N`2`@C’ 2 `@  `?怢 `N@ 2N` internal error: unknown opȀ  `##Г*` €-N%NN !`? 2@Yv '4'4 #J '4`?@  @ @ @@Z@ T <  D @w H < 8 @k < < , @_ 0 <   @S $ <  @Z  < ( @;   < 0 @/   (@&   $@   "@ @  Ȁ 4߰ ̀ ذ  @[4 '4 $ 4@'44@   # @ @  @@ `? @Z @B: @Z 1@B3@B2 @B  $ 00@.  ,@-    r$`-#*` €0, d`?0, ^@ 0,@Y W 0 ,̀@0,@M K 0,@F D @Y > @Y8 X@44 @Y8 , @Y X@  @Y  @Yy8 8@<  `? (  (\@p(<P@pTX @t@㿘@Y68` #耢`@Y*  <   I  ?  ` @/D0@/@unexpected operator/operand㿘@   €  2     `?㿘@ 2   €     㿘@ "   €     @ 㿘   €  `?@%missing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operator㿘 2m  €   2_  €  2X P  €    2  </   2  + €    2  (  2     @@? XPH@8)(!-a-o㿘   ``? `   !$*` @@`?   $ 1 ` "㿘%s: %s%s㿘 .`   ` &@5"`0"h@5 XtHf0c dslmnpprocessesnofiles(descriptors)memory(kbytes)lockedmem(kbytes)stack(kbytes)data(kbytes)coredump(blocks)file(blocks)time(cpu-seconds)ulimit: %ctoo many argumentsunlimitedinvalid limit: %s%-20s unlimited %ld exceeds allowable limitbad limit: %s㿀 J""`    /  H-b S*Ж a*`  * * f"  a ?' H" " @Zwb?퀢 S"Ъ"` "L2  `p@4s  *  @ 4   @4% 0 @?O` 2!#?@*  䀢   x*` 2 @4  @}ސ : 5bЀ vb#-+' 2 @"耍  2@42 2@4` : @Q @4wؤ 2G  *@ 2?耍 2? @  "! ! @-7 @3"  2 #2 2@47   : @Q @4, ذ 㿘Ԡ#? "#" """ ""a@q ! <c "c  @"b@  *b؁   COLUMNSLINES㿐 Ԁ 4  X b."`@h`h %   "c!В   @} "@{  !ؒ   @}q @{㿘 "Ԁ`@r  cJ` J` @Ē J` @?@Y 㿐 "`  @N @p- @J   @Zޒ  "!` ?㿘 @^#㿘 #`2@a 0"* "㿘N  #   ?*:  @` N$  *@`$  N P "Ѐ~ v"" c`# '`(b`! '`'`'`'`'` '`$'' b' ' ' ' ''c` ۖ w$b "'ݚ & & & ܔ & & '///@wL/L"b 2 ?$bL"  L"ؐ?& L" L"ؐ?& L"  L"ؐ?& L"  L"ؐ?& L"  ?& @K   @A0`  @wcJ   J 2JJ- + 8`(8  J            `?J `2"@ 㿘@ / 2 ; cȢ ,`,  @   @S~ 0``,`2JD #    " J# * `J `? 񀠠"'   J "  &J ?  #J 2 * *  #*  "㿈g @ a  @@5  @ ,`@  @,$`@M,`` % @  J?`/2 `*`'' @' $< , w, @''',`@@"`@' $< , \, @'''" '4 2 @&| #`fileglob: substitute error( @31  @   5 N@ \@ 2.@  .@   N@  \.@   T@E`"" & T@>ސ !& Tch@0 U  t` ''' `8$ @< $< , , @'''"@`'"@ ٔ    . `2  @; @R J`2@) h` "&&㿘 @@`@;  `"@FPATH㿈`ذ @# @| c=`c ` ''' `@. @) @$|c    @ L   "@A@v!@wӐ#@3":   &c` Ac. * ௒`    $@@ $`2 @: "$`$`` ?ᴐ@7>   c,  &@  cᶒ`*@4@UC?  @:  .&@cᙒ` ,`@.. &@ @' c$< , ̔, @'''"@`'c"@ ༔&;|&()㿘 &'y  x@ \  *` *:  ' "24J  x 2   6 J ` "   *` *:  ' "怢 \ 5$  L @ `    `2  N @6! ` `N / N /2`?'&㿐\`u '    "#@  `$  $@$'@*+?@!㿘` A  #`@N.N '%L \2LL  "L `*`[`?`$"LL  (2L@5`  L /"  L  \L  N ~ *`.@*`㿘 $ @@ @*` @`@K@J    K@ K @" @*`㿘 # , @ " c9` , c1`㿘`@_" (NN / ?N /"?N /2?N /2& *&㿐@h @Qj @` c`$< , 6, @&`&`&@c@N`@"@`&@@hА # 㿈@   c  ' ރ'' '耦m@4ǒ : @@@ `-" @N @ 2 @,  @`,@   /,  " @M@ݔ $@H< ": 6 ,",@ @ ,@  $@ @c@Z`?`,&M@`MIFS\$(){}*&;|<>"'\㿘 @t"@u  ) ' ƀ( ƀ &@? @`N@46" N@40 ƀ 〦`?`ƀHL00h<hpDh`0P H8(@D4,x0hXLHD80̬ ̄XʤdΌ,xtp `PH0T(Ldcommentset-argupcase-worddowncase-wordcapitalize-wordexpand-filecomplete-listyankexchange-point-and-markversiontranspose-charsstuff-resetstuffset-mark-commandsearch-historysearch-character-backwardsearch-character-forwardprev-hist-wordup-historyno-opnewline-and-nextdown-historynewlineforward-wordforward-charend-of-linebackward-wordbeginning-of-linebackward-charyank-popprefix-2prefix-1quotelist-filelist-commandkill-regionkill-to-eolauto-insertmacro-stringgoto-historyerroreot-or-deletelisteotend-of-historyredrawkill-linedelete-word-forwarddelete-char-forwarddelete-word-backwarddelete-char-backwardcompletecomplete-filecomplete-commandbeginning-of-historyaborthb fd'(! ! %"#)< >g  0y7#- 1= ?2*?* /.&.&_606162636465666768695U5u4L4l3C3c[O%A"BCD㿐      ""b"#b#""".1  \#Ԕ%     !     "c$ # (0## #c, $c $#c  "  "@    "##c## @A ! #(`  T  \`D#" :  *@s#?$#(#)  ' @  @  #4*`@  @  `* @*`@` c0 6 "#%#* * c* @$ "  0 0 `".c00"@g  @I; 㿐 2/@  0/1 #?? &#@C#&# 㿘   @ h 0c8>  *  *` "J "" 㿘# b "@ ! " "@"@"b@$"$b@ 9 ?㿘 "' @~֐  ?@ "# 1 b # `?"@  #@tLb8? %# 㿘  㿘 " b쒢! @   # 4$## @$"#@ 㿘  @ @ܐ 0 4"@  㿘 a , % 􀢀 @ "",", ` @{ b?" "b  ) L@-@ "@~@0%# #  `" `4@   @   "c @ @%# ?@L?㿘@  㿘@ 㿘@T  b@㿘@K  㿘  "  @G 09 ??2# L   b  ` *:  _ $2b L    `2*:  _" $"??#@G 㿘  "  @ 07 ??2# L   b  ` *:  _ $2b L    `2*:  _" $"??#㿘 "  c   @|""0b  "$"@J" "0  "J@`@X$"""㿘@??@ ??㿘N  * @ : N`  L    㿘 #@ 1N` c   @: N  c* 㿘 @~!0`L  `  @? ^  ? @@9@7㿘 " b얢 @+   c 4"cc Z"㿘  b  @    4" D@㿘 " b @*# c??$c%  @/   c@/ c@ 0??$c 㿘 @" #??##   b2J@ 0 # ??## 㿘@ @   " *@`"" 㿘 `D@6 㿘 `\@/ 㿘 c $* @%"@ 㿘 c $* @@ 㿘 #` @`D0   T c  \*@ * @"@ 㿘  D   \ ! @Z 0  ""c$% "@# " ""@{" @$b$@ " @v 0@ 㿘    T `\#$`" :"@ `z (㿘 " b쀢  #`y01 I-search: 㾐?/B )3  J??..?# %*.@ #` `.! "@f  "&O`^ B?` @"@ ``@"@@   #4  `@? 㿘 #$`? `D  % @# @ 1@zL@`^ ĐD?0 `D?:@   \?$$㿘J@ ^`@zǐ@1   ?@ސ ?"㿘% # *b'  ɠ$ b@$b    " "$#"+@ "#,@ 㿘 bv 㿘 bo 㿘@? 㿘 ?"#@' 0@$ g%  " b쀢    !   @=   $    "@  "@" ) b쀢@2 c  "#  c 8/  "#@  "& / @  c ?@#@  b쀢@  > *b쀢@8 <@Ő?" #@ ??#L8? &c㿘1  ""􀢀  @ 03"  J# `" J"J"CJ"@J" ? ?*?"*J"4J@"1J" ?*?"*"J@"   ?          㿘  " b " " #@   #@ @ "##@ < ~ r  㿘 " b@E1 # c* @ "#I# * $@ @`[ &# nothing to yank㿘 #   "c"# # ?c* @  ## " "c,ΐ 0@3"@ϐ? yank something first㿘 #0 0  ' @"?& ' % *`@y1@  b"   ?$$* @`*`         "# "b""##( 㿘@  㿘Y "      " "#"#b *@j?  㿘 #@D`N *:  ^2*@ N>  ?`  +*@`?` N *@ L  `  ^*"@ ?*@*"("%s%s = %s '%s' 㿘  c!Ԡ!@$ 2 !c!ɠ!@$!!@$ c4.  ` *` # * @$א!0  c8.  .` @$͐!cannot bind, not a tty%s: no such function㿘 #4` @$ "ð ##  *` *   `2 @$a :   ,  4@     2{4    4,  @     ` 2N@Xl . %#  : . *  "@.ʒ 2 ; . c*   4"@#B ې @CÒb 4, @ 1 ` .#8@  tb4@*#8@ "@@ #@ :*"  * *+ @ #@ :*"  * +  㿘# b ?"c(#  "c4  4* ``4    + c4* ``c4   !N  ` 4*  ` @ G* `bҐ, "c8 +  #  "? +  *  @ 8("8 4( 㿘`     ` ܔ  ` ֔  ` Д  ` ʔ $  , 㿘 #,`@ 0 "@"@"  Ɛ $c, 㿘 , "  ",0@y  㿘# % ' ) + b"@0bb!ՠ " %b$b$@v$%"/@9$$$b%"%b@v?! @%  㿘 @`  㿘 @Z  㿘 @T  㿘 @N  㿘 @H  㿘 @B  㿘 @<  㿀  "# "b#\#`" "  = b@ 0  7@ )"?%.  뀦6    㿀  `9   ") ""#\#`" "  & " s "@ @,ٔ" 2   #@B耢    "    ""#\#`" " Ø`@ 0E  `0>+0@uˠ$ ! " $@"@; 0%  "@ "@.@  J /#0@C 㿘 # 2`@ " :`#"   ## "b"b  c " kӁ 㿘`?"  ` `J@"J``""0 4 㿘  !  "# ## < "# #   # ? $# #` #`c ?@㿘N `#*` : N c*`㿘    % #  L `   , * ?  L @ `,     $c$h$$c 㿐1 "% " "  '"@ڔ "   $* "#b;#"    _  㿘  \@` S 0#`:@t?@(L@(N "? "? ""? '"? , :    " '2?, :    " ' 0K  N )   " '!N    " '2  N  "  "  ""  '" ?`"NN     " '2 , < .. 㿘@ U㿘@  L㿘@ C㿘 " b  0s#??m!# "`L "  `*:  _ $2" L `L ` ``L ``+  * 뀢4 `L ` U#+  U `L  ` *  `*@ `*`L  ` *:  _ހ U $ۀ U#??!#w  㿘 # `'  b "   #  N  c$ %# substitute㿘' #  `T@4`$ $$`T@-@ !"bp@Q `$`T `8@L㿈 C! # Ȓ``'''@ c D '''" '`"  @|  c$< , %, @'''"@`'c"@  㿈! # σ` '''@L":  ##Ь`㿈! # e` '''@." :   0#@ƒ#Ї`expand(NULL)%S%s: bad substitution%s: %sparameter null or not set(  'a(@   @jc   #J`2J 2J 2@! #  ''  '' (@  ' ''Ԧ?$@@>#. €N  #-  €ب Nհ N Ѱ   ڸ ظ   $,@` (,@N ``?$@@>R ,@N `4 )@’2@$  ' #  $,@` (,@`,@N``?$@@>! ,@N ` ),@`,@`" ?/  @Z@$  @eL n?$@@=  ,@L `\  @$ ؒ@  @a   @8,@_ ,@3!@2D  2   # `" " $ 4$@ 444 $` ` %"  = #    ?  ,@` ,@a `b"( @` ,@T T    %"  = #  E ?/?,@` ),@,` T@dܢ T@2' T@@q$  ͪ`@ @eK@d'؀`2T!X@ @ @ݒ!`@ N '   '~ | 'z ) 쀤@~ J  l'd   J  b'؀ W䀢 2  '܀`N'#Ѐ  W䀢 X FW䀢 D  A ` % '`  ?"` `  "`@J1  뀥   ? @JJ '? @G'W䀢` @! "cX 2耥  2,   x*`    x*` n 2,@i ,@`a$@`@$@ @ @ @ ?(`@7(@``  `c$< , 9, @&`&`&@@" &@`  `c$< , #, @&`&`&@@ݒ@"@`&@(@  '   ''}  ''쀥 w  x*` x v  R,?߀`]O"H*` €G [`@ ,@?`< `,@ 6`@3 {`@0 ,@`*`( % '  " ('@  @ 2  #? ,@` ' 2,@,@``,@`  xL  8H|@X%s: parameter not set㿈N@ $`N@ #cNN` _ } `@! [ % *O  * @ *O  ] *@i@aS  @2 ' $+  2 2c @  #`+ @a1@b^' Ӹc @n@ + cJ `   2& @- &@: @:`$$@    N :   N   N  * `x@  @2?N  J  2&?&'N@ * @'  %%=# #`` 2 `Ӑ#$@ @ +   @`$`` ``?$@$`4`  @! [ t O  * @n O  ]j  %%=#! # ʠ` '''@hK@`  +   $< , , @'''@a"@`'2" :  Ӑ#$@O `@   ˤ`6 x ,  ,   '''" '$`@ `$`$@O  @`?4` = @ x* @ B? ?@`'@aS$`$@ +  x. @2 "@@J`Ӑ#@ += -?cJ c cJ `@#@ x. @2 + @funny $() command: %s%R%s: cannot open $() input㿐 #! `@.  T"`@Q"@ $ TO V@ .``)``$`    " !"` x@[ @-   @C  0 2!6 "@@ @CB  @Ր  @ @l 2@ @@Z 6 &  㿘@Ғ %2#0Q@0L@8J.@< A. (;*7.@< ..?:(*$@; 2 ?#&@8Ɣ@ @; 2  㿘`@" : @* 2`@`  `c$< , ə, @&`&`&@@S@"@` &@, @@"@:` "@@=̔4㿀@`$< ! #' '!' ''쀠`  @ `@&> &.@U @2|  2   2Z @:  "  @  L / '< %@(@ @:i8  ? @   2. @ (*L /%< @ (@2   @:D8  ? @ @<  2 /,@`,@ % $< , , @&&& $@@7"@`&@ /,@`N /?$@@7ܐ,@N /`@ /  ,@k @;  2,@$ @" @7@b@k@&@=P @"@! D  9@ ` . L 1 .2LL +L .N .#@:  @kR @"@@7p@jg@&@ @$ΐ 2J`@!͐2,*+?@! 㿘@  -$@@jCL@`" @% (2 @`L@  @ `@` 2 @ @ ,  ",, , `L@  @,@@㿈  #' 'q ' 'L@?"@$ `@6 ``*@L@` 2 *@L` /"耢 :*@ @   @.ȃ N "&@?$@6ѐ 2,  ,N  &HOMEPWDOLDPWD㿘N  +@]!@^22 NN  2 N@\!@^% - N  @\!@^@ Ӑ#" 㿘!  H@P)@PÒ 2 @$ 2    @6Pc@$ `$ 㿘  @  +N {2( N   `N { }   ,?2 "N  逢` # k$0e    c$< ,  , @& & &ǒ"@`L& 0B> "& 4 N { },  ,? ,% 2# `& #`G@h۔@h֐@@hѐ,g  2㿘 @.Ք %sPS4%s%scoprocess already exists%s: %sX'D'H'D   H H DR` H?D@p {@4   "`@Rj DR`YD D"cXD  `  *`#` :`'H$ Dv J#%`4`/ #!!@[!@\͒ @D@  !%#Ӡ  ` c@C @  @@#` @FH ;'HD` 2 ! DR`"! DR` ! # @y`# @"` @h D `%D `#  %'@ 6 '`R$`l` N@J@V D@?* : `<"*` €HD@'0.DH`H  'HH 'H@_! #  2#  @ER @S #D` 2R !! @ @3 DH@` @) @H 'HD`'DDR@ ! # ` @DR# H `@D@b2H`ܠH "'0DR`DHŒ aD`'DDR@ HD a `@g  c 2 @q    @g @2@2" `   @!@  @ؐ ! #  # 2@А # b2`@ @ @g$  쀢`$   @ @ $b@  $ `$ $  @g  H c ?2'HD H@ڒb0VDH %`D!E'D `D R@  `? DH H!'H03D!(`?D '`!cx'''''ߐ0 'D` " D G#`  #' 2@#`?  @2,@1Ґ c @pސ   'DR` * `D@Y` '@[DHʒ a'`0'D@Y`@[s DH a'@) '0 # 2#`?  @1@1 c @p   '0DH a'D!DR@@  `? 0D `~D!r DE D Hf a0=D D`'DD`aDR`\D '`  @6  '@ D 'DD 8DR`01DH a$D`D@HDV 0D @^y@'@P-@1DD`@H "a !D@@ ڠ!@' @12"`lH @0Ԑ  H!  J# `@0Ő @O DdxPl l LL "!X!p!!_builtin: %s: not a builtin:pcommand -p: restricted%s: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s%s: not found㿈 #J  'H'P`'J     2 ( ""@[ ?@Z HL  ^"#X@ 'HH A"@]H b   JP 'P*H c < "@7  # b@7c p?+   J#`æ = "*`   @Ғ 'HH H `H c8  `'H ! H Ha @VH H ` Hh   J 2  @ "B7  +)  DM!`(`2  @W!@Xϒ @@ a  Ȁ`#Ӗ#  @?  ` @<㈒  @['   @ Ȣ`` c#XH  J#` @Ӓ /  c0@P @/'HH    0A逢 0<H@8'H`H H `H `H!`۠#@ cp@n H  @- H " !a@ #@V  '@Jp@g @  H cȐ @? 'H 'Hh"&" # `" `` ! #H`"`( ``  "`  `"( ", "0 "4 "8 "< "@ #K ! 'H H2 + ! "'H#"2@m   H P  a "`l  H*%H" }H@ #@ &$H` HH@H ?"@ @ToH"` !*` € d l@.@.`@.c@ 0XH`" H ` H!`#@ ?@  ~A' `@: c@  4'#L `  (""@Y H @W P @CP "!L  !Ԡ @N  @N H  `2`"  P""@?'P  " l@- +,+,,,,,EXECSHELL/bin/sh%s: %s: %s㿘 @U!@W+  L  " @  L 2  !  "?& " @@ " ! a@!@shcomexec: %s㿘# b|@I@I  b@? @㿘 #`    @Ih  L @I& && 㿘 @Hה  2 " ?$$, ` $ @SW `2 @I`?@Q`$ $V``$ 㿘 !  N = *a +@2"|@@H@I5` " "" FPATH㿘@H J# /@   q`  "|@H ` @2 /`]    @U!@V4Ӕc  & &  @ &   ` @2  ` 2 % `0 !  #@H #`   @Β      &c@ ?&  `  T P`N `     #@H &   ( &  &   "#  @   (  @.c@& &  &` @Ty!@UӔc   @_  `( & "`(& 㿐 c@H   J`/  c@ $ ?$@H 28@0   '?@5 ` "! <   I  ?    "&㿈2&@f / Ő 2X 0V"@Q@a{   #' ' ' '耦`:@@ : @ab@$" @-}@`t /, "@@-k@`by N@ ɲ`Dz  㿘' @% ! #X$$ @7  #  "@2$b @@8$b$$%s%s %Rcannot %s %s: %sopencreatedupcould not finish (dup) redirection %s: %s ?      / J "`     ' ' ' ''''J`!!'! #@S>!@TkZ    @N@ ?`P *` €I G" J `B&  @?@. <  30.."   @ߒ `'L -  L 2 #     @ | ! ! @NX |@  ?J ` bc0@  ?@.! ! 2~?  #      "@a@ ܐ c?# *`R   ?@ ߒ #` *2 "@_ @ =@    !   @M  "@Ra@   +?@^'?`@^` ` "@   @ X@ w   @6]  9l9|999t9here document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %s㿈?''D 'Ha@ N ?! #  @@  ' '쀢`  `@- '  `!    " @a @ !쀢 T?@6< T '@* # @hՐ   H @*" T@6q?@^c䀢` #! `@  D" "$ T@0 !a@@ B  `8$ T@ @9 @9D@)@6I?0@^6? " !a@x!P@ ː ???REPLY-rreadPS3㿘 + )'% , `2 #` @Qwc@RJ`@;@Qm#@R@ @a *  @Q\c@RJ@ ۲ @Ҧ 4ӑ* ?Ӱ#%*d) %s㿘.`@ `@9㿈   @^@&     @Uo   '# ''@1㿐   `A`?K  K " K`? ) K  : +@  +@K `@* +@u`   S#t*`  @A`?   $ 㿘`   "`1 #耢 2 . 㿘ndbteste_error: %s (offset %d)㿘 &c@  ++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():x"'ؒ'@&@x'ܐ 'D'L'''@( ' c @f  􀢠 *@"@($  L 1 @#@'@l` (2ܐ '@N"`"@ @Vܒ ("D  @C "@RJ 0@P L@QiD@' end of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variable%s: %s㿐`C!8.` €  ''&"  *( )"  * @P  #H @//@ *`#@c` cx ccc@m 0`@g @' H0HHHIImissing )zero divisormissing :㿘 `Y ߀ ```#@ @`! 86& `"` `?.& 2- (& `@ ϐ`$Pi  @t@  @g S `:@ @X02  ),`@#*`  @A`@5  @  ` ` ` s@耢 ``    $ ` `#*` € @Q  @R  @B   @  "@  *@  :@  @    @    @    @     ~`?   x@   t @  p@  l@ 2  $ @ `  @ `U   "  $ ْ@ `  "   8  ?3$  @   $   ?$  %pM @Z   $   ?$ "  `$ @"@P9@O2&   ,`* `@M0MHO4LDLXLlLLLLM`MpMLLLMLLMMLDLXLlLLM`MpMNtO4missing ]㿘` LL  `2 &` (  `x* @ 4  [ L * `2 [2 ` @T 28 `  ! @&`@@ "`#$@&Ȕ@M+#&`t`[ & 6 _'   _  *  x@2L #"L $@&@&` }"`" `"` `@O x @`' '&` # @* :  ` 2  @*  M ` 2&` )&`&`㿘@@K` ` & "@O@ @N"& 㿘N 2@@2 .`*   $ .`*    㿘! # `#""" " " * 㿘N`  @@" @b @N  @ "$ `ݒ @@ @M&@O @ *@&@$ e:glnrs0,1,2,3,4,5,6,7,8,9,- $_-%c%stoo many argumentscan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e-16 %d %.*s %s cannot create temp file %s - %serror writing temporary file - %s_${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %s(        % ?3`C<!*` € a@M ,`@YR c @%c@|a`  @4C!  @! @+`耤`* Q   `2 2"@Ґ!0 `J@ `@ ے =   #@%`$ @ ,@    2   @!V  @< @  G@–B `@!X6  2  2 2  @s!  `!x @ @W  @Q    @ @  @ `@5  `?`=!! ,) )7 5 3+\#X\":@3-# $#X@3&a@ ! 2 #X@3a" ? \@/#X  c @ @# `  "`!a@y!@  !@2!" ? (@/?   "a!@S!@l J#` #  @K/!`@L # `T!@!> $`TT`  @- 2 `@"F @OI     \'`$ M' '' "  $" @#Ր"@@0 & `@.,@+!$@U # $@b(@V@. WWWWWWWWWWWlWlWlWlWl]WlWlWlWlWlWlWlWlWlWlWlWlWlWlWlWlWlWlWlWlWlWlWlWlWlWlWlWlWlWlWlWlWlWlWlWlWlVWlVWlWlWlWlWWlW WlWlWlWV㿘@" )+ ) ' @   @, L " @ \@    @"@vᘀ ,? ߐ`T@ q%`Tsubstitution failed㿈` #@#`0V@W@W   #' '  ''$@"  @# @V@U@  〦$ @# @VƐ "@$@"@Uڔƒ$j%s: not in history%s: invalid range㿐@% /   \ ` "\* @ \*@   D `+@P/ \ `!@.%"  !xL ?    1 `\ D " : ?@u '!`@  D* @no history (yet)㿘  D `\  2 \  @" \?㿘  `D \@"ذ 㿘!   \`D # `\%  " ےc@`\ \`?$ \$ L P  \D`"8@*`  L P  " P L 㿘 `\  D " : `? @Uې `D`D. @@ #\@!?- @@   `D `D@@ݒ `D&@ > `D@@ \@怦?㿘 ) #D' % \D"@ : .  "@@V D@,  %#D$\$D㿘  X`!  T   @ q   T  ?c@$ T @o`\㿘!  D    "D c@"? "`\$ D㿘%  # D `D* `\  ' @D`D @V;*D`D*` @@!E@U;$@ (% \J "*% \㿘  \@U)@@U& @J?` "\` ,@\`"@ , @T/,HISTFILEr㻐 J# `L   "X "\@Gr#@H  J   8" Tc@@   "T@5` -   ,@   `\ "k @$@``? $@r ݰ @w%s%c㿘 `H  5"`H    D \cD" :  *`"   T !@aP `\ ) !X@- `\`@   2@x㿘   "`l"N'H'L'P'T'X  3 @ cH@/@.f @+ؐc@ 㿘'L'P'T'X@m! #L@/u @.R@+Đ%s: 㿘   "`l"N'H'L'P'T'X 3 @L  "䀢c@.cc@/MH@.* @+c c   J#` ""@i internal error: 㿘'L'P'T'X@ ! #c@.ϐL@/@- @+n @F %s[%d]: 㿘 !   T  #  "  @ #쀢  # J- b#@.c !  T     #` @. T"`㿘  d'H'L'P'T` 'X! #@.̔H@+shl_stdout not valid㿘 "'H'L'P'T`'Xa  #X@.H8@J   <   ` `㿘! #X @)   0@)  ?@)   "`dtoo many files open in shell㿘@'b   "!` Ӑ"㿘  @r  ` "!`  ?"@R4鈐㿘 ` #(@* ``@R#0Ô @Rcan't create pipe - try again㿘@| 6# &  & 㿘@Q@Q bad file descriptorfd not open for readingfd not open for writingillegal file descriptor name㿘 L ` ",NN  2(N*: ?А @ `+( h(  %` `  2  p N  @K &?? """   㿘! "Ȁ`  @@Q"Ȓ?$"ȁ㿘 b   bȀ` @Qp?$ 㿘 " `  @Q`?$ no coprocess   Ѐ `"@?㿘  1 " `"Ȁ 6""Ȁ "@Q5?&"  "@Q-?$   @Q%?& /tmp%s/shXXXXXXXX㿘  `#@R @ ,$ $$@,@  @( $  X$$&Otttargument must be %job or process idambiguousno such job㿘  P "` "@Qz  "$"c@; ) ' J`  *`   @'Ԑ J  "`J Ԣ ``  .  * $ @; ?. J` "J`@ @Bn 㿘  l ' ) <%  X24  2.  2 #J` "%J` 2!2   @   @y  2  @  @y  2 `@^  @mX@2#!#`@Ē #@zc #J` @.*` j_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job control㿘  cJ` "J`@AՐ   `'  " @ $@z  "` "a!@$#x $  Ԑ#@:˔ ! @O @b &0 " @2 Ԥ `` ,   *  @:?,  9   b 0 @yא   "a!@#:  $a!@ܠ#Ȕ0 $@b   "a!@̠   $"#b$  `(  5 @Ac01 `" Ԥ `` ,   *  @:W?, #Ԣ ``  , *`` 2` `@:A ?, #J `@A~exchild: XPIPEI and no last_job - pid %d%Tfork failedcannot fork - try again/dev/nullchildexchild: execute() returned[%d] %djw:last proc㿐` qaH  `@O @ <$@$`$``$` !  p     Xchڐ  `h p"#"`h@ ` `2$$ $  X $ $ $$$ $"$$($0  " p"`h@ Z ` 0@= ) `@\z,@%   "!`#  p`  @ _@c @OD #`?"$` @N "`X$` #J ``   `  $@x`  `  ``@ `@`hb@N^cb  @O @V`#J `` 2J Ԥ `` ,   *  @9;?, #J ``@cF `#J `!Ԡ   @9!  @9 b2  @a#Ƞ  @N@kc   "#"`|* @@J* @8na`n c@L @GC`8@b  " $0 " `" `#@x#J `! `@)#(` %` #@)@`2` # @(ʒ@&<@Ӓ  @Nj 㿐 `@N`  `p `@" @NS waitlast: no last jobwaitlast: not startedjw:waitlast㿐 ` @N: `p``  `  a aj  @N!   } @  @N %s: %sjw:waitfor㿐  `@N   &@  l  X   X@2 2' @{    X   @M۔ "? @MՔ ` *`  "Ԓ? @'  @M   &@㿐  `@M @@   @M  *`   "0) `2 @ 2  ``2  @v{  @vx 6  "a! @"  @Mr job not job-controlled[%d] %s%s| 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resume㿐  `@M> @ϒ   @M4  *`  ː"`  ` @M# !*!@հ "`(!`̐!X`(  +!)!'  2$ $  a`  !h  2 # @$#X2$` @ݒ `"` @ҐK` 2?`  ` ` ` @=ڒ`4 -ՠ`h ```@ !`   c@=”  @L `! h!p``` "a@L 0a` t  ?@ $`"t` A``@u  ;` "!)`  $``  `  @=c !#  @^`  `!!!@!`  @Li !!!@j 0  `!` 7$`@  @LL You have %s%s%s jobs stopped and running㿘  l'   X b  " J` "J` 2  2  2 " 2 " !"!"" """" """"   jobs㿐  `@K     @o ` @KԐ  *`  Ր"B   l``    ! %  !`  @ @6X ?   "$   2   l 3" "@?cH 2  @K  notify㿐 ` @K}  `l '  #L` "    @ @ ? 8 "$  2L` l  %# "@蠔`2 @#㈒ @KI 㿐 ` @K@ `t`"` "` @K4  `xasyncj_async: job not startedj_async: bad nzombie (%d)zombie㿘  t  !!2 # @b@  2 ,#bHJ 0B   `|   " x 7$`t) +#%# l t "! " @6   `t a |  |bh  & |@v |@ l㿘   (& `  2 & , `X"@IԒ j_waitj: tcsetpgrp(%d, %d) failed: %s㿘``$`$ #J `"` @uM  bx  " ? @3$$`" @3 2^ " `   `}$ $#J` 51  `1  .  ! @= $`($!  @) 6   "a!$ @ؠ `*    4  @;'$ &',   2 $  @;c,  ?R$   `  c@;  `2, ;$,#J `  2$   Ԑ ` * "$@2Ӑ $   `"<"`t#J `!  "## @^@!  #J ``@sp  " la    X    2  2S" 2 @UD@U l  (`" `  @`2`  2 (  '''"' $" @# $ " @# '''' `$` `  $`@ ?@f  %acheck_job: job started (flags 0x%x)checkjob㿘 2 (%a 0`  `  4@`2` ,&  ``"  &  : &   &  ? # b 2 0 $  0`"  @2   ? $ b   @c& L : 8c 2L @ L  -c   ' #!   `"R``2 2  @  @] @   ` c #`@tcJ `    t  % |?& & `"|@Uaȁ%d RunningDoneDone (%d)[%d] %c %s%5d %s%s (core dumped)%-20s %s%s%s|%s%5d %-20s %s%s %s%s@ `' & p ,  @#0   ?` ' & x& '  l2 +" - ( ֗*';     `0C( `0>&:? ԕ:*h @⿐1``"./ :  && ` /!' @@#K `  2 `2  `2     2  /Ԕ *h @⏐`` ( &&  @#; ``@# ``& `@#`2O %`& А '& ؖc@"  &' 耢` & c`& ؚc@"א   ; 7  3 )&'Ӷ /&-+&``  #\#\@"2 a   @"     ڀ` 21  Ӑ@"c㿘   x* &*@v `l  , "  2 ,l |`   z 2 p`:  %`m k&@L`?F'#Г*` €  l  l V` R`0T@3 `l I  J 2 @`  l 7  ( "  @j  `"`2.&@-    2 (`@G2  l    (`@ 2`` 2 (`` &@ HDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDHDDDDDHDTDD||||||||||DDDDD㿘 ` "` c@O d  l`" & ` 2@`"& 㿘 ` "` c@0 @remove_job: job not found (%s)㿘  l l`@2 @(a 0* " ( `    @"`" !   X @ ` `|?"`|` p& #`# pt" t ll2`"`l0l""ll"" """㿘 (   "@E &? 2 no closing quote x'X7 / 3 - ?'xX'|'p't @'h 'l Hh '`'d%ࠀ&`H   , @% , 7  TJ@  \ࠀ `"@  T " #` &``TJ@  \ࠀ `"@  퀦 `?&`@ ]T`  ?"`  Jc "''`  `   x*` `?$@`` .#\-` € [> *`; *,d@=:  @֐\ # ,,\L  `?$@`, , L \`TT @$T\" 8" " "P%T @ + ? ! 'TJ` `\ࠀ " @  ( ,Q,@ΐ '"  \ "+ \098 \TJ@  \ࠀ `"@ = ,,``&` t@ p %*  , t@ p %  \ T ` $9 ,/ ,J@  \ࠀ `"@ $͐  \ "` ? `` ?$@Ԑ`  , \,,J@  \ࠀ `"@k (: {TJ@  \ࠀ `"@X (t  @p %  % d $ % @ t2 @}p %  % % | U  ,,@`TJ@   \ࠀ `"@ : # ,,TJ@   \ࠀ `"@ # %@̐ t @3p %L @ t @$p %=  `x* @ 0  , X,`?$@`,TJ@   \ࠀ `"@ * `2`, ," X `?$@` , X,,, ,, , $,@WTt  @p %  ,%  J#`Φp @ @ 2% @ T``~ ' p?2@p ,`&` " \p?2@p   ?.#H* € ("  ) " '`.  \  (  $%  ? % %  %  % `&`%  " \% 2    %  '2 `% ?&`  2',$p ( )  % 2, ? % TJ` `\ࠀ " @ )p?2@p,"@d   $ @CҐ , (,  % %%  } *p?2@pϐ  } |p?2@p Հ (0׀ ` \,2,TJ@  \ࠀ `"@r $", \ " 0  ` ,  2,  \, ) (  ?Z% TJ` `\ࠀ " @@ )y @C 'A '  =%  \ 'TJ@  \ࠀ `"@   P, "t  @Up %  ,``h&`8  % , _ " \ , %U % TJ@  \ࠀ `"@ $  \ " `  , \, ,,+ ) | ,?p@ p ( , * , , t@p % TJ@  \ࠀ `"@ ``?$@ Ԑ`` (@=#" d < >` L@ } ` `x* @u ` L`?$ >`?$TJ` `\ࠀ " @A <- & >* &  >  $ 28$TJ` `\ࠀ " @ - $@$ > <  $$   > $ | @$@͐$$ $d!l " 82h,`2e,lؐ )"ذ ) ; &T ( 206 0 |TJ` `\ࠀ " @ | ; | &!,!!!& &$!@? J#`TJ` `\ࠀ " @ (~!@\0zdl$  o"`8@N b `@8@ J@  ` @,@`@ `J@ `= @@$ 2,?L? J? H!@&F  `@&   !  } 8,`- ) "@& #! T!8 " T @$ T""" "8%T8`)?!T`T dPP㿘  "b   @b  $bhere document `%s' unclosed 㿀   '`  ` "` #!' 'z! ''+ -   $ ` `T L@!?$@ , `TJ` `\ " @`ڀL  `` 6@Z% '.@<?$@ Ő, `TJ` `\ " @b` ߀`?$@ , , $ `&  `?"`㿘  T'H'L'P'T'X`?  H `8`? (`8"TT!Ӡ#"o  @x#ِ㿘ϐ <Ӑ#?$`$ $ $ $ $ $ $ 8 $ $!$ 0$ 4! 0$ , $ ($ ($ ,$ 0$ 4㿘 `T @J  $@``n$@0!ܓ*` €m#@b@`   $`$` $`X$@` `Ӑ#$`$@M$`# $`$`G$@`  `8 $T@ P" `  J`"`8@ ?L@ `"`8`8` $T :$` `  `$T "  `` ,`,`T $` $`$`8$@%$TT$@``@ #` w``8$T@`2 ` Ӑ#$`$`$@  ! #@@@J  x$@llX<㿘 #J  ` ,  `?   @  (<$@  (,&` &   Ӑ "c@f `J`  J` J`  $ & ,F+ "  `@ ? & ?#+ %  ( @z"@  `$  ` `"@'%  ("  J "   ,$ (" $٠?@ - (Ҡ? `@ ` %`T  `"#@f2  , && @q$ ,    21&@ -&+ "` J x` * J  *`  2J " 2  ,葒    [&   @  PS1%dPS2㿐 "" P10S1@0!X@1G@='*   B@x J@  !11J`` ! 'J@' `!``  @PJ@ 倢 !@! #'`'@  # @F֐   "  "` @ _ "`@ @/ΐ!h@0! $ 㿘! #@@ǐmissing ] 㿐 ' TJ  \   `" @`k2!x.` €, :  # ^  `x* @ V  S  P N   x*` G`, :  [A @[ 2.1# L # ?&@   .L  c`TJ  \   `" @   x*` ` `2, .: @b 0 ?&@Ԑ.p ǔǰ 㿈   #' '! ('  '') TJ@  @ \ `" @U?$@,`: , [  ]":`  T, n$&`?㿘 ` ?"`  Tc ` T@` "@`$ * *  T " " 8"$ T T㿘  `   T@J  7"@ `    T $`J  '"#$`!  T@J  "@ \ TJ` "   T $`㿘 #`j!" !$ $ 㿘` ~&``& !tMAIL8@Y   "#   `" 9  #  3@., 耢     %%<#   "$ @  2$  2$ ̀@   @$  2   8  ` ! =#@` #@7#@#@@q$` $`@   <  $` " 㿘# @>` c@@P$` 4 #@ : , @ % N? \ @;0 ?@Cannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENV8 X((@r@ 2@Բ  @!  #@"#  ????????'7  @*"c' @+) @29 @!]5 ;4 #@X  "@S   H@N @#1  "|@G @'#@`"٢  p  2ِ#``   `  25 H$  @`   @ @`$5@+ @-V c# *@9*c?@5@ ` 4c@b 5c@`  # *`  @  "!# *`   #`  @/   `@7 "`X'"Ӕ    @.#Ӓ w#5@+T @,L /@P 5 @  P@2 T@ @ ݐJ@ @ q J@ Ӑ#@,ה @b5@+ @-(5@+ @* @.:"@.8@-@+  Ւ`@, a`a4`    @&  &#5 5 "@5@*    #耢  @,@3 #  " @,@##耢   @bJ@bX   ,#,  @' 6L @8d   `. @ $@$` 5㸐 ȑ. @ R%cN '#L  # Β`. @  $`  @  0  $`  "`  !5"l@T ㋒`&%c `, 5`$`p   @ $` @-ؐ @-Ӑ   ,,"` `  $` `"$`@/I  <  #@  #L  @ , L  . `?c@%""&@X L , L , J@ 2 #L  5`J #L 5 !  @Z L `2 #5 &!0  @N #J ` 5!@ @D 05@)!X@+! J@    @3 @@ 2  5@)ߐ (@+ @  5!\# *`# *`#J`  E@q*`@  include: %d㿈'D'H'L'P'  @  0 'y?L   #`''0''@  c @@  4L @#` @   #" "?`8!P*` € A oP`  l`7 @E7c  L 3  #"`H" c `'Dc" @ђ` "@6@ ` @u c" " @t@tL||t㿘 # ]`"`"@@ shell: %dUse `exit' to leave ksh 㿈'D'HD `  J ''` H@   T' '@쀢   "#Hc @?  :?`.*`9!h €쀢  2 ⮐# J# `D `  D "`DDc""  @" T@ @"`T8a3  # %8 "`@2 D 8`L  D`  D` ?"` 쀢  JHDd D@ BV .  L  ?'`ED"  3 cH  g  D&cH"`H '@6   L   D ` D "`l V  쀢  cH 2"cH@ @i  "`Tl   $$∝㿘  #J `    l`  `J `  ! Ր `@ ! #R`9"|*` € c@>  #` 2`@#T@@@l@@㿘# c D`44  c`$ $ $ $ @$c㿘 #` " `  `@"` @&`  ` , R@`"   $` ` R `  @  @c` 'T@ !  J# `f`   l  2  Ԑ `, @ @ @3ߐ  @5#`l$`㿘 #  "    ,`R@ `@3`$  $   2 " 㿘 # @ @  㿘! #@`@#`#"`@㿘  !   X@2@  2 㿘@w / 2@r r  4@εb@ alloc: %s㿘: a#`  x    0  x3 xJ  x( 2J  0123456789 |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|㿘 x – @  2@ `  x  @  2@ `x:`2" :" :" :" :" :" @:"!0123456789ABCDEF㿘  ܠ?:#,@@ @?,@*& 㿘   @3{ @:㿘` p`@* 㿘 @    $  &@ $$ xah`cXPeH8(i klXmCnfbuprxshh`vXP@0 xxtracevi-esccompletevi-tabcompletevi-show8virawviverbosetrackallstdinshrestrictedprivilegedposixphysicalnounsetnotifynolognohupnoglobnoexecnoclobbermonitormarkdirsloginkeywordinteractiveignoreeofgmacserrexitemacsbgnicebraceexpandallexport㿘;  . @ " @    ". ?%-*s %sonoff㿘 .`@ #J  ;#`;#;#@ ސCurrent option settings set -o %sx "*<<K X;ب 'ؤ  ,` "`@2ΐ$?$ؠ @'آ``",` ;#X@ܘ 0$ x ;#` ! ܏X `+ @0@0@@$ $ @ # 3`{@畐 `?@j*+?@! 㿘   U +> M  * ? [D  ]`2@       !"   23   ]". -  `'20 #  a@3  `  | )`02 `  2 *  ``?㿘 0   @퀦   ?" ` [ * kπ # 4 Ȑ_`"̰ @̐ €Ű ?    @ "   ? 2 @ "  2  } 2|  @֐@Д "m   ?a 2` @ N  F 2E  @N@ E?B  @# @ 2     ި   @* `?     !`?2        " (2 `[: 8  - 2  ]      2  " 4 @4    ]2   㿘% #>   ) |?? |2  2 ` `@ᇐa 2  * 㿘.` @㿘&@2 :  :  [* @@ƀ ?@$@$`$@ƀ $$@2 @$ $$$@$̢`ݦ2$&@:`: @?@$$@$㿘@( "" * " " " %s%s-%c: unknown option: %s%s-`%c' requires argument㿘`" @@* ?J@ ; @ @+ ` @ &`-*J` - `J`  ``  &`&@`:-" J`` +2&`J`  `&`?@-`  &@&```&``,  :` `?&``: `; `, `#"N@ 2J N :2` `&`L.`@#p` @#2@3@`:`;;`,@+`?`J O  `&`4&@`;2N/&` :2` `&`.`M :@#` @#@#@#  <`` /#1 ? `#@* ?`@ &`%&`2$<`@+`?`K    x*`  &`   `x* @`&`&@&`<`%s'\''㿘L    x*` !2 L L  *`a" L A#8ف0/L ' A#A%A1 `'`s$ #XmH #X ?L@   " *@`" L  `AR#H%-*s%*s㿘 #`'L`_ӴcԦ @# " @?@#` @$@"^Ԓ@#" $  ,   1B/B-Ӑ@"I@ L` @p@i @&ڠ  #J`㿘`' @  `@L@ "` @& "$@-Q@ $,㿘 @,L6@+g.㿘 @+   # "a # @  $$a 㿘 @^   ?  @T  ?  㿘   #$`$@q`   @+ c  #`㿘 @! ? ? ! "!@*$!@ 㿘  ` Ӳ#N@ / .'m 2N` .``*`:  / 2   LJ@  :2`J@"@  `&  L /"" "N "@+"@@*@J / /,  $'" @*J / /,  @+V "@t@*k "&Ja/`? 2   . /J@/"`J@ .2K((G(/J`"`/"`.%J`/  "((((`ЖΒ` (J@H/2J@"J@(J@ @/"J@(`J@ @/2(0㿘   Ȓ Ӱ#@*ѐ  `@ # "`@b @ْ$bb@) Ӑ# #`㿈@* c ' '2 @ ''@  @2*@ /*@`*@`"@㻘?&@b^N /"N Y@O / $@@*q  N .F 2 N .2 N .  @ (:N@ /@ 3  /&@.@` @" n@)e@.@ @)# 6 . "!` O / @ " 2N㿘"! #0`#`0 "$`,$`$@$`(@[   4`  @6@)  , 0` 2@tshf_fdopen: missing read/write㿘`"`` @   "`  `0`0``` E`ձ    ! #3`&  d & ! #0)` 0& b#`  & ,& & & & & & & & & (`&& $shf_reopen: missing read/writeshf_reopen: bad shf/buf/bsize㿘`"`` @   "`  `0`0``` EbK   E  b0 (6 Eb0<  & & & & & `& & & ` &&& $shf_sopen: flags 0x%x㿘 Ec 1 # 0`#   &,B B `$ @?& &&&&(&&& &&&$㿘   @e@' &?"$ ,0 , 㿘  @I@' &? ?& & & & 㿘   ` &  @ & * & "i ,㿘  @"$X ,0 ,R shf_flush: no fd㿘! 2 0? 6Fbo h " $"! ?@  *@ &  ;    @'  & & @ @  shf_emptybuf: no fd㿘!   6Fb5 h " $"!s?@ `k * &a!` d@$@2[?  ,*`$   +` +` " "@    & & & & & <& @5  "@ $% " @& 6$   (&& $@ &  @(͔ @& @ 4 `  * && &     & &  &shf_fillbuf: no fd㿘!2I  6Ga0ӧ @h " $ "!@ W ?2,?  && ! "  H   & ! 2  "  4 6  "!& $ h&& &  & 㿘   " "aW?h " $"!O?@   ?2D?@*2&  6   `" :  2  8   : 2  (   "@& &  & & * & @& 6   "a(&& $? shf_read: flags %xshf_read: bsize %d㿘H` `H`  ` 4@& @"&& &@`@ ?@ @$@( ?shf_getse: flags %x㿘Ha(Ҭ `4 `0 ?(  @!,@@+ " $  4@%&@ @"&& Ң@,@shf_getchar: flags %x㿘2 HbHc   ? ?  $ @`$ shf_ungetc: flags %x㿘@2@Hb> @('?"7?``@` 2.? ?"%?``@2@`@&`@` "` ?*  &` &@ &`*&@&`*`  &` shf_putchar: flags %xshf_putchar: no fd㿐@?I` ?">?@ "*`` /I`0ܐ @( "`$"!*?6`  "!`@ "` (&`$&@` @$}  퀢 0 2 `v ?" ?``?&`*@`&`㿘 " ?@%@shf_write: flags %xshf_write: nbytes %d㿘Iaш `6Ia р `@@`4 @$$@@"&&`9  ?23?@ #`@ 6&@ &@% " @$ 6$`  (&&$&? 4 ` @$T@"&&㿘'L'P'T'X@MLshf_snprintf: buf %lx, bsize %dh'P'T 'X` Ic Ȓ P@*BhȖ'H'L'P'T'X  Bΐ H@.0123456789ABCDEF0123456789abcdef(null %s)P `  @, `:  %"N@ `2 ̒`& * & ``   U`* : `L#L!`*` €CA?"<@;N@7 261N@ -+ )  x*` &,@: , ?Ѐ`  ,@.,* :`@  ?Ѐ` "N@`  & , 8 ۦ ۑ* : `SL *` € Ϧ * : ``\K#*` €   ,` @ ^ 0,@@D 2 =` u> -9 +42 /`   04  ,@# 0""J J `   4  ,@  x X,@ 0,@%$@`J @#ɐ ` // `d`% @"@@ L@`+ @`-` `0  )?"*3 0  ? 0 ?&   @*@`& ?` ` @` x 0  ?*`:  `&   @*@`& `?`@  0 '@, `2 < o& * & ,    @?  ?L@T &   @*@`&  `?$@@, `2 < ;& * & 4 @, W(?+X,,,,+X,,,,,+,4,,,,+l,,,4- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - ,+- - - - +- - - - - ++ - - ,- +- - +)))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))㿘  T! ` `?@}$!<!<   "a0 $!<3  "a@ !@` ` a0 ` @ $a0`@3 㿘@" * # % @   @! 2   @g  @` $ a< @$a< | |$@ސ $a<㿘ϐ "# % Ȑ  !@   @9 a< @$a<̐ $@!瀤! $a<㿘  ) + !<`a@%!<۱ %a@  ` @`T `瀦 0`* &! ; &   @ 2 2  @  @ޖ $ %!<too many <<'s 㿘 !<`  $!<c ! "a@ #  !@a# % `8$!< ! `` `?@, `8 & J`   &  "耢@ `M!"@"& 㿘 <  !@@ "<0 $ "a@@5 㿐@U  @ @n too many redirections %s: bad identifier forselectP! # }` # @}` @'''# @}` @'''ز  !<` !@%a<ѐ ,  "a@aaa tЀa!a `{ a`(#  ,# oa  00"  aaa# %a<̀a# %a<`~x# ~s`#~o`0 @ %a< `T #$ T耠 ` " `@:  a`$a< @ %a<m%@a"a`(c!M0jaM #,% צ%a<ؐ" :  " :  2  @" "4" :   N #  `8@  #$< , }Q, @'''`8" ' #$< , }:, @'''`8" '#}`" : ؐ" :   ؐ" :  " )@  %a< %a<  ( )٤ { }Ԥ@Q  `T$%a< #$< , |, @'''#Ԓ`@ "@`'!  #$< , |ϔ, @'''  8"@`'@  STTT"ؚb'%a<'''''!M" @ @G! `8@J   #Ma #M#M#  `"$@Ȑ@I@$0$@a   @ @$ $@Ð !   8$@! @$@@ m @$$! @,!M   @3   @{    @q    ؐ! `8 @!M$,ߪ#% ##|ϒ` $ ,%,|$ T  ;# #$< , {, @'''"@`'#"@ {$ #$< , {, @'''"@`'#"@ {Ҕ $|`#|`㿘 a<  !@"a<؏  "a@! {! }@  N 㿘 H!@   & @ @& 㿘 a<   !@&!<\ , "a@!!  &!<  @c @ʐ  & &  㿘 a<   !@$<3   "a@! {!  }@=     @`2$`& < @$< $@ڒ 㿈! # @z` @'''@z  !<` !@$a<   "a@( $a<% !  $< , {, @'''8" 'a<`!@$a< %!@|ݐ! $a< $< , zܔ, @'''"@`'"@z̒ &  m )ڐ a<` & $a<ד %!@0!@!Y %s: invalid function name 㿘@ 5L #   xQ *aa=aJ 2 @   T`& 6 `&  {%   "a<c ` U2` /& @Ő c& `y  c"`yݐ   ` :"  @* `* `* `c"yŒ`  "`  "@ "  c` ?2`㿈! # @y` @''' a<   !@$a<   "a@;: 8$a<%  #$< , z, @'''8"@`'a< @$a<А $@߀ ;@ܐ " :  # z`  , #yݐ ,   '''"@`'#"@ y͔㿘@" " " JJJJJJ J 7 7 J JJJJJJJ{Jx}JpJhJ`JXJPJHJ@J8 newline|&((;;||&&[[!}{timefunctionindonedountilwhileesaccasefielifelsethenif㿘  c@ `@# R!\`!\ T` "`@@@`" `"T`" `@ 2T`unexpectedunmatchedsyntax error: unexpected EOF %S%R?%dsyntax error: `%s' %s 㿐  R#  !@"a<  R R" 8"a4\\\a4 T" Rq#R   8R @ \ @ "@R` 2`@  R// R#D 44" " T"4 " 4 4 㿘 # x`22 " " " " " " 㿘   b " T4""4!#  !0aliasexportreadonlytypeset㿘 J#`* :   a)   Sb0@P "  e rSb8@F  r tSb@@=  t2 S@4bP   2 8   "  "  P P(P0P8P@㿘 !<` $!<` @ A  "a@ !@   J" @ ``H`D `A `8S9|`7(3) (`  8` `  PԔ X # @ `     8  `8Ԓ`H@Ѯ`? .`,$!<2 ` #St.` @ ``@`*`` c$< , w`, "``"`@"``@" "@㿘 !<`  $!<e @ "a@ !@!"$!<$  @`* ` c$< , wy , "` " @"`  `8" "1Ӱ# 㿘` & .`` @ " ?   ! <"@"`84J@  @`*J@(8 @ ( * "* * 㿘"" 2 `2 @㿘.` vV  @*``@$.`6 @˒ 6 5&  @6/*``%`@ "`V  * ` 2V *  " ?6 w@ב*`w㿘T  ?%  * @ @N N@@2   @С 2   2T *  2N  㿘T ? T?* @`@L`N@@2 `@q /2T* `2L`T TX*`T@b u $@$`$`$`$`@u`4$"R`"`"      㿘 @`㿘 T`  `u* T``  "@ 2`T` &"@: Ud], &Error handlerERRUser defined signal 2USR2User defined signal 1USR1Information requestINFOWindow size changeWINCHProfiling timer expiredPROFVirtual timer expiredVTALRMFile size limit exceededXFSZCPU time limit exceededXCPUI/O possibleIOStopped (tty output)TTOUStopped (tty input)TTINChild exitedCHLDContinuedCONTStoppedTSTPStopped (signal)STOPUrgent I/O conditionURGTerminatedTERMAlarm clockALRMBroken pipePIPEBad system callSYSMemory faultSEGVBus errorBUSKilledKILLFloating point exceptionFPEEMT trapEMTAbortABRTTrace trapTRAPIllegal instructionILLQuitQUITInterruptINTHangupHUPSignal 0EXIT㿘!Ԓ `#X`    2 *"J 2"@` aL#aL `  TaT t#W!b 4"`#"`"` aT @$ T$ t$!$ 4$" $@ @ @ ` @! @ 㿘Ԑ `!W"!Ԑ!`@Ք )㿘#c̀  @@   $c"`p0@?SIG㿐  `x* @涒 D A 4@ 1ԑ*  `;԰ ` %W  /`@ ,@ #@ @*  2 @   @n @u @ @=  2  @]  ΰ  㿘Ԑ `. @ " " a ""`@ " pb"  2 ""x "`p`"$a@$a㿘  p`@<"@Ԑ`  "  @   Ԑ`  " " H2 @  timed out waiting for input㿘̀  X `›"J " "" @ " p" ""xԠ `      "  2@ 㿘  & 2L " @ " l ) " l  " !  & ~&  a!  l$ l  ! t]c@ &  & 㿘 "" "`p ""x``  $  "   J@ 㿘Ԡ `  2 ` 0 @i< 㿘 ! t#@#@W & a` & N@ W"    "@& 2 W"  J# ` π&   &  &  @( 㿘Ԡ" `    @   `  @    @  㿘 Ԑ" @ 㿈< ";      aH@ 耢 `` & &      J# ` @! "&  W& "  '& ''@~  setexecsig: unset signal %d(%s)㿘  2  Ya@   ` π` & ` `  0 `  &  & %S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T||&&! [[ %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %Twhileuntil%;do%;%T{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T%s㿘 ?* : `l["P*` €   #Y@a  2 Y@   K#Y@Ԕa  2@ Y Y @’`3  Y Y @ *:`Y `"(Y"0Y"8 @ Y@@ YH@  @ #Y , @bP@  , `2 YȔXY `@yV 2  Y p@o ` %Y)YYx@d   #Y@Za  2Y@P @K"Y @C `'-Y`+Y)Y@8` "`"  )  |@(  2 `@b``Y`Y А@`!Y Y@ Y @`    Y@Y ؐ@` `YR@ ߀` @Y @`'#Y*: c `Y#Y# @ϐY @ʐY (`@ĐY Y 0`@Y8@' Y @Y HV  Y#PY#`  @ Y h@ Yp@ `6@   @@Y`@ 2@ @  'Y@   `  햐  ݒ  @bx @ 2@큐 ghhhhhi i<iijkLl0l0kLmTlllm4hl< <<- << >> >| > <> <&>&%s 㿘 `       4`  @ @ `  @ `03?`.\ *` €[` "[[[`@"[[  [؀`[@ [@ڒ 2  Y@ϔ0  !["Y!@ooooop㿘 `    ^ $ג  @Ӓ0 2   ^ $ɒƐ ?0Ò㿘 %\N  , p@€NҰ NN`   " ` $ \졒N왐 $얐 (N`&* : N  )섐 $쁐 (~ (N` * : N n ) )k  + " ( "` $N`{  {YN  sN  NN }   }NB  ( | );~Nshqxqqr0rrrss4sLsT㿘'P'T'X@P h'P'T'X   B @PG`N% Nŀ`:~]"*` €zL s *`:  L  iNbdd 2 `2 ݱ `? -,L K *`뾑:  L  AN9! ;  ;맒 뤒+ 럒`  똒?  $N 뎒?  N/  ~zNruvHvHvHvHvHvHvHvHvHvHvHvHvHvHvHvHvHvHuvHvHvHv,tupvHvHvHvHvHvHvHvHvHvHvHvHvHvHtptvHvHvHvHvHvHvHvHvHvHvHvHvHvHtvHt㿘 g m 4 4V  @\$$ ` $  $ ?m$  " $@@?$@  `$@  $   $ ?mo$  " $@@$@  `$@ " @$ $  $ $ $㿘@ "m@@Քwdscan: unknown char 0x%x (carrying on)㿘 #^N + * bd@€N  N N  N`  ?N  N?@? ` 2Nՠ?^N?aXp Nz\zzyyyyyyzzzhȠ   < B#_N  * `T@€疐[NU NP $ (*  : GN`? )> $; ( (*  : 2N`+ )' )& $N`{  {N  N  NN }   }N   ( | )Nzzz{{Hzz{|||0|8㿘  &le ? `- l[ $@$`$ `$ ` $ `$ ` "` $ ` "`$ ` "۷$  ب - &㿘 7  " mf  " m^   mV  " mN   mF " @  ϒ ̒m7㿘  " m, " m&  "m m  㿘@ʒ㿘@9 /dev/ttyNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s㿘զ  @?$% _#$ @W   "a!_#(@P$ `@    @ݐ   _cP 00 @  $ "a!_@,#p  1   "a!_@#p @ ?$ mc @ 㿘! @ ?$ O㿘! # Pk)`k$` #` `!$`$` $```$`` $`Dk$`H`g `$`L"`㿘 #```L"`T`?,` `@!"?@`@ @- ?@ ?<`  `(" `, " `0" `4" `8" `<" `@" jl `X PH@0(    LINENOTMOUTSECONDSRANDOMMAILPATHMAILCHECKMAILVISUALEDITORHISTSIZEHISTFILETMPDIRPOSIXLY_CORRECTPATHOPTINDIFSCOLUMNS㿘  c@!ʔ `# `  @@a"`@`" %s: subscript out of range㿐&@@) @0L@ [,@Ր ' &@3 c`D ckm`c$@ٵ #(&a "ckW`bad substitution㿐! #`IL@ ` x*` h# "#a!  "ሠሐ $ $ ,  $ @ + `+ ` @+` + * :`  ?Ѐ@4 +`@t $[$"L``U߀` "b *` € "E$  @$   l:$ 7$  =}$1$ - =@* D  0L 2b`@`@H$ !$td㿐! #    x*`  # $" $ ;$ `#    L  є " L" @ $""$ $  @\`@$ !$0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyz㿘! @ΐ T# M b"hb" a  & `" ?.@` ?.@F `  #?. @ ?` . @ې ?.@ 0 0? -.0@@.%s: bad number㿐@?2 !c Hr%s: is read onlysetstr: %s=%s: assigning to self㿘$ c` u M R#"7 " @ @  @@ c`   ir &  ?` &@@Ӑ @v ח &   & 2   !&@H 㿘"2&  # ""ሔ"`"`  "`  !&@'㿘! @ϐ L `"P?" &@J @2L@Ӣ#L@   :`  L`x - #- & # $4+?   *@`    ? ??ɠ?  6? @ ?L@ ΢`2 &@㿐2 b  & h  `& & "!&@%0*s%.*s%*s%.*s%-*.*s㿐@ ǐ0@ "$ # `gA0@V @0@ L( "  `2"@ #@ @ @@  @`x* @d d #\" #n* L @ ` `@ `2`@ dN@N@ 0"`dK `@ {@N . `L ` *@ `*J 2 0@N  `L ` *@ `*J 2 㿘    @ @  &f@& @ * =,  $& @   gENVSHELL%s: restricted㿘@P " L [ =@  @  6   x * @` &  L =  #$Ґ@   J#`a`@@ e`H@ e`P@ he X)h6` `ѐ  .@ @$ c2   #g5`@y  p   b@ b2   bb "       ?$"2` ?$$ `* $ p$ p@2$ " F  `"  ? " f $  ?$`"  fŐ  2#""  4&   b    `  #㿘 " f @` `"&  ` fz fw `& `! @ a&!@6㿘  `x* `  N* `2 ` [@ 2J1 x(*  J ` (2 `J [ H(8[`]2H2H㿘ɒ J`?㿘 @  J@ J` =`?㿈! #!d`!'''# PT? H? ?  ; ѤL  : " L@ ?"@ L "   y& $< , d, @''' " ' 6L2T $< , dД, @'''"@`'"@ d㿘@㿘! m!ڐ  @ 2`㿘! ![Ȓ <㿘ݐ ?`9g#*` € ~`,&@  a" $ >@&?*  D >& >&   `  >& !&8pȝ8 ?`h"0*` €# b쀢 ! d#@ʐ$#@$b5 0ғ L"# ~&pe  ԉ 0# `  dŒc@$`L /z@n  u@9 p<  j c@e$` ~&/3~JX`J#`Qs,א!Ӏ G$#Ԑ D$#f>be ~&0  ~&@!(& ~@/&$ "!" `&  "  ~& ` " ?"Ḓa&t 0@d  㿘 ?`/h#T*` €! "쀢 1 d#@ cV#@$"g 0h"xƒ Ӑ "c1    dc@ & ʽ 0 0 DL,8DDLLLLLLDD㿘 @`$2$   &     @b !@?` ~$@$`$`$`$`$$`J@ `]"?["J  ][["  㿘 [@  #"@є㿘0$`c <ޒ    Δ   㿘d8$@@ ~|# b  ` $b `$b@~M5 "( " @  @2 @Đ~V @   ~ ϸ @   "` b@ ?@) ~6b~8 ~6 ~.! ?" @" @$"  ." "  /?㿘 "` Тl h*` €! "p+  $b ^@j "b ?b b @$b  "p " @ L"b@ G@ b    ?π #!"?В "$b !*  #!@ $b@  " /"` "`i#i# @ R а?@  b k @ ! " "` "`@@ < 0Ր    "`@ h @ b*@ "@  C$b`L  `  *` * ?3"  !* `L" ?π "?В "$b ! * J` f#!Ր   1 $b`L  `  *` * ?"! !􀢠 !$!!@ $! ! * J` 7#!Ր    @k$b$b  $b !* ` "$b   @ "4   J"H`  @$ba *@ @K"H $bbb 2 4 a @  @4"4 b "@"" @ ? 0@$b@ 9 b2  " "b4 "" ?  "4 '  ! L  ?  `2  !Ȕ?`L ?  `" 4?  !@ @? "@" $4  @ " 4' @  0!"4* '  J#"` M  - * `"  *@ "   ^  @* `"  *@ "   * `"   @ "c b     W 0X  0Ua$b @Ȓa "   ?5 0G? ? 0B"p` ""0 @ @ 9  !$b ! $"D# "D@b@ " ߀   0%"p`Lb@`s`c`C @   @@"D @|@ S   @ O  @r$b 8xx㿘 ""ڐ?# b0         #"x"b#b|#t", p (@T$b0@Մ    .       㿘 " " 2< "p`   "b ` @ 0"0 ?#"0"` &` ?"  * "`` 0 ?"0` `?#   #`@W#` Հ2! "  "b0" @F "` `" "` "`$  "`@  "   "  @+"  "@0" " "0# "0"~" b(   "", Cm!.  €o (Հ`"!D 0 "( ", "0  a  *@"D J"@ s c C  bD?@uI@  E  b@  ?  J##`!  @ @ 5 ! "  ?@ +?0 "(* # bp`"0  ` "  @"`  "` "*@bp  ""` ` "` "!D p`^y$%s %d%sfc -e ${VISUAL:-${EDITOR:-vi}} --㿘  %@  @@" @  @ @] o " 2"  2@ "`2@! "# b "@` @5"   b "@# # #bD@( @?* : `yq"*` €@ e  `!ՠ!H, # bUN` $?  " JN`@ @ؒ J @ −∀ ``""@  #@ ]p @`,@∀`  @@^,@ ,@ $" 9"   " b|   ""t`"  #  (""p "|   ""t"b @y  " ` "`"pma @  b @g" m"N@N``c ma @  ";`  ` `@x  &?N@ c' N` w W "L @  `  ?  `2?     N` %  N@ c@@N@ y@ " N@ c    b "|  ""bt   % # b88@ ? b8` "? #` "|   ""bt % # b88@  ? 4   "` ?"` a o?  " b|    "t"! " @" @"` D?B"`  "|`    T `|""! ?"@y  ""t'$" "|    ""t"bp#" "|   ""t"ma @  b " "p! "t# b@Q@ "t$b$"t! "t# b@D"@ "t$b"$"t " ` "|   ""btN` `@    *  "|     #""t"p " `j   "|  ""t@ "‰#@  @ ""p " R  "` * `T   #  `T  |t " ?"   m"m"m  @ $ ! "    "|  @" "bt  @"`@’e ! "   "|   ""bt  @#"`@""`"H"`  " "" A"# b ! @"x "x ""t3$b  "|t@  ?"t ""4N@"!@ !@  ?N@`?`N% `?'  t@H   ?@~@ 0""x$$t? & ? GJ L J   `2 "* ?& LJ  ` 2JL J   `2 " ?2J Z '    ##Ӡ L '    # L  `2     "  J 2    |#t " LJJ   ` c @ 2 ?@  ?   ` ?#` Z"bp " ` Q)#    '%b   L  |$b#t ഀ " b$b#t*  (b` `??"`b# ! " w *"("  b@ђ   J## J#$`"?@  @  "p`  "` @" xŰŐxxŜL,x8\`Dp|DŰ8D@l㿘@?* :  `t  s P*` € "`?@T  "`?@%   b   ?@   b   ԰?@@  "` &ɰ 0N@"!N⸠ ☐ @ oU".⸐ %""@㿘 " + "@o< @  ".$bN@o0`" @$"#$b$bo" b?@&b$b "" @  $bN@o`" @$"$b㿀  ) !!D  !!  b  %!\$!D! " %! "    #\#`rǚ @d?0AѢ Ւ %!"D"`5 / + -  3 @ Ӑ# Z 2?@,`@@tt?@ `?!  " ``"`b| %t%p&&bD 㿀 ) !!D  "  @  $!D "!!D  ""  b  %"$!D `%"`   "    #`#\rA `@ް?0G@@ְ?orѐ 0s ',`@ rݒ @+t9 7 / 5 -  . @rȒ @   ,`@+t9 7 / 5 - @ @rk+t Ւ "D`?9 7 / 5 - b%"b@b"s| 2쀤`  "!DJ?`/ Ӑ#v rd| &t&p'"%D3 㿀   #\#` q  o rE 0@>?    H"     ` M-㿘 J#"`  zm!   m ^ @m㿘   "  "5 㿘@mq mi㿘! "  " `R5c@$"$`$`㿘@㿐@&!z"@h {`@   '%@w@"?ሓ* & @ @i@@@ `,`@_,`@* ?Р @ `@P @ `  .L@ ..`.@`@}x"!L `2@@6@@骐?Ш@ϒ `@L @@ ``@@`L`''  @  "@ a@ usage: sleep seconds 㿘{`@!@ 㿘@ 㿘@if%s: destination pathname too long8@# ! %{+- /{ i  $#l$ch $ch$#l@ @W? fa* & @ @@逐 . @%p?@Ԓ  <   $`@`@@@@r?#(?{@a@ @@fM / /-`?< @ /@@. 2L ?`? ` L /"?* L /2? @6 #@@F  @@2 2  Ȳ@Joverwrite %s? override %s%s%s/%s for %s? cannot resolve %s: %scannot rename a mount pointrename %s to %scan't remove %s%sx #h`{@j u #l` @_   {!c@2` #p`+@M  &@ 2" @a@: @f Oa{ {#{#ؔ @#\` `/ `P`? "`@ P  $P `  P ? $ @ߐP  $P` 2 `y`Y2h @  "` !` |@$  {#@F1N @s @J4  {@F!#>  @F'8  @ <   @  | @e | ( @v | 8@E 0<  @,@%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set times㿈 @=  | 8&@2! 6  | 8@E@ @ " "! ?Ò* @ c` ) @ @?$`  %#d@E   8@E0+ @g|cd@x` #d| 8@Ex@̐ |#@Ep@@Y @! " ,  $!|#@E\ 3 6 #h`2} @EO@ } 0@EFD@$!  ! -}D } @@E5 ''''@6耢 } P@E&@T | 8 @r | #@E /bin/cpmv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf㿐'D@'H 2!}#HD}H}cPX @< | 8@Dْ@ɐ @* ? }}#`@D͒cHH }}#p@DĒcH? :}}#5cH@o 2!}#D}}cPȘ @;א| 8@D@ @* ? }}#`@Dc }}#p@Dc  :} }#c@D usage: mv [-fi] source target mv [-fi] source ... directory 㿘!!~a@ɧ~@ɣa@ 㿘@֔㿘@  2"  @< "㿘@   @Ґ &  @<  &㿘 @ @2   '"@% J-`?` J L +  (*J?Ї8 `2 "@ 㿐  ɒ 2  @쿰 $$ %d㿘 @슐  ~ @<   @_ & &㿘 2  `?J@   Đ "   |&=<>+-*/%:()㿘 cx    8"c ."cxL`*L   = @ " #"#L  `<"  `>`!  0  0  "c  "c  "c,   "c|"、syntax error㿘a@ݐ 㿘! #    #| @#  0%sh c M+) JH`@: "  @+!bh@  @4 Ȁ ؀  *@ "   "p @O non-numeric argumentdivision by zero㿘 #/' Ր А  c@> 2` @`& ` c@0 @ & @շ & v Ҁ Ѐ 㿘 #     c@  ` `" & G ဤ 㿐Ң  c s : -5 (?` X *` € -@@J H @D B  /@1 3 QO?` -#ȓ*` €  @ $! 0 @82  @2   @ 4 0  @z`? @t@ ̐ʐ〰      @ llllllllX T(lllllllll<㿘[ c  Q   ^ yc 㿘 c  ̐ ^Zc %d %s 㿘@v`bp@  "#x̐  #`"@ @ `@CF!X0`@CB!`@㿘@<_msgbufpM:N:dmesgkvm_nlist: %s%s: msgbufp not foundnamelistkvm_read: %s: (0x%lx)kvm_read: %s (%0lx)magic number incorrectcouldn't allocate space for buffer datakvm_read: %s%sp@  ! "#57լԮ' 9"!`N"!@@b(`M  @"@@@l0 @ @> @L@m@ @Y@?2 `!"8@Ɛ@O  2 `"H"`@C @a   !"p@`@3 @Q   !"@Ԓ@#  a@b@ @K첒 b@ `@/쀢@" !"@w@  6'@: @  @ @" L`>2 / `<`' `$` `? @^ Oـ`"`Oؔ?"`` * $@* @B`@Ġ `?"`਒ * $@ @| usage: dmesg [-M core] [-N system] 㿘b@[!@j 㿘@ssethostnamegethostname%s 㾘@ #'ڠ) @A@Քc@? sሓ* & @ @2@`" @@a cH@8 @Y;! cX@8|  #h@ɒ . 2*#h@A@ usage: hostname [-s] [name-of-host] 㿘`x@!@ /etc/fbtabr /dev/%o%s: bad entry: %s(null):㻐 `@  aW@ # 2, ؐ@= I`@q  ! @0 L 0`@ ` a  @  ! @W#@h   a@+ a@ $@_M @\/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m...㻘@;@"@) .2`@~   "!`bȐ @VΖ@f : "!`6b$@, @  b@V 0 -+#@ @c  %@@ 2 @RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs%s%sr%s/dev/%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in label㹠@  `m!@>B < @ @ `0#$@H/@P  $@@C? @@x@<? a ,@`:!@>P @   "!``@#?,@s `!@=3 !@=, e`e@  `"@=ܒ@  @. :`@ z` `"(@=  ֐ *` J@   r%s%s%s%c/dev/%s%s%s㿐& "  "a?  @ / @ `@  ac#\ฐ$@ # @& ?$᐀`?᐀  #ธ@$# @ؐ& ?$ᐁ$Id: logwtmp.c,v 1.4 1999/08/17 09:13:13 millert Exp $/var/log/wtmp"h @ "@Ւp В @I@E @A @vސ@ $ $ @ @K$Id: logout.c,v 1.4 1998/07/13 02:11:13 millert Exp $/var/run/utmpp#` @w )  Ѐ @  2@Jɒ @Jƒ @v ?ܒ?@蕐@翔 $ @Ҕ $ $O@$Id: login_tty.c,v 1.3 1996/06/17 07:46:02 downsj Exp $㿘@ `a@̔ ??@5 @5 @5  $ @ڐ 㿈   ?'  @ ?㿈   ?'  @ ?J  (8% $ Jp?2 J <"  J `( %d%02d%03d㿈֨!   @l N''耢 '3 ! #  c @$# &c$#N %} N`rd !*` €\?Y"b @ dR$b(@#K$  $ 2 !  $  $ c*3c*@.'*' `N @$! N @$  ```'' @Ȑ* @ؒ  $` `: * "@$ c@ܐc@ߐ$:  $  'c* N m! c!@@!c*clllllllllllllllllllllllllllllllllllllllllHll\lll,llllllllllllllHllllllllllllllllllllllllllllllllllllllllll㿘 ̔0@/ 㿐 @LC`ذ `` 8  `@c `? , %  8"4 !` @* L`"!4`"!@@ ` ? " @֒ *  @Zǐ   2`D  a?  @ *  @Z   2`F f(?   `Ȁ?  "f("  f,?  a쀢" a耢? 2  a? 2 "f,"!  R`B?2 R`? ` ? 22`B ``!  `@#(`?, )  `8? " @] *  @ZN   2`H  b? "@H *  @Z9   2`J㿘 Ȁ`"" ` 6 "耤 + , `""@$`* @@  2``J  뀤 + 㿘 Ȁ ")?  @ 6$? `& ,` $"@ "$@  * @  2   ,`R   ?`@ 䀤`&?㿘 Ȁ "=   @ 68 "Ԥ a ,` &" "$@ $@   * @  2 `" @,` @ `"  @# @@@ @&@ `@ Ф JJ " J`?{%d}^%c\%03o㿐? ! @嫐   @奐 c  *  @( "@ %c  `  \' `%t` `~o) L@J `ic* #c\ L 'R L\N  `~J L@J `FcL 'Bc@Sa(c@VϠL {3  L ,'@  (cJ }2% ~4" \ L @J`c ' *`' c* *㐠 *@ c* c *@ ``c 0`\^ E` ` L ^*` `,` / B s`,`:`^2 `*㐠 *@Z  ~ L J` `,`: `!`^``^c*B ` `  @俐  ` L `  r2  㐔 n*㐠 *@$  `~ L@ ` `\c  ` ca0@`@  ca8@  ` c*cncurses %s.%d5.2㿘1 #LLb 0@f㿘 `` ?@;@;0 ` @;@;| 2* ? ,,,,,,,,,,,,,,,,,x,p,h,`,X,P,H,@,8,0,(, ,,,,++++++++++++xrptNLMTncnsbsYGYFYEYDYCYBYAhlutccNDNPNRHC5inxxoulhzxtesosmsmidbdainhskmhcgneoxnxsxbambw............x.p.h.`.X.P.H.@.8.0.(. ....------------kndTdBdNdCugYpYoBTYnYmYlYkYjYiYhYgYfYeYdYcYbYaNCpaCoMWmalwlhNlwsvtpbsglmliitcoB BBBBAAAAAAAAAAAAAAAAAxApAhA`AXAPAHA@A8A0A(A AAAA@@@@@@@@@@@@@@@@@x@p@h@`@X@P@H@@@8@0@(@ @@@@?????????????????x?p?h?`?X?P?H?@?8?0?(? ????>>>>>>>>>>>>>>>>>x>p>h>`>X>P>H>@>8>0>(> >>>>=================x=p=h=`=X=P=H=@=8=0=(= ====<<<<<<<<<<<<<<<< 㿘 ?` VV @ @`4``#@: <   .*@: :`"@  @3 㿘!V  bP)N,  J `AJ 9 ` R  4 6/ `L@#D@1&    @`@7 a "  " "   "      @7٠a "  * V &N.  R ` N  @1bt0@1bp㿘1! "?"`2J` ? 2   !"@8`㿘1! "?"`2J` ? 2  o !"@8e`㿐!Rbb  ``  '7 @ 4  ! @1$2bb 㿘 ȤJ` <J`  ~ؐ ? `!?bh @+ % € `?"`` @* "@@txȐ "xbD @1b\ Mb` "I@1`J  ~ؐ ? `!?bh @ % € `?"`` @* "@@t=xȐ "xbD @0xȐ?"x@0b\0] |`"  Ѐ  M!bhR` R` ?   J`@ "x@"t"bt@"bxbhR`R` ?  J`@o "x@"tR`"bt!*"bx  (*R`*  @ ?H?""tH"t""x""t"x""x㿘 Ȯ`` `a䀢 `u5؀`f @a`7Rt?@ Rx?@ϐ ? J` ~ ? ` ?bh @ % €  `?"`` @* "@@sV xȐ "xbD "@/"xR  z`  @`WRt?@ 7Rx?@o? J` ~  ` ?bh @ % € `?"`` @* "@@rxȐ "xbD "@/"xR   ب  2   `@"  `Y S7J `?l ?# 0  4   8  ?  `? 1 bh"@'Ȓ @ @/76h "h"x "t @  J`@  "x"t@ - &@"bx"bt a䀢~ay xR   ?h @@Ƞ  - @ I@.x"x&@Rt?@ R?~; J` ~"`` ?bh @ % € `?"`` @* "@@r xȐ "xbD "@.&@"xR  e- ,c &@@\- 7,`Rt  Rx?@" > J` ~ ? ` ?bh @Q % €  `?"`` @* "@@q xȐ "xbD "@.@"xR  `@``b  @6^ 7!,`Rt   Rx?@ ?Ƞ  J` ~ ? ` ?bh @ % €  `?"`` @* "@@qD xȐ "xbD "@-"xR  `h@ذ 㿘='a   52 +)ؤ.@@@## .$ "@[@bh     J`@ "x@"t"bx"bt  ֢`'.@9`㿘!Rt?@ Rx?@?! ȢJ ` ~!? `!?bh !@G !% €! `?"`` @* "@@p!x`Ȑ "xbD "!@-6!"xR  㿘@ !Rbb bb2bbabd  ex a@:,a"d`@*7@@a%X@a""d! ` - ` @!* Q*`v  aaR`R 4 @)@ 7?  V ~  (@R`?! (@R`?@SR`4 !`(2 `(@2`!R` `(2 `(@2`Р R`4!.  * ?(  2 (@ 2`R !R`.  * ?(  2 (@ 2`R  ` %a`!*`2@:a2bh* @  : `  `J a@@ a"x@V"ta"bx"bta"h`@0 @,   !@"㿘 ` J ` ?# @` !aRR @4@[ @ @ 㿘䀢 'bt "R`bx` + "t*` (*  @"   R`쀣 ` ` s?"h  @ÐaR "x"ܖ" ]`aRt?@ Rx?@f>a ȤJ `` ~"`abh a@ a%`€ a `?"`` @* "@@n axȐ "xbD "a@+a"xR   ?0 `@+r㿘!bh?bt bx@M  `R @+b"@R`ؑ,`a*  `(,   "@ R&`(R`@! P ,`* (,   "@ S &(R`@&P㿘! aRR  ȈJ  a ?# @`  `  `  bl ?#@ c0   4   8  ` @ y? 7 !a  +  (* @*@ `? &*  ?+  (* @*@ `? &* " `6Ҕ  =   `8$4 4"h     J`@x "x @"t"bx"bte e R`  e+   e" S` &e㿘! a.(*  ( e@e . !bl 89R` @4 #Р ? '? !     @2T 2  @2`6T#(+ *  @ 2T  @ T`@ن J `  `!R      ?@2  4 !"h     J`!@Ґ !"x @"t! "bx"btJ `  a?# @`   !R ? !!R  !@2R   @"!R $4`"!J `l ?# 0  4   8  ?  `? ! R    !  *@"! R !2 b  , @" !b $\!R`)!b܀ %!bh@ `   J`!@- !"x @C"t! ?"h""t@ ""x@   @)1`)"h  ?    J`!@  !"x@"t! ?"h""x@ ""t@   @) d4%,!R  8! R`* J`?l ?# 0  4   8  ?  `? >!R @,`  @ @@@"@!"h     J`!@ !"x@"t!"x"tܘ,$@@a*0R ,@"!R @,`@"@w@!$܀ q@h@ `   J`!@] !"x@s"t!,"bt"bxR`?  R`?  >!  J` ~! ? `! ?bh !@. !% € ! `?"`` @* "@@k !x Ȑ "xbD "!@(!"xR  73G,`,   ! %G` @& 8!"h     J`!@ې !"x@"t!$b"bt"bx !"h`@&!,`,   `@!"h     J`2!@ !"x@"t!"bx"btΘ]@&!`bh@ `   J`!@j !"x"t@&@ !"x"t`a "`|  `  @ŧ "-`  `Ѐ !@ŗ" -`А"? -`xn! $@@ݐh!e!`bh@ `   J`!@ !"x@'"t !"x"t`ᤐ`" T  @R" ,!"?(!4 !"h`     J`!@ Ր !"x@"t!"bx"btϒ  ! ?bh @  @r$!R @"@,@΍*㿘 Ȩ``   ` 2 ` ؠ ؤ abl  c0  bhƑ*   @a  J`" x  ` ?bh  @ y   @&`"bt"bx` (?"h""t  ""x"  J `@ \  "x @r"t?"h""t@ ""x@ M   @&``۔` ?"h?""t@ ""x@ :  R`'"h  a  J`@ $ a"x @:"t a"bt"bx  @&-aR`?"h  @  R`}"h     J`@  "x "t@  R`"bt@Z"bxRt?@  Rx?@ < J` ~"`` ?bh @  % €  `?"`` @* "@@i x Ȑ "xbD "@%"xR  ?`R`@R`"h     J`@ x  "x @"t"bx"bt R`! P @ , * (,` `"@ S @&(R`&P㿘 Ȣ`a "L`|@Ɣ@%Z`` J` ~ؐ ? `! ?bh @ # % €  `?"`` @* "@@h| x`Ȑ "xbD "@%° 0X`` T`@% `K`` J` ~ؐ ? `! ?bh @ ֐ % €  `?"`` @* "@@h/ x`Ȑ "xbD "`@$` `؀ "@$ ` @$`0ON' @$``J  ~ؐ ? `! ?bh @  % €  `?"`` @* "@@gܐ x`Ȑ "xbD "`@$r` `؀ "@$j 㿘 Ƞ`!  @ƒ@$^0   @$P`T? ȁ㿘@$H@$ 㿘 5%b .@- * !bh@  ` !J `@  !"x @#"t!bh"bt"bx@  2b 3 X`/2.!!bh@  ` !J `@ ܐ !"x @"t!bh"bt  "bx@ ̐ `X@# !!`.@2-Ȁ2*!bh@  ` !J `@  !"x @"t!bh"bt"bx@ Ȕ  0!`221!bh@  ` !J `@ y !"x @"t!bh"bt  "bx@ iȔ  @Ɣ@#}x!"`7@26Ȁ23!bh@  ` !J `@ @ !"x @V"t!bh"bt"bx@ 0 H7ƲȒ  @#E=! X`42ð?!bh@  ` !J `@  !"x @"t!bh"bt  "bx@  7ƲȒ  @# X!?!bl " c0 2  J`2  @6~ !"h  &   J`@ Ð "x "t@ ظ `R`"btZ"bx!Rt?@ Rx?@b<! J`` ~" `!bh !@  !%`€ ! `?"`` @* "@@e !xȐ "xbD "!@"!"xR  !! R`!@! 㿘 5%b .@- * !bh@  ` !J `@ 6 !"x @ L"t!bh"bt"bx@ & 2b 3 Ԁ`/2.!!bh@  ` !J `@  !"x @ "t!bh"bt"bx@ `@"  !!Ā`.@2-Ȁ2*!bh@  ` !J `@ѐ !"x @ "t!bh"bt"bx@Ȕ  0!`221!bh@  ` !J `@ !"x @ "t!bh"bt"bx@Ȕ  @Ɣ@!x!"`7@26Ȁ23!bh@  ` !J `@i !"x @ "t!bh"bt"bx@Y H7ƴȒ  @!n=! Ԁ`42ð?!bh@  ` !J `@1 !"x @ G"t!bh"bt"bx@! 7ƴȒ  @!6Դ!?!bl " c0 2  J`2  6~ !"h  @   J`@ "x "t@  R`"btZ"bx!Rt?@ Rx?@<! J` ~" `!bh !@ !%€ ! `?"`` @* "@@d !xȐ "xbD "!@ !"xR  !9! R`!! 㿘 Ƞ`a 2a`X "?a `Ԁ ?!bh     J`@X "x @ n"tbh"bt"bx@H    `X Ɣ@ \   a   @Ɣ@ N $7Ʋ Ȓ  @ AX "h     J`@ "x @ &"tbh"bt"bx@    `Ԁ Ɣ@     a   @]ƒ@  $ 1 Ȓ   @Բ2 Ȱ 㿘 Ȧ`J  ` ?# @` ˢ  X  `R 2 +؀ /!bt@@/ "` /!  @  Ȓ  @ؒ @` Ȕ  @a?"bt"bxFȤ` @ڒ  @a?"bt"bx! eF&ؖ񀤿`J  J 怦値$ ` `!bh@  &` aJ @- a"x @ C"ta "bt"bx#)a"h &   J`a@  a"x "t@ !a "bt"bx a  L  `F`+/a"t@@` /  @  Ȓ  @;ؒ @`" aȔ  @?"bt"bx_Ȥ` @  @Ȕa?"bt"bx! eF`2 J `  J )`( $#+a"h    J`a@s a"x "t@ a "bt"bxl aa.`.::@"@9 ?㿘!"bh *bl  !  d " @Q  ` "`@I Ȁ " @B  ` " @:  ` " @2  `  @* `"\ "`  `J` 2 @ 㿘㿘!!"h`!@ !bl  c0  *c0Ɛ? @ ! *#0!S "x@"t! R"x"tג p! ""d  @  @f@Ԥ'Ԓ @% @ ` 'Ԓ@ @M`''Ԓ @   '''@ @L@*  @ @#P@r @ 㿈 c#ؔ 1"c? -'''@ $!쀦  Ƥ ؠ a    @R  a*%a"e@U@a 2""d%| a@( 㿈 @ļ耢 2  耢 2 @ı  㿘# ` .  !   "c c@ĝ 0!#쀢 # c @ē 0 #@& $#& ʐ ǐ b$#   $`㿘!! @"$!!c,` `$%`(#c$##$$a# Ԑ!ВcD@Ľ"㿘  @:㿘aa쀢 !؀2%| "ae| e|2%|"e|@ @ $@ ( , 0# "#(@#( "%@ % "%@% @@  `   @G  "!` @ @! "!"a""##$!   NCURSES_NO_PADDING㿘 @(%آ"!a"a"|@ %a?Ȧ "`"`"bp2`2`2`"bt"bx"b|"b"b"b2b\"bd@3#a*c0a@ "b*1a `#hcpx〔 "c4"eH"eL"eP"eT"eX"e\"ep"c8"e`"eh"el R `@  a "<"@ 2 "bH@³.`a֒aД"@ސ#Da. *eGa*%Fa:"%"%t"%>` @H !؀ s$! @? ؀i#!!a!"ed"` "`$*! *` !֐ $!`@ !` /@   >`aR "@ =!"a @ /!"a`2`a`"2` " $`!a`R`%!"ԓ>` @ޖ ؀`"!a @" (@?   D  " ?㿘   ?㿘!  ?\ €"dT@`@㿈ش!  "l  `  bl  c0`?  /"h%   ` R ?#<.?#؀` ` R  `2`*  `?@ @@ *`@~ @ .  ?# `2 .?` +.    ` 2     0   @  e@ `  @ܔ*@% 7 Ȩ`` " @ʔ' " %E   `  @,  "@ %D  @   `  @? @%r`n?# @2  2S `N @E0F `b `I`6  !6 6 6   6 6 6 6 6 #\  `;`#h `  @  @a? @%/`+?# @2  2 `  @ 0 @  `  @/,  " %E    `  @,  "@ %D @   `  @@,   `   @? @@%"`?# @2  2 `  @ @ @ @   `d  @Ɣ@   `h  @@   `l  @@   `x  @@   `  @@@   `  @@@   `  @ @   `  @y@   `  @n@   f  @c@   f  @X@   f  @M@   f  @B@   f  @7@   f @,  "%""h 㿘Ɛ`؁dh` @l@x@@@@@@ @@l ?@ A 㿐 'H1f"@N[b8`$RN  <N'@t7 > F Nb8 >4 L"<aȐ ` *: ?')":  * .H" N> ` ' ƅ#D° N >!"`2  "<""!b# N ('㿘аb@ ! @ǐ?㿘 `  ! R` @ @G㿘 `p @;!?bp"bx?"bt@\"bp㿘 `` W@#! !$b 4`Ȑ "b`Ȓ  <`Ȓ !#"50`Ȓ !#".H`Ȓ !#"'8`Ȓ !#" D`Ȓ !#",`Ȓ !#"L`Ȓ !#" |`Ȓ !## `!"c"c ؀ "` !"c` `( !`<" @   `Ȓ !#"@  `Ȓ !#"@ ؒ `Ȓ !#"@ϒ `Ȓ !#"@ƒ `Ȓ !#"@  `Ȓ !#"@ `Ȓ !#"`Ȓ !#"`Ȓ !#" 4`Ȓ !#"T`Ȓ !#"`Ȓ !#"@ `Ȓ !#"@ `Ȓ !#"@ ! `#"`@ ْ ! "bc@ ђ `Ȓ !##@ Ȓ `Ȓ !#"@ !"@ 4 `" "` p  @Y ` "b "㿘!!?R` ?@!bp?@!  ` @@ x@sW   b@   @+@sM !bԀK a&!Ȁ@@s.Ƞ`@ @s- " `,t@ 6mВ@sȰ  `,@/@ѐ` W'А`V@s M@ aȀ&@!@@rȠ`@’@r " `L+@ 6$В@rƐȰ  `L@@` 'А` @r @а"@А"@0 ' ''' b@  @rȠ` @l@r !bЀ a'!Ā@@roȠ`@L@rn " `Dؠ@rE"`` '؀`@`  O耢 `.`$(* .@ `L 2 ` ؑ. a* . ``$ (@ bh ? "  ` !`.* .ؖ! $`( * 'ܐ*@"'@ ȴ  `D@@ %А` @q @д"@@^А@qՒ@qے 2TS a&#a"@6Ȑ@qȠ`@@q a" `80"@q`  8b@ǐ@i %А` @q @д"@ А@q@q 2А"@@㽈؀@a a R   @YR@hT @ P@L`T   & "@ C)# `  @є`?` ?"`* "@X ?`  `  @` ` ?"``* "@W  R  4 4 Т"@@p"c@ؒ@q  ?"?R ? ?, , @ Ѐ?@pȒ"n Дb@ ?  ?)  ` @p" S Дb@  "@ 6 Ȣ   `0@p"  8 Дb@  "@ 6 Ȣ   `H"@pwR  Дb@  "@ ` `"  J@ 'J` #   8`"@pHR`? Дb@  b  @p!"`E#*` €! Ȑ`@pC Ȑ`@p:0   Ȑ`@p0HR  Ѐ` `@p Ȑ`@o8?R А"@@Ɣؐ@u  ?,l㿘3ذ!`Ȑ + # - < > | ~ _ : ' o v ^ * ! f&!&!&!&!&!&!&!& & & &!&!&!&!&!&!&!&!&!&!&!&!&!&!&!&!&!& & &!&!&!"l "`@&` bH .@  (`Ȇ "HJ@ a ~ `6  + . 0"   4  f&   "H J `*     * 㿘!*x!RR" RS  S @^&%t ; RR  `.Ra`&2aR "@ 2aa &R @ a 2aR   @ 2 @  "+? 2 a` 2 2` 22` a倐"`2@ې a"%a% "&@a"%&"`"ذ x2d2d2dJ2d<2d,2d2d 4 8   H* 㿘 `e "d@@7 0 @@. 㿘 `e "d@s@ 0 Ґ@j@ 㿘 `d d  @ 㿘  1!Ơ Β1 ` R -!!"#,` R`"@ !  "c(u{a c( , 2  R``a*`"$!֐ $#Ԓ "l@* a "c Y?  J`###Ԇ J ؤ!a`Ȣ d#  # @@ 2@ `2`-2  ? * @*`  2 ` 2`2J` "  2 R@ 22@ #  R `22 #  R `22  ƚ` 㿘. .`: :`@ .*@: @ *`:  &**`: :` @ 76H7@* :  1 &@&@*` *  *  * * 'А "@"@* @7@- : <` 2,,,: :`"@*`" < " @y*  x:   ",:`"@ *`" < " @j*   *`" < " @b* !h* : @q!h6㿐. >  '#Ѐ 6İ?! c0.` & . & ֓, #ԓ:`@ `2?ԑ,`:   a?.`: `#Ԁ@ 6?.:   6? ?a+ : (.   *  ` D)؀A R  :. (R* ( @@  "?!c+` 2S" S ?@3  3 6S 3 @43  S`@$@ R`a<(*`2?h#*` 2 Ȑ "h $`"* J `##  d, : * *,` P :` *`S` S`(PS<#\S@z#`@ 㿘 Ȩ$`. :  #Ԁ 6F?.`0#.: ` c4;?.:  #$2?J `a.  *   8 !.  *2@   2  @ 2`  d  , ,`,,:`::@; @ J @ ` P P`一"伀2 圀"堀2 䴀2 * :   Ԁ`"? + # (@3@ + # (2 + # (2 * :  Ѐ ?*#( 03*#( 2 㿐 7`7#Ѐ@ |` ` "@@6 0m!`.`:  =a 9 . : W`WW  aW .WW )a #1` W  aW  pa #1`W  W  x @ WW #W Wz7W {7 77W "WW Out of memory㿘! .  !@o"Ȁ $!@kÐ"%d0 'P'H'L'T'XH`"!@9 H ! ` L@o"H $ L    ?? ???'3 / K@`%2K@  L'`* K        L* : `X'#ē*` €  *5 *   ) "* *   `"  * L @ ` (* +`?Е:  c 4 *  K    %* *    "*$ @?ߑ* : `]9"L*` €1?`֕*c" 'K ?Ѐ "     ? ?А  ` @?А (` K@?`? K@ 2`#@&DK@ 4  * " # @`&a  !  ** *`#@&a*N . :  % "  Ȑ  *   L'`*K@ @       L* : `X' *` € @ *5 @`*`  ) @"* @*`  "  @* L @ ` (* + ?Е:  c 4 *` K@  @   %* @*   `"*$ @?ߑ* : `]W#p*` € Ȓ`@ %1 * `C$a   ! * ` &a ``L ̒`@ aȀ ĒNaր#ؔ ! * ` &a 2@L    Ē*aր#ؔ ! * ` &a 2@&`L 4̒`@ aȀ Ē̔@P @@̒@$K`?πƢ`* a4L@ *a  * "@ &aaK ` `*`a: ?   ! * ` &a@    *`a: ?   ! * ` &a@   P*|" `  `*`:  `a @ i*`: | `Pa@a K` *a   *"@ &aS` ` А `*`( @@*`: В@ aa  ! * ` &a a   ! * ` &a a a  ! * ` &a a   ! * ` &a a#@a  ! * ` &a a   ! * ` &a  @Đaxa  ! * ` &a a   ! * ` &a  @ɒ Raa  ! * ` &a a   ! * ` &a  @ ,aa    ! * ` &a `)aaa    ! * ` &a `2 a   ! * ` &a `a a4VL@ *a   *"@ K&aa  ! * ` &a a   ! * ` &a aǚ a  ! * ` &a a   ! * ` &a a a  ! * ` &a a   ! * ` &a a a  ! * ` &a a   ! * ` &a @ah`?a  ! * ` &a a   ! * ` &a @  Faa  ! * ` &a a   ! * ` &a @  $aa   ! * ` &a a`?a   ! * ` &a a8 4eL@ *a   *"@ Z&aЀ  'Ԁ 2PL@ K'a   ! * ` &a 2;L@`  2L@`3L@ 2`L@ , % `L@ ? ;`뀢 e`L@` L@ 2`L@  % `L@ ? ;`2L@`L@ ̢`L@  @ Ȑ  * ā$`l$X   (< $ h<\HHHHHHll$llllllllllxl0ll|L888888㿘  ~,°?V @V "   8 4R 4? 0R 4?( @;`@ ,,`*  (`@4@@ ,@ (@h*` F& ( @,`*  ("@  ( 2  (@ 2` "` 4* @*`  0 (* "@ `@ @ @G  ( 26`  @h. ("@ (`F?  4* @ 0*` * " (R @&2  (2 , ?"`2  (@2``@ V ,.`: @6 6 6 ,V .V @ @2V 6 .V V @ 6 VV @ 6 P  @ `4 Ȓ H  ?  P   @`? 4@ 㿀! R` '# ؖ   - " aR  /c-  a"R    - ?"" a?R  '# ؑ- " a'R   '#- @&''耦 #@' l *`- @* *`-`a- %'%@ M@F6c"#a% (,`(Ha, ( (@>  (K@ a (`(-2 (9@ !@*` ( (   c?" "@'쀥6r' *`- @* *`-`a- %'%@ Q  @G c"#a% (,`(a, ( (@  (@ a (`(2 (@ !@*` ( (   "'c  "  ``'!R`ց㿘!!R`#쀢 #耢`@  aR `*` @ۑ*   $a% "Z$#@a"%T$#aR $#a 0a , R}%! a+   (*  R  S+     +  e"S`+ Wae 2aR`@ a"eae aR`@ a"ea   R6%! a+  ( * Q  + `  +` @e " (*`Q     +` @e"@P`ԑ+ a R * @˕*a R`K + e   "   2"  ""S` a R`'֚ # ւ?#+ e    "   2" ""$S# # 2  2  @* " 2 R`O# P6P#+  ?2P R   + " P 2+ @ "@    + @?" " #  :  4 ` 6  6 ?* "@R  &P=倀* R`(`( *   @*? `! 㿘!!%W&  ?"@ )* .`. @ &@@ D! !.`(* P ` .`+  倲@" 0&.` . @"@&@@ ! !.`(* P` ` .`+  倲@" 㿘!#R`c  !#@dϓ*` y$#R`$c R`67?'aR   , ?" $  ",  " R   , @?" " a?R    㤖aR`aR`? 8 6 , @?"?6? &#,  "? , ?"  ? , @?" "?8 R $  g 㿘@ /  .㻘@PY 6" ` "!`2?@А#@F "@* 7@P9 ?㿘 Ȁ @0R (  ?㿘 Ȁ R (@?   ?㿘1  ,   ?`0  `"""㿘1 ͐ X 2? `\ ?"`\㿘 Ȁ ?ɐ Xa  !  ! "` @R !`  `@6  㿘`Ȁ  1!  @: @l!`  `@   ,?㿘 }!Ё㿘 !ЁNCURSES_NO_SETBUF㿘@\#p $@!!` "`  @`j4*! ` @ !" `?@̖㿘 ؒ`!` @1 2   ` ".  . ,%F ?㿘 !`` @ @ . ,%G㿘? 8 ?@\a "   `?" $" $ ? 2* ?  2" $㿘 ?. @ 㿘!`` " ` "`@ 0`    ` @㿘! +bp 1  a0"!a `P  ? `@ "?@a `4  ?@a@c""p?   㿘`2`  2@   `  㿘!,㿘  `d "  @d@'    ``  @S@  !! 4`@A! "`4 ؒȀ Ѐ`ᰀ `|਀ `T2 2 Ȁ Ԁ2XḀ X2 ᨀ2 㿘֐# `%# `ȗ*   @  ,   2㿘`{@ w ` s . o 6@       2   0`  `@ "H6  "#@ڴ@Z &@  @N & ,,`@ .`.6 @ " 6   @6 & 2 @ ,`@ʐ 20  .`.6 @  6 㿘 J `@'@Ґ0!R`@#ؒ@ @Òc@  "!`?@L ``Ɛ ؀@@ 㿘! "  @㿐!`  e  /`R@| 0 "  `? "`` . :  @* "@@Cb 㿘Ɛ@ 㿘? ? Ȁ 2 ' ` ` Ȫ  J `  R `! "  @*R` ` R   L  -؀`0/ƚ +  ,` *  `?Е: ,` .*  L `*Б: @  `2 N *2%@Ғ %N '*`:  $  N <"  ƀ $N x`ƀkNL `.@Zޒ > 2ƀ $ƀ <[NL ` L+  +` *  `?Е: +`N `.*  L `*Б: @  ` L  `2 N  *2  @e N *"N /"N` `  "N@y N ` N }` ` "@d % 㿘#`Ȁ $` @h!`4 `!  * 㿘 " ?@A@`Ȁ""`Ȱ 22KKnn,,XX ` `%%KK ?  ǘp 2` ` "p*` 2`#b  ǘp  "p`` "p*` 2`  㿘#`!@t X* 4 :``Ȁ`2"`㿘  " @9  @_㿘 "O? 8 "K? 0 4B$`" V   T  @41? `V   T  @4"?0?@%.`.* & 0& 4     (@"  ` V  & (  2* ?  5 81R @'8 (S `&R4 ( ((0R @S  $R 2 R 6R2 R`@ނ` 882R㿘 7 8 3V  ,  4 * @ (*` R&V R 0 ("   V  4 R@ $R2R@6V 2V  ؚ` 㿘  V 4@ V  0@@  8  8 㿘 V T`T` T``@T` 2`J  6 @6`6 `*`6 ``6 ` 6 `H6 H` ?6 `& `&  `.  `.  `.  ` . `$& $ `.  `. & 0& 4& 8`,6 ,`.6 .T` *   (@`(@`( (@`2 `( (@`2 V   㿘 B!et< 24 !"et"@@  %؀ ')V  @  ( "V @-V `@ @& (@$䀦"$"$!耦"%!02㿘%"  ` !R "@ `2!!R "@ !@ S @5 S  0@  ( $ ! @~?.@ (*`"  ( .`    " (@  *"  㿘-  * (`&$T @47 T @41 `"2 ?" 2 T T @4 2& 4 & 0 `&  & ./ *   ( (@"   & 8㿘V V & ' * 8 4 㿘  "   @}   @} L  @} $ (@@m !?4  4 44 4 4    4 H4 $  $ R R@`?, , ? , 4 .4 F, , , , $ $, , $ 0$ 4$ 84 ,4 <4 >4 @4 D 4 B  (@ 2` ( 2   aaR@a   4 Ra`4 aR  a  4 aet$`$@"et㿘V  * `7..:":`  * .@ *`* (@)?>&,V  .*  (*"@ V $ ( &V ,`4-`<"> 4<* .@ *`* (@`  <&>V  .*  (*"@ V $ ( 4V ><" @ 㿘 "?  `" V .V ,$@@ 4?   ?@Аh 㿘!` Ȁ "b"bd*xX  Ȓ }"d"X* y Ɛ X?㿘 Ȗ !#bd*xX ~ Ȑ >`"X"d*y  X㿘  dX* "d㿘`!"" d X 8 X d  # d# X㿘`!#"dXXa"d~"X㿘  dX@ s"d㿘`` d *@` d  "d \ XȀ?H?Ȁ?HA㿘 Ȁ ?R (@p a`?2b\2b`2b^  ""|   | &?R 4?`&?R @4 ? 2  2 2 ? ""   㿘 `` ?ð0 ` 㿘 ?` @ @`@?`?㿘  >?  ,@ `@ *: <" 4"% *: *  (@*`  ,`@j.T ?$T 4 T <?@?4 = 㿐@#'@ #* "*"@ *`@*`'@˻  " R @4 `*`   ((R 8@  " R  4  (R      `&,?R @@ &?@ 6# @4  *` (?  ( 00 (  00` @ ` R @$ ( 㿘!䀦  . 0@    ! *. 㿘 ?` !` `!`"`;"`  ?`H4` ` T`*[ !*`R:  4U `  ?(: * @`(*`+` :*V  (*  @-`V =`@4 $+`: +(:`  @"" P?0 06P040*`:  `6 6 ) T`:   !, R :`@ ( `  ,`!*` ` !@``H !@2``  2! `*`㿘 C? @  *V :  6 6  @23?*V :  4-?,V :`@ %?@%,  (* @R?$ 2 <2V * @@ "  ("Ґ   ` ?? @ ???@?@@㿘@2V ` 4 V @(ZL 2\V V `  ?# ? @  ?# ? @ ?#@? @@@ V* @ (*` R?2 26R242*" V   *V .`@:  . 6  6 6 6  6 6  V `L " L! @  "@@ V ."V V @`V  @ ??#`* ` : @   @ @ ? @@ @V* @ (*` R?2 26R242*" V   *V .`@:  . 6  6 66   ? 6 6  ?"?V  6 V .`@ 6   V  { V . $    n   j ?d6 c ??#`*:  V   @   @ @ ? @ V* @ (*` R?2 26R242*" V   *V .`@:  . 6  6 66   ? 6 6  ?" ?L   ?66  㿘 ?@2V ` 4 V @&ܐL 2]V V `  ?# ? @  ?# ? @ ?#@? @@@ V* @ (*` R?2 26R242*" V   *V .`@:  . 6  6 66  ?  6 6  V `L " L! @~  "@@ V ."V V @`V  @ ??#`* ` : @   @ @ ? @@ @V* @ (*` R?2 26R242*" V   *V .`@:  . 6  6 66   ? 6 6  ??V  6 % V .`@ 6   V x z V . $    q?g   h ?b6 a ??#`*:  V   @   @ @ ? @ V* @ (*` R?2 26R242*" V   *V .`@:  . 6  6 66   ?  6 6  ? ?L   6 6 ? 㿘 ?@2V ` 4 V @%XL 2]V V `  ?# ? @  ?# ? @ ?#@? @@@ V* @ (*` R?2 26R242*" V   *V .`@:  . 6  6 66  ? 6 6  V `L " L! @  "@@ V ."V V @`V  @ ??#`* ` : @   @ @ ? @@ @V* @ (*` R?2 26R242*" V   *V .`@:  . 6  6 66   ? 6 6  ??V  6  V .`@ 6   V  z V . $    q?   h ?b6 a ??#`*:  V   @   @ @ ? @ V* @ (*` R?2 26R242*" V   *V .`@:  . 6  6 66   ? 6 6  ? ?L   6 6 ?  . ".   ؁ LINESCOLUMNS㿐 Ѐ`2&@Ȧ  )R`&` Rh&@Ґ#@ & 4&@# 4&@ '@ )) ȦR`(@)؀   ""!%ȒhR(@ ! 2 " 4@&@ 4&@ @ 4 R `$ R $& R@&@  @ Ȑ & P&@  2  `2 R` & % ܁㿐}! %d€㻘@NM / . @V @!   `6` `J@ &*@ `&``   `* ?"" ` &`TERMTERM environment variable not set. TERM environment must be <= %d characters. Not enough memory to create terminal structure. terminals database is inaccessible '%s': unknown terminal type. CC'%s': I need something more specific. '%s': I can't handle hardcopy terminals. 㿘 @*# N  Ð?Ӑ!@sc@  @ܐ" ?Ӑ!c8@s"@  @sڒ 2 ?Ӑ!@sܒch@ F`@  $$ $  $ $ $ $ $  $ $$ $`?&Ӑ!@sc@  ؀2Y&Ӑ!c@s@  ȀR(,$ ,0$ 04$ 48$ 8<$ <@$ @D$ DH$ HL$ LP$ PT$ T֐`` $ @#耢 "`@A` @!``@>  " `2( 8`؀ &` J `&?Ӑ!c@sH@W J   & ?Ԑ!`@s7@F  㿘@O#Ȗ  $  @*`ȕ* @ J@  @8*:  "*@`J@  @Ȗ ` ȁ㿐@#' @?N  "?J ?  "@ KA \ K ;`J  L  #  2 : 뀣`" *!"@  L  (8\J̀ ``2  J@\2J@  @L "J@` @ 2` J@2*  J@`TERMCAP/usr/share/misc/termcap /etc/termcapTERMPATHHOME%s/.termcap /usr/share/misc/termcap /etc/termcap?#d x'@&"b @f" h@L"`Ր@Mb:$M@ /2@O"Ȓ @L-$"@E/h L@ @Kْ ըhՔ@^["!@LВՒb@L̐Ր@LȒc$+@L$ L ! *:   :2 , L  "  :"   `$ ۠ L  `$M@ /2 !?@> !?d?J?!?#d@߅ A% #`#\' '  ,   *@KJ 2JK @2 !??#p@,`& "@"  ɢ` :..!?#\   #` 2˒#p?#d "@  @  $. @2@ $'|:@9 2?բ"@y ?L /֔@  ?#@@L???## ! b " "b @L-"b?c    @ a  -? &@ &` &` &`  &` &` &` &` &`  $&`$$ @  #@ob 2! 2@Out of memory㿘@j 2@LC """"`""a㿘   "!@e!@ba""ab""b 2 |㿘@J{ | @b :  !x. !x  *`㻈"ߔ"$2  @\ː   @JK | $@JD |  terminal names must start with letter or digit㽐ض " ,b@3 L  @K"  b "@G@?2b` b "bb 2b",bName collision between %s %sresolution of use=%s failed`!/'Ȁ`A ! ' '-+׀@(!@g "! @@R @o$ !@I@oc! ဤ@` ?"`* "@1 a`2؀ @ a?"b`y'`( 6qa  `0@@,, `4`, @@J `3פ`0 @ax "!$ ! `3`?????@QЀ '`@" @J`$ԗ*$ ت $ $ $ $ $ $ $ $ $$!'$ (& `2`(""א@J* &Đ '`(&@a`2`(Ā`x 0π `W `($Pa  Д`0 (`E   @N%`( Р`0`(*` *@ `(? $`(@` "` @` "`@` "@$@$`$`$` $`$`$`$`$` $`$ a`2`( !`8 ` 6` `J@ ?"*@ `&`` 6` ?` *R ?"2 `&` `  6a`* ?"" ` &`a`2` a  a?؀`"!a@@ $"@I@a`2a exit_standout_mode but no enter_standout_modeenter_standout_mode but no exit_standout_modeexit_underline_mode but no enter_underline_modeenter_underline_mode but no exit_underline_modeexit_alt_charset_mode but no enter_alt_charset_modeenter_alt_charset_mode but no exit_alt_charset_modeenter_alt_charset_mode but no acs_charsexit_alt_charset_mode but no acs_charsenter_blink_mode but no exit_attribute_modeenter_bold_mode but no exit_attribute_modeenter_ca_mode but no exit_ca_modeexit_ca_mode but no enter_ca_modeexit_delete_mode but no enter_delete_modeenter_delete_mode but no exit_delete_modeenter_dim_mode but no exit_attribute_modeexit_insert_mode but no enter_insert_modeenter_insert_mode but no exit_insert_modeenter_secure_mode but no exit_attribute_modeenter_protected_mode but no exit_attribute_modeenter_reverse_mode but no exit_attribute_modeto_status_line but no from_status_linefrom_status_line but no to_status_linemeta_on but no meta_offmeta_off but no meta_onprtr_off but no prtr_onprtr_on but no prtr_offrestore_cursor but no save_cursorsave_cursor but no restore_cursorexit_xon_mode but no enter_xon_modeenter_xon_mode but no exit_xon_modeexit_am_mode but no enter_am_modeenter_am_mode but no exit_am_modelabel_off but no label_onremove_clock but no display_clockdisplay_clock but no remove_clockset_color_pair but no initialize_pair㿘 ` ?2C``  ?"  ` ?2 @H("  `  ?"  ` ?2 @H"P `  ?"  ` ?2 @H" `  ?"  ` ?2 @G" `  ?"  `d ?2 @G" `d  ?"  ` ?2 @Gؐ# `d  ?"  bH ?2 @GȐ#P `  ?"  bH ?2 @G#x `h  ?"  ` ?2 @G# `l  ?"  ` ?2 @G# `p  ?"  ` ?2 @G  `  ?"  `p ?2 @Gx ( `  ?"  `t ?2 @Gh P `t  ?"  ` ?2 @GX  `x  ?"  ` ?2 @GH  `  ?"  `| ?2 @G8  `|  ?"  ` ?2 @G(! `  ?"  ` ?2 @G!@ `  ?"  ` ?2 @G!p `  ?"  ` ?2 @F! b  ?"  ` ?2 @F! `  ?"  b ?2 @Fؐ! a  ?"  a ?2 @FȐ"  a  ?"  a ?2 @F"8 a܀  ?"  a ?2 @F"P a  ?"  a܀ ?2 @F"h a  ?"  b ?2 @F" b  ?"  a ?2 @Fx" bX  ?"  bT ?2 @Fh" bT  ?"  bX ?2 @FX" b`  ?"  b\ ?2 @FH#  b\  ?"  b` ?2 @F8#H bt  ?"  bp ?2 @F(#p dP  ?"  dL ?2 @F# dL  ?"  dP ?2 @F# $  ? $ ?@E#㿘 "  "Ӱ " "Ͱ   , " $ & " $ &   $ &    ,`@GR 2 ` " $@@@ɴ@ @* Ĵ  @#-  ,` @G8 "   %`0`0  ,'`@* `n- "% " M $"4 I $ "* 2`6 "@Hu6  :&   *?8 1 $ $* 2`6 $@H]6  "&  ,  ??2  $ &* 2`6 &@HE6   &  ,  ??"  $ " &   @H0, ? &  ,  ??" @b "@ ?%& 6 6 Entry does not start with terminal names in column one%s `%.*s' may be too longprimary namealiasusetc%s (%s termcap extension) ignored%s (%s termcap extension) aliased to %s%s (%s terminfo extension) ignored%s (%s terminfo extension) aliased to %sextended capability '%s'unknown capability '%s'maMTbooleanstringnumericunknownwrong type used for %s capability '%s'unknown token type㿘@?@C!X@|"8<b@&!&!&!"DL  | *  @&@& @C-)'%߀  !@ᰒ @C? @Aؒ | $@u& (TRݮ"Da0bD@EaȀ bD@EےaЀ @ ( ,*@ *`"  (b* * 4"@  ( && ("0`bD!D l@  P0 %"! Ѐ`G ')@EbD 2   "@ |D 64" @B /` 耤`0) L` L')@EbD 2   "@ Zl  "P @B ` ``@bD`` "(`bDޔ  "obD@B"` bD@B"0S`Nߠ"bD@E;  0@Aq@  ߠ"bD@E)  0@A_@  @ '`  s` "   " """В"bD@B?"0W"*T` 0B'?` " T`  "T`0@" T`0= ? * 72@? * 2"@T`  -*  * (20  T`* V@@ bD@lT` *`"  ! "(@A0 20@A#0  , :@ o @%@ ]@ @A%"0`@@m +    ( @ ,@@_ + "  (`@ @X0@A@7  `O`2JT J $ @J<* `L2+ 8.􀠠*򀠠/>"*8$+ J`<+ `` @`L2`*8.􀠠*򀠠/>+ + *+   8*8 `㿐///@@㿘 @ Nxph`XPH@80( kcuu1uptakhtsstkentnlkcuf1ndkcub1lekICimkich1ickhomehokrmireikcud1dokdl1dlkdch1dctbcctkclrclkelcekedcdkcbtbtkil1al%s$<%d>hardware tabs with a width other than 8: %dhardware tabs with a non-^I tab string %sunknown capability `%.*s' in ko stringko translation table is invalid, I give upno value for ko capability %s%s (%s) already has an explicit value %s, ignoring koacsc string synthesized from XENIX capabilities``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~x` 2<  `Ȁ 2 af( "a@ "` a쀢 2  f, " @ "a  `2  R D ؒa@&ؐ"@ "` 8 2!  R H ؒa@&֐  J %`2 4ؐ"@y "`8 ?2"8 `, 2! f0 ?2"`, J )`"  R F ؒa@&ؐ"@P "`,  2(  J &`"# 0 ?" ", J )`"  R F ؒa@&~ؐ"@& "b  Y` J )`2 R F ؒa@&aB?" ?"  ?آ! @? @?. +  ` #?"``, ?آ! @> @?  ,@?  @ "a` 2;  J`+ " J`'  "  "`2  R J ؒa @%ؐ" @ "b R?2   J *`2  2  `2 @" "` J *`2.  R `@?"#  " ^b  ! b@>"8@?  "`2 @b"  "b  2` &8 ?" @= i  J` m`?  &8  ,"@ "`@2`@@A_ 2``  ?"h@>da@@OaD`@J`l `2T @>" * @2T`@@>"E* @` @AQ :!T` *` "@@>`@>,?J" @ $2 J <2 J  >J*@`J  ?"*@@ ͐@T` *`" @< , |‥ "  a4 2  c " "a4 "#  J `   ܀`2 !<@ " "` !<`2 @ " "a<  `2 @ " "` &@ ?2>#?fD ?28#?fH ?22#?fL ?2,#?fP ?2&#?fT ?2 #?fX ?2#?f\ ?2#?f` ?2#?fd ?2#?fh S?Q#?bئ#@=c @=yH fL j fH k f@ l fD m fh{ n f`v q fPq t fTl u fXg v f\b w fd] xL @  "bH@=0bH `d  ` @ #H "bHacsc string synthesized from AIX capabilities㻈 &t \?Z#@< @=H ftJ l ftJ  q ftJ k ftJ x ftJ j ftJ m ftJ w ftJ u ftJ v ftJ ے t ftJ Ւ nO  @  "bH@= "&t㿘?2 . !l"L#x @ " @? 2 @;  2 V   2 V 2 0 `Ȥ  * 8(((| `a8 "( (8*@|2`"(* "A J< K@ 2 J`K@ J"`J   J + 8J`J2 `  J  "JK@2JĐ  㿘  "@ " @  " @ " @  " @  " @  "& $@& $&& & & & & & & & (((Illegal character (expected alphanumeric or %s) - %spremature EOFempty longname fieldolder tic versions may treat the description field as an aliaswhitespace in name or alias fieldslashes aren't allowed in names or aliases$[]!*?dubious character `%c' in name or alias fieldSeparator inconsistent with syntaxMissing separator after `%s', have %sno value given for `%s'Missing separatorIllegal character - %s@# `4?  ! @; 8?$`4, 8@  ?@@m    \ ?@a   ? J`1 : : .@N .? "P` ? @B .  ?j`L   `2 . "P`2 آ"X. :`@9   ! 0@@;U@L10 0`0 *`0`"4bؒ?#"8"<"@""0-؀ ,$0,1` \ `@   ,@@ ? :@;T h ,@ ,ڐ $0,1,@0?   :$0,1 0L@ " " ,",` 0@9 | 2L@@L@@:,@,@@ӂ | L 2@:ܐ x L@@:א!00 0@:Ґ + 0@9k  @:Ȑ  0 0@ 0'%@9X( `@`L @ `ۑ*: `/@: 0%D !آ`@a?`L @ `2,@"0  ; _2,@,@",@,@ :` = #"0  ,?p!p! !l!T @!f!L1 0@:!`""Da @%L1 !@ ! 0@:X 0""DO -آ@`L @ `",@,@  N,@@+l 2J!@:3 0J`L1@:(!Ȑ 0D%D"`   0@U* L1:  @:!ؒ0"D""D"  ?@ @: @Premature EOFIllegal ^ character - %sAllow ^? as synonym for \177Non-octal digit `%c' in \ sequenceIllegal character %s in \ sequenceVery long string found. Missing separator?㿘'H    ; ^2 \ %/ \@{?@9!  `L  J ` ?!! @ 4@9 ?2  ,@b `@9!@`" y,@o @L? @9!. @ɑ: & ?Ѐ ' `/-+@5?@9?Ѐ  L @ `a`@9a, ?Ѐ " ,@A?`j+!L*` € 4,@ 1,@ .,@ +,@ (,@ %,@ ",@ ,@ \,@ ^,@ ,,@ :,@!!@ @9! ,@2,@0 2,@ ``XX @9 ! @O`1 ? H@ b0 7 5 ^. ,@> dddddddddddddddddddddddddddddddddLdddddddddddddXdddddddddddddddddddddddddddddddd4d@ddddddddddddd(㿘  "`4@8f 8㿘. > @8?㿘9 ?;   5 7' 4 @/`8#D&< &4  㿘1 @"<? L"<  `. > 2  㿘 bD   "<J@ _ _' "ؒ`""X" "<`J@ O' !1 ' N 0 #@@bD$"4bD 0@ǒ$  $@"ؒ`"""$<@ ">?J *<J`$%t%+%;%+%-%*%/%+%c%s%-%c%c%2d%3d%d%\unknown %% code %s (%#x) in %s$</>㿘       "    "" #b#")"  "b` " @) 9  L `  `@ L `2`*:  * ."` `A*`: %21-"H`b--"H@?ۑ* : `N`"<*` € %-"Hbb  %b"(  % "@☐   %"X@4N@bbpߒ bВbx$bג bbВ bbɒ bb$b@bb$b@bђbN@ = + - * /YN` p cSN` ON@ = N` p N` ?␀@  ?$א` @?֑* : `(!*` €b bb bbbbbZ@$bb     " $$␲@rN@P @bebF @b4b< b-b@2 b#b+ bbN@ 3 22) % bc bc bc<$b'N@ "$?$bc %-"Hb"H$b!N@@# @@3 N@b`"H$bN@ Ē#bΒc@$b!%`@ L `2 "H*:  * . b@"Hb-"H$bH$bb"H-"H"hhhhhhhhhhhhhhh0 8T4p4pp$㿐ؐb`@   L `  ` " \%03oH``L` J ``:`\ ! !  \,"H"H,"H"H`@ @@2c@ؐ%>㿘`ʒȒ%%%%?%%{%d}%%>%%t%%{%d}%%+%%;%%?%%{%d}%%>%%t%%'%c'%%+%%;%%?%%'%c'%%>%%t%%{%d}%%+%%;%%?%%'%c'%%>%%t%%'%c'%%+%%;%B%%{%d}%%+%%c%%'%c'%%+%%c%D%n%mdoxX.%.%r㿈//@~@J >    v J /2sN@%?L `2?*:  . * <2 ?N $"  # ,bH~bH L `2*:  ." *"?N@ \@N` ^ , *`@ *bHbH*:  $*N` <*`%`@L `2`*:  . * / >"`:  % *N` %*`:  %  *bHbH`@ a@v a(@m  aH@e  @0 ;  @ ahap@J  a@C @0 + bҲO`'b@4r  a}``@4f     ~`na`@4W  2 ```o`_a@?ۑ* : `N\ *` €  %*bHMbH1  %."H"H`L @ #`z"H@L `2."HN@@0)a ;N@ d8 0E&c"ab`N@ 1 2$  22N@2N@Ia  0 bp> @ *bH6bH N@  `N@ @2N@  "LǠǠǠǠǠǠǠǠǠǠddddddddddǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠǠDŽǠǠǠǠǠǠ ǠǠ㿘  , '!6 6 6 6 "6 $6 &@y) ,&  2 @y" N&   2 @y&x&   6   *   &   6  ? *2   &      *"   &  ""㿘 @Us" @{"@4h㿘! "@|U" @/ 1 "@@"@$""Out of memory?c  ""@ ! ?#   ??  ?"@""@"@` (?#?  b? , " "" @x" & @0u#"@{   @@&? ?    " 2  "   "@  `@ " $ & < @ ? @  @@{Ƣ` @@"$@xA & @0-# @ ? @   "@ `@@ @{@@ ( @?#@ ,,`@2 " " (`@ 㿘@2` 6``J ` * 2` * `&`` 6` ?` *R  2 "` 2 `&` `  `* ` " "`  " ` &`80( ڸڰڨڠژڐڈڀxph`XPH@80( ٸٰ٨٠ِ٘وـxph`XPH@80( ظذبؠؘؐ؈؀xph`XPH@80( ׸װרנטא׈׀xph`XPH@80( ְָ֨֠֘֐ֈրxph`XPH@80( ոհըՠ՘ՐՈՀxph`XPH@80( Ը԰ԨԠԘԐԈԀxph`XPH@80( ӸӰӨӠӘӐӈӀxph`XPH@~_~^~]~\~[~Z~Y~X~W~V~U~T~S~R~Q~P~O~N~M~L~K~J~I~H~G~F~E~D~C~B~A~@^?~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"! ^_^^^]^\^[^Z^Y^X^W^V^U^T^S^R^Q^P^O^N^M^L^K^J^I^H^G^F^E^D^C^B^A^@ @* h`XPH@80( ܸܰܨܠܘܐ܈܀xph`XPH@80( OTxrOTptOTNLOTMTOTncOTnsOTbslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambwp`H0p`H0 ߸ߨߐ߀hH8 ްޘހhP8 return_does_clr_eolhas_hardware_tabslinefeed_is_newlinegnu_has_meta_keyno_correctly_working_crcrt_no_scrollingbackspaces_with_bslpi_changes_rescpi_changes_ressemi_auto_right_marginrow_addr_glitchhas_print_wheelcr_cancels_micro_modecol_addr_glitchhue_lightness_saturationback_color_erasecan_changenon_dest_scroll_regionno_pad_charnon_rev_rmcuphard_cursorprtr_silentneeds_xon_xoffxon_xofftransparent_underlinetilde_glitchdest_tabs_magic_smsostatus_line_esc_okover_strikemove_standout_modemove_insert_modememory_belowmemory_aboveinsert_null_glitchhas_status_linehas_meta_keyhard_copygeneric_typeerase_overstrikeeat_newline_glitchceol_standout_glitchno_esc_ctlcauto_right_marginauto_left_marginph`XPH@80( xph`XPH@OTknOTdTOTdBOTdNOTdCOTugbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinhspinvbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcols`hP@0 xhXH8(hXH0number_of_function_keyshorizontal_tab_delaybackspace_delaynew_line_delaycarriage_return_delaymagic_cookie_glitch_ulbit_image_typebit_image_entwiningbuttonswide_char_sizeprint_rateoutput_res_vert_inchoutput_res_horz_inchoutput_res_lineoutput_res_charnumber_of_pinsmicro_line_sizemicro_col_sizemax_micro_jumpmax_micro_addressdot_horz_spacingdot_vert_spacingbuffer_capacityno_color_videomax_pairsmax_colorsmaximum_windowsmax_attributeslabel_widthlabel_heightnum_labelswidth_status_linevirtual_terminalpadding_baud_ratemagic_cookie_glitchlines_of_memoryinit_tabscolumnsH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`Xbox1memumemlOTGCOTGVOTGHOTGDOTGUOTGLOTGROTG4OTG1OTG3OTG2OTmaOTkoOTbcOTnlOTrsOTi2slengthsgr1evhlmethlmerhlmelohlmelhlmehhlmscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcocopu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoffcxoncrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbtxhP@0( xhXH8 x`H0hP8(xhXH@8( p`PH@0(pX@0 xh`P@0 p`PH@80(xp`PH8(p`P@0 p`PH@0          x h X H 8 (                 x p h ` X P H @ 8 0 (                      x p h ` X P H @ 8 0 (           x hxp X H 8 0 (               p X @ 0  x`H0x`H0 pX@(hXH8(xhXH8 x`H0x`H0 xhXH8(box_chars_1memory_unlockmemory_lockacs_plusacs_vlineacs_hlineacs_tteeacs_bteeacs_rteeacs_lteeacs_lrcorneracs_urcorneracs_llcorneracs_ulcornerarrow_key_mapother_non_function_keysbackspace_if_not_bslinefeed_if_not_lftermcap_resettermcap_init2set_pglen_inchset_a_attributesenter_vertical_hl_modeenter_top_hl_modeenter_right_hl_modeenter_low_hl_modeenter_left_hl_modeenter_horizontal_hl_modealt_scancode_escscancode_escapepc_term_optionsexit_scancode_modeenter_scancode_modeexit_pc_charset_modeenter_pc_charset_modedisplay_pc_charset_page_lengthset_color_bandend_bit_image_regiondefine_bit_image_regioncolor_namesbit_image_carriage_returnbit_image_newlinebit_image_repeatset_tb_marginset_lr_marginset3_des_seqset2_des_seqset1_des_seqset0_des_seqcode_set_initdevice_typepkey_plabset_a_backgroundset_a_foregroundget_mousereq_mouse_posmouse_infokey_mousechar_set_nameszero_motionthese_cause_crsuperscript_characterssubscript_charactersstop_char_set_defstop_bit_imagestart_char_set_defstart_bit_imageset_top_margin_parmset_top_marginset_right_margin_parmset_left_margin_parmset_bottom_margin_parmset_bottom_marginselect_char_setparm_up_microparm_right_microparm_left_microparm_down_microorder_of_pinsmicro_upmicro_row_addressmicro_rightmicro_leftmicro_downmicro_column_addressexit_upward_modeexit_superscript_modeexit_subscript_modeexit_shadow_modeexit_micro_modeexit_leftward_modeexit_italics_modeexit_doublewide_modeenter_upward_modeenter_superscript_modeenter_subscript_modeenter_shadow_modeenter_normal_qualityenter_near_letter_qualityenter_micro_modeenter_leftward_modeenter_italics_modeenter_draft_qualityenter_doublewide_modedefine_charchange_res_vertchange_res_horzchange_line_pitchchange_char_pitchset_backgroundset_foregroundset_color_pairinitialize_pairinitialize_colororig_colorsorig_pairuser9user8user7user6user5user4user3user2user1user0wait_tonefixed_pauseflash_hookquick_dialdial_phonehangupgoto_windowcreate_windowremove_clockdisplay_clockset_clocklabel_formatset_right_marginset_left_marginclear_marginsclr_bolkey_f63key_f62key_f61key_f60key_f59key_f58key_f57key_f56key_f55key_f54key_f53key_f52key_f51key_f50key_f49key_f48key_f47key_f46key_f45key_f44key_f43key_f42key_f41key_f40key_f39key_f38key_f37key_f36key_f35key_f34key_f33key_f32key_f31key_f30key_f29key_f28key_f27key_f26key_f25key_f24key_f23key_f22key_f21key_f20key_f19key_f18key_f17key_f16key_f15key_f14key_f13key_f12key_f11req_for_inputkey_sundokey_ssuspendkey_ssavekey_srsumekey_srightkey_sreplacekey_sredokey_sprintkey_spreviouskey_soptionskey_snextkey_smovekey_smessagekey_sleftkey_sickey_shomekey_shelpkey_sfindkey_sexitkey_seolkey_sendkey_selectkey_sdlkey_sdckey_screatekey_scopykey_scommandkey_scancelkey_sbegkey_undokey_suspendkey_savekey_resumekey_restartkey_replacekey_refreshkey_referencekey_redokey_printkey_previouskey_optionskey_openkey_nextkey_movekey_messagekey_markkey_helpkey_findkey_exitkey_enterkey_endkey_createkey_copykey_commandkey_closekey_cancelkey_beglabel_offlabel_onena_acsxoff_characterxon_characterexit_am_modeenter_am_modeexit_xon_modeenter_xon_modekey_btabplab_normacs_charschar_paddingprtr_nonkey_c3key_c1key_b2key_a3key_a1init_progup_half_lineunderline_charto_status_linetabset_windowset_tabset_attributesscroll_reversescroll_forwardsave_cursorrow_addressrestore_cursorreset_filereset_3stringreset_2stringreset_1stringrepeat_charprtr_onprtr_offprint_screenpkey_xmitpkey_localpkey_keyparm_up_cursorparm_rindexparm_right_cursorparm_left_cursorparm_insert_lineparm_indexparm_ichparm_down_cursorparm_delete_lineparm_dchpad_charnewlinemeta_onmeta_offlab_f9lab_f8lab_f7lab_f6lab_f5lab_f4lab_f3lab_f2lab_f10lab_f1lab_f0keypad_xmitkeypad_localkey_upkey_stabkey_srkey_sfkey_rightkey_ppagekey_npagekey_llkey_leftkey_ilkey_ickey_homekey_f9key_f8key_f7key_f6key_f5key_f4key_f3key_f2key_f10key_f1key_f0key_eoskey_eolkey_eickey_downkey_dlkey_dckey_ctabkey_clearkey_catabkey_backspaceinsert_paddinginsert_lineinsert_characterinit_fileinit_3stringinit_2stringinit_1stringfrom_status_lineform_feedflash_screenexit_underline_modeexit_standout_modeexit_insert_modeexit_delete_modeexit_ca_modeexit_attribute_modeexit_alt_charset_modeerase_charsenter_underline_modeenter_standout_modeenter_reverse_modeenter_protected_modeenter_secure_modeenter_insert_modeenter_dim_modeenter_delete_modeenter_ca_modeenter_bold_modeenter_blink_modeenter_alt_charset_modedown_half_linedis_status_linedelete_linedelete_charactercursor_visiblecursor_upcursor_to_llcursor_rightcursor_normalcursor_mem_addresscursor_leftcursor_invisiblecursor_homecursor_downcursor_addresscommand_charactercolumn_addressclr_eosclr_eolclear_screenclear_all_tabschange_scroll_regioncarriage_returnbellback_tab@h@`@X@P@H@@@8@0@(@ @ @ @ @ ?????????????????x?p?h ?`!?X"?P#?H$?@?8?0?(? ????> > > > > >>>.>>>>>>>>>x>p>h>`>X>P>H>@ D>8>0>(> >>>>== = I= = = ===========x=p=h=`=X=P=H=@=8 =0!=("= #=$=%=&='<(<)<*<+<,<-<.</<0<1;<2L<3<4<5<6<7<@?<8@<0A<(B< C<D<E<F<G=;H;I;J;K;L;M;N;O;P;Q;R;S;T7;Ui;V;WQ;xX;pY;hZ;`[;X\;P];H^!;@_;8`;0a;(b; c^;d;e;f;g:h:i:j:k:l:m:n:o:p:q:r:s3:t:u:v:w:xx:py:hz:`{:X|~:P}:H~:@:8:0:(: ::::99999999999999999x9p9h9`9X9P9H9@98909(9 6999988F888888888888P888x8p8h8`8Xe8P8H8@88808(8 8888 77H777777777777777x7p7h7`7X7P+7H7@78707(7  7!7"7#7$6%6&66(6)6*6+6,6-6.6/6066263646x56p66h76`86X96P:6H6@<68=60>6(?6 @6A6B6C6D55 F5 G5 H5 I5 55O5L55555%555x5p5h5`5X5P5H5@58 50!5("5 #5$5%5&5'4(4)4*4+4,4-4.E4/40414243444546474x84p94h:4`;4X<N4P=4H>4@?48@40A4(B4 C4Dp4E4F4G3H3I3J3K53L3M/3N3O3P3Q3R3S3T3U3V3W3xX3pY3hZ3`[X3X\3P]3H^|3@_38`30a3(b[3 c3d3e3fW3g2h2i2j2k2l2m2nm2o2p2q2r2s2t2u2v2w2px2hyt2`z2X{2P|2H}R2@~28202(2 2222111111!1%1&1'1"1#11 1(1)1$1x%1p&1h1`1X*1P+1H1@18101(1 1111<0y000box1memumemlOTGCOTGVOTGHOTGDOTGUOTGLOTGROTG4OTG1OTG3OTG2OTxrOTptOTmaOTkoOTknOTdTOTdBOTNLOTMTOTbcOTnlOTdNOTdCOTncOTnsOTbsOTugOTrsOTi2slengthsgr1evhlmethlmerhlmelohlmelhlmehhlmscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcocopu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoffcxoncrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbtbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinhspinvbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcolslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambw/\%.%#0"-@,8)t*d!% &,0`++T*.`'*04+</ # Xh/D)P\-"`*P%0|*%$8)!!"l.$0*($|l+H!X"$@+,+$ \!++x+,&4, +@)#.$H",d*)*4p,0(-4-*p&8%T)&.H.0(T)**@0@%#D0d.,#)\*/-0(0-") !4"x t&-/+@-++l H 8!d,-p#+0).#0!!,D)"0$ x"T$.T*L%.d,,+ #+ !(*|#$/&D-!!-d+*0X"0/,&/,+D...&t.&*h-L0$4), !@*-&\/h" )t+T D!p"$"H*&"#8-//".<,/0p..&h04% $-0#,$-(-*X.00p,,'d/*0L#&/!D )*#\$#P/t-X/P ,t-.l)/8!|&/<,, !L&tX$p8$&, P!| ,P/-|/. ! h ,\@h@`u@u8u0@@@8@0@(@ @ @ @ u( u ?u???uuutttttttttt t!t"t#t$t?8t?(tx??tpth> > > t` tX tPtHt@t8t0t(t ttttssssssss ss>(sssssssx sp sh s` sX sPsHs@s8=s0s(s :s=xsssrrrrr r!r"r#r$r%r&r'r(>)r*r+r,rx-<.rp/rh0fr`1rX2<3rP4rH5<6r@7r88r09r(:r ;r<r=r>r?q@qAqBqCqDqEqFqGqHqIqJqKqLqMqNqOqxPqpQqhRq`SqXTqPUqHVq@Wq8Xq0Yq(Zq [q\#q]q^q_p`papbpcpdpepfxpgphpipjpkplpmpnpopxpoppqphrp`spXtpPupHvp@wp8xp0yp(zp {p|:P}:H~p:8ppooooo99oooooooo%ooooxuopoho`oXoP~oHo@o8o0o(o oooonnntnnanmnnndn nnvn`nnWnnxnpnhn`nXnPnHn@n8n0n(n nnnnmmmmmmmmmmmmmmmmzmxmpmhm`mX.mP'mHm@m8Xm0(m(m m/mmmll5l6l7l8l9l:l;l<l=l>l?l@lAlBlDlxElplhl`lXlPlHl@l8l0l(l ll^llkkkkk k k k k kkkkkkkkxkpkhk`kXkPkHk@k8k05@58 50!5("5 #5$5%5&5'4(4)4*k(+k ,k-k.k/k0j1j2j3j4j50j6j7j8j9j:j;j<j=j>j?j@jxAjpBjhCj`DgjXEjPFhjHGj@Hj8Ij0Jj(Kj LjMjNjOjPiQiRiSiTiUiViWiXiYiZi[i\i]i^i_i`ixaipbihci`diXeiPfiHgi@hi8ii0ji(ki limCiniokpUiqhrhshthuhvhwhxhyhzh{h|h}eh~fhghhhihxhphhh`hXhPhHh@h8h0h(!h %h&h'h"h#ggi(g)g$g%g&g>{g*g+ggggggggxgpghg`gXgPgHbxmumlGCGVGHGDGUGLGRG4G1G3G2xrptkokndTdBNLbcnldNdCncnsbsugrsi2sLsAXvXtXrXoXlXhS8S7S6S5S4S3S2S1YZYzYyYxYwYvZzXyMTs3s2s1s0cidvxlABAFGmRQMiKmZyZxZwZvZuZtZsZrZqZpZoZnZmZlZkZjZiZhZgZfZeZdZcZbZaZZZYZXZWZVZUZTZSZRZQZPZOZNZMZLZKZJZIZHZGZFZEZDZCZBZASbSfspIpIcWAPAfhPUTOQDDIHUWGCWRCDKSCLfMRMLMCcbFrFqFpFoFnFmFlFkFjFiFhFgFfFeFdFcFbFaFZFYFXFWFVFUFTFSFRFQFPFOFNFMFLFKFJFIFHFGFFFEFDFCFBFAF9F8F7F6F5F4F3F2F1RF!3!2!1%j%i%h%g%f%e%d%c%b%a#4#3#2#1*0*9*8*7*6*5*4*3*2*1&0&9&8&7&6&5&4&3&2&1%0%9%8%7%6%5%4%3%2%1@0@9@8@7@6@5@4@3@2@1LFLOeAXFXNRASARXSXkBpnacrPpOK5K4K2K3K1iPtstawistsasrsfcvr3r2r1rppopfpspxplpkUPSRRILEALSFICDODLDCpcnwmmmol9l8l7l6l5l4l3l2lal1l0kskekukTkRkFkrkPkNkHklkAkIkhk9k8k7k6k5k4k3k2k;k1k0kSkEkMkdkLkDktkCkakbalici3isi1fsvbueseeitemeaeecussomrmpmkimmhdmtimdmbasdsdcvsupndveCMlevihodocmCCchcdceclctcsblbtYpYoBTYnYmYlYkYjYiYhYgYfYeYdYcYbYaNCpaCoMWNlwssglicoYGYFYEYDYCYBYAhlutccNDNPNRHC5inxxoesmsmixnxsxb[RY\Leed^c<V(USLS|THcZ_aP]g fVpXPYdhd,e4^f`T`Ubpa,WXa\T$`e^cS@SpQUbfYpQHQPdcg8d ]PX_\QladfH^bZ0ZP|]TX\_4]ZxWfxR\YdYQ^8bW0US_d]H\Sa[c\(UDU UPT^hcdDU8Z_dZl]xf[Y\XTSf e^fW `QSTZ_TPX]bLV|WYdte@^gW<b|VWa^cYWTdg,VdddcSX,]gQ XP_Rh`0`_\Qxaatf^bU_P_@]$`HUQa` Q\|ahU\P`$^Db[_pU\a[X\4YLXD^tc$ZZ`x_]f[VLWxY\ddPe^cTZZP@_Ppf`]bXVZ$`<eLe|^cV@RDSXW$bVWYXfaedcY4d8ddP]fQ0`l_]aDQa^ fVZf$Q<T<T_L]0\aea8X \Y@YXhX8^PfWdf<Z_|]`f[Y\@Qed^c0VQ$eRPZ_]b4[VXXY\pXd\e(ep^c`Wf0Z SP4[Sfl]bdVXTfTP`^cWHTleSdTTZHZ<PdUWlbeVXeYTT0RPa dcO]X`Z`ZT\`Q`aZ]VXte_(] Qa``^,bV4SX_X]<\a[\SeX^\c VS`_V]lfOHp@8r0(sX0 s@0r0lo80lo@0r0rrssXs@oqrqpp8p@kHqhnphq@xph`XPHn@8r0(q m` mX mP mH m@ k mk BCKFKEKDKCKBTekKAIRISHSIBMkqGGGcGvGhGdGuGrG8G5G7G6RTPSPNPDLDHMENCOCFGSGEXENIXEEXSDSCVCIAT&TBOBSDsb2@2@2@2@9@80@kselkbtabfont3font2font1font0  Dl(null)(cancelled)\%03o㿘`1"j! ! 1"e!(. "@L* @`$ ".N@ Q` \%'"", L @ ` 2,  ,4   ,  n,   r,  b,  e,  L@ `  @,  ^, ,   @I8@LNN@` ",, 㿘  " "`" *@㿘 @ ` ` 㿘`@L` ` "`@^`@$`` "$` 㿘`@L` @ "`@B@@$`` "$`   㿘  "@"0*"ȁ㿘 @$bȁ"%s", line %d, col %d, terminal '%s' 㿘 "'H'L'P'T`1'X b!#`@$ϐb#`@$ǐ"#`@$ JbȀ b#`@$@!3 :@!0 @%H#@$`㿘 b!#`'H'L'P'T'X@$b#`@$"#`@$ JbȀ b#`@$@  :@  H@$#@$q`@K 㿘 b!#`'H'L'P'T'X@$ab#`@$Y"#`@$Q JbȀ b#`@$H@ Ő :@  H@$#@$:`@KI 㿘  @   @. $`  . $   @. $ `? 4@ ?@. $ `    . $  ?㿘`@ǰ     㿘 " $  &'  & * 2`@6 &  "  ", @  @  @*  @*@?, 6 " $ .&  * 2`@6 &  $  "* .@,  *?  "  @2@2??6 $ & ,'  * 2`@6 &  &?  "*  *.@q  "  @"@"?6 &`" "` `" $  " `"  $4  "`2 "  " " $ &㿘ڐ:? , @ 2 * ?  4 $2 $ "    $ "     & "   㿘Ô c " $ &  ?   +     " ǔ!" E "- A ? 6  "  `*   &  " ?6 *6 " ? 6  $ +     2  $ ?6 6 $? 6  & +     "  & ?6 6 &  㿘4A " $ &    ,  @L X6  @, &  +  ??"  "H%" S": O "* 2`6 "@6  @&   * ?8 7  $* 2`6 $@u6  '&  +  ??2  &* 2`6 &@X6   &  +  ??" 㿘 " $ &  @I,`  &"" @ *  ;@      &G  *@   А͔   Ɣ   + * ?2`㿘 "`" $`$@ & `&  `@  $`$@   , `  @^ "  `l@D*  & " `&`"`$ u`& "   " $ " h ``"& "`"`* "  *`  $,`$ "`"* + `  $@ `$,`*`* &`& @ M  "& @D& @;-``@d&`@G㿘@&`& `& ` & `& `& `& `& ` & `$ @De& $ & @Da*` & @D]*`   & `  *@  &`  6 ` ,    2   &`   6 `"`,    "  &``"`$`&  , @D(& `@F”0& 㿘 @D[  @D; " "a@D/usr/share/terminfoTERMINFO㿘#! b 2"  "`2"@F` "'@D"  b *b$""㿘ݐؐ *b??   2 2  2 2 (2  㿘 @E?/`/` 2/`&@(/`&@/`&@@`N  N2 8&@@‡/`!?#&@&`&`&` &`&`&`&`&` &`$@E 2 #*` 2 #### # #*`*  *+`+ @  R OM`K -`/4s @C! &`l  ?#""@Ea/@F @  +&@@͒" > ;   @F , ,@  &`@E? @E6 ' '@i  &` .@E(2% ` a!@S  &``-`@E2  `@E 2 `` , '!6`6`6` ?c @D  "(`#?c@D 2ưcc cc*` c **   cc   *`*  4° /4  ,+ '`6`6` 2`?6`&``` :*`&` ` `5*`, &`` 6`"``,@D2 ?c @D , 6`$?#,@D2 ` `NU? , c @Dm2j ,@B 5&`@D_\ , #6`&`-`?#@ `K * `. @ "fx`x? "?@Ef?@k  &`- ?#,`@  +4 `*  +$` &4 ?. `   &2 !4  . ` !"  㿘@   B  @p   1 ܐ@D%s/%s㿘@E# )c@Ғ 㿘@] 0 '' L``:2 ` ,Җ 뀤` @A~%c/%.*sTERMINFO_DIRSp@^ 9*N`ؠ@߳  b  9  2 @C 2'''@Aߐ"  $  @   * *@A '"TERMINFOHOME%s/.terminfo/usr/share/misc/terminfo㷈@CZ耢 *@A"0  @$#'@CG 2**@A"@ *J@   *H@ $#*$ *"X$$ 耢 @. 2 @$  2 㻘$@ސ@ / .@ /   *@ 㿈'''@ @Ւ V @C@@t  7@Ò : 2& @C ,.@@` *@ N`   ,:2\"*@*@` N  *@*`   e !2  &&& & &&&& & $&$"쀢 `@@E`@@@@Z`?HOMEOut of memory%s/.terminfo㿘@Bu & b   +@@!ఒ ""N ""@Cl $8"@Cf@? $"+Ր!+a@S"$OpenBSD: kvm_file.c,v 1.3 2000/02/19 22:01:31 deraadt Exp $can't read fileheadcan't read kfpinconsistant nfiles`(0((  @   +(((?Ģ`"@Ā` 0 @  0 0?Т`0@` 0  ++ @ɰ kvm_getfiles_filehead_nfiles%s: no such symbolcan't read nfiles`( N  '' 'Ē   @C. ?$((`2(0@ &((Ā :((@&((((Đ&(0  @C ?Ā`8 ((,@(j   a'@ _@ 'X`0@ U&,, 8`H'''@ *  ` ` ` 2` @ ,@CP7 А@   ,@5h) ` *` ((*  `'Ē @} &(((0 :((@&(((( Ēܔ&(0 '&(($OpenBSD: kvm_proc.c,v 1.6 2000/06/18 17:59:54 niklas Exp $($ 2 ` ( @J r&($`  $ @"s @  < <b Ā@耢`@ | ( (2[ ( &@8$ E@8* @D@ d  2C D@ \  2; `H@ R 4 421 x   (  @Aa && ($( (( @7m ;   @AO & ($(@@( ( "(   @'$&($can't read proc at %xnprocs corruptcan't read pgrp at %xcan't read session at %xcan't read tty at %xcan't read tpgrp at &x㻀 @6̰"ɰ/-+---'-)-@!@!@p@6?X@ږ  `Xp@Җ P` ``@0`@0  t\ "@-@?8'P@  a5HN'D7 'T@  $D )$`& @ $' '@v  !@İ?0CH'?'?' @ 'ؐ`'h`@U @P 7'7Ԁ`7Ҁ`   @@(|!@!@P@(x!"`@耦Ccannot read allproccannot read zombproc㿐(@  .H @  .`@M?0. * #+  '@ & kvm_getprocsproc size mismatch (%d total, %d chunks)_nprocs_allproc_zombproc%s: no such symbolcan't read nprocsP( "(@<&(( ;  ?'''   @@ ?@M &(  @@| ? .@X\ "@&O  .h@ט"N @6-"F'.."b.''''ܐ@  ` ` ` 2` @ .@' @S  .@ *@ *`" * @' &(̒ؔ'&(㿘( @,`$ $  @`2$,$  (4:$ $(4"@ " "@ "X@K!@!@ 4쀢@ O逢 2 N1 " p!  Ѐ    ?'ؒ ܖؘ @?  $ N`1  А@:   ԟЀ   h a@ " 㿘0|㿘0invalid address (%lx)㿐 %06  @@'   @& &$OpenBSD: kvm.c,v 1.19 2000/10/25 23:37:38 deraadt Exp $ %s: 㿘'P'T'XP!!0c0@D@@ 0 @(: %s : %s㿘'P'T'XP#a0c0@"@ "a!0@T#@0 (@ʐ@= "a(#0$  @>c@H%s㿘@:a   "a!1@* Lseek㿘! "@=Q$!?  ! 1??Read㿘! "$!@(H&($&((&(,&(4&(P&(T&(<&(@` &(D@=Z#1?1`1!1!@  &( 1z@4 1p<  N`1a@  1j`1" @ h &(1O@ \ &(1C`1"0@?O` @ E ?-&(`D1"8@ < ?>&(1"0@ 4 ?6&(1@ + ?&(`1"8@ " ?&(1"0@  ? &(1 `@ @   ` @'@; x(   ֘ ?2( "?(  2??### cʀ@2?2 # 2? 2? k&(<" " "( ?2( "Y(<(   2Q(<c @@2K(<2` 2G(<  o&(@ <&(D(  { ?2( "1(<( (D䀢@2'(< (  d ?2( "(<( w  2(<   2 2(< >(H (< "(D@8&(<(D "?@8&(@&(D?already has a dump headerdon't use on live kernelinvalid magic in cpu_hdrinvalid size in cpu_hdrinvalid dump offset㿐(<  3 ?( 3@?(  ?2( "?(   2y??c# #ʀ@232 # 3`i e? &(@ M&(D @  ( D Ø ?2( "@(<( (D 3(@ @ >`D  >(H(   ?2    3. (< &(< 2`(< 2`(< "(<"#"@@ 2(<(< "(D@7&(<(D "?@7&(@&(D?clear_gap㿘  38 ? @?  no valid dump header(s)kvm_dump_wrtheader㿐(<`(D   3͔V?  @g I(<`”??F#(@ c ?''  @g 2(<` ?"/?(D (@@go !(@ "@ ?##''  @g[  (<`? ?2 03?㿘@7,(`  ,   "a@ @툔'%s: %s 㿘@7(`   "a!#4!@֢aД@  " 㿘(  @9v( &(@9o( &(@9h( &(@9a( "(P @(P "(D@(D &(@@6(< "(@6( "($@6($ "((@6(( "(,@6(, "(4@6(4 @6@6Ő%skvm_%s.db/var/db/file %s is incorrectly formattedinvalid argument to dbopen()unknown dbopen() errorVERSION_version@a?c 44Ȓ$@F   @ #$( "! " O 54X?5R?5 L?5 8 ?   2:( 5􀢨2@!Y(5`@ ''   2"(` 2( @!? ?#@2 (@Β 2( ( @?$(bad namelistsymbol too large㿐 2@@MY?N5h 0H5xB? 2J .1@9>$ ' '  2 ` 2  ` @ ݔ   @ ה   $J $*` . .  .  > &clearing dump on live kernel_dumpmagcannot invalidate dump - lseekcannot invalidate dump - writex( 5=6 ''{?25.h @d *# "( ܐ@$$a   @8P ?2 ( 2 ( a 6(( '@7l  6 H p?invalid address (%lx)kvm_readshort readno valid dump header㿐h / ! "  $!@8 ?2h2h!  6< a?h@7@  6P S?Q6&0Kh< hD 6=?4 7$6.1$.@͔ ǀ8@h  ! "  $!@7 ?2 h 2h ! 1h @6 &Ԑ"$ֲ@$kvm_writeshort writekvm_write not implemented for dead kernels㿘( / 1 "  &!@7| ?2(2(!  6 ?(@6  6 ? 607?$OpenBSD: kvm_sparc.c,v 1.4 1997/06/11 10:32:16 grr Exp $_kvm_freevtop: internal error㿘(P 7Xi&(PUnsupported CPU type㿘(D  "c &(   "`  &(    "`ؐ7C?( @.A "`ܰ 㿘# Ӑ #?# @@Xinvalid address (%x)㿘=#@8(D6`?6` `?*  *    *  ?$  @,Ӑ c? >`  ?>` *  7(  `?+@ *  &(  & 7ЖԒ  cannot read pte for %x㿐=#@K(D6`?6` `?*  *   ` >c?  >`  >` |@ @8 /   ( @6_ ?2(  ( @5  8 `  7( ?@* &(  "@7Ж s 㿘(D       2 8 B   2 D 7(H@F@F @  fЖ8 ??㿘 `  #  $# ?@# ` 㿘#(#( %8   `` آ#(, @@?, @ ِp㿘 `  "` 2@ : :*:   㿘    b`  ?   b`  8 `R  $D`  $$` $:  @,  @ @ $@D@`@ @  $@$@@`@ $@:`  $D`  $$` $:u @?n #@a@? ?#@  ؐ#83@   2 "  S Q 664+@,   @ "@ B@ `@  "@ "@ @ ` "@ :. >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .        b`㿐?@  @  ?@ `㿐? H ٰ Z  P B X7ąB' B'@    @q @> . 6`  `6 @3 @م? H م$% X7ąB' B'@@ f  X  D'…B'@@ F #ddف#dd`` B BhBD# 2@  2*2   㿐    b`  ?   b`  `V  $D`  $$`$: 7 @*n  @ $@D@`@  $@$@@`$@:   @ $D` @  $$`@ $:` @??#@a@? ?#@  ِ p4@   "  d`]664,@ ,    "B `  ""€ `": .  >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@.  @@b  d ,6 @4 =   b ?㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@(@(㿘 `R  $D`  $$` $:  @)K  @ @ $@D@`@ @  $@$@@`@ $@:`  $D`  $$` $:u @?n #@a@? ?#@  ِ!p3@   2 "  S Q 664+@,   @ "@ B@ `@  "@ "@ @ ` "@ :. >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .         @    㿘  @3F 㿐 '`v@1K㿐`w@1B ?㿐` `` "  "' "a? `@1%㿘`^@1 " $" ( " ( " $  ? ? @  gc" "" "  ( $$OpenBSD: swab.c,v 1.3 1998/02/10 02:19:48 deraadt Exp $2":J  *@`*@ `: DJ  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ `$OpenBSD: index.c,v 1.2 1996/08/19 08:34:02 tholo Exp $*`:`J   $OpenBSD: strsignal.c,v 1.2 1996/08/19 08:34:25 tholo Exp $㿘 @\ɒ`$OpenBSD: strmode.c,v 1.3 1997/06/13 13:57:20 deraadt Exp $< ( b("" c4" p ?" d ? l0 "  -  ? s8" w ?*@`! - r*@`  - w*@ (@@` 0 @ 0  - x S s*@`  - r*@`  - w*@ $` 0  0  - x S s*@`  - r*@`  - w*@ " `"   *@ "   *@ - x T t*@` *@*`$OpenBSD: strcoll.c,v 1.2 1996/08/19 08:34:13 tholo Exp $㿘@窒$OpenBSD: system.c,v 1.3 1996/09/15 09:31:52 tholo Exp $sh-c/bin/sh㿀>>!a?' '5 '@Y@[ '?  @Y?0#@Y "a>!@}1@1E @/  @.  @j.@X@. @. ??$OpenBSD: realpath.c,v 1.4 1998/05/18 09:55:19 deraadt Exp $./8!>"@  " .@ `.`@'#.c /@} @`> "@(*`J@ /"*`@Zz c0@x #< (@ 2  " >M"a@.˔# G! ".@@ @ZS <>"@8@u$ "2! "N@ / N``?O @/ِ@/֐ $ " ?"a >b@@@Y  "! @.Ɛ ! "!@Y@.$! $OpenBSD: rand.c,v 1.6 1998/12/07 21:47:22 millert Exp $㿘q@%=bm `9 1 *$㿘!lځ l$OpenBSD: radixsort.c,v 1.3 1996/08/19 08:33:44 tholo Exp $㾘    +@  ( 4 * $*        ""a?@H  㾘2  `* @ `* ``4  * ``$*     " "a?` @  @+.`  ?@Ӗ @+ ?"@@ & &   8#?c#"?#") ? `   @? !+` /!  $!!   *    "@쀢&$!  耣*a*` *   f?  ! *  $?c@@"c a!a* ` ! !` "  & &&  "*  $!%$$@ ` ` #@#`#`!" *@  #@ * *  ?# V??"@@ & &  ͦ ?8c#?#"?c) @"@?    @? !! `1* ? $!  *`    "@@&$!a #a?:*` *   r?`  !?* $  %!?c@@ "c"! * `" ! ?#!` "` @& & &  *`""# $!@%$$@ ` ` #@#` #`?#@? ??c   *@ #@ ?"? I?㿘`.  %? @ @ @`@@"`@  &&?? 8 `ք $OpenBSD: heapsort.c,v 1.2 1996/08/19 08:33:32 tholo Exp $㿘` " "a?@) 6`? -&   ,,-`@"  6 @" 4ݢ2ت`k@"z @,` @"m @,`  # @"]   @"N-  @,`  (5 : @"8@"4  6  @,`   @,` ڨ@) $OpenBSD: getopt.c,v 1.2 1996/08/19 08:33:32 tholo Exp $%s: illegal option -- %c %s: option requires an argument -- %c 㿘 ܀ !!J`# !"܀ *@$!J@ -"J`B" `$!J``- !B""$!m?! J  $!:"aԒ @ 2J aԀ-!X?J`a "a!`K ?N :G 8B!2b : ! ""aJ8aa 2"a!J@  ""!$!` "!B"$!N`: :!`  8BaԐ!b@  ?*`@ ""aB"`$!"aԁ$OpenBSD: bsearch.c,v 1.2 1996/08/19 08:33:26 tholo Exp $㿘@!<>@  $>>2 $OpenBSD: atol.c,v 1.2 1996/08/19 08:33:26 tholo Exp $㿘 @ޔ $OpenBSD: atexit.c,v 1.2 1996/08/19 08:33:22 tholo Exp $㿘! "!2 ! $ @'א ! ?""$!* "  " 㿘 @ǔ㿘 @? @㿘  @  x@+#Ccxؔ  '''''' '@耢  ?㿘'L'P'T'X@yiL㿐@Β  !@ #h`2V @V   6  ?`" @ V  @ 6 􀦠" @ @"! # "a?逢    @ @!a@"  @  " 0@'W  0& & && & ` &  @@"& 0@'H & 0 D & 4@'A& D`& H6 $a&  @ @wG @)llll!b<6 6 & $& ,& (& &   @( 㿘` ` 2 `@'  " "a?`?` &``@ , :   @ * &@@㿘`? "`@  "@@䄐 $OpenBSD: getrpcent.c,v 1.8 1997/09/22 05:11:07 millert Exp $㿘1 !#l  @$&#l㿘  @/ @W  @;㿘@ 0@  @ޒ    @4 2@r㿘  Eڐ#`@`$@Ϲ $ 㿘  `   @䶐 $㿘 "  2 E#`@` &# @ "  @)@  # 㿘l `[ @n$,d ,L``#Ea@~  E .@@va 2.@>$``N@` `N@ "` "`@ $`$`@Z "&$.@``"!$N@ @`*`:    $ @@ " $.@``"$N@ @$$OpenBSD: auth_unix.c,v 1.12 2000/08/24 17:03:20 deraadt Exp $authunix_create: out of memory Ц@% ( H@%! B "a#ta& & & & & $H$ $  $ @Z$ H0P' '''''@!@~3 4@&'`€ $$ @%S $ @' &  &@& 0E!@ՒcȰ @!?  @u^/@R @R   x   @ #@`㿘` $  !㿀@( $` @ҧ`   @%$ @_   & &   & '@R$ & &  & @g `$`@2`8  $`''``@q  @} @ ''  €@} "  @$`$`@1$ '@}t``@㿘 $@$   @$@$ $  @$@$auth_none.c - Fatal marshalling problem㿀 $`!@ @ْ  @Ԑ 2 G@  @$a  `@`   ` $  @@ @'@: <  "   0$`$` $@$`$`$`$`$`$$`($`,|$`0 $``@O "`2` H z` 2 `@`D @#* $`` ф @`D8 H??`( : :@D(` H 2 L`$2  L`@`$  L` 2 L`@#* $` L $`` "``@  2,0@{  `@  @ 2` ` @. l2` H 2|` ` `&@ #  ; 8>>(` :`@?? D8 >` > >> `` "`@#x`  @#r㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @@?@ kby@@?@ژ 2 8@Ę@? c3> ?'"`. @ . "@2 &  : +   ; &   + : :&㿘  `L#% .> @8 @"A @!@ @C @!@  @"@" &@D(@"f  , N@: @` ~`* @w@@@ @  `s @2   " @:h N @  "s@ :[ N@ 2W  hQ  @    @ N @  @ @ (:  `24 _"1 @ :. %@@  " @ :" N@ @  2 @ : @ `2 _"  @(   `_` . c`$ .  `-.`2@ `.> @P@"Z @>0@"W 0@>@" 0@^0 ,,  @ `?, ` ?,   "@ &@ @ @ɔ 2 .` @ @.@ 2 2>, /` " `/` @>, " &  2`# ?#$!" D/  > > /   @ /  "?>&@ ,   :, :[ 2"  :@, ,  &@  ::B "   : 㿘 @ N * @@   + @ N@" `   `2  `      ,  `        `0 "  @?  ``L `@ ```_` `L @ `2 _` ``L ` ``_{   `{_  {  @2  @ @r`& ` `㿘  0@ N * @  + @ N@ `   `2  `      ,  `        `0 "  @X?  ``L `@ ```_` `L @ `2 _` ``L ` ``_{   `{_  {  @2 2 @ @s`㿘 ك( >+@ @( "m M(NR?~@ Y @o@@_@耦 $@  Z"q &( v82rm   2kf e b( 2a\ 2]X 4YT  ( Q J G((@ @0@@0>@@;  7((@@ 0((@@ *(@((@   >(@/(@@.  @@(@(@0(``   ` $  @@ @!@: <    >(` :`@?? D8 >` > >> `` "`@.` "`$@(`$@% 㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @/@(?@ kby@ @?@ 2 8@@ݘ? c3> ?'"`. @ . "@2 &  : +   ; &   + : :&㿘  `L#% .> @8 @"A @!@ @C @!@  @"@" &@D(@"f  , N@: @` ~`* @w@@@ @  `s @2   " @:h N @  "s@ :[ N@ 2W  hQ  @    @ N @  @ @ (:  `24 _"1 @ :. %@@  " @ :" N@ @  2 @ : @ `2 _"  @(   `_` . c`$ .  `-.`2@ `.> @P@"Z @>0@"W 0@>@" 0@^0 ,,  @ `?, ` ?,   "@ &@ @ @| 2 .` @ @.@ 2 2>, /` " `/` @>, " &  2`# ?#$!" D/  > > /   @ /  "?>&@ ,   :, :[ 2"  :@, ,  &@  ::B "   : 㿘  ,@ 0 ( N` @  ,@ @n `@/ @ N@`@Ⳓ "   `2        ,  `        `0 "  @# ?   L @ `_ L @ `2 _ L  ` _?{    `?{_  ?{  @ L@ @ `@`@@Șa& L@  `㿘  4@ 0 ( N` @ɒ  , @ / @ N@ `  ` 2 `,`    `, `         `0 "  @i ?   `L `@ ```_` L @ `2 _` `L ` ` `_?{    `?{_  ?{  @& L 2`@s @ `@:`@5@c㿘>!`+@ @( "v`M) PV~ОDŽ@ d Ş@"x@@n@耠5$@  h"@&("`8@2@ ``2@{ z@u `2u@n 2o@h 4i@b `(`_ ` X@S   @ @. @@O@ H/@(D A@ `@.`@@6/@O@2@(@  5> (@  @@/@@ `.``(  @@@/@@@(`㿘<"e @ @4"E@ `( "`    "  " @*** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%x`> @7$ H!  H  ` @  2` "`@ `@GTc@@ @ޔ*0%d㿘۠ H "  @  2 U`@ǐ1U 0123456789ABCDEFabcdefxdigitABCDEFGHIJKLMNOPQRSTUVWXYZupper space!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL(    " @@!S 4x * @`*`@|$` $` $`@j @$`$`$@$`$` И P` `H  " "  ! $ $ 4$ 8  !$ $ $ $ $ ($ ,$ 0$ <$ @@$ D$ H@  `?$ @:   "@j  @z  @ `$ $@ \@ @ @ 4 (< DbE$ L$e& & & @ߒ ` "`@D`㿘   @J @:  J@ | 2@  @&J@ |!` & "@ h  "@ G  " @  "@ <   " @ z "@ .$㿘 @?ܑ* : ` X&Y!x* € @ @m   D`" D D  ,  " @  @J@ )} )  ,  H" @ J`)a&@: ]@ڔ   ( "( `, N"`,@̔  `( "`( 0 A"0@ =@ 8  `@P/ @ *@E& @ @  , &@:` @  @L @ , :`@ @  @?֐ , :  ? {Ր`  `L ` &@ , :  +"(  ? *"  , {J"@c "@D "@W "@8{"@J "@+n "@< "@  @_" "@  @V $@  N@r @J@ ,2`& `L  !@\@@E @ @:  J@ }2 `&@ :J@ }"   @ &J  }  @ @ @  @  @?֐ , :  ? {`   `L @ `aaa_a``aaa aaaaaaaaaaaaaaaa`aaaaaaaaaaaaaaaaaaaaaaaaaaaaDaTa`xaaaaaaaaaaaaaaaaaaaaaaaaaaaaa`㿘 @ @ &@ *J㿘   @ J@ ^2 `&@  `( "`( , ", @-  @  ` :J@2J`` & @  `( "`( 0 "0 @B 㿘J@ ``\ & @ @2   a&a)xa{`." `[`*`0 a(&0 a}a9a1 ~a?Z0} `@Jy @ t@?p@ l  D`" D D  ,  " @ @ `  J@ \J` ) \K )  ,  H" @n @ ` J@ \ J` )`)&@ %,  H @M `@1@C @    "`H@ @ ~  @"J *  &"@; "@ "@/ "@w p n`$J \j`$J {f`$&@g @ J@ ,` & `L !@P @9 !@ @ ` : J@ \2  J` }2 `*&   : J` &` :J` \2J }2 @ @  `$  㿘   L @ ` `. J* ?а  `  ` . ` @ƒ [:<:]][:>:]]㿘@ǐ    [bH@.  2&   [bP@  2 (@A  & @: J@ ^2`&  @:J@ ]2 `&@ ` ] *] ``] @:"J@ -2`&@ ` - *- ``-,` ` : J@ -2J` ]"@ @ :J@ ]逢@  @:J@ -2 `&@ ` - *- ``-,` J`]&@-   s ` ,`?,"` %@ `@ L `"?@* :  @ `@* ` ,`?<@` @-- `?, @ `@" * * `" * ` ?,`  `" ` @ ` * * `?,`` @@  @@ߐ@20@P@^ 㿘 @ J@ - [    * @ 0*:  : ="40e   &@ J - ]@ @ @ @y  @  `  J@ :J` ]3`@f 0m   &@] J - ]@S @ @ @I  @ ` J@ = J` ]`?&@3 0:@ @ J@ -2` :J` ]"&J` -`& -@, *`: :`@@  @ ` * `@   .`㿘   L  @  &   ` aT"` @  @R 2` @J`2`@ǒ 0!L  @ `@* ` .`L `  `@@[ L 㿘 =@L@ ` + `@.`㿘 @ @   ` :J@J@ [2 J@J` .2J@`$J@`$ .@ @ ` J@ . J` ]`$@Z . > 㿘 @  ` : L@2L` ] ` &` :J`2J ]2  a" a@@Ǡ 2`@J`"N``@   @ 0L@L * : (H㿐 &  ]&///+& &㿘 ` `8`L` ` ː* : ڒ0@o`   `4, "`4㿐 &  ^  ]&////& &㿘     .  `y_!*` € $" r&  "@A`Ԕ  "@  @_" "@  @V $@  0M "@ "@  "@@"@  @7 $@ ` @Ґ 0% "@ "@0@~0@t0@ {${8{8{8||||||{|h|||||||| ""  " " 㿘   "    I `& 4 @=   @ ,  @ S,  "`   @  "`@ E  "` , `  :`@` @$ ` "  ``%@ @r    -    < @ , @% $*,`,`$`$` `  (  @ (*@   *` 㿘   *`   7` 2. * @% @  @ ` @  @ @@`@ ` @ @ `@ @ @ "`@ *   &@>    `@ @" * :       `@ @2  㿘`@`  @&`@ # @ a  ` "&` @ <&` ݒ 0 ?@&` ` ` *? ,8    ` "     ,8   `  "     㿘  '`8? @  Œ `4 &`4,@ @ 2  ʔ 2,@  $ @ $ @㿘  @c@ .` *  @ 3. @$ 㿘      `2`@:`*` @E @ *`"`& 㿘  ' ߐ ,   H.    @ "@ @  "@ ` ` "@@@* "@    (@> "@㿘   @ v.` 2&  0& 㿘 &`  @ e*` &`  &`㿘  w `  >1-+)'%#@ `:0`@ "3 / &`@" !`@""c>$""`@ * @@  2`(  `@$ &`@ 2@`@ $@   &`<&`@ &`(`@`>@ `@ `*`*  ! `>   4  2`("`(%02x:%02x:%02x:%02x:%02x:%02x㿐 !!0 b `P#`  #\@Ӑ㿐 L   `2   @1 J: `L@ `2.@".@ .@``ݠ 㿘 "ƒ  %x:%x:%x:%x:%x:%x/etc/ethersr+ ethers.byaddrX``b`a``@#`#\@m@ rbb!@a褒 R\?@  @h0V@eS  J?` '< @ s , b, a@$ @yɐ̀ 'b̒a@zĀ Ȓ@ @@  @n  @ @ " "a?ethers.byname㺀@ bb!@Qa褒 Q[?@ @0U@R  J?` '; @  , b, a@¥$ @y[쀢 &bc@z䀢 @& @g@  @£ @J @Ʃ " "a? 㿘’ ) "N  2" " L@ ` " N  `2 N ca@6`@f.  " "a?㿘 !#x ` @iD?  !$ 㿘 !cx` >@e?"`$OpenBSD: rcmd.c,v 1.36 2000/02/25 04:39:08 itojun Exp $㿐 #\.`2`@dRSHshelltcp%urcmd: socket: All ports in use rcmd: socket: %s (invalid)connect to address %s: Trying %s... %s: %s %drcmd: write (setting up stderr): %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: accept: %s socket: protocol failure in circuit setup. rcmd: %s: %s 8\'L'D'P@ 'T  c@#P ccc`@#X  .``2 @D@Wa,` cc#X@c`  4`@  DLP@8QT@ ظch4` @  D??@ ??Ș '''@mi İ? ` ! "@g , D"@2 #'  b@ q "a 0 ?W' =" ` 7/`` !#\! @ F c7?!cc@V @L%`/`!` #\@ * c7?cc@<`  ` @-` # !cᐢa@b#@"0`@8~    "! # !c!@cp `#c!@Fc@` @2h@u~?0)@`@H` t`@up`2 cc@ '@8D!'@ 2 `* @@  @3uc @@  @f@  @/ "!#c!.c@kQ6 *   +6`& *``+ &%᐀@   @ : ᐀  !#d!` @@ℒ0d!@~`H@n @3”   #\  @ G  @} @N@J !#d!@`x@Kl' '@  #\  @    @|#@|! d!@(`D@ LL @@ PP @@T T@ @ɔ  D "@#a!da@? @O @   @ O` @1O@w0 @@@k@ʐ@1=?0p  ? ???'fa8'ܔ@kԀ ?0@t; 0Ԁ   @P   2 @t&?㿈  ?  ?//'@4 /etc/hosts.equivr/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writeable by other than owner8  ff"8@bP `@v @3[ @/`2V?!`"O?@E I @cfbX@G@T@1efbP@]@1^`2@f  f#"h<  f"T`@h f"` @f"  f"Ѐ  "!@ِ?㿈  ?  ?//'@ 㾐@]!? # * ( &# L J ` `*   *J   * ŐJ  2 *J      J    L  J `J    * *J  @C L + -L   @ 56 @ɒ -   @Le& L   @ ?@    @LI @N @IL@ + -L`  @`0 # ` @L-L`  @ `` @L @͐  ?@Ɛ`?  ?   @_ 2L?h !#\ /ؐ! @ 29    ? ???'f'ܐa8'Ԕ@iԀ  0#@r- 0 Ԁ Բش !/  !#\ @~ 2  @p   2/@r  rcmd: address %s not listed for host %sh  c#\*c /! @R 2Q  !#\ ! @E 2D    ?? ??'f'ؐa8''Ԕ@iԀ  0-@qɰ0*Ԁ Բ !/  !#\ @ 2  @    2/h bX @q@q %x.0.%x%02x㿐!    77i`  @@C  ` @ @*`@2 @, %i@ʒ` i` @Đ`@,'iL`  @ L 2  @(@*L@6 i` @@ `J@ @ υ(85 i( @*@  `J@ @ H*@`*@ `@ 1@6/@ #  # .@@  :  *  . : .  .  ̒ `% ` 4`4 `4 ` 4 4 4 @: @ `*@ @.  @* 4@ 4` 4` 4` 4` 4` %d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dxN -   j``#\@1?7#j`p#\#`@1+#!j#\#``@1!j`@1  @@!0aN  ӑ* : `K`j#*` €   0,@  ,@L@  @`j + 0jj "j #耢 L@ `" 4  @ ,? @0,@?@0@P!lltt㿘`&    @d `   @$@ꓒ? /`4 / &/㿘@`@ @eM` .`  А  *`: ?А *`: ? `*`: ?` `2` ` `  k#4,` €?, ?".` ,  ,  ,   , *`$ @$.`.@㿘    @  ؀  @Ԕ    @ :, @ܖ"P .",   @ ` :  , ,  , @ 뀤, ؁㿘 !@d `   А *`: ?А *`: ? *`: ?ɀ`2    l!x,  €,@` ,  ,@ ` ,@`@* $@*$4`HH   0 *`ܖ . *@  ` :   *`*@` *@` *  *@!1%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%u㿈 ! +   *` *    *  # l @ #\ b #d#`#h@M`@ 1@>/@ #  # .@@ :  *  . : .  .  a|a| % p,p ,  ,  ,  ,  ,  ,  ,  ,   , , , @F @ܐ `*@ @:  @6  p,@ ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` %d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dxN -   m`#\@./7#m`#\#`@.#!m#\#``Ț@. !m`@- @@!0aN  ӑ* : `K`m#*` €   0,@  ,@L@  @`m + 0mm "m!#耢 L@ `" 4  @ ,? @-,@?@-@P!㿘`&    @T `   @s$@烒? /`4 / &/ 02  "2 2 㿐 @?.@ .  ?#@.   ?#. ` '@   0? (?#㿘! !@0 @4   @0$  @$ 2  @0㿘 a @/@0  a a @/㼘 ? c ( ` $ " `-  5 @ `%" /  /@Ԑ / *`  @ *   ` 2@$$ &t @2f "o %@  @'   @$ @2J ÒL`%` A` @" 9& @ &/J@ @ . ` N .  0@ "@  @h` *@`֒ @R"` `  "` " "a bf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpap !#` @]?ؐ@ "!0 @ڔ O؀  obА@    "w /o-o+o)oL f"a4e b2b`2_    *2#" ( # $@H $@@ $@8c  #\$# @-  @XŘ$ &    "" 2```22`" @ 2 4 L  f 㷈 !#` @\x?@HC "!0 @A O耢  obА@s   "0 L f4!` b2`$@` / @X$ &`Q   `@ Ǣ``4 L ؀ f 㿘! "!|@.Ƣ @˒ |  @.  |@ 2 | @.㿘 "a| @.@.  a|  a| @.udptcp%d㻘 \۰?2װ?ݒ! @   @  *`@ İ? @" ?  /`,   p#p#@-x `" @@ 8?@@ ,`p2"@@ p@   0: < @ 8 22` 2`*`        ?#@2  2   2     ? ?  IG  2D? /@" 7?@Z @- @3;  @I@ (@?@ "?  @  0@ ? 㼘 @" (?@`@@\ ` @!  ? @ %@.*` %u㿘 ? ?  ? ? r  @+ " @؞ r@7Pno errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failuresystem errorinvalid value for hintsresolved protocol is unknownunknown/invalid error 1r(r+ r( r%!r"!(r!Pr!r!r!r!r"r "(r "Hr"Xr"pr"h\PD8, LC_MESSAGESLC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALLPATH_LOCALE/usr/share/localeLANGC㿘@ ! # 2 Js@ $##J`s 0$#؀` % 1ݑ,"԰ݐ"0 `  @` ? N@ G!ݒ!,@@ J@ `@! sJ@ `s@ߐ H sJ@ ,s P,0@ `{*@ݨ! `  . @ "0J@ . 0. @q  .@ ` ` ,0@@c  U,@B / 2L` "0   . @P  , ` ? / `L` /"`L` L "0$@ 4 . @3 . ,L@ `/`N@ /"`@`L@  /2``$@   "0. @h  @N    @D     @ %s/%s/%s/%s/%s㿐ݒb4  #@4ࠢ )t @֒   8#\#``# @<@#`` #POSIX%s/%s/%s㻘 ݐ"0b,` @ #s`P@ t`@ ݒ@0!,`  t#@$` `㿐1ް" 7   5 ;  3  &ؔ&b&d" `'b#Զ  .( > @?*   ఖ` (@ (   (. @?*? (    8  .@/@.?$ ݺ@x  x  .@/@.7$ ݰx ./$ަ  ʅ, `' ` چ` ғ,`  , "''@#  ކ# @4("('  @4(@'@(#ײ`` ʐ    ``    ``  ) ! "@  @  ""؇(@'@('$"   " %@x  @  bb܇(@'@('` 􀤠O  ް .$ Ɩ `ސⰔ ( ( . '   (@&@$ . $(   Ԁ  В     2*`0"Ё㿐'L`'P   `' '   '' 7 Ҷ`7  ʞ`@7 7 .# /  @4. 954 @@  ;@ 4#@  @. @   @ @c@  Ж`  ªc``)>' ~!~      6 . ( 0 .`@.  @6  / 00@@ @@/ 6 `?1  `6` (o  ǵ.`. Ȇ`3 ɱ. ``@ `?   چ`3 3  c 3  +  , 4 * 4  #4c %/ L `  @   @P  㿈"`h֐ / / / / / / //''.@.`.`.`.`.`.`.`㿘"`2 2  3 ``  d@  ` `6  a" 6  $6  *@ .  a &0`@ * ( 0` a*  0` !,@ (` `    ` . #`   c# &``  ` " d     <ݒc @3 @&5 -22 5 -@ !b`@2@ 3 @   ```@ 3 *b` @  `3`3  @``@ ` 3 ``@3`  !`  ` 3`3 ``@ @ @ `  ` +` ` ` @ @$@ $$$   㿐ބ" *        * $ $*  㿐"`L ޖ"  #  + @ @ @   $` ?ޞ" (( +  @ @   ,@ ($OpenBSD: sigsetjmp.S,v 1.2 1996/08/19 08:17:45 tholo Exp $`O" (0 (`M0($OpenBSD: setjmp.S,v 1.2 1996/08/19 08:17:44 tholo Exp $  0 " 5H P """  """㿠   @" &  g @$OpenBSD: _setjmp.S,v 1.3 1996/08/19 08:17:25 tholo Exp $" " " @" `&"`@6 0``` L `2+` `  `  `  +`\ @ +G` Ey@*` \+  nq+ \+  rk+ \+  be+ \+  a_+ \+  vY+ \+  tS+ \+  fM+ \+  sG+ \+ Є 0+> + 9+ ` @ ` \+0  00+ 0+ ` 0"+` \+  M+ L `   ^+`  ? +`@+ -+ +  +TTTTTT\tTTTTTTTTTTTTTTTTTT㿘@N@:`'@*``2`"*㿘 N@`N@8N@N@  "*㿈`  `@''''@㿘 @  @$@ 㿘  `h!@  !  ""! /dev//var/run/dev.db@jh  @\  "P!< @ H zD " HH.@ z.`  P.`  .`  .` .` @ '  ?PP 'T'X'\7P X` 2 d` @ "@` @  @@8z@ H & "+!@' "@# `@ @@º  @@`@@ 2@ H @) D% * @,`@@,`@*` ,  &, @ & @ ? (* @,`@@,`@*` ,  & , @& @ˆ 2?* . @ݱ. ?H80 noopaquenodumpnouimmutablenouchangenouchgnouappendnouappndnosimmutablenoschangenoschgnoarchivednoarchnosappendnosappnd㿘@2 z. #``  ,+  *    * @ `J@  @`*J@  * .  ߑ+ * ,㿐`2&@2&'5+{L@ 1z# @V  2  `@K 2  `@ &@  & ڤ   @@Ғb0 2& 㿈 ''@ƒ I @ Jg" 8o-"H XJ+"FG* ?`C*  u2?*  !00  `  `+ *`+ *`` *``*`*`"   *"* 2 㿐L V?'@n @ -@2  @d @, 8 ?  L  `8` @  ,02+L*  ` 2 А L   @B 0 2 0-3  =@'/@  L g  o a *`:  u*` : -)$8 :  + - =ڐ`=*` =  ?* : ` u}"t*` €$ ?" ?"" II -@Ӓ &`0 ? ?@ -3 =`@ =` ="  +` -@ ݐ& ? ?@ -3  X@  -@ Ő& ? ?@ -L3 @{=`G =` =!``=` ="  -@q & ? ?@ -=`3 @V`" -@X  &`# @5 ? ?@ -3  X@6AL  ,**` .@vdl󸀢`g"*`o`= -`X`+`-0?0<`u07*2 -2   +* )2  &2 *2 <c* 2  * 2 +-  =  *   - +  X2`2 `: J@+-X2@   `J@-+`8  X`8  `( 2 **   2 **  "J@2 ** ʐ longjmp botch. 㿘~aP @d 㿐  ?  @ ?? 㿘@@s%u㿘 ? * apN  2" # ap @0  $ap@/ 2$` 1 !x~@Ȓ 0 @R .  㿘 ? * aN  2" # a @   $a@  2$` 1 !~@ 0 @" .  /bin/shsh-c㿈'HN@ r'D w "HJ`  " "al @앐 'e @ @찰 0\@?  H` }`8``@ ] 2`@ "+ *`'``#`," ` 2   * 2` * 2`[&``@(@& HOME㿘 ~6 (2.?  *@`@  /2*@N @ @ В @7J@) "%  @(k 2 *: 2`J@  @: 2* 2`2㷐$@`a  `? *`]`?"D` `[`*C `M4J ``!"   [@D ] 2   [4`!8 6`[4`! `!4 `- `4`-  `] `4 4 `]` 4!&` 4!&` ` !&` ?"44 `4@, !@` 2 #"?@  `- `*`  #@&  㿘@@㷐 @ 8  4 /6@@ " O " /#< !@(@2@ 2  2 /6@6``&@(   2 2@ ` /2`  / 6@ /` @㻘6@% "$@" 2   @\ € C? "? 0=< @ ( (%"h . ` . ` 6@` @4 ` @i ? 6@Y 2 Ā 2J` @ @0@㿘`@`` * @̐ @冐  ` 4?@夞  `` *`,&`??$&`  @ `"@@b:   @ڒ@` * $`&@@``  * $?㿘@:a `?`]@ @``[`*@ @I@"D"K  "B   =  ,  * 2  @`! `?`2`@`* - ]@ @ 2`@( `" @`* @  ˰ @*@`?㿘 ` * ?? @@ ?@?`@ .㻘 #7@:` @2` @0@㻘@* @2$@0€㻘@ @2(@\0€    (*@ `㿘@@ @ @offonsecurelocalrtsctssoftcarmdmbufwindow㿘 b  @o 1 !b@[ Ȁ N@ bb`? "`@ @  "@ ဢ0 L @ ` " L   `2 L "Π! #"ˠ!  a"a  @*$`L $`$`@ɐ$`L $` @!"` "`L M" '@1    L ` ?|$` `@    L `  j$` `@     L `  X$` `@    L `  F$` `@    L `  4$` `@ה    L `  "$` `@Ŕ    L `  $` `@  M"L  =2 M"@n$`@%L pM" #" L #2 ! L "  " !& L "& @ 2,J A "62 J\2 J ""  *@'`# *&*  2 ** J "   "   J "  "  " 0 Jŀ"*㿘@E =   /etc/ttysr㿘1 "  "@b&"@ @C 㿘1 "  @I8&"@ /dev/tty X# @    'ĒĮ @ Ȭ @ݢ   Ԁ  ?'Ԫ  @@@ː b  ) #, @Ҕ  O ,#0@䯔 `Ԕ 'Ԑ@  @堔 ""@"㿘 #`   @ڔ  $c # ` % @Δ $c8 $# 5 c* @*`@*`@# *` ' "c@Zc * @*`@*`@*` @'$# $# @ $c*` *  *  # * @&c㿘 c(  @ @  " "aN  "a 㿘 '  @u% ! #(@>  @i "!$,` #(@R @ @o@Y   "㿘 @M@ " @Gx  'ܰ''ܘ @倚  ?8   *'*`F <@㿘@!H #8` @{     @Ζ  @~!H㿘 c<  @~!8㿘@~!H@Y     @ cL@z@~֐!H  㿘 c<  @~ʐ!8ؐ㿘@~!H@-     @~ cL@N@~!H  㿘 c<  @~!8ؐ/etc/groupr㿘1 #8 "@m1 "t `""p@ &"t  !@b@ 㿘@ 㿘!@~k!H   "#L @~b!H㿘! #8  @N# bt $#8`""p@ $bt㿘!!H@~F@~Dgroup.byname%ugroup.bygid: ` !LcP' @~1  c ) "p p "x` "x@Q %"p@൐ "p  4V,# bt`btИ#`% #\ "x|cH@Rؠ@bt $bt$bt$|,"x cH|@0КЀ @}%"p"p "x#cH@Ȑ@RР@i%"p  @d"pԒ@k@\%"p,' #8@W$ 2' @t 2L#8{#8`? "`@ @  "@ k0 +L :h  d@PԐ x !  S%"p"x "x@P K"p #"xcH@\cX@~J"x!@L#`@QР 2*"pԒ@@!̠#p,'̒@0ϐ&@0ː&@0ǐ ""p@Vw ȔJ@ "p@ P&N&@Pr cp@0̀  " @ "p %"p@}g ̠ @0cp  &"#p@ 2"p#p@0&@0~ ""p@V0 Ȁ@J@ 2"p8"p &̀"p̀  c@%& J ,  *"@`    ""@*"@ `" ̀@  '"@ BLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocks㿐@ߨ!_!L [@˔ Q" J``MJ  1`M*`k`G`K`(#!!`m`g!!!Ф !!% $!$!!@5"% @"@5 @׷!  " @5ے!"" "@@c  %@ %@&@.㿘p " "a@m ( `&& & & & & & & & & $`& $@$$$@@ː g `@@ ]?42 `-  @ J@`@&`6`2&` $@ * 2``6`46`4`&` &`%   ئ@$@@R &"  2 4 $ H @ɔ &  $ & $ " "a@\@@ @ 㿘`&`@* 6`$2` `@J@.* / 2 L    @G@7`6`& `,&`&`& 㿘  ` @٠ T 2 6 @Ӑ  " @  @@  $ `@ B   "! @  $  `@ݯ ""!?@ݩ ..㿘 $@;  8 `6 8@ /6 4`& 4* 2   @ * 2``86 4$ 2 H @ &  "! 6 4&&  6 "6 6*2  W`"  6$ @ , @" 6 "@߱  " @$ 4 4` *$$@ $ @? "" 6 "a 4 6$  "a$  &   2 @   $$@ I$  Y@V 2 2 8$! @    $@ w 2$$ ݀ 2# @O * 2``6 4$   H @~ &  "! & 6 4 6 6 6 6 8  $  J / @  /*@ &`@ @S$@ܰ V 2?2  $@ܪ ""!$F *@V 22 6$! * 22 @ '  $ @   # " a@ $$a@$$@  2 $ 2  0@ " " $ $$   6 4$ 2`8 "  ᐐ 㿘`@ " E"a $ "@>" 4  9 27   "@}@2  $& $ T 2   J`/ $ @&  H @ @& @  2 @j  㿈  $ 'H @   HH ]  "! % W5 4`2 $ `  ?`  0 ''쀥 H 2'@@  "H`2 6%  6`@5 6'  ' $ J?`/  $B  / *U 2  '"'    2 `L` .2 `L` ?` ` `@` "% " ` @(@ `@А  % "@u@@` 5 4 $ & $$Ұ     $ '@  `"?c 4 2$  `@4 $ ` ` 6 4 6  4 4$ 4 4 6$  쀢 " $ `  "  $ $  @ $ #4 4 $    &$ @j @ @$ @  4 4* 2  *`2  $ &```@ 2[ $`@耢`@h $   2--􀢠$H 29 U 2   $ @S     @x 0  5 4 $@T& $2 H`  5 4@ڰ@@ 5 4 $ & $ " ?:"a @8 $``<`6    > 86 > X>> > > > (> 0> 8> @> H> Pf ``@ #! "!@"` 2 &`$!Q @  "!&`  > X>> > > > > (> 0> 8> @> H> P:  < @ ((&`, &`( N`@`.6`0N`A  ?`@c  2`  `2``,"&@`R`2 6`(  @  @    㿘 ( *@"$  2 $   "$ @$ $   "    @  `"`" 㿘 $ D@ٰ `@ @ $`, I ?$`<  4`&$`4`8$`4`6$` $`㿘@ٵ  㿘 ?!c &   "& @٠&  " ?"a  @ٲ 2 &   "& @َ&     @" "  2 @""  P26㿘   @ܭ8   8 $ ,  ` @  ?@ ?`,@ "`(@ " "a ?@! "`!@ۀ$! : xxswufsswap ,rwrqro㻐- 53 "$ @P?"  bX@T _"`@В% + J #" @Đ & @ & @h   bp @& "x"& b` @ @z 􀢀J `#@b$`@ @b 􀢀J `@ $` "@u %J #" @j $`@f $` @b u$` $`$` @Z +@- 􀢀fJ b``#@[$`@A " @ 􀢀MJ I`G@E$` #@!/@%"  "@~ )"@w "bp@q h@k "%  @b @k  "@W %    @ O 㿘 "`@?    1  "㿘@/ " ! @( " " 㿘@  !  @  " /etc/fstabr8! " "@ 0##Ȑ@N  "̀@<   " O "a@?c؀ $"  "a@ 㿘! " @$"fstab: : p ȒcȖ   ''''''@@ڻ''`А '' @f 㿘'L'P'T'X@TLRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdxb "''@   @;!''T?X'`'d'hl'   * ` *J`|`:2 *@#i@#dĒ@#_  @b 2X    @c 2X $X@ Z : X $XĒ@$X?"Ē @$N$(Ē(@$G$0#0@$@$,8$4Ē@# @b 4Ē@$+?  4Ē@@$!T?20@,$8H@$X?24@8$<ĒP@$?. 4HX@#? 4JĒ`@#?  4Lh@#? `4NĒp@#\? $Px@#`? $TĒ@#d?$@#h?㠖#$#  `/7#  a7/ '/7 `/7# cL7/ʠ /////@#?8$$@#||$ @#zx? x $ Ē@#ot 2 t@ , , pĒ@#a?    , @"6 @3, `*`:  p  .  : ?4 #7/ 0Ĕ/@#5? l`*`$:  4   aW$@$㿘@  @@r "&@`@ 2@`L ` > @L㿈 4 " ''   @؍ ? `@ԯ찒   @{ ? ! "!@Ɛ$!?@*@Լ  "a ./㿘 N #@?J? / J /"  J / 1 6 P P@" J /2"  $1  P@. " ?"a x" '" "  @؀ ?  '$OpenBSD: sigcompat.c,v 1.2 1996/08/19 08:19:39 tholo Exp $㿈`"  `` @'''` @O  &㿐'D D@5 㿐'D D@) 㿘'D@D$OpenBSD: killpg.c,v 1.3 1997/07/25 20:29:58 mickey Exp $㿘 @1  " "a?$OpenBSD: creat.c,v 1.3 1997/07/25 20:29:57 mickey Exp $㿘.`2@&$2 pa@$1 pa@$ pa@$ pa@$̈́ pa@$< pa@$$ pa@$9 pa@% pa@$ pa@$ pa@$Ä pa@$` pa@$R pa@$S pa@$ pa@$ pa@$ pa@$ pa@$8 pa@$ pa@$7 pa@$ pa@% pa@$ pa@$ pa@$ pa@$ pa@$ pa@$j pa@$  pa@$ pa@$u pa@$d pa@$' pa@$Q pa@$O pa@$/ pa@% pa@$+ pa@${ pa@$| pa@$# pa@$  pa@$) pa@$= pa@$ pa@$ pa@$" pa@$  pa@$ pa@$OpenBSD: sigsuspend.S,v 1.3 1999/01/22 06:07:56 marc Exp $ o pa@$OpenBSD: Ovfork.S,v 1.2 1996/08/19 08:18:01 tholo Exp $ B pa@"` h`''' ''''' '$'(''Ȁ` `` "  " `` `@ "a?$OpenBSD: strspn.c,v 1.2 1996/08/19 08:34:26 tholo Exp $ ` (  *88 " (" $OpenBSD: strcspn.c,v 1.2 1996/08/19 08:34:15 tholo Exp $   (8 J2J " $OpenBSD: __strsignal.c,v 1.5 1996/09/25 13:19:01 deraadt Exp $㿘   T@  0?,@ˑ  @  0,libcUnknown signal: 㿘!8@ , #X  @@ . ?@ @ @. @ԇ "@@Ð$OpenBSD: strtok.c,v 1.3 1999/11/09 11:19:46 art Exp $㿘 @`   2H( HJ  " H?" J  H  2*? " 2HJ$OpenBSD: setenv.c,v 1.3 1998/02/02 22:44:53 millert Exp $㿐N@ ="`@@ "| @*7@* ,`` n  "! `  `h  `@л*` *,`$ `"h@o*   ,`@$ "a" 'L% "L  =2 $@T  *`" -?`* *:`,` `= = *`: ,   =2 =,@ *`,   @* ,``  㿐 "!*`  "  "@Ћ  @ 7'''L'P'T@t'Xb'''''@!ДL㿀'@ ?''@耢 @y&㿘 (  " "a?6?@U @2 P (    ? 2 0    : @  0f  < :@ f  "  :@ F㿘 $OpenBSD: pmap_prot2.c,v 1.3 1996/08/19 08:31:41 tholo Exp $㿐 `?'@ @ '@В    @  @%ݖⴀ   2@ 㿘<"e@& "4"E@&  $@`  " @Z  " <@T < @N@L$OpenBSD: rcmdsh.c,v 1.5 1998/04/25 16:23:58 millert Exp $/usr/bin/rshrcmdsh: unknown user: %s localhostrcmdsh: socketpairrcmdsh: fork failedrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: setuid(%u): %s /bin/sh-c-lrcmdsh: execlp %s failed: %s 㿈`!@  !a@X?@,b   @ 2@?0&   @ " @ "8@m-?0ys@!@Ғ  @̒  @m"P@Ӑ @ @m"h@ʐ @Ɛ @  "  "a#!a@w@"@@Ҳ @Ԓb  /@Β 2 / J  " /@  @  "@  ⸘#\@  "a!#!@wb@”@t @а@ l $OpenBSD: rresvport.c,v 1.5 2000/01/26 03:43:20 deraadt Exp $㿘@ 㾘@3:!`` " .  /("a,  @u &!?4@c44@ @uՒ  "!`0 4@, @s?@$@Y?p  `'  p  @ub j  `"#,`' @ X?'0a$'@ ? J?`6   //`+/Ѐ`7@є   ??ؐ@      2  @?$@`٠OАВ@ OЀ @ ?@ڐ @sNo address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): x؀ N   "@Д'$ a '' "@!a@Ї$$  ! $:$$ @/ Resolver internal errorUnknown resolver error  "8 "P * 㿘 "ax @s@s ax `ax @9 ax @s/etc/protocolsr㿘!" #(@wc8$"@v a"a㿘!" " @$" "! 㿐b   #(@w\c8 %""@w y J?` 2'#"!  @, L@ #@ # 2,   "@tc Ҥ, LL "  " @t֒  ,@`@u,""J "#"   "`"``!L  *`:    $@t " $,  "$L  $ /etc/networksr㿘! ! "@vɒb$! @ue "a|"a|㿘! ! " "@i$!  ""!| 㿐 a   "@vb $  @v y J?` 2'# ! !(@Z, L@ #@ # 2, "!,@& !,*  @t+b  , L% L "  " @t☢ ,@`@"M!,< " ""`  "'$L " *`:    $@ , @s☠ " $,  "$L  $!,x   ?''D'''   @      @8ܮ   @ ܚp  g   2b  ] T  T ` ?@` `L / 2 ` @>  :    * @" @   ? @    + " @   ? 2@`2@@@+ *  ,D "@֐0"* @ʩ @ː? @/ܦ     2  * 2  " T %` %` @ \ . %`  T@ T   ?`%@%`hf / 2 ` @%"Y  T`` %`` %`%`  *  @" @   ? @   .  @"' @   ? "%` "%`@" %`@ @  @͠@̧@Ց.%@ܨ *h @䀥@ D%@""@ 㿘@-_/㿘*`$ #  А :`b@" 2  .2 N .2 *`  gethostby*.getanswer: asked for "%s %s %s", got type "%s"x @''܀  "" 0  `#`?c$ '耢'`  "  @SY$ b@쀢 ` "   @ @"'' %  "\'"cc""""\  2?0 @S$ b@쀢 " @Tǐ* 2 @T* 2 @T* 2 w 2u5 2  @ @R$ " %@@̋  `"@?@̂ @ 4Ԩ @fƒ@"''%(%@R˜$ &  " @] @ 4 @f'ܐ"'' @M  @M@M@ %@7 : 07 0@f܀  %#H7@Rv &l 쀢  e  % #@%@`?U @ @"'K'@f~쀢   %#H@7@ @2  @% "@''   " c '!  "䀢@ ' #@q"'@ ''䀥 "  ? 쀧 3 !#x !d%@` "  "\@ @ˈ @  @e̒@"%''#x  @ ""!  ""a 㿘@eo#x !#x ` #x@)=?#x@*   @  @  @eQcxbf㻈 !#x ` `@)?`@ ` "?      " /""  " "a  "" " @} . @&N 2  L ` D0N? ."? #@S ! # @}ܐx`  !#$"b\''c& #cb\& ,  @ ""!  L `.2 J 2 J .  L  `D`@} : 2NN :2DN 'N? .< #@SF ! # @}  !#$""\''c& #c"\&  "#!, ^   L  `D`2 *:  : . J 2 J .  "!0 @ O  c@}M   1 L f"  y b 2`2@ @$$  @`2L Հ f%u.%u.%u.%u.in-addr.arpa%x.%x.ip6.int㷈#x@d !#x `@'? @א)`&    ?#@"           "?   " /  "? " ""@cɐx - ",  c  @d- "! +1 2c@d ## , ,  ,  ,  ,  ,  , , 0@< O耢  c@|n   Q - \M f"= y b ;`29`26`@1  @#[$ '-   #& & @%\%#x  @L  & &  ""!@*`` xM  fx@c2/etc/hostsr㿘!#< #@pec$#<@o"#@㿘!#< #@`@ $#< 㿈#<` + "#@pAc %#< ?#<@p  %a J?` 2'##@5䀢  HT  " "ahosts.byname㿐@"    "` "@4w % ! % X X@÷"#cp@$X@5L X  " "a㿐@  .@?` .@`.@`@ 㿘  , (   & &    @ &@ $&@" &@@$@ `&@?&`2@㿘P  @ '  "`~ /   d .@2` 2 ?(R& `@  `.. V?V 6?6@?`&@&`@ 鶇%s: 㿘`8!b@f`@ѐ@\b@k㿘@ʖ 㿘? @– 0(xhXH8 hP8 User defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0㿘N  @  " @_ѐ $  " $ @ 㿘 " @|D 2   2 㿘 ` @@`@ 2@$㿘%  `"  `(L ` ?@ @Ԓ"@ @"  L ` ?@ @" @  @"  ఒcH" "  ""  L ` ?@ @" @  @"   L ` ?@͐ @" @  @"  L ` ?@ĵ @j" @ĭ  "  c  $# $": 㿐N@ ' +J@` :'J@ 2`a'@"&@& @ ] @7ːUJ 2 N& @ H @7AJ 2} : :& @& @ . @i'J 2c #@4^ ' @$Z & @А  @i J 2H @4E @4 & $@ #H& & & $a@& @& @` (&  `"  2&     &   &   2&   2&  `2&  master.passwd.bynamepasswd.byname` #䀢`@ 1`? @2%   c æ  #` #@1 $ y   !  "G! c , @- "  ؘ#`% #\ #c@2|@-c  $c $@#'! $ch$@#    c@Y؀ TJ$@̀ @ $ " J  @#   @=@1؀ #*! `  @# "   @!ܚ@1h @$  & ܀ "Q @M ! @ @' ذc *@` ; 0a  2`/"@  ''@Ȑ N I1 #J + -J  @#    "c  "c@0 "@]1 "` 2)#J  @@԰ ̀` J@ 7 @Ҕ @[ * # __YP!+pa  1''/РА!@= 1 # ''   # ؟   㿈@% @ Ħ? ) `#)`2#$ #` #@/ #$%##`@9耢 2 $@  $%#$%#$İ p #`@ A    "#?7 9#J`+`-"J c# cc @/e #J   @" _#! # @$#c   @! #@0* _ #`@~ %#2c@ ܒ@Ԭ @|?耢 " J  M#   # @#@/` "2! # "%#@H%#`@A %#c %'؀   # @#@/˚`  ! # "O%#@ K%# #@&``,̐c < c $05` `@@H ܢ Ԁ` J@ ؐ @s @cː c@x/ c쀢  @&J' S  %耢  2/ @Ԕ  ''@ ! 쀢  @&ư %'  1/@`  @`''@Ր #쀢`  @&䀤  # %umaster.passwd.byuidpasswd.byuid` #`@ B 7 `@[  "c? 7 9#J`+`-c # cc @. o#J   @" _#! # @;$#"c   @! #@.ɚ _ #`@ %#2c@Z ̒@Ĭ @?耢 " J  #   # @K#@.` "2! # "%#@%#`@ %#c 'Ȁ   # @##@.j`  ! # "N%#@J%# #@``,kc ;c %04J ` `@@ ̢ Ā` J@ v @ @c i c 쀢 c @&cD' T  %耢  2/ @t  ''@ ! 쀢 c @&cf  '  3/'@X  ''@z #쀢` c @&c䀤  # 㿘! #   "c"#耢"@& 5$#"  㿘 㿘! # "#@ $#! # `"#@ $#" /etc/pwd.db/etc/spwd.db%s: %m㿘 ?"`@ " ""В   @zr   "c ! #  b@*Ґ  $# 㿐 c  v  ! @a#@" 2 $## "$#@$#_ # "#'  @* .`` "  @* .`` ! #Đ@ ` @ ` @ $ ` @* .`` "  @* .`` "  @* .`` " @* .``  c@k `$@@@a   $ $OpenBSD: getnetgrent.c,v 1.9 2000/08/24 17:04:02 deraadt Exp $㿘@ 2 `@  & & @ P &`@  㿘  @2 *@5&  2 & @&`@   * "  & 㿘`  @ .`@ @` @*@@㿘  @: ,`@@u) 2 `@* 㿘L@ @ L@ L@ @ `2` "` LL@ @K   ` 2  L L L    `2  " *: #&   `&@` `@ [ @@* & 㿘@J  2`@ E `$ ,  ,   )    "@O @I@G netgroup: db getnetgroupnetgroup.byusernetgroup.byhost㿀)   / @} @ ,@ ''  ?0@ @W耢 &`@ ߐ & @1!@ 2" 310 0!!!@=@+䀢   netgroup: Syntax error `%s'㿘J`"V #%J`#N  `&J` `  L `2 "(2; &@͐cX.?, &J  `L@ `  # @f &@@ b @@  *L 2 netgroup: Cycle in group `%s'㿈  @f @03;+ 1 *'5|  ? @<0 "` &Ē㿘  ` `@sk  `  @s_     @sS   㿈  @ @Y В 1 M ' " ?:( @а 01 "@  "@  @@  Ð@ 0@ %s.%s㿘@q `@l   PN  Ѐ`N@  В@5(%s,%s,%s)㿘    ` @㿐` @" @ @C   ,㿘ؖ   і  ǖ    $ @j7"NN? ,2 N`@n3Ѐ  @  @Ur 逦@ 㿘 !`$ %   $`@    " @   @@ `耢 $   @$/etc/netgroup.db+㿐 `'!    #   @v6 $    cȐ n 1 @(u0@@UQ `@g  $ 쀠  "@" " 㿐!    '#   @u $   @(6`cȐ # 1 `@(*@K`  `  3`  2  2 @T  /   `  " "a@# #  /,&@@ @0Đ "#.@ΐ##`' .-@"`@-`d ' ""!' ''@ @"ʠ?! * .* '@ܐ @ ' .- - -@o |`@y u /-   @s b!@.$?#5 @s~ T!L` .2 `L` `  ``@@4 "!'!$` `   `c/`@t "&@&@@\ 2 `? /, ``$ @P@p0-f' `'! '!``@1`@, @p 㿘 1   " @ & "  @e "`@  ` "  "  @S  " "a?J:   JJ2JJ@:  :2J0 2J J@ 㿈#\?@ %s.dbtcx'X'D'H` 'T~?X  # ` @T !  @$ ]`@SA ' dĦ`@r$ P '    @l 9'# @~:   @t  "T@?  `@@l@@?@ٔ`@ H"D" @ j ' 1 ".M@  `(;,L \27, , &@$@M $ @* &!耢 ?@?@*M@@?$ 4̨耢 @n ɶ? ,L " #"T@ 2ݦ\  @= 2Ԧ '䀢  V䀢 @ސ ??s  ?L: ,?#\$쀦 ? 耢 @@0x" ?2 :,??E &@L  : $$@L? : :,`$@ "&@$@$' %@ " "a@ܐ@x?0=@$@z@v@f?h = X耢 $@$H@"@k 2 "@H " "a ?@A?D"@ 㿈@''`?''  ? J ? ?  &@J `?  JJ|:? ?J:|?  㿘@@㿘1   " @r7&    " $"`"  r㷈  $`$`$ `   `$@^jcp \$% `    "R @^ `` @?@q `$`$`$`  0@^>cp $0.*? "  L  `   *:  : #   J?`\2#  # J?`\2 "  " @q ?0O JJ`  : \2,@,@,@` @^< ` ` @@q $*?O  *J  | :2 *#\?^    1㿘 = ?@ d 2N " "a? dmS*2Q* N :s "q*А  ?  *`* Б: @  N/7$*`*1* : `2$ !*` € * ? *? *? *? *? * ? :*???*?  2N"@`d 2  ,?@(? dN :  ^ \ N`:`2 *" @ 2  ?@q?&㴝㿘; = >?@ d 2L " "a4? d  `"@@6 d 2 `"?@?@ dL : 2*@*@`"@@ 2 `?@?&㿘 # 2N@2? 0  `N@ x X `    @ϒ`@А *`: ?А *`: ? *`: ?& 㿘N@ :`N@ :2``@k.`.`㿈P 'P'T'X'L   +  ?#`L "@  "` + "@ "!@㿀P 'P'T'X'L   +  ?#`L "@  "` + "@@e㿈P 'P'T'X'L   +  ?#`L "@  "` + "@@1㿘 "!@7?PATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin:.execvp: : path too long sh/bin/shx  N  " "a@g" / 'K- ""(@{ "0@9  ?#` ' " u"a@Nxb- "  "x@"@$"b  '''''' @ A@ /,`@, "!@`=6!0*` € @  **@`2*  ?#`b$`* @$ a"@0 bp@bܨ 2M   %?(((((l(((((((((((((((((((((((((((((((((((((((((((((((((((㿘'L'P'T'X@$L$ pa@$ pa@$ pa@$ pa@$ pa@$; pa@$Z pa@$OpenBSD: rindex.c,v 1.2 1996/08/19 08:34:08 tholo Exp $*`:` J " $OpenBSD: yp_first.c,v 1.5 1996/12/03 08:20:03 deraadt Exp $yp_first: clnt_callX  N "q @ @ `"j N@ "f @ @('_ &'@&Đ@A S !  ?''?'?'' ` #\ ¦  ؟#    `@SݒcĐ?"`h@A.ఒ !`@5& & @*@`@&'@ ' @@@*@@_@Bā$OpenBSD: fork.S,v 1.2 1996/08/19 08:18:06 tholo Exp $  pa@"` $OpenBSD: strsep.c,v 1.3 1997/08/20 04:28:14 millert Exp $  J H 2* #2HJ$OpenBSD: strlcpy.c,v 1.4 1999/05/01 18:56:41 millert Exp $   (+  2 2 " 2+J " ?$OpenBSD: ffs.S,v 1.2 1996/08/19 08:17:58 tholo Exp $0 "2 J "2 J   "2 J  J $OpenBSD: bcmp.c,v 1.4 1996/08/19 08:33:57 tholo Exp $2J  J@ `2J      @ ` L `  % ?& &   4@k 2@L @ `2 @2   @ xe`",  €  4@kА 2B @A` ?& & ޤ@ l2ڤ`פ,* Ѧ?ö"P > ö 0 8 3 0ö 0/ - @@& @# ö 0   2@w2s"?L `äö"P    @@kh ـ@  ? & &@kW 2ɰL @ `2  8B@!,  €"   @@k5& @$`%@$& &@ @c "?/ J #  ?& &   4 @j  "n0 L`  ?& &  a@  4 @jې @J@0 L`  ?&  ,@&`@"=,@"? L @ ` ?&  &  4@j "L @ ` ?&  ,@& `  4@j "$@v,@8!H ?Հ`MB *` €` ""  "L-`R  "L-`R `` %   @  ,@ `? &  &@j5 2 @( @   x X@$@,@   x: p2l"8!1 ?Հ`:+#̓*` € "   $ !,@ `? &  &@iʐ 2 @(7 @@@. @ e E@ @@$@,@@e 2":"$@ "?0LL`DDDDDDDDDDtt(((<ddddddd||(((((((((((((((((((((((((((((((((((((((((((((((((pp<`ppp(@xT` @^` @ `  ( 6( " * @- `]** @]6` -* @ 㿘 0 @2 4@P$ $& 0& 4c  @,@< @& ,@~  @@Ӓ& 4&& 0 ?㿘?, !#h`2` @` 2`0  " ` @ E?` &` ?6` &``  6` `0  ``4@& @ "@-?&@*` %&`` ` ?߀6` @@ (` 2 `` &`&@``@@ `B &`&`<&`8&`0&`4&@.`B㿘@ 2 * $@c% &&@@S@@g&$@ @8@B"@&&$OpenBSD: xdr_reference.c,v 1.3 1996/08/19 08:32:06 tholo Exp $xdr_reference: out of memory 㿘@ @   @s  &@!@` @ @ @&@㿐@@ '@Z   Ė&@ 㿈N 0   N x X2  N $ L  @>, ?:` D , :  *??  N + :  . @  $@`  L ` 2$@?$@`$@:   **   %s: : %s 㿘 "!a 8’b@`` @ː’b@V! "@Q@N@]㿘'H'L'P'T'X@H㿘'H'L'P'T'X@H$OpenBSD: xdr_ypreq_nokey.c,v 1.3 1996/08/19 08:35:03 tholo Exp $㿘@P @:F` 㿘/L  `-+M  M0 M x XM 0  >?xx? ?@e?   ( 5 ! "@ @   " ""a?? ?x<@ B   L    Ӧ ̦ ``` '@㿘;'D`L'H  `-+L  L0 L x XL )0  ) #?)  >v u   $ `%E    7 "G "T @ 4?@  @  ?1  *&ᐔw~<@  b 41@ @  1?#? &ᐔw_<@ B   `L     H  DH"@$OpenBSD: authunix_prot.c,v 1.3 1996/08/19 08:31:22 tholo Exp $㿘@W `@Y[ @W'` @W"`  `b8` @i    %s: 㿘`8!Ēa@ @Đ@b%s: : %s 㿘 "!a 8ĒbX@z  @Ēb`@p!Ġ"h@O@h㿘'H'L'P'T'X @̔H$OpenBSD: xdr_array.c,v 1.3 1996/08/19 08:32:02 tholo Exp $xdr_array: out of memory 㿘@@V̒ ' @ 28 @ @   % @  &@Đ!@c` @  @ @ @@&@㿘 :     @ $OpenBSD: pmap_getport.c,v 1.6 1997/09/22 05:11:08 millert Exp $p o6 a4?a4!'''#\ab7ڐ @E! /!<'!<`''''' #\! ڀ    "a a`  ڀ 2   "a @܀?"6 @x6 ځ$OpenBSD: pmap_prot.c,v 1.3 1996/08/19 08:31:39 tholo Exp $㿘@V7 @V2`  @V-` @V(`     !x*@ @ *!㿘  8 Q !#x L ?# ߐ @ @2  @2      ) @nH  "$   0 # !cx ?c 2 `"  @2  㻐 )@/$ @?@0Ő* `4 @0* 2  ` @C6   ܤ 㻐  & $?  @.$ @@0* `4 @0* 2  ` ` !#x 'H'Ԁ`'D@H?"E?#x `'H" 'Ĕx  <''̀  'Ȑx  @  ' @  `   @? ` *!`"  DH`Ȑ#*` €   )4?`Ā#x!`'Ȥ  !!`! @ "%a @   @L $! $a " *a! "$!@LH  *! "aJ@/D H''''a@x H`  " *a 7ްa@ޠ  ް"@*` 7ހ  "@!6(̀ % @'j @/* 2 ' 77"7ހa@Y ހ  "!@j>#x"b* &7ޑ* 2 ""a@9蠒 ޒ"@*` 7 @ !` !ᔀ  ! @ #xᔀ @.   @K]$! $a " *>a"!#x `Ȁ!〥`!!!  Da@K䀢 # $!D a@>HH!   /'7a@Kq  "$!"aD aH@K/H Ȑ *x#x#x* '@` '耢 4' ''a  @2  `a 2 * +  &   @K  @u  "!`a0F! B'' ""aa @J؀ 4'Ԑ '@a#x $ (y a (2 DH a     #x *@r#x!``"D  `  " @c'@ Ā #x ` `#x a@P!`  DaH`/Ȑ#*` €   )4%?`D  `@ x Ȑ  '@Ā  "Ѐ  " ="a <"a"!?"$#"#$##㿘!!  @?$!"!""ᘁ㻈 ! ?&c $@$ ""!:?#d#\#`  @  " ("ag 6 " "a ` `ɐ!L*` € "   "  "  " "a?%(%4%%%4%4㿘 !#x  `   @ " ""! " " ""aN    J .Jd?`2J J .`? cx@ tqcxad2  ? @j 4a  cx `  ! ;:cx b4 !c /c@@G 4>a =7 "   "  2     2 `"" `@  "@ @   $ `? $?%.*s.%.*s㷐 !#` @` ""!'?`@?"N .2h@ ,@ ` $@?Ę$ȘHOSTALIASESr㻐 !# 2y @!@ 2q mʐ@Ka "h @h ZJ?` '#O@, O  L@ ` 2 L@`L@  @@ `"`L@ 5 ,@@> * L` @ `2`"`L` `  1  LL  @ `"  ($@W@,@_M.$0 @K @_D 㿘 @? @$㿐 U?@9`0`  `@@"$`0@Ɛ $`0T` $` $`@` 3\@D `@  ?@~`2  `C  $`4` $`$`$@2(" $`4` $@  $`  $`$`$`c# "a؁H !#x `` d@` ""!?`  @o@` #x2@4@@ *` * $@ >*` a ?$@?'D'?Z?2X?? Ժ@*B ˑ. $ 2 @+.2  @+  ;4` 8?@*'  @+  @+ @+  @+x 4`  ` .` ,` @+m2 .`@+i2 `@+j /`2 @+b```@4`& 㿘.`  .2 .   ,,`6 @͑2 @6 , 4 @Œ@6` ,`6 㿘@j %?' )!$@@F #c4    22@i2`0@$@   @i2`4$@  2 !  4 8!  2`6 5 3- 7 14 8 8 @*  `@i#$@@c4 $@` ˨#( ,,`2   , @4*  2` , 2  @` ,2`x 6: 6b@qD" @D ` ? &<6"㿘!  @q Db!/   D < ! t!  @ @i|$ @ @b 2 @/@ $ @a -    6`8)` 0@ @G!?4 0` b  40:@ 5b `2⪔ . 6 fLOCALDOMAIN/etc/resolv.confrbf;#domain lookupsearchnameserver%dsortlistoptionsconfRES_OPTIONSenv  !#x#x'`''   !"cx 2 $  "$ 5 ,4  ,$@!d<*@  $d̒b$  $`@T@)̀ >-@ " 8` @TѐL`,_ '$DH \  .  $@` ' N" N@ 2NNN    2 .$@#@H '! "̒c !0@T /`'#\@, c(@F .O K̐c0@XP  *O  %c@ 2;N "  " N - +! !#ؒ @TU̐c8@Fj, 2.'c@@X!  2AO  ; "!0@   N   `L@ y @ b f,  ,``L@ y @ b f , "Ӱ cH@W۔  WO  RcP`2N "  " N  ! !#ؒ @S,_@S 2.L#ذ$D ? ?@N  . " $@`  N @   N   2 .$@ z'cP@W 2O  2| xN "  " N \ Y ̤ L `  .J   L@ `"*  ??  ??''c`  5@eϐ@O (` #`  !+  `@u  !*  @_!   ! +  @`   !#*@" " "" 'ch@V  O  ֐`  ! a#xlcc-7N "  " N π ̀ ;@ `2N N`"N@RА 2 NN ; LN.@ߒ B !#xah-`$@@R %`. N   ; L `" *: @. %h@U'%@@O'%`h*`c"  ' S'@  @(L N` -`@*` '@ @@"#"#"#"# . `N   ; L `" *: & ./ @A @(  ?    4,, *,`` ` =.cx@V   O  ̒c@@F ` !x"  !#xd `**` "d@Z+ !#xL`` @ [  @Q .  ``@R ,a_`- !#`"#` $@N   ! !*:   .Nd`#ؐ?@$$@@QÒ . $@`@$@@  !x @  " @# @c !#x` "` ndots:debuginet6㿐N U !#xc'%Б*:  N "  " a@Ur    @D (%`L  2` ``* ad+  < $ad@UN   @UH  2N` $`N   2 N  0 ???$OpenBSD: bzero.S,v 1.2 1996/08/19 08:17:56 tholo Exp $ `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*㿐@ ?㿈) L `y 0   N x X    L*:   `  @ ?;   D` +`ɚ@ ;  . = $" $5 L `0$:  `2ѐ"$*` €?#@!耢 * #@?#@耢 쀢`* *` ` 耢 쀢`*   *` * @`2&@ EF E`EE@X8PG`GXG`GXG`GXtcpudp㿐N '@w   J   8  ????' $ $ $ $ $ $ $ `?"V  2y? 2u? 2q? 2m??g? "   "\?$$  $ $ $ $ $ $$ !"`" 2`"    ".? ꀢ    2/' ' ' ' ' ' ' '   $ @ $$ $ $ $ $ $ $ '  ' ' ' ' ' ' ⌀`n'$$ $ $ $ $ $ $  U"   O2N @ "   D`2A @ "   7`24  2 $   2  2$   2$ @`@` `" `` `   m 2l?g? V$$ $ $ $ $ $ $  =  5 22  @ "   (`2$   2 2$   2$ @.`` `` `     2 `?&   "&@&fbf㿐@  q  !#`H? Ӓb8@NP  "!0@ O Ӓb@@N@ `+ J@ &`J@ f" y b  2 @  @N@b  `J@ ဢ f`@B `  &  "!` Ԑ ,*` €???`@P POP Px& ' @?   "!`1 @@ 2) @J  "$  " ``@  $  @ $  ?@  & @Oh&'ؐ@̒ 2= @  6 @#H & @`2"?@ $?@   ` `  & @㿘@ 2B @  2 ; @M1 %  ,@4 $%?@!?,@   2 @?&`2@А㿘  @@  &`?@4^ 㿘`@ &  $  $ $  $  $   $ `$  @ $ `  *`@$  $ *  ` `@0 㿘@ 㿘`"E    2?         3?1?/?  "(?@ ?c ?    #`ђ#X@$ِ ߀ 2     2  2    8 8    㿐N ?`@? ?@?@  ?@# "@  J@ ?gethostby*.getanswer: asked for "%s %s %s", got type "%s"?cH'D  'L????؀  D0M2L D? c  ?D# 5`  " 8"aD@r D€  " %"a@@  " "a&'L ?#" ?@?D@> BbD@ "=@@ * 2 `@ ܐ* `4 @ א* 2 ` @ ?2&D@$ D€ " @@ 4?@2&? _@耢 (Z@@_ @T@QՒL@# %H@]@2  ch %@6@20@?2*@?# 2  @N & ' ' ' ' ' ' ''  ' @(? %@ ?     2 @d ??"  @D?#  L "Δ ""a  "" 8`  ????'???'???耢 L H $ ''''' '?' $''̢ ' 'Ȑ  $?'̢ 'Ȑ@X ! TĀ   $ `    > 2$ /etc/hostsr㿘!# א" @>b0$#@=]㿘!# @Re$## ?cp#`א" @>b0 %c| c@ ?#@c@ / "o L #?גb@%h %e %T %s[%d] /dev/console p<ڔbҐ ### :@ ` "#!# @!ڔ@Yt((('$@!ڠ#@)Ӑ@#6$@#܀` c   8%cc ڔ(@YI6$@܀ !@ޠ#0@Y96$@c   :,@` ,@`@*`$ $7'ڑ:  % N` m `@9@Y (6?&$`, ?`@*` : ,@g6@܀ $@'ڐ$c8 '''' @0   \`c @@Eؒ@ )@)@9ؒ@ ܀ ڐ#@ @a  >@F* $@ڐ$cP ''''ؐ@@O㿘!#؀?" @E?$# " X/dev/log(#c؀?   @7J ?4$cؒ @XZ c؀?-% X )  ? j ?/???????????۠/cP7@E gcؒ/@7f j? @c$c$X㿘 "#"#܀c"#c܀    "`\㿘!@#ؒ? $#" X〢  㿈  ?'  @ ?? $OpenBSD: _yp_check.c,v 1.3 1996/08/19 08:34:57 tholo Exp $㿐 !J"h` @#    "h&@"ߐ"h`?$OpenBSD: yp_get_default_domain.c,v 1.3 1996/08/19 08:35:09 tholo Exp $㿘 !&J"h` "h @ ! "h "h& $OpenBSD: ypmatch_cache.c,v 1.7 1998/01/20 18:40:27 deraadt Exp $㿐@ ``        6 2 @  D``$$ $ $ $ $  $ $$``  " @$  @$ @ &$ @ $  @ $$  $ @*$  @&    @H  @ @,` $   D  $ 㿐!  `  (  & #'@m ` "  2 @HÒ 2 @W 2 @$  2  yp_match: clnt_callX  L " @ @`" N@ " @ @$' '@Đ@ h  !z "h@Hz  쀢 `@'@ '@! 0_ @@@*@@!0U! Ė ?''''''''' ` #\  8 П#$    `@2^a0Đ?"`h@谒 !$`@'@ ' @L@"h@@H*  $@ʔ " $@=@!Wāyp_next: clnt_callP\ `N "w @ @`"p N@ "l @ @$$a '$@'@@ U !  ?''?'?'''' ` #\  8 П#    `@1גc?"`h@(ఒ !#`@/'@ ' @@@*@`@ $@ $ @@@*@#@=@ $OpenBSD: strftime.c,v 1.7 2000/09/06 23:05:11 millert Exp $||||x|p|h|`|X|P|H|@|8|0| |||p||{{{{{{{{{{{{{{x{p{`{P{H{8{({{{zz%a %b %e %H:%M:%S %Z %YPMAM%a %b %e %T %Y%m/%d/%y%H:%M:%SSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJan%c㿐@%J'ߐ @2"`2*? *?%02d%2d%Y-%m-%d%03d %H:%M%I:%M:%S %p%ld%lu %d%04d%e-%b-%Y-+PLF`%<L`z6"̓*` €/``ސ"0*` | ߐ!@``ސ"0*` ` ߐ!@ `` ސ"0*` 0 ߐ!@`` ސ"0*` ߐ!@` d@'lߔa@obД @ ޠ'ޔː#` a@TȰ` a@Lߔ!`a@@` @u@u " ߔa@-`ߔ a(@$`a@` @u͐@uɒ " ߔa@ }`a@u`ߔ a@lߒ!0@e` ""Ԓ@XߔO!8ߔK!@@a@ԖH`@'`'` '`'`'`'`'` '`$'`('@''ߒaP@)@$ޔ#(ߒ!`@` `?@@"ߔa@ ` " ߔah@@, > ``'l` $2m@u- d 2 n@u'! 2mn!m@u d  !n@u! !m!n? @u$?@u  $@?& Ζ 4` -`` -` 5-`:  V g ߔa2 ߐ ' d@tߔaap@#ߔ!x``` " @ ߐ @ ߔa@ `ah@wnbb̖ ',` '@hf' '` d@t'lߔa@ݖQ`ߔ'lap@ԖH`( @ؔ@` D` b4 @ @ɔ9` 5`$`6ߐ! !@@J <@G <* , ,  <@tSߔap@ bܔĘ  . L  }p}~d~H}}8X4LTx~$~ Xx~8XHxh< ԝ㿈@'ʐ@@ `@  (*@  $OpenBSD: strtoul.c,v 1.4 1996/08/19 08:33:52 tholo Exp $㿘%L @ `` - +L@  L@` 0 L@ x XL` ` 0  @?@r?L  / " "#@8? ??%@  @`    ? ??ޠ 4 `&@ $OpenBSD: atoi.c,v 1.2 1996/08/19 08:33:24 tholo Exp $㿘 @1 8`#`? "77''''@e*@㿘`6 "@"&&@%+, @s `"&&@ &@`", 値@FQ ހ" ,㿘 @0 rjeechodiscardsystatdaytimenetstatqotdchargenftp-dataftptelnetsmtptimerlpnamewhoisdomainaptsapfsbootpsbootpctftpfingerlinksupdupnewaccthostnamesiso-tsapx400x400-sndcsnet-nspop-2sunrpcauthsftpuucp-pathnntperpcntpstatsrvprofileNeWSsnmpsnmp-trapprint-srv%d㿘`!*` €1 1 1!1!1!1~!1{! 1x!(1u!81r!@1o!H1l!P1i!X1f!`1c!h1`!p1]!x1Z!1W!1T!1Q!1N 1K!1H!1E!1B!1?!1<!19!16!13!10"1-"1*"1'" 1$"(1!"81"@1"H1"P1"X1"`1"h1 "p1 "1  hb @% ,8DP\ht(4@LXdp|icmpigmpggpsttcpuclegpigpnvp-IIpupchaosudp㿘`+ ԓ*` €1*#1'#1$#1!#1#1#1#1#1#1#1 #1 #1  b @$ː ,8DP\ht%s㿘 !#x!` G   !\a@bÐ  !#x`  @ @  @* 2  &<`cx!`  !`?` '`@ * '@ @$. 㿘@`;; res options: %s㿘b@bv   !#x# " @ R@bfb2 `?`&`@ * &@@# ;; ->>HEADER<<- opcode: %s, status: %s, id: %d; flags: qr aa tc rd ra UNUSED-BIT-ON ad cd; Ques: %d, Ans: %d, Auth: %d, Addit: %d;; QUESTIONS: ;; , type = %s, class = %s ;; ANSWERS: ;; AUTHORITY RECORDS: ;; ADDITIONAL RECORDS: ;; ...truncated ;; ...malformed 㻈 !#x `?k!`  ( ``" x `2` !̒ `<" +`  c8@aϐ`& * & @#ex!` (x?`&@ ; ;* &@#Mx!` "@xch@a2``cx@a$c@a"c@a!c@a c@az @c@as c@al c@aex!` !x c@aY !?#cД @aQ c@aL  c@aFx!` +" ?`& * & @"Ւ  tx!`  "?`@a#? g !#x-+)`  @@a@8`   @ @>$ @ `s@m`  " `@ܐ* @2 @```@8Z`   @ɐ* @2 @`Ӓ (` ` "? ?`&* & @"b?<`@/  8?c#\  ՚ %@  H#\ @ǚ @  `#\    0 @``x0@``㿘"㻐@ $ O ?`&@ .* &@! .@"v㿘Ԕ".㿘@  & @  J?`."  #`#`.  *`㻐 ؘ$ @":0  %lu %s %s ; proto %d, port %d " "\"?" ;; *** Warning *** OS-type missing ( %lu ; serial %lu ; refresh (%s) %lu ; retry (%s) %lu ; expire (%s) %lu ) ; minimum (%s) %d %u %u "%.*s" %u %u %u %u %s %s ( 0x%04x %u %u ( ) ; BAD BASE64 %d ; LABELS WRONG (%d should be %d) ( %s %u ?%d?;; packet size error (found %ld, dlen was %d) ?c !#x ` Y ""!   =$ @!@j*  2 @e*  2 @e @\#xa`*  2 `d#x`0@_]#x!`   !@! 8@_O@ 8@_I`eC *` €``2?%?@mӔ   T"@ @@  82,T"@ @z@   @ * 2 `@ ` @_?`&@   X@! 9 6:5%@8`  \?`&@ \* &@ ?` &@  * & @ m`*?`&@ " "* &@ VM H `X@ ʒ6:5%@8]`  \?`&@ \* &@ 0?` &@  * & @ `*?`&@ "| " 2g@  h`p@^Z]?`&@  * &@  "[ ?`&@  * &@Ӓ @ G @  @^`@ ! @f @^@ ! @Z Ж@^@ ! @N @]@ !!@B @]!@ ՠ!* 2 @]x !@ ʠ!* 2 @]֐  " ?`Z&@6WZ  X@9 6:5%@7p`  \?`&@ \* &@C?` &@  * & @.`*?`&@ " "?`&@  * &@ g "?`&@ "* &@9 6:5%@7`  \?`&@ \* &@ג?` &@  * & @’`* "?`&@ "* &@ ?`&@ * &@ ? @ H 8?   .@ N ޒ 8?`  @͐Ւ 8@  * @ 4 * 2  @\Œa ! !(@\ @\ @\C@  * @ 4` * @ 4 * 2  a0@\,?`&@  * &@&[ " ?`&@  * &@C 2h| ?`&@  * &@@oO 2M!@ 8!@@\@B  ?!? @jԔ !T#"@ @@ aH @\$  * ' ``X@6 @1 ?`&@ * &@,`*?`&@ ) )* &@?`&@&  * &@v@ * 2  @[ɒa` ah@[Ðap @[?aX ✒$@  @+1而`?2@[!xL?`&@  * & @5`@倌`?}a@ x*  b@92 @[ a@[y@. a@[l@ ^ah@[b !@ Q!@< @[W@ I@4 @[O!@ :!Б* 2 @[F ?aX ✒$@ i @"+1而`?2@[)!xL?`&@  * & @`@倌`?a@[a@[@vaؔ@Z?`& * & @&a@Z @pp@ @@@p@p44pppTp pppp0ppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppTTANYHESIODHSCHAOSINxh`H@80     h`PH@8 xphPH  p!hP"H( dpehPfH0#("any"URN Naming AuthorityNAPTRgroup ID (nonstandard)GIDuser ID (nonstandard)UIDuser information (nonstandard)UINFOmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressA㿘    @  2 2 &   2 2&㿘   2 2&   2  b@M2&㿘   2 2&   2  b@/2&㿘" 㿘" initdebugaaonly(unimpl)usevcprimry(unimpl)igntcrecursdefnamstyopndnsrchinsecure1insecure2?0x%lx?㿘 ":1"/1&'1=1 &'161 +1@"#1+1 $11"1 "11 1###1###1## # # #  `@0 secs%d day%ss%d hour%s%d min%s%d sec%s㿘  !h!h  `"`6 . @d <@t <@d <@t <@d @t  ` `!p!!@Z L 2 ` , !!!@B L 2 ` ", !!!@' L 2   `2  2 2 ` 2,",  !!!@ %ld.%.2ld㿘  @d52   @d1 `* @s1 !! @t d d@d@ِ㿘 L    `1 +   +` *  `?Е: L .+`  L `*  :`Д *` * + Б: @ +` *  !`*   ```@:`!`,`@s 4 * $ 㿘L    .(`(б> ``L2`Li.) (б> ``L2`LK.+(б> `.2*`L!. 8(( `(/ 8а( (`/ ?Ѕ8`L"`L2(82)|((` (( (( (1 ((` (( (( (1 &(& (82 ( " ""`L"`L2"P\\\\\\\\D\\\\D\\\P\\\\\\\\\\\\\P\\\\\\\\D\\\\D\\\PȌȌȌȌН㿀''@|-'@@  / /    /逢`  2 쀢 2   J@ - +`'?J@ +`' L4' 4' 4`5 5 5  K ' , @ *  `?Ѐ K .,  ' `L ` '* :`Д@ *` * +`Б:  ', @*`@*`@@qL&%`L  @ `   ' @ `  4  4 `L4 ' @ `  :X.`/`L  `' @ `  `L  `' @ `  :/.`r/`L  `' @ `  `L  `' @ `  :.`I/.`.@.` .`.`.`.`.`.`.`.` .` .` .` .` .`?; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %smH '&%c@0 ` ``*`  `* `*`     `*``+ @ +`**@ *  @`   / /ސ†"??ڐ!  N S/ /@a#'@qq#@a <@qj <@a{ <@qc <` W/  E/@ak#@qS#@ad <@qL <@a] <@qE < d@aU d@q=@pl @+䨒 "ae@ "a^@ "a#\`#p#`#d#h#l#t#x#|##@;a a@vaa@va@vܐ㿘@z*   L ." `@ &L L * 2?J?`.2 %04d%02d%02d%02d%02d%02d㿈'@ 1  l  "  " #\!(#`c@ZONEREFZONEINITUPDATEMAUPDATEMUPDATEDAUPDATEDUPDATEA8765NOTIFYCQUERYUCQUERYMIQUERYQUERYNOCHANGE14131211109REFUSEDNOTIMPNXDOMAINSERVFAILFORMERRNOERROR㿘?   @`G  .&`)?0C@ @??(@`@.` , \ . \2 (@@:)?(@`(@`<   !`?( `@ &  ? ` (@!㿘@    @ 2`  `B ?@n  ;:,*`" 7*  ?@$@`$@ .񀦠\  ,  $ ??"? >*@*,2$? $     ? " ?  L @*`P㿘D`4 ` "' 8?, ., \" Ґ  < ` "&`."  `?*  @ `Ц &*?J .( J.  .`.`Ѐ   Ѐ -2 `2J 㿘N * N  .   㿘N  % ߀ ] `.`\ " N`  ߀ ] `.`. J߀](J    ( ( (*`  2 *`*@2 2 2 *`*@*`*`?Ѐ 8?Ʌ(8㿘 B :@'倢.3+1// #4 `L `഑*   ` D "$ Ӑ   ഑*  `L ` D "  ,  .@`   ǀ.  8 4  6%* . @ 0 07( @ ` 07(*& @* 㿘    "@  @G /"a?㿐N  / ( #@*  " @* @*`@ $2,@  ,@ .2 `,@ N ް   .@.`.`.` 㿈 @w N :   N :"Nt K N  `D ?## @) #8@)  ",R (N`:`.`GNN A >4, ,   6  @2l  0+N`°   !4, , `$   ? % **   @u   㿘    "@  @" /"a 㿈 c @P @ " "a %x8  ???? Ț 4`@ :`*`$@*`#@ * * ``# ?''  ?,`` ?'' ' ?Ā@$''''``,` ?Ā@''?Ā ??'?#  : .+@  Đ@@ `@ 2,`,( ``, ,` ,`Ā  ,`,`$%  ] ( @u b@`` Đ@ 2, :, , $@ " "a %d.%d.%d.%d㿈'1  8#\@: 㿀'  @  `c   "%,' @r' P'0a$'@tC? B`6   /,/0@,   @,( "@tQ  @+     2   $ؠ@, @t @q㿘#@ `! "@c!x @+ `  @+ߐ   20 `ax @+ђ ax@d 2ax @K@ܐ㿘  `P@Ԗ  / =㿈`B  0   `2`*3  *2  `? /// ///ꀢ`?/@q??@q@q`?@qT` . . . .Ğ`? ///@ * `@    2`*  2+ 2  //逢`?/@q ?@q?@@q 0 `. . = . =..?㿘N  ^ `L   Q` 0 @& _ "`   `9N +`3N@L"@* .@*  `C"@@: .@@**`  ` `3"@@: .@@**`   @%"@@ .@` N  L @ `2N=倢=@ N    #9 64? L @ `  =N   `2N=2?N   L  `"?N ` @ ?0?  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~* R   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~* R 㿐@@ؒ  ?&㿈  ?'  @r ?? $OpenBSD: xdr_ypresp_val.c,v 1.3 1996/08/19 08:35:06 tholo Exp $㿘@͒ @b` $OpenBSD: xdr_ypresp_key_val.c,v 1.3 1996/08/19 08:35:04 tholo Exp $㿘@  @A` @l` $OpenBSD: xdr_ypreq_key.c,v 1.3 1996/08/19 08:35:03 tholo Exp $㿘@  @5` @H` $OpenBSD: xdr_valdat.c,v 1.4 1996/08/19 08:35:00 tholo Exp $㿘`@ $$OpenBSD: xdr_mapname.c,v 1.3 1996/08/19 08:34:59 tholo Exp $㿘@ p @$OpenBSD: xdr_keydat.c,v 1.4 1996/08/19 08:34:58 tholo Exp $㿘`@$$OpenBSD: ypprot_err.c,v 1.4 1996/12/14 06:49:47 tholo Exp $  `(             LDT<T4,$ $OpenBSD: yp_bind.c,v 1.10 1999/08/17 09:13:13 millert Exp $/var/run/ypbind.lock%s/%s.%d/var/yp/bindingclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFDH'D"@?x  ? _ @~ ? "a # @pQ @p@p!? !"`  ` " @@m 2 `%b``$&@D ) @p $ !"` D@'Β  2 2 h@mW l   @p l?& \& h  h 2> hD$ @6@?  ?"- h@  #  '''̒ '@̒@ @o& h@ol@o"Ͱ @m4ɰ     ?А   ?؄?//'a'bД  @] 2 @#" @m #   @" @l !'''' #\@" D耢  "  D!@IMc `€ ?f& h @ `* @7 `/# 2 & H"X @lT   & L. H. I& P& T ` . J ` . K @. L `. M `. N ` J. O6 X& h@"D. D!'2`@:`' ` ? @& \a''Ēb H @ И \ & `@#P& h \ @5  ?@ ܐ#`b`&%b``2&@ 㿘 ` @?& \& `㿘 㿘 !"`  @&  2 ` @`$@$`@l>0 J ? * `` P 4 4`"  'L  ( " `P  @  4㜘'L% (( ` (@  @../etc/localtime/usr/share/zoneinfo/?` #@n)  N : /@" / 2 b@ E 2  N /@! .   2N" " ?N :" N /`?"#`"?@n@n #@ >c @"@@! . 2 @\  2?@=. ?? @ @m@m֐ 2ذ?;`8`5`&@2` &`/`$&`,`(@`, 2&` ` 4?` !r4?``24? 2? 2?* + * @ @` ?@@  *@ $@@$@ r 6``, & ` `` 6`e @*` Y`` & @` 6` gLΐ`& @` E&  @``@& ` @4Y?`  `   #L@ @*`   `#L@*@ 6`!L@&`& @ ` ` gL" "` L@` "` ?` `  gL" "`L@` "`?` ` mnJJ Ѐ ,-+2  " JЀ   ((+ Ї8   JЀ  & "@ 㿐 ۖ $* "@*`@*`&@N :  ʖ ; *@" * @&@N :   < 2@  &@㿘N -   +    @ &@㿘N J M &@`* !?В &@ `   "0 N .  ` v  "$ N . `      &@` !m` 2N  / u` &`㿘 ` @S d 2  @S! 2  "  ""   * * "@*`" *{ ;xT!u* * "@*`" *k ?- @ \*`@ ?* @*`" *" *  @S    &@ d@cy d@S,`@*`@*`@cl  ``:```: .`" @Sn  & @,` +`- @* *` \  `& +` * "*"@ *` posixrules,M4.1.0,M10.5.0X '@lVa!'{$`@?L <ԒĠ 7?" 2&@L '_$#?L  , ;  2L?Đ1'L 2L`"L , ;i  ࠒ ?L , Ȑ ?L `Đ     &`&`&gL&gP&g` &gT&gd&gh`eب '9 Ĕ͐ǔ$ $@$@,`$@ ,,`$@ ,`   @R d 2  @R! . .*@ *`" *" * Ȩ&` ?  ``@e gP* *  ``gL   eؔgP@gL * @*` ` @6  * * ``  @1 eĄgPg\gXgL` * *  `(  `2*" %% #* * ` ``@ۘ Ė   &gL&g`&gd&`&gP&gT &gh  &`&gL &`&gP&gT`&` `&` ` "?#L@@ @.@`@.@ 㿘"(Ȓ  㿘   ? P"  m㿘!",@@TZ㿘@h # מc  "@! 2@jÐ!@ $c "@L   P"P "T#b("@"L0 Pl L :A 㿘!",@@㿐  P``'`  %gP@ *`` eؘ%``   *@ 6* , 'L@ @@m &  #L@@ 4*" &(㿘!",@Je @D㿘 c"< ,@< " 㿘"0@+ c !  "c #,@"#,@,`" "x&(㿘 ޔ㿘 c"L ,@ " 㿘! #Ŕ㿘  ? D+!L!P +  2.   4  ?*      ?+    @2   @     @??ɑ+ %T@`d@Pt&@ T T!  ?"  `@`I.&@PY.@`B <& <@PR&`@PM  & &0'@`/!m`&* @*`@*`@ <  d@`$@`! <  d@` $@`!$$@`Ѧ` @P d 2  @P ! ,  , @ , @ \*`@&&&@`*``*`&$@ @ 6`&$& & 㿘ː@h@ "  2`㿘@ &8@_@_8@^|@"&@`` ` ` `@ ('D'P&@`'H'L'Ȑ  '̒`'Д 'Ԗ 'ؐ  ' ' $'('' ' < G?В < ??  8?ܨ 0?z'l *?Ԁ )!n'o? ؤ  ܤ  ༀ @O/ d 2  @O)! ,  , @@ `'Ԁ!n(+ؤ  ܤ  ` @O  d 2  @O! ,  , $@ 'Ԑ*  Ԁ!nݢ'"@ 'Ԁ  ''ؐ  Ȱ?ؤ\ܣ*   @Nے d 2  @NՒ! ,  , * @Ԁ@ؒȶ 8 ?ܐ'l'Ȑ?ŀ ?Ȑ ;''x''' 'IH!@   P#,? |,* 'P@P@耢@2-?? (/ * 'L@L耢@@ " L'HÒ 2耢@츇???줄ϪC?LH  4? `?' *"@' *@'耢`   @' 2?'LHD P"@?㿘  { 㿐  &  `" K && !@   P#,? :- * P@P@ @2-? (,* @  L`?"@  && `2 "@  " `?&& ޢ쨅?Ϫ?㿘!",@ѐ a@ɐ㿘?" 㿘& c 㿘& c} P PL*` 㿘'DDD&㿐'DސDD@ 'א D"@@ `'D&@ &􀢀 ?0'D&@ 4􀢀  SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%.3s %.3s%3d %02d:%02d:%02d %d 㿈 # *@ "@  *# @ "@  'l (#h #\ #`#d@+q  㿘 c@" @ " Ȑ $OpenBSD: strstr.c,v 1.2 1996/08/19 08:34:27 tholo Exp $㿘N@ `@eِN    2N@ 2N?$OpenBSD: strcpy.c,v 1.4 1996/08/19 08:34:14 tholo Exp $ @( *` @ (* $OpenBSD: strdup.c,v 1.3 1997/08/20 04:18:52 millert Exp $㿘@e @b @d0 $OpenBSD: strcasecmp.c,v 1.3 1997/08/20 04:13:57 millert Exp $        @ ` " @ @ @`  @ # 2 @ 㿘`` &`` 2 @@Y  " "a&?@``"  @Z% ? `@?&`*@``&@`  @Z ?@#?"77'''''L'P'T'X@>L*@: x؀ N "  "@d'$  `P '' "a@ؒ@d$$    X $:$$ @c| 㿀@d' ?''@HS$OpenBSD: clnt_udp.c,v 1.16 2000/08/24 17:03:15 deraadt Exp $clntudp_create: out of memory X\@a   `` ? `d@a@ `` a@=! "a  "h"`$ X @2 `2 *` V 6  $$$   $  ?$  $ $  8$ $ \$ T$ $ (@+K$ $ ''''' X@v @ +  <`€$ P 6$  '  @W   ' "!  a"a"@  b~@c $ @,$ $ @` @` 㿈`'' #\b'D ('H? \'L'P'T'X'D`@'T'P$'P('T`!ؐ` 2 * @`_ U@c  '$$$ $$$$H'|'x8'@$8`€PX@3€ D € PL€ 2  @`K $, `€'<'HH X@<H   "!$0@`0 $, P  "T F "!!X'7 "' T''' @1Րp?/b@!b?'8 2`* `*  $ 8  @ ?% X`x '` | 'd?``d'xP '|TH @_ې $, ᐀ Mh@1 hp"@l'`t"`'d@?`x`@|'Xd@'\@?XX\'xP '|T& @_ $,r ȠL ) " \'L@/ ! "᐀ #"$0@_$,Q (uX`@ 2o @  @ .@,, DD `€   $,$0  %@  D@  @  D'D @ ''$,",@_3, ,"@0"`4"`㿘  " 8 8@%  ("$"($"(""" "  "" """   2x2222㿘   " <@aE < `@ 8@^ې@^ِ$OpenBSD: clnt_tcp.c,v 1.17 2000/08/24 17:03:15 deraadt Exp $clnttcp_create: out of memory `@^  @^ d 2  c@;! "a  ""` 2= *` 26 @^@^y  6#$   @ &@j  @C    "!  "aa"?O @`K $ $$ $  $   L$  $  @0 $ @(' ''''Đ 0 @ Ֆ @  2  P  # @` `€ P$ H``@"|`@  $@$$  @^# @^ h 'H'P\ L 0'L'T  @$ `$ T   @ 2 `   0&@$ $%`  H ``€H " $ € PL€   $  $ $@  q $@   $ $h 2@d   ` % " $ $Y % ""0&@'`'`''@ 8'耢 F@ C  $ "'0<Ȁ2' @  $ $ 2&  T  $ $$ (€   $ ؐ $ $؀  &@@  $"  $  @ 2g&@ $ $"@("`,"`㿘  " L L@` ``" "  " " "  "  "" " " "  㿘   " P@_ P `@ L@]@]P2 `!ؐ` 2 * @\ܐ ?@`e  '$ $ $ $ $ $ $  @.  Ȩb@''+ " 2`* `*  $   @e a@. Ȗ"@'̒"`'Đ@? "@ '"`'@?' '`  ` & $@\)?a " & (& $@\?"@\@^ 2  6 & $& (?a & $& (㿘# " @^{?&a?$ $$ ( @$OpenBSD: clnt_perror.c,v 1.10 1998/12/30 22:26:18 deraadt Exp $㿘1 #` 2#`@\!&#`#`%s: %s; errno = %s ; low version = %u, high version = %u ; why = %s (unknown authentication error - %d) ; s1 = %u, s2 = %u ... 㿈Ƞ 2 k `€!@#!И@$!!@S耢`@ D*` €&@!#$ @aؖ@$7@!&@$ @$@@.` &@$  @$$ @$|(!&@" @$q !&@" @$fPbh. @00p @$[ @@@??@??@@?@@@@@@@@㿘!#!b u@7CBBBBBBhBHB(BAAAAAhAHA(ARPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code) # ć* 㿘!#!b @7;%s: %s - %s %s: %s 㿘x  / !耢` !耢`!!#А  !#ǐ @N@#V!  # @#K! ,,%s㿘!#!`@6EEEEhEHE(EDFailed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OK  Ї* $OpenBSD: bindresvport.c,v 1.13 2000/01/26 03:43:21 deraadt Exp $㿘@㾈`!'@?2`\?@]p  `   '`  ' " ."aE? '` ' ) .` *`.@ '@찒 +@U  #@ ! "  !@A   $!@ @e &$! $OpenBSD: auth_none.c,v 1.5 2000/08/24 17:03:19 deraadt Exp $㿀! #h 2  < @5 @ 2$#h+  < ' "!!&  a,&  && &  &  & @ (@ @ @& <  `@㿘 #h  ` (<   /etc/servicesr㿘!! !@a$!@ "ax"ax㿘!! " "@$! ""!x ,/㿐a   !@a $@  J?` 2'#! #p@[r, L@ #@ # 2,  "t @Ib0 ,@`L@L@ "` "`b8@8 ,@  J ?#* #t2"` "`"` @0 "&$@,  "!$@L  `*`:    @$@`@0 " $@,  "$@L  $@#t$a pa@$i pa@$ pa@$] pa@$ pa@$x pa@$v pa@$  pa@$ pa@$b pa@$h pa@$! pa@$OpenBSD: xdr_ypstat.c,v 1.4 1996/12/14 06:49:45 tholo Exp $㿘@ v$OpenBSD: xdr_ypbind_resp.c,v 1.3 1996/08/19 08:35:01 tholo Exp $㿘@[ " @  2  @`@`$OpenBSD: xdr_ypbind_binding.c,v 1.3 1996/08/19 08:35:00 tholo Exp $㿘@ 9  `@ 3  $OpenBSD: xdr_domainname.c,v 1.3 1996/08/19 08:34:58 tholo Exp $㿘@  @$OpenBSD: strpbrk.c,v 1.2 1996/08/19 08:34:23 tholo Exp $J H ? 2H  J  $OpenBSD: strcat.c,v 1.4 1996/08/19 08:34:10 tholo Exp $J" @ J2  @(*`  $OpenBSD: strerror.c,v 1.2 1996/08/19 08:34:17 tholo Exp $㿘 @`$OpenBSD: strtol.c,v 1.4 1996/08/19 08:33:51 tholo Exp $㿘7L @ `` - +L@  L@` 0 L@ x XL` ` 0  ) #@AC@Q+$ $    - ") "6"&? ? %@O"  #?% @Oђ  @`L    Ҡ? ??ˠ`2&@ 㿘 @R   " 6 "!8 !#h`@N(` "K  ? "B ; "> @N @2P  @ ? 2 ?  : @ 0d < :@  d  " : @ DE      "a2 @M h €dl"@2 T & @Q  2  <   (4 ؐ$$L4 2T @P Ȫ@B 2#0 @" P  @ ? : @ 0d "< :@ d0 " :@ D8<" @d  "@@d   @2'L4$L@@@D 4%@2L@%@&0$  $@"$0@U $0  ?T4 L  :  @ @?2"$0` $@@"$0@U $0 @ ?04 @]  @ "@$"$@M ?@?20?0`@@"$0@Up $0 $ ?4 $ 㿘 ;   㿐@ & @ME  @&! l6  lll!b<6 6 & $& ,& (& &    @V" $OpenBSD: fgetln.c,v 1.2 1996/08/19 08:32:29 tholo Exp $㿘 H* D  @U0 "?& H& D 㿘 4@͐ 2F&@ @?  $&@ @ "$4 4$  @?  $@Ò D@WO$"@$@`P $@D@W>@ ئ&@D&@ $OpenBSD: xdr_rec.c,v 1.6 1998/05/20 23:50:02 deraadt Exp $xdrrec_create: out of memory 㿘@Ty D @@$ <@ @Tk$ @ $ !@0`0 $   2 $   $ 8b& & $$ $ $ $ ,$ ($ $ $ $ $$ 0$ 4㿐 4 ,0"  @&@4, ", "4@%   &@ 㿘    &  & & @- 2  & @ "㿘   4   8 2 @a 󀦠 8@9 & 4"$ 4@㿘!    " 8 @Vr & @@$  @$ @  2  㿘`   @V  ?@  "  , ?  "  0" &㿘 ?&"   0  "    $  , 4 "  0   ( "@ $ 4$ ,    " 40 @  @  ,0 # , 4㿘 @St @Sr㿘 @ "  8  & 4@ 2 4   4 4 4 8 " 4& 8 㿘 @ "  8  & 4@ 2 4  4 4 4 8 " 4 0 , `?㿘`       * "@   # ? " `""㿘 ` "@ @?* "   "     `$ $ 㿘 0 (  $ "  ?" & ,& 0 㿘$  0 ,     4@U? ,&@& ,@㿐    2 & 8& 4  㿘`$  0 ,  @ ` 4 & ,&@  c(/  ?$OpenBSD: xdr_mem.c,v 1.6 1996/11/14 06:33:13 etheisen Exp $`"" " " "  "  "@ "   "@   "   " ? @dd(*#d ` * `* `*d# "  #"@d 0#d*@  *` *` *` "  #㿘 "  $  @T~  @$  㿘 "  $  @Tk  @$    "    @4 " "       " "   $OpenBSD: rpc_prot.c,v 1.6 1998/03/19 00:27:21 millert Exp $㿘@  ``@R!㿘@ 㿘 @` " `    ``€ @`  @`㿘@ݒ " @   @ܒ`  @ג`@ƒ` 㿘@ʒ @` " ` 2  ` `@-  㿘 &`&` 2 @ @` @`  @` @`  *  "@ "@ "@  "@ "@"@ "`"@"`jjdjpj|jj     "@ "@"`"@"`㿘    &@  "&@ @ ڒ@ &`@ "  " 0 " 0 &` &`&` &`$OpenBSD: xdr_ypbind_resptype.c,v 1.3 1996/08/19 08:35:01 tholo Exp $㿘@$OpenBSD: __strerror.c,v 1.6 1996/09/25 08:17:30 deraadt Exp $㿘  !@:  0?,@J  @:  0,libcUnknown error: 㿘 @А # , !  @@ . ? @ @. @S "@@Ԑ$OpenBSD: xdr.c,v 1.5 1998/03/19 00:27:27 millert Exp $㿀 ' 㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 @ €'@€  &@  㿘`"   `  0  `@€ 㿘`"   `  0  `@€ 㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 @ €'@€  &@  㿐 "    0 V@ €'€   6@  㿐 "    0 @ €'€   6@  㿐 "    0 V@ €'€   6@  㿐 "    0 @ €'€   6@  㿐N@'   .@ 㿐@'В   .@ 㿐 "    0@  @ '€@€    @ &@  㿘㿘$ "         a 2      2    c0`?xdr_bytes: out of memory 㿘@[ "2  2+ "   0"   @N&@  !@*a(    @N*&@㿘`–$㿘{ "   @ "  2    €xdr_string: out of memory 㿐 @   "7 @Q;' -8+ `  ` 0!  2@M&@  !@*2b ,#@M&@  㿘?NLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGC㻘 "?N @ / @w@O 2 @N  2 @N  P  XJ B  ?* : `(3"|*` € J@  4 @ 1 *`J@ ) @ **% J@   @  *`J@  @ **    * * L  :`%*@9?2 L 2 L ?y8yyyyyyyyyyyyyyyyyyyyyyzyyyyyyyyzyyyyyyyz0@ ?,@G @O;$?#\   @O @O/?2???#@ @L  && ̐@N?㿘?  " =  @ @7   @.@08/`(@ @ @?@4@08/`(@р 6`6`@؆@㿘?  " "a ?" @N @L[ $OpenBSD: errlist.c,v 1.3 1996/09/15 09:30:59 tholo Exp $ x`H0XH8 hXH `H(pX8(`H x`H0 hH0~Inappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisc quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0$OpenBSD: index.c,v 1.2 1996/08/19 08:34:02 tholo Exp $*`:`J   $OpenBSD: strncpy.c,v 1.2 1996/08/19 08:34:22 tholo Exp $ @(*`  *02 @$OpenBSD: strncat.c,v 1.2 1996/08/19 08:34:21 tholo Exp $JJ2 @(*`*$OpenBSD: qsort.c,v 1.5 1997/06/20 11:19:38 deraadt Exp $㿘  `@ `= @BT3%``@$@#6 $"    ,*  @$@ ֘ Т06`@B`@B`(q@B 6`-    4  $  &  4  -% %    4      4  ``&$6? "" ? **@AW-`)@` @$$@`6? ""  ? ** @3 π@0,)$` $$$`6"? "" " ? ** @ @ @-` `@@$$@ $6"? """ ? ** =@@%``@$@#6 $"    ,*  @$@ ֘ Т0a@@}$@$ @  $`%`$@ 2`? ""#@  ? **#@@8``% 2`? ""  ? **@  @@Ė@@%㿘@ union㽐@  @Aے   "<   " "a @ ?@Fѐ @ƨ$#"`@ $bP4@           c@F @@FŐ0%@  $@䀤c``@I@U  @F@Fr $@&  5p"   ` , %   `$@@$ '@۔ , %   @ @ "$  2``2$`@ 퀤@FS   @F'*  2 & $& @F&  & @F>@H  & && & @ΐ& 㿈 !0`!0   '?   @Iʚ ?!0?!0㿘@ @IJ `@@?` $@@F$`@E@H^@I: % pa@$OpenBSD: strncmp.c,v 1.3 1996/08/19 08:34:21 tholo Exp $2J@ "J`  2J@ $OpenBSD: strcmp.c,v 1.3 1996/08/19 08:34:12 tholo Exp $J@   J@J`  $OpenBSD: merge.c,v 1.3 1996/09/15 09:31:50 tholo Exp $㿀'D'H 'P " "aB? 'D ``?'H@>{@EY  D0?H'P@,H@>k` @@'耢' H@>_'` ?' @  ?&@  ?&@P€ ?  2" MP€F'€464'- P%@€$@($@>w%@@=2 P€4@P€4=" "  $@ `$@`/  ,@ ` ,@`!`" $@ `$@ ` ,@ ` ,@ ` VP ` $@ `   ,@ `䀤` " $@ `  ,@ `"  ''` ?@ @ 'D H@=N@H@DN 㿐.@` ?@=5@$ &@=,@@@=$@  ?@=@$   @= '     "``"@ "@   @,*@`$ P*$   $@ "@   @,*@`"@ * *ܢ$$  @tstore.10_prom0_fake_saveecho_pv_putchar_sun4_idprom.65_dtab_stringbuf.75_promdev_inuse_prom_mapin_prom_mapinfo_prom_mapinfo_cnt_prom_devmap_promvecstore.88version.ogcc2_compiled.___gnu_compiled_ccd9660.onfs.oufs.orarp.obootparam.orpc.ostrncpy.ostrerror.ogets.onet.oin_cksum.oarp.oether.omemcmp.oglobals.oexit.ocloseall.ocread.oread.oopen.olseek.oclose.oprintf.omemset.omemcpy.oalloc.osdiv.orem.ostrcmp.ostrlen.obzero.oashrdi3.o__main.ourem.oudiv.oumul.oinflate.oinfblock.ocrc32.oadler32.oinftrees.oinfcodes.oinffast.oinfutil.o ... . ..bootۀbootxxbinstall installboot . .. tmpwn root.operator ses$unit chmod 640 ses$unit ;; ss*) unit=`trunc $i ss` rm -f ss$unit mknod ss$unit c 121 $unit chown root.operator ss$unit chmod 440 ss$unit # backwards compatibility with older PINTs rm -f scan$unit ln -s ss$unit scan$unit ;; local) umask 0 test -s MAKEDEV.local && sh MAKEDEV.local ;; *) echo $i: unknown device ;; esac done #!/bin/sh - # # $OpenBSD: MAKEDEV.local,v 1.3 1999/11/25 20:10:57 ian Exp $ # # Copyright (c) 1991 The Regents of the University of California. # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the University of # California, Berkeley and its contributors. # 4. Neither the name of the University nor the names of its contributors # may be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE REGENTS AND CONTRIBUTORS ``AS IS'' AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE # IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE # ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE LIABLE # FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL # DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS # OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) # HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT # LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF # SUCH DAMAGE. # # @(#)MAKEDEV.local 5.1 (Berkeley) 3/22/91 # # Local device MAKEDEV script. PATH=/sbin:/usr/sbin:/bin:/usr/bin umask 77 for i do case $i in *) echo 'MAKEDEV.local: no such device.' ;; esac done  @ :    @@: LI@@P^<@`bT U: 9((AH: *I: - : -  ($?VA: C: C: u* 'zA: Q: .1xˀ: .1xˀ K`A: e: :  (: : : /tmp)-BmAi: -6=: :    "m: -(: S+: S+ c!: /: /: /xҏ!: !`: !`: #*^!: $[܀: $[܀: -DѥM!: /q: /q: 2b!vV!: 3%: 3%: 5 RmR.!: 6=: 6=: 8C !: 98p: 98p:  &!: bZ: bZ: F!!: ]J: ]J: X;%!: h: h: {yi!: X: X: 4)*!: I: I: v]M,!: : : f{!: !: !: &% <Bu!: +: +: /q vBu!: 4s: 4s: 8C _Bu!: À: À: ]J kx}Bu!: I : I : C Bu!: k : k : e brDBu!: % : % : ( aBu!: /: /: 2 TͺBu!: 5 R: 5 R: 6=!: 8C: 8C: 98p wˈ!: :i: :i: o:!: À: À: Ĵzpӯa: S+: S+: v-!: X: X: ve)a: I: I: vwZ!: v: v: v`a: : : vƬj!: C: C: v=Lfa: >: >: v!: p: p: v(a: t: t: vy!: : : v"a: : : v!!: /: /: vמla: ": ": vҭֽ!: $[܀: $[܀: vy'a: &6: &6: v#!: 'c: 'c: vzݍa: *Q: *Q: vK,!: ,: ,: vuM!a: .}: .}: v e!: /: /: v 7.a: 2b: 2b: v y(!: 3%: 3%: v ٪a: 6=: 6=: v \t'!: 7n: 7n: v ߶[a: 9: 9: v 7r!: : : v da: bZ: bZ: v | !: : : v +a: : : v9a!: : : va: !: !: v_tv!: S+: S+: v0a: p: p: |!: G: G: <ѷa: : : Xp!: e: e: Ra: U: U: P!: ": ": _Na: $s: $s:   !: &%: &%: гa: ) : ) : L2q!: *Q: *Q: /a: ,: ,:  y!: .}: .}: 'a: 05: 05: $1!: 2b: 2b: $z,Ga: 4s: 4s: 2!: 6=: 6=: oѤa: 8ـ: 8ـ: ,!: 9: 9: a: 1-: 1-: 1!: bZ: bZ: MRa: Ĵ: Ĵ: ~%!: : : ɓaa: р: р: t%9!: !: !: R a: X: X: L!: : : Y\a: v: v: Y%V!: : : D1Ra: C: C: !:  :  : k0ٔa: p: p: n!: G: G: a: % : % : *T h!!: &6: &6: *T ]a: ) : ) : *T!i5!: *T: *T: *T!tdRa: -L: -L: *T""!: .}: .}: *T"Za: 1xˀ: 1xˀ: *T#. !: 2: 2: *T#Xa: 5 R: 5 R: *T$|!: 6: 6: *T$Ba: 98p: 98p: *T%U!: :i: :i: *T%JPa: 1-: 1-: *T&!: : : +&6 Oa: ]J: ]J: *T'|+!: w: w: +'-a: р: р: *T(M!: : : +(QDa: : : *T)Z!: N: N: +)2ba: v: v: *T*!: z9: z9: +*IF(a: ܓ: ܓ: *T+@!:  :  : ++{3a: : : *T,-!: 9: 9: +,"=Wa: 8: 8: *T-G=X!: e: e: +-#a: U: U: *T.EO7 !: !: !: +.@a: $[܀: $[܀: *T/!: &%: &%: +/ϵ <a: 2: 2: 90BP!: 3%: 3%: :i0 Fsa: 6: 6: 91ƚo!: 8C: 8C: :i1޲a: ;3: ;3: 92%U2!: : : :i2sa: : : 93p!: Ĵ: Ĵ: :i39<a: ': ': 94G!: р: р: :i4a: S+: S+: 95IU<!: X: X: :i5Ma: I: I: 96/!: v: v: :i6 R3a: : : 97T4!: ܓ: ܓ: :i7s0a: >: >: 98o)!: p: p: :i8Ra: k : k : 99b!: 8: 8: :i91ia: (: (: 9:)!: U: U: :i:鑎a: #*: #*: 9;-N!: $s: $s: :i;~}a: 'V: 'V: 9<!(!: (: (: :i<Q8Ja: +: +: 9=!: ,: ,: :i=a: /q: /q: 9>!: 05: 05: :i>ia: 3B: 3B: :i?3}!: 4s: 4s: :i?^ ta: Ĵ: Ĵ: X@!!: w: w: X@a: р: р: XA1NA)!: : : XAq9a: : : XB E!: N: N: XB a: I : I : XCKs!: z9: z9: XC-a: u*: u*: XD㴓U!: W: W: XDaeRa: : : XEOA.g!: t: t: XEd/ a: 4΀: 4΀: XF !: e: e: XFGtxa: !`: !`: XG"o!: ": ": XGpAa: $s: $s: XHeR!: &6: &6: XH,7?fa: ) : ) : XI@"!: *T: *T: XIV a: -L: -L: XJ?!: .}: .}: XJu>a: 1xˀ: 1xˀ: XK!: 2: 2: XKta: 5 R: 5 R: XLG1!: 6: 6: XLa: 98p: 98p: XM!: ;3: ;3: XMQra: À: À: XN7!: : : XNMЂa: : : XOϪX!: ': ': XOa: C: C: t "!: u*: u*: t*Fa: p: p: t h!: G: G: t*]7a: : : t hML!: e: e: t*2`a: /: /: t ..!: !`: !`: t*t8a: $[܀: $[܀: t Ϳ!: &%: &%: t*{ >a: (: (: t \ C!: )': )': t*%w`a: ,: ,: t sW!: -D: -D: t*laa: 0G: 0G: t QD!: 1xˀ: 1xˀ: t*1G a: 4s: 4s: t >Wk!: 5: 5: t*$a: 8C: 8C: t !: 98p: 98p: t* >0a: : : t 3!: À: À: t* =a: ,: ,: t !: : : t* X.a: X;: X;: t (īa: ߀: ߀: t !: : : t*v:a: C: C: t qn!: u*: u*: t*Ea: !`: !`: 'c BM!: #*: #*: 'c*a: % : % : 'c  !: &6: &6: 'c*ɭa: )': )': 'c {/!: *T: *T: 'c*Ra: -L: -L: 'c #vh!: /q: /q: 'c*lSa: 1xˀ: 1xˀ: 'c 6^!: 2: 2: 'c*^a: 5 R: 5 R: 'c  '!: 6: 6: 'c*ca: 98p: 98p: 'c Vj!: :i: :i: (*_a: À: À: 'c !: : : (*M a: ]J: ]J: 'c .2!: ': ': (*pa:  h:  h: 'c $!:  :  : (*Ua:  :  : 'c ?ܼ=!: 沀: 沀: (*a: I : I : 'c Rd!: z9: z9: (*%a: u*: u*: 'c !: W: W: (*Z39a: : : 'c ~Ar!: t: t: (*a: 4΀: 4΀: 'c ,z!: e: e: (*a:  U:  U: 'c ˴x!: ": ": (*Ѭ,*@`"@ * $ $@ " "`?  㿘  ,*  @ `$@ `㿘@㿘@C=   8  <*`    8#" # # #?㿘` *`!<@@  2 "  @  " : @F   & &   @6@  2 @C$@㿘  @&   22 &   2   2    @R  &   @ 2   "   & @ `"   2   2  㿘  $ @F # "$a  a  @F a@E1!@E  "&& $Ą pa@㿐@̒  @ ,  ``  @ " "a @: " 3  `l!3 llll!b<3 # $# ,# (#  # 㿘 @E   ? ɚ @F @E 㿘@  ? ?$  @`$㿘  @:㿘 !#h`@:}  $ 2 0  " "!@4 G?"  @: @? $  ?4 $   4 ` @@" <@B   <$ 0 $  8 &$  2 @9U )@C !  $  $  ?Ȑ*@$  4 2 @ 4 4 $  Jr  wa "  "        &  "  J+b  J +    "@ 㿘T   " "a+?` @: `" @  &? " 0@A  0` @@"$ 0@A $ 0 D "$ @Ay$ D$ 4 $ 㿘!ɔ@8  " @ @xn6@ @n6 @ @Fn6 " "a ?*" " " " " " %$sniglet^&8`   " "a@!ܢ ʀ ?$a$a d "@Ē  "!`  ̀@  "!`$!  @?$a "! @    @ N " "$a !$a a@C !?! "!p! "2 O@!a@2 O`?  *a  €!`@ "` OX! "`(@: $a@ 2V ` `D* a8` `*@ :@ *`$a@D   `@ $a0@ @$a0  a @ ?$a$$a4@@h $ +! "!@֐"$!,+,,-,!8cLd☘"b  & & & & & & & &  &`@Ba@@g$! 㿘 ?@ @@Z " ? ? "  ᐐ?8!` ! @$ $ $ $ $ $ 4$! $ 8$  D @C  Ē @C @` @˒ :  @ $ $ - " @  *@@@ $ $  2$ 4 2$!  2  ဢ@ d"$  " "a  $ @  㿘 4@:   & @   *  D# *#  * ,& $& `@M֖ " ?!.`2 ? & ,& < & 0@9& (@ c , @4& @㿘!4@     "!!؀ !!ؐ?* &! @?!??&!@?!@K 2! "!! 6!!8, @ "!@?! , !?@A@?r " "!?㿘` " "a? "? !4  @ W  2 ?@  2?&!0 㿘!4 9aa!  &*&  !!& @  @B ?"$?@A=!?! O ""!&!,? !8 đ, ` , @ @L  2?  ,  㿘  @=   ""!#!,?㿘  !   ""!#!,?  @ 㿘      @    ""!",?㿐 @ @  ?P ` ` -` G`   % 2  `@ @A G`   @  "s ``݀@O +2 `'@Oܐ* 2 `@ d "W ``  T?` ` @J F?F ` `C `! ``+00 `6 `,@  @OĘ  & "@&@H͒ 2 `@Jg  `?@H  ?0 @>?? ` ?-`㿘     ""!$!,?!$   $!($!$$!  ! 2!$ $!( ( @ۖ "m?$! @ "  ($!$?$!$_ !(*  `2@ *@ @ $! $!(`  @ `!$$!  $!$"! @ "! !**`     @P  *?0)! ` @ @ &@@ ? " &`! ( 2  @& *@ 2" &@  !$ $!($!$$! $!( 㿘 (  4  0& (!@   @  *`*`!@0 "+?&  @ !ؓ,` "  ?!! `&!&! (@    D*` + "&  ,  & ,& 0@H'㿘@=   @At&@@ @=%$㿘! € , (  0㿘 @p   &!  @i.@   ! "!N$!?6  + +* !ؐ@" ! `&! @C: '|'d 'h'`'l't'x'p ?"@ "  t  'lt  |Dx#`'tE 'x| "'||DE#` 't'l'x'd'`'|'p| ဢ@d[ "@D  •  "L!b@b ?F$b \ $b X'\ T/ P/ L/\'X/ H/ / /X'T/ `/ `/ `T//'P///P'L////L'H/ / / H//L!b@ "  O?"@~ "_2z "'pb  $b $a$bp `؀!'p"'pp@ 8'p` b  $b b $aԐ $b $bp$ad p?*  'dpd* @ *'ddaؐ@4?l@4??* 2``4aܐ 4aaЖa@ +$@b 12 apt@Ė@3?b  $b  b  $b @b  $b  "  " O"a` ` "a@;/aЀ?@=@;' 㿐 @  "  2 2   @ǒ " "a, a 2,?"a@x  "@r  `2? $4 $ $ !ڒ 4 $ !ؒ @>N@W  @R 0?TMPDIR%s/bt.XXXXXX/tmp㻐@= 0@;V#h0#p0#$@s?'@= @?@2 @=  㿘  `"" @ & "  "!А "a?㿈  `@ $  " "a'?@' ?  @@ 0#\  @ؚ!Ȱ" @ @@0@$ P" `2@0' ` ` `.' .. . .' . .  .. '... . .. 7...7  `?2 .O.* 2   ܄ؚԘБ.`2 7 **  '. ***'**** ' `* `* `**' * * **`*`2  ² 0ki* 2  e ΰȞĆ.`2 @7 **@  '  . * **' * * ** 1'****'****' `* `* `**' * * **`*`2   P" `2@0 ? ``U2 * 2  Ģ+ 2 @  '``. +``+`+``@' +@ +` +`+`` @ `@' +@ +` +`+``@'+@+`+`+`@ 7 + 2`*@ *t`Ģk* 2  f ܰ؞ԆЄ̪ʑ+ 2   '``. +``+`+``@'`+@`+``+`+`` @1`@' +@ +` +`+``@' +@ +` +`+``@'+@+`+`+``@'+@+`+`+`2  7 `+ ʒ@2*` *`' . . .'. `. `. `.'. . .  . . ' . . .7. .7. ..t#tp * d * #p* l t`*  * (` (` ph(`  #l  * (` (` l(`  #h * (` (` h(`  #d  * (` (` d(`  #` ` `* (` `(` `(`#㿘 ``@@m $`@0 ?"+?@n@?2`$? "a@7$` $`a "a@7$a$aaȀ "a@7$a$aa@7ΐ@7̐@:+  ?㿘  ``@2 $ ` " "a?" `  `@? ?@A " ?$" 㿀 @u L" !ؐ!b!Ԕ " ?'''' @;͐@  ?$  pa@$\ pa@$OpenBSD: memcmp.c,v 1.2 1996/08/19 08:34:05 tholo Exp $" @ ` ?  2  @'P'T`'X#?"77'P`''''@`*㿐@3 ?㿐 @' ?㿘  @  㿘  @   㿘8` " "aL 2 $? " "a@90 L@!   0,@0 ?L`XL X`?#@  @ I 4GA,?L X` ``%<'+ " L/2?,@= X, `Q%a8L`*@2!  &@D , A, a, "!`5 " @!!  "!`' @  "a `? aL Z2`L" ,  @ `ʀzŀ  /dev/arandomx @5!@ے ?@8U x@8   %?p    , 'l p l @9Ě ?2 ?. ` `.   @ 9 @.  ` , , . 㿘 !#t`   *@? ##t**㿘 !#t`   aa? *a ` `,  @@, ` - - ,㿘 !#t`   (   ` + *  *  ( ,   ` + *  *  ( +` +  *  * ( ( + *  *   (  `7 ``206l(* * * * * * * * ؔ ټH4  㿘   "   "     6@ !ؐ?*@ ,  ?!0    2@$   `?@AΚ  ,$ ! " "@!&& $! "㿘! ! ` "`@4     @8@4 $`@4  @8  ! |?z&!@"``@"` 2` ` "n$` `@ *  ? ` @B 2m ` "``  !ؑ2*  !0  * * " *"` "=$` $`  27$`  23$`  @ *  ?     @A̘ 21 $  , "` "!`$ !$!"  "@ `" $` $  `  `" $` $`&,` ,`!Ē!$`$@&!`" @ :@`! "!""!㿘! 4 !/   `   @An 2?`"  "  @7A @3  " @3"!2  @"``"` *` @`"!"`!"@! ` h ``"b @@! $`b  " "`(   " `   " "a?`aܐ < (`Ԑ@ 4? '' @7 `@7 `aܐ Ԑ@ ?Ӑ '' @7 @7 `aܐ ̠Ԁ2 a@ @&` "?)`  Ж@ 2 @  ?  Ѐ @@  Ѐ "`b "`@m?2 `@@ ?`    ?  "@ @ #\@Đ c0m,* 2 2`   , "*@70  ,  6 "@6  2  ` &  $ ,@ `@7`@7`(@ @@ 2 a`@2a`  4`a䀢 2@  2  5`?2 ?@2@ $a 4a쀢 2 @`2@ $a4a$a@@  2b @ - b   $b 㿘 @ b!袒 2!I&!& 6 ` ` ` ?"@  @*7!䀢 2`` 2/*2 2`?@2' @ U &  6!6 6!쀢 2* 2 @ > 46!쀠 `?&&!@   㿐  `"" @  $ "  "I   "B @L@   6 " =  @  /'`?2  2  @/ 2*?  @N`?2     @  ?`?@ Y  " "a? "  $" 㿐@ @ E @ x " @@`"g@ ,@ .   @  "ް ` ?2 ? =@  !?&! 2"- 2 `@@  ! "!2! @ &!@ \  @  @ N 2 @! "!2`! &!@@`2@ y@ Ȕ @ "y @ i`e ,@    @  "c   A@  !?&! 2""- 2 `@@  @  @  `!"!2`2!  &!@ q @ Ԕ 2@  ?@ !"!2`! &!@"`2@ Q  @ &@`?㿐 @y 2z x? 2  @ 2n`?  @  2&` @ 2M" `?2  2 @S <?0L@  H ? 2 @ ئ ` ?2  @" ?#@Ӕ?"%    4 @ f " `?2  @ ؔ  @ Д  ?@ ˔ ?@ ?㿘?r# @ ! ` - @  @  ?"u`?2  2@@   4`!ڐ 4`H$` @ 2q?@ 3 "D!i?`` @$ @4V`?@4`*2  ?#  2*`2  `?2 "?* `+ 2  *2*` `?4`@ O @! ,@&! 2@  @ 9  @ 4 ?@6  @ ̒  㿘 (@   @  .@r 2m?.@  `` @ p` ?"^?` " @@` @ d@ ?2@P?`@ ` &@ @3@6*?#2@   3*`2   ?2 "?* `+`2   *3*`  @?6 ( @ @2    2  ?6  㿈  ` ,`" `  `  #\'7 @ 2 7'@ 2 ` W,`?2 ?7'@  ` C,`2`"@  %' 2`7@ɔ 2 `" @ > ?2 ?2('`"$'@  /?'7@ 2 ` ,`@   $@4`@  '7 `#\  @  `  ,`㿘``"`@ [  `"@  ``" @ L 2`? "@ ۔  $ pa@$ pa@$ pa@$ pa@$t pa@x@\ 7ޤޠ@+ ޠ@ ?  ޒ"@6 * 2     & , @2K@ & $ , @2=@28@ Y,  @ ?@ U V@:?`,Bἔ @ W  7  "  "  0= 9 ; 07   5 ?   `( ?  *   2`*`2  (" ` ? ? @ @ ` '' '@'` ?:    @.$  "   @q @   * ޓ2   * "@ *@1    6   "  "  0 @ e0 ޔ"6 *`3 ޒ*  @1z}$  ޔ"6 *`2 ހ`*  & &  $   ,  @1X `[` @ؐ?`0Sހ ? * @      @` @Ӑ$@$  ޔ"6 *6 ޓ*`@ &,$  ? * @      @` `?2 $@$  ޔ"6 *`6  * 2`&  $ @-W`"@ 2 @Ӓ?@?@ @  ἀ?$ἠ  @  @0@ @  @? @%㿐@ a  4`$@4``$`@$`` $` ```?2 @  &`4`7&&C@,ؠ 2@ 8  @/` @`$` @ ``$ $ 4 4 $  @ 2@@, & @ @Ɩؐ@0Q"@,&&㿐@# @   $@$@$`$ $ $`4 4`!ڒ4 4``  $ $` @&&㿘!ڐ?6`6`*  2 `@?2 @$$ `6`6`*` 2` @ ?2 @$ $ ` 6` `&` @  㿘!ڐ?* 6`6`2`&@ @ &.`  ' 6  ` " 6`6` * 2 &@@&.  @/ `"`  @>?2`  ? ` ?" *2 @ 6`6`@/&@+`   ? 6`&` @Ô  x`!ڐ?2 7'T*`* 2`'X2`     -'7  ''`'-`2 2` X6  "-  -0*  -0$2 @ @ `  2 @ @ ` `  ? `-2  @   2  @ @   ?@+-`2 7   /`2   :/*`2 -2`@ $* "6 2  'ܐ@/ܒ`@*`2     -`-2  `-` 2  @6    - @@-`  22@:# # "2-`2 T @"2@ *F`-2  ` `  "*`  *`0  *`0@ @ `  @ @ `   ?*`  @ @ @ ` @*-`"2`64 @.*` `-`2 4 6 6㿘 @      " @  ?` (0 `*`0`@*`0  㿈 ``"@@u $``A#ē*` € `( @@/ " "a? @t#\a@Cab  @ @<0$`<<<<㿐`]B!t*` €  "  " "aL?@F    @ @l "7??2  "  "&@)6` @ %   * @  @ @H "??2 `" &@?2 ?6`  h\ h h\ h㿐  `  @WS @  D "" `D6` ` ` *?2`2 @5  @  @ " &6`   `,`&@` 6`` ? @x 2 @ה 2??2 ?6`&@ 㿐@ 2~ "[" 2s' '@   @C ' ' 7  2&  +@ @,  @ 2$@2D? @ >??2 4  4 @ @ @  !& ?2 @2 @ `2 @O 2$?4  & &㿘  " (@(]& &  (&   . (6 㿘 ,&! @) 2& l  2`*`    , 2 @6 @-   "@!&P, `?, 2   +" 2$&-`    @Y 20 4 ?2 @2&  @# 2 &6  , 2!,2"!2`! &!   @U㿐 @` ' 7@Ĕ  @; 0 @6  & & & 㿐 @` '  ?2 ?7@  @ 0 @  & & & 㿘@`* @\7    @ 2n?$`2" @@ @'=  @'{ "T?&& @+&& && "B  `   @` 4?0@`2 " @"$  `  (@ @'  @'> 2'@?  '`@`  @+^  ' @'  ' 㿐    2    * @  2   * @    ' '   !@E!̀ "!?'!€ `8 @  " ` `` @ @    ``@㿐@*ה ` @*Ӑ& :! @&V @&`$?&'!?@' @D 8@*@Δ "@`' 㿐` !@?@@k %? $$ $ $ 4 @4  @*x $@ &ۦ@  㿐@*] `@*Y  @ 2` ? "!@x   ? @ "'`'@ @ 㿘&`!Ԓ&`"  @&!@S&" 㿘!Ԁ`@   !&@" `$" $!@> 8@  # <   " "a  @ $(  &&   ""  &$ &$&$&$"$$"$"$ mpool_new: page allocation overflow. 㿘$?F`@!@& @3 , $ &$@"&@" &$   *   * "" 2 "" "" " @2 &" & 㿘  *  䀢@ ""`@ "@@ & "`  @"@"`@%&  㿘@R ?   *    "`"  ,"@$ $` 2@"`" "@ @ & "`  @ "`$  $ @2 &" &    Y, &"@@ "P $@ђ $@' 2C @2@ $$@& $   " "a2  @($ $  ,     `*  ,   $$ ` 2 "`" "@$  $ @2 &" & $" $$    `*` *` 㿘 @ & "`  @ &"`@$m 2@$g 㿘   @f?2  ? 2 @$  ?㿘dd @*;d@"7d  2/  @A?<    *  @@  ""` @ "@ @ $`"`  @ "`, $@"2 d@#    d@'k $ , d $d 㿘$ `$$`` @$$@&ǖ 2?@2?`$@%$$ ?` .``("   2 2  $_ pa@$OpenBSD: calloc.c,v 1.5 1999/11/10 20:12:31 millert Exp $㿘@@#s @& 㿘'L'P'T'X@jL$OpenBSD: vfprintf.c,v 1.9 1999/08/22 17:06:35 millert Exp $㿘` @ _&`&`&` @   ? ,$ 7''7'''''@1 @ 2? @  @4 InfNaN0123456789abcdef(null)0123456789ABCDEFbug in vfprintf: bad base0.㼐@'H'` ` 2 ` @1  " "a*?`   HW` HH<'$'8 ''''' '$ @$  $< %'$'$$ $$@ '耢 '[ ޤ ' $  '$''?/+$J@`'$?`XN#@*` €O+ $ /+ $ L ?Ѐ 8, L** ?Г:`  L $ 8  '8H8@8 .' '$.' $ '  +/+$J  *>'$L ? 8, L** ?Г:`  L $ 8  '8H8@8 .'$.?&i?h$?Ѐ  , * $?РJ@`?Ѐ '$ $?&U?T?M  , * $?РJ?Ѐ '$ $2A'8 9'8H8@k2$/ - @$J l2( '$$ 8`@.@/@   ''8 @ `.@*  : `.@:  6q  -/+`k ? g   G  "  8`.@''ȴ?`".@''ȴ?@   x H -/+H! @  H! ,#`!#\7@Ś0 g G00?@$ g g E e e f'0@' , @ ,`  O7 @  O7`  " O7 C  -@/+  8`.@ :`:  `.@ " @ 8`.@ 2`.@ "   '' 8 @ `.@  `.@  8`.@Haؠ '  q x8`.@H!   @  "$/+@#   'x'|x 8 @ `.@  `.@ / H!H!؀  ''X'\X  8 @ `.@  `.@   2 /+ '?`S "  7HF"  4`,  `4 0 , 806 03,  @  `0,   ` `0, , 4`  ` 4  ,'@#< ' ? @/@ /+ ''O+ `' '`4O+" . 3`X $$` '耢 ': ? `X$$@ '耢 '$ O+  + $$`  0/8/98 $$` '耢 ' `4" . +`h $$` '耢 ' e? 4$`h$$@ '耢 '̒ O" - +`h $$` '耢 ' 5? 4$`h$$@ '耢 ' ! e$$@ Fx BV0H"0 $$` '耢 'u 0,@  $$` '耢 '\ ߤ,?  +`h $$` '耢 'B Ť? 4$`h$$@^ ``,H"0 $$` '耢 ' $$` '耢 '  0  - +`h $$` '耢 ' u? 4$`h$$@ '耢 'ܒ _$,$,@R$,$, @ '耢 ' B0,"@ - +`h $$` '耢 ' '? 4$`h$$@ '耢 '  H"8 $$` 0$0 @ '耢 'o 0 H"8 $$` '耢 'Y ܤ$0," $,0" @ t , 4 R   ./8/98 $$` '耢 ', x B,$,?$, .@ ? 4 +`h $$` '耢 ' ? 4$`h$$@$$` '耢 ' f$ $  @ '耢 'ϒ R 1" , 3`X $$` '耢 ' 5? 4$`X$$`'耢`' !8 &  ' 耢  8' 耢  8'8`@"` @ ` @? #/8/8$/8/8/8/8/8/8$%/8%%(/8&&&&&&&&&&/8/8/8/8/8/8/8/8/8/8'h(/8(/8/8/8/8'/8/8+$/8/8/8/8/8,p/8/8-/8/8/8/8/8/8/8/8/8/8'<'l(((''l/8/8'/8*`+(+'4/8+/8,t/8/8-  ?`/*`d * d *`d * d*`d*d* N%2   N `XQ"|*` €N ?` %L* @ L*`ДЀ @LN*6 N ?`  L* @ L*`ДЀ @L $@  @ d@r`d *@`@4 d@d`d *@`@4NЀ NЀ   +  * ?И NЀ  $ @ `@d@2`d *@`@4qpN `@d@ `d *@`@4_^N@d@`d *@`@4ONN@`@d@`d *@`@4>=N@d@`d *@`@40/N`@d@`d *@`@4N@d@Ғ`d *@`@4N `@d@`d *@`@4N@d@`d *@`@4N@`@d@`d *@`@4ߦN@d@`d *@`@4ѦN `@d@`d *@`@4N@d@p`d *@`@4N@`@d@_`d *@`@4N@d@Q`d *@`@4N`@d@B`d *@`@4N`@d@3`d *@`@4rqN `@d@!`d *@`@4`_N@d@`d *@`@4PON@`@d@`d *@`@4?>N@d@`d *@`@410N `@d@`d *@`@4 N@d@ђ`d *@`@4N@`@d@`d *@`@4N@d@`d *@`@4N2N@1* & )d+ " d `Q"8*` €`@?``@? ``@?``@?x`` $d @%EEEEEEEEEEEEEEEEE= EDED= EDEDEDEDEDED=L= ED= =ED= >>>>>>>>>EDEDEDEDEDEDEDEDEDED?D@HED@HEDEDEDED>EDEDAEDEDEDEDEDC@EDEDDDEDEDEDEDEDEDEDEDEDED??H@H@H@H>?HEDED>ED@AB?EDCEDCDEDEDDD㿘@  * @&@@@@’&@ *@ $ &@ 㿀?"\ f#   e E   9/ -/?#\  ?@ 耤 g G f# fJ 02 @` B  '@@ B3'@   0`*@@ '`" "@ ``, -,   +,  ` @j  0.@P ` `0..   & 0. `0. &㿘` ` ` 2 @@#  " "a?@`  ` `, $$ ڤ`" $&`ְ `s "` `@  @2` :` ``#. ` *. @Ւ` ``&@$`$`$@$`` "`*@@`@"@$`$@.@` @ @@@$@ 2` `` `,` $u` ` @`@"@$`$@`" $&`b   `  ` @F "@  `@ ` `@ @ @@@@$@ +0@ `,` 0   @`@"@$`$@2`@j   `" $&` ` ? @4` 㿐@H 'T!D@m T 31?T2 7耦(7耢 2: % 4`44`44`4`ؤ45 5 ȕ4'5 5  B'? 8' `@5`@E`*  @+@;`*  @!@1`*  @T  -`@#T :-`-2 ,`- ͓2`   ` `" `` 8   đ. ?2@ Đ" * c'Ā@ '.` @ '  @ @ @?   '/ @   7@', @@Œ '@*. 2, @ ( ?#   ?#*`/@.  ?@ '$$66`% @"6``4@  * . ?  @26`@4@Ā2T`#@  " . @?* :@ @2. 4@*  *`T@ :̑* Τ Г*`@  +    ?( 8 2 + ( 2;```0  ?2 `2 #;`` (` `?#@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @(#)divrem.m4 8.1 (Berkeley) 6/4/93@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  $OpenBSD: memchr.c,v 1.3 1999/11/14 20:28:24 espie Exp $"   ?2  $OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $X@V+  2     " *@ `2 "@ `2 *@ `0* @  "2 2  "? *@2 ?"@? *@$OpenBSD: strtod.c,v 1.13 2000/04/30 04:58:22 bjc Exp $㿘 "Е.  ` @ " ,, @U "`"`"`"`   `Ѕ("@ 㿘? #  @ Y @@ U4`4  *  $ 2  ,   * @ ː, " & 㿘 @T  *`   "`"``   N      &N    ?  * ?<* 0*  *   @, 0"@& 0"@" ?  0 0 0 02 "@0  "@㿘&  " " 㿀 `@6  `  ` . ' , `,`% *%@  ''@ L@ @`'?c '? c@ g @  @ `4`4 444 4  $@? #@ G 4 4@ ?4 @   4 $@  $'  "' 㿘` !̕*  >``#! #```"q$# $@ 2^$@"`" >`U>``2@㿘>` @ *@  Z `  " * ` " * " 2@ ` "`" & C`(` " ?8 㿘     H     ` * `@ (? # @  "  22: "  33 ` :`@  ?# @  : 2`@ 33  :`  ? 2 ?   ?0  8 4?8      ( ;``"##㿐  * ? " &@ " 4  ? "@ ,2   ? " 3 ,  ? " 4+ @ ?"#㿐T ?. . 6  `''`'   " *@ $ 2 '$   $   $ ΐ $ $   ` 5͐@& "@ Γ. @&. "@&㿐v? o ?` " *`"  * #??ā`@ 'H`L @@ `    ' ` @ `2`M@ - + '2M@`M@` @`0 *  `M@`0 @`O* : *'     -*   ?4`+  *  ?Ъ`M@ /9뀥 :E` =M@0Ϫ`M@0`π 6e ' `(``   -*  4+  *   -*    +  *    M@Ѐ Ӓ`e EI 2 `2"ڪ`M@+ -І `M@Ѐ .0Ϫ`M@0"`π !Ъ`M@ *  `M@?Ѐ/9*`%@ "@" 2     `H &@  '"艡B?  ?aؑ* @ $'%H "艡BD? >'@  2:%`"_H%`  !ؓ.` ?$%% B"@ $%aؑ*@?$&@ .`% B@?$% B !ؓ*` ?$% ?*%@P !ؓ* ?$% B?4$ :" " ""a䀢 H   + @?$% B?: + ?,$ ?%( B?  $(#a?_]  !ؓ* ?$% ?K:4 b + ?$% B?: + b@?"鋠#" D(?)F!?()BD F?" " ""a䀢`|H 2?@?r  2'''m  0[5 # @  I ?   ? ?2@ :?8 ?遠 ?"! B0& "!+'逥 b&1'? 逤""!c"c#B'cB &'??@%?Ѐ B- %?,??? @'cD?   #"D?" cB B?d?? @D?   F#' €?# c 0#  ``` *@ޒ` ܒ `       $@  ?3 6" @   4`% & $@    2`&  u & V  ?H 2"?"쀢 #㿘 t -    `@L `1?#  @ @@4`4    "@ @2 @:`"44 3`: ('  "'  0?#`  - @4   4` " 2 @:`"44 3`:  ('  "' InfinityNaN0h "'L'P'T ? "̒ *@  "" ""Ȁ`6'@ '@ * '  T#"@̀ ^?^^!(!8\ N    \"( B T "\^ְa@ "  ,ȓ2g Ⱥ| ?* &' $2`   @Ȓ"@̐$* 2@ ̐"*@' #0B?{͔ ? '?#8#@'鉡 FcPH(JHBH ' B# '!ؓ, $ȇ%)'#?    '% 'L 8'LL` 'L L "'b!ԓ* €?'? 'P'P`P 'PP' 'P '쀧`   ` ""̔  ,  `"̪ ""Ȁ ` Ⱥ  '  aؑ* @<"  #Ƞ "  ?Ȁ " /`@ &' B<  `ȅ!?Ȳ`aؑ* @>`$Ȁ %B?"  /`@ $ȇ%B?ȡ<  `耢 cX 9' 쀢 c` B ?'酠ȀF#h?0D'@'&#p  '$% ?ȅ)  P?䀢 Iaؑ* @`$釠%#x ȑȍB'`0-@ȍ…&' Z?ȉ"#X#ā) 0 @6T?#`ȑ DDB?ȅ'`0.Ȱ …&' 8?ȅƁ)} 0`@4?Ȑ* a@ $釠% B#`Ȁ@B'`0.Ȱ ?#xD-Y 0ȉ&' 9?Ȱ?N 0"? Ⱥ`D??Ȥ  ZX!ؓ, "P #    cp Bȁ  1-@ Ȁ@ȍB'`0 H.Ȱ  ?ȉ"#B  ?ȅ$%H` 0?N 92?-@ . #` B?#(D`'Ԁ ! L ؀d3 6" &$' %  ` @4%%&@䀢`` 5 z q L̀ 2'?@2 '   ''  *`q  "@ `  ` "```@i c耢`  ޒ  Ք 쀥L  ǔ y  1Pɤ8 1-@`Ĥ``(܀'  Ը* @      Ԁ   ' 'Ԑ  `Ԣ 02H  &b` L` ̀ `9+ 4`f.& ``L`̀ `’  4`2N.`"K.``:  9E. `9` 9., ;..@   $ ` 0.@  ʒ 4 ??`N  1?N 9  .-@`N 0"?   Ԁ`@ߐ ݐې2. 0-@` .T"\2"|||}|} $OpenBSD: multibyte.c,v 1.2 1996/08/19 08:33:39 tholo Exp $ "  J` ? `   ?J@"J@@  " *   J@"`   `(*`  㿘 !#h`2 @& 2   +?"  0` @@"& 0@ǐ & 0 &   ?6 &  6   2 @   &  &   &  㿐  C & & (&@&@o  c  C  & 6 & &# "a& &  &@V  2  6 8T  &&@:  &<  ؐ`?`&$&@( "&@$ L ( (l"@"$㿀. * "* @  * ?  ? #  ##? P? ?    ( 0 8 @ H?88888 8(80888@8H8PX㿘 !#h`@Q!X   R X 2 &  ?2 2 """""""0"4"D"H㿘@DX " `X  ` "@` 2`} $㿘d@ΐ `c  ! "!؁"ch㿘 2 d@ `    "@  "a?㿘T` `  ` `@" $@`$`` ? @4`  $`` &  4`, $OpenBSD: localeconv.c,v 1.3 1997/07/23 21:14:40 kstailey Exp $$ "DH       $((()(*(+ (,!(-"(.#(/" H"H "` "`"H0((.```````$OpenBSD: umul.S,v 1.2 1996/08/19 08:17:46 tholo Exp $ /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@+ddd0㠅(#h @    @8@ @  $OpenBSD: getdtablesize.c,v 1.2 1996/08/19 08:19:20 tholo Exp $㿘@Ő @(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @(#)divrem.m4 8.1 (Berkeley) 6/4/93@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  $ pa@㿘 `@h error: x 8!f'ؠ"0@n  a''@h ''@d'@`''ؔ @   @"a warning: x !fbא !` 8'@@  a'ܐ @:'''@6'@2'' @ 㿘@  / 0. @   !|6  !"@   "!@ "@  㿐% . 6  * #\  .  @x?! !@*. !$$!@Ȓ  /etc/malloc.confMALLOC_OPTIONSunknown char in MALLOC_OPTIONS mmap(2) failed, check limits. P "! )- 1 g @ ? c , @  2Zg@  "!MHLđ* : `>7g#*` € ԑ* 5%  ԑ2 1%  ."!  *"a '"!  #"a  "!  "a "!  "a "!  "a %  %! !g  $!$!L     "a`#\   @Ø? ?"agɐ @ /2 !x?  "a|$ "! &!x %  Ԑ *` @P%  "a&a(D `x8Tp㿘 /!0   * `""` "@""" 6   !|4  !"@ *`   " @   "   !`. @ Ѐ`  a "a@㿘 ( ?>   ' >  `ᄓ,` n  b 2 2 *   *@, @ @ @N 2* 2`*26 2 2 2"  ?3  *  `"6 3 *  @(   #@   (3 *`@ (*#@  $?2 2   a| ᄐ#* """ 5  `  "   `* @ " *` 6 "@& a#: *  ,    @ allocation failed. 㿘 !x` !`$0@  (1ݐ !` 2 i>  !` @ malloc() has never been called. junk pointer, too low to make sense. junk pointer, too high to make sense. modified (page-) pointer. modified (chunk-) pointer. chunk is already free. pointer to wrong page. 㿘 !`@ !x`2 i\!!|4` "@ iT! ! iM! !*  oiA!`@ !`@ $0 !`5@30@00>(i* 3`?@i " o2 2*  2@ `i"8 !` @ 3`@ 0"P 0&  @0@@page is already free. freelist is destroyed. 㿘 O !x` i!0F!`C !|6 "@ it!08 a ik!0/ !*   j\ h0 /iU"P0 iO!0 # *  `'  ! @   "@`@  !`*  @  $" " " !`!" "A$!  :  2 @ " " $  "@0$ @ $ `%$ `2" ` $ `$ @ $" 2 $ $   j" "$$  -`% Ԁ@&#  a@"`@{ a@` $ @ @$  |2 " ?$a  % ! * "`p0l /  2 i"0a2`*  @ `2 i"80U !` @ @ *@$@   !* *`24    `"@`"`  : " $ "  *$ "  2"  |2 " !* "  in malloc():recursive call. out of memory. 㿘! !k a "Ā  $!k!!Ȱ ?$!! a?$!Ȁ k" in free():㿘! !k b "Ā $!k!!g!Ȑ?$!ȁ in realloc():㿘 k# "aĠ  "kؐ!!Ȱ ?$!Ȁ J ! a?$!Ȁ k"$OpenBSD: getenv.c,v 1.4 1998/07/16 18:02:33 deraadt Exp $ 4 "ሀ / !#8*"@ J=2!"  J JJ 2 J=ې    㿐ƒ$OpenBSD: abort.c,v 1.6 1998/11/20 11:18:49 d Exp $㿐?ߒ'  @e 䀢   !؀` @"@@~  @%  @M @@s @ 㿘T @Z  P > B< P ?Đ*@4 㿘 ! V  @  ?Ē* 6 V @"㿘T   @?  2  ?Đ*@4   4 < P㿘@QV 㿘!X ? T` "??`X2x? `}'m!̓*` € G  @耢 ~?|z d W  7  @耢 n?l ,  )  C  #     : !              '9'    '1'                    $? ܖؘ @ ? ܀ ? " "a ? ܖؘ @ ??܁4@dp| $0(LX<x  ??''쀢'  ""a ? "! *@ @  '@؀ ?؁$y pa@$ pa@$. pa@$: pa@$ pa@$I pa@$% pa@$6 pa@$ pa@$„ pa@$ pa@$ pa@$OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $Y V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @*㿈'XX#d#h#\#` @T Ł㿐 @V  ??#\  ǔ@=  @F $OpenBSD: sigprocmask.S,v 1.3 1999/01/22 06:07:56 marc Exp $@2@  0 pa@2"$OpenBSD: brk.S,v 1.2 1996/08/19 08:18:02 tholo Exp $bX@4   :pa@ b  $OpenBSD: strlen.S,v 1.2 1996/08/19 08:17:59 tholo Exp $ J " $OpenBSD: memset.c,v 1.2 1996/08/19 08:34:07 tholo Exp $($OpenBSD: exit.c,v 1.4 2000/01/06 08:45:50 d Exp $㿘 "!` `?, @`, @?, @`2` !؀ @/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin㿘 @tU  N "`2J "   < ; <"oa8@v <9    1 ",  ?`#o"*` €#?###    (",&  & " "a?t؂$ pa@$ʄ pa@$Ƅ pa@$OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $Y V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @*$OpenBSD: sbrk.S,v 1.2 1996/08/19 08:18:10 tholo Exp $   : pa@"$OpenBSD: cerror.S,v 1.2 1996/08/19 08:18:02 tholo Exp $ " a??8  F @Ȕ [  , 7 0:" ƀ 4   ?  ' $@ `,`  4`  ,` . ’ Ȕ ,  , 2 ??. "?ǐ ĀƐ d &@㿘@  `r d а  ? "' ' ''''''!  !    "  "& `& . ``& i& &`D9 "'!  V ?#` `! 2``o "  & pc f&  @"& r"pr#&  "S   & x 2K5 "@p !& tsqr~qt"c($p#xcx& & & & & & &   "'5 "`  2   "` Շ Ճ !  )€??5 "0 " "a5 " `"&M& 㿘  `"" V & " ( "" "a?㿘  `"A $ `.r!H*` €@% "(" ( #  $    ( " "  $?2"G " )2"!€??<?" " "a5?" " )2 "!€ $" ـ8 @l   ( , ($ $@"   @0@$ ```,`㿘  `Ô $  "@`2" " "a)?@ " )" !€ @   ? @ "   ԑ@0@$ 㿐̀ Ȁ   `2B?$$'3'Ƞ `? "`@  "@?2,?2,` =@  ̀?*   !$ 㿐bO ba'a̐@  =?H?2.a̤!!a$aaȀ & v  `. 2 @$a. a`? "`2aa@  "@?ӀaȀ?&''`?*aȀ b  !$b 㿐bà aȀ / m`2 b6?b  !1$b $a$aab'b'b$b b a* 2" b @  Ѡ  ဦ$b 㿐bb  b%b*'b  !$b   2 &'@   ? ߰ $b 㿘  `U $  "$ @`" ""@@% (  " 2 $ @  $?$ $ "a ? "  @$" 㿘@ 2@?`@     㿘`. @   " h ?2I?`` @& . ``@ " @: ?6`?* c2  @ 3@*`2  ``? ? @" : ?* `+ 2 ` *3@*` `` 6`b?$b㿘` `Ҟ $ @& ?2" ?$ "I" 2?" ( @f! j" 2??"?p `` m $` 2 - |  t 2 €??"k?   @2c?$ '' "آ   24$$䀢 G   "$$  ? '' ` '   $$?  k  ?   ? *@$  ?㿘'L!Ā ! = { `; &!&!!L  &!& "@ @`* @   !ϯ!̀ 2.?&!" @"#!̲ @ !Ȁ B`2&!? &!!Ȓc' !'''  㿘 ,&!   J " $@& 6 m   ?2  !*`2 @`*+@   @( !2 !&! В*2 ?@    ?*2 ?@    # 8 3 !' ,` *`  ? *`   #   !?&! ` r@ ߀$ 㿘,` ``$, @2 `Ȑ,`2`6 $, 2 `,`2`,``2 6**`@6$ 2`2`㿘`. `@C"?. "  ,"* *`@`2 `" @ @4.`22@22*   @4 248?$8``.`㿈      2 j?- .`3 3`@c Y  - `  -`@<`` , @ '2$'2%* "@ , 2 $ @ @ "@44 @ '" ('`@ʴ@ "* 2``**`4@@% 2`@* 2   - ` ?-`p?*2`@   ?* 2   #\@6 2?܀؀*,`2 ` 2%`# + 2**4' 2*`* 2 2`? c  @h   l  i,`,`2  ' %@ '`' `# '`2#  * @  `@  @͐ "w #. * @  `@ c@ 2"?U .`* 2`@  *` `8,`,`2  *F @ 㿘`' *2  "- * @ ?*2  `  ^ ? "\?``"  Ք*``ё* *  @  `@ `@= 7 `  *  @  `@  ؔ `@W 2?`  .` 8` & 8 (p` 4 $  Ԑ@ڔ ?㿘 4@@ `2  & 4 & 4``@r.`,`2 `  &` ` *`*2*  2224`㿐!  6@  ?6` 6`  < ?*  D@  3 *  <  ' ?*  D @ @>  ?P??  " O"aB?6@`2  @ 2  6@ ?6` 26` ဢ@-`"@ :  &@?'  .@ .`.`.`` 7.@.`@  `@?7 .@.`` 㿐!? @Ր 2o?  ဢ@,! "@ :  $'++ + +   `@`7 **  <ڐ ?*  D@  4 *  <  'ɐ ?*  D @ @>  ??? "  O"a?㿘 !!<   , &! X " R?* $ ĕ.2 !8.`" $      (HASH: Out of overflow pages. Increase page size 㿘 D, `$* : ?: 1 8. @ @c €2 * ?  $* ? @  :  ? ?k` *` Ց. ,D@  %$@   "@ * $@ g$  yc o 1 % *` ,$   ?$   * ?2%``y, F  2e ` g $y% * ,$  , ?$  :** %  * @% , ;C  :**$   * @%  *` $ ?%$  D D .  4  ?* D@$@ g4 . . 6  㿘`2 ` '*  D@  $&& $ !8 : +`*`   @|  :**$   * *# TMPDIR%s/_hash.XXXXXX/tmp㻐 {$ 0{ 8{ H$A?' f?&!!    ! ?㿘,``$4, @2 ``$ 6, 2 64`4`` *`$ @2`* 2 㿘!@6  .`!8$ .`        2   ?*@    2@* *@ 㿘`*  d* 2 *`*  4`$ , 2 0  +  +  42*`4$ 2+ * 2 4 `s%'+ @ @- $@,`4 2 4  4%@*"@2* 2  4` `.`*`@`?`*  H* 2 @ @"**  4 $@ ,`2  +  +  42*`4$@ 2@*  2 +  4 ! 2`?+  4 `` .`*`@`? 㿘`  * 2  ( `*  ` * ?`*` .`2` H`   +  ?  `22`$`&?$`?2  + *`2 "  2 ` *`@ 2` ` ,`  8 ?$ 8㿘`,  " * 2`@( `$*, 2 o &  $@``" *2   **2  ?,  K ??㿘 @+  ?  "    +  @  `+ &@  㿘`.  `2.*  ? ^ "s?`  .  `*  ? I ]` ?* @   2  "?1 -,`D?  &" !&  * !$  &!(&!$&!  ? (&!  &!(`@ 2" !$&!  &!$ ,`2 @?&   "!E ! & "a?㿘`   "@(`!  @&!, &!( * ?Ɩ /&!  `,!$&!  &!$*  Ĕ $?,` 2 @  "! `@ 0 "a?㿘@  ?&! &?㿘```? * 2 "@ ` ! yP /$!  ,%?@* V ΐ ,` 2 @  "!``@ 0 "a?㿈\'P 2d?@ P* 2`` 4 P $ L?$  `"`` *``/`` *` 2`6 *2 *62`6@2`* 2 P$$  `` *` *  *` 262*`@2`P  ?6P"$ $ 㿈  `"" A $ " "-" "*8T "!̀ :!Ȁ 쎐 `?"$!$!!!" " " !'"''' ("T. € (   " $!"@"  @ ""@  "" R  " "aM? 5" )2 "!€???" %" "" ')" '"' " "'@3 #?"`" "4@   "$ $"  $"        ĝxa ź䀢?/ ?' ' b@    "b@T?2 @N J?     ?`"@ @. 2 #\ 3b /$b. * 2`2   .  "*  .   4 "@4  2    $  * b b$b @$b $OpenBSD: crt0.c,v 1.3 1999/08/20 14:11:36 niklas Exp $...T.T.Z.qX.x....o(..x.p_x.h_x.`_x.X.P.@.8 .0 E.( u8. u8. p. p. . - - - - - - 8- P- "H- .h- 3@- 9- N8-x -h 8-X-P-H-@-8-0p-(- P-P-P-ph-ph,ph,ph,{,|,|,5,,,,, , ,,xP,h(,`(,X,Pp,H-,@-,8-,0,(, ,, **$OpenBSD: args.c,v 1.8 1998/07/09 18:39:23 deraadt Exp $$OpenBSD: conv.c,v 1.6 2000/06/30 16:00:04 millert Exp $$OpenBSD: conv_tab.c,v 1.3 1996/06/23 14:19:46 deraadt Exp $    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: dd.c,v 1.8 1998/04/30 05:55:02 deraadt Exp $$OpenBSD: misc.c,v 1.7 1997/09/12 04:33:24 millert Exp $$OpenBSD: position.c,v 1.3 1997/02/14 07:05:22 millert Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_cd9660.c,v 1.11 2000/07/31 01:57:06 pjanzen Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: df.c,v 1.27 2000/10/18 20:37:42 mickey Exp $@A0?PA>Bp>C=pC<@$AA@Y@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. qxxh`P@0xph`H0 xҰA0123456789abcdef@(#) Copyright (c) 1983, 1988, 1993 Regents of the University of California. All rights reserved. xp`PH@8(xhXH8(xhXH8(LH,$%ɠ&)T*D +Ƅ.@ !\0 "\D( <\UH <\E<@Xx8h`XXlP('p1122L22)+8+(++***** *`*@ *0 * *:;;;;:WPW@W0W@W WWVWPVW0VWVWV[UGHRBD M@dmCXLS1@2pxhXH8(hP@(xph`XH$NetBSD: atalk.c,v 1.2 1997/05/22 17:21:26 christos Exp $xph`XPH@80( xph`XP@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( XP@0ph`XPH@80(xphX80( ¸xph`XPH@80( °¨ph`XP @80( ˜ˆhH0pxph`XPH@80( xph`XPH@80( xph`XPH@80( @(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount.c,v 1.20 1999/05/31 17:34:42 millert Exp $@hX@(  @ $OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sync.c,v 1.2 1996/06/23 14:21:55 deraadt Exp $@(#)cl_bsd.c 8.29 (Berkeley) 7/1/96@(#)cl_funcs.c 10.50 (Berkeley) 9/24/96@(#)cl_main.c 10.36 (Berkeley) 10/14/96@(#)cl_read.c 10.15 (Berkeley) 9/24/96@(#)cl_screen.c 10.49 (Berkeley) 9/24/96@(#)cl_term.c 10.22 (Berkeley) 9/15/96@(#)cut.c 10.10 (Berkeley) 9/15/96@(#)delete.c 10.12 (Berkeley) 10/23/96@(#)ex.c 10.57 (Berkeley) 10/10/96@(#)ex_abbrev.c 10.7 (Berkeley) 3/6/96@(#)ex_append.c 10.30 (Berkeley) 10/23/96@(#)ex_args.c 10.16 (Berkeley) 7/13/96@(#)ex_argv.c 10.26 (Berkeley) 9/20/96@(#)ex_at.c 10.12 (Berkeley) 9/15/96@(#)ex_bang.c 10.33 (Berkeley) 9/23/96@(#)ex_cd.c 10.10 (Berkeley) 8/12/96@(#)ex_cmd.c 10.20 (Berkeley) 10/10/96@(#)ex_cscope.c 10.13 (Berkeley) 9/15/96@(#)ex_delete.c 10.9 (Berkeley) 10/23/96@(#)ex_display.c 10.12 (Berkeley) 4/10/96@(#)ex_edit.c 10.10 (Berkeley) 4/27/96@(#)ex_equal.c 10.10 (Berkeley) 3/6/96@(#)ex_file.c 10.12 (Berkeley) 7/12/96@(#)ex_filter.c 10.34 (Berkeley) 10/23/96@(#)ex_global.c 10.22 (Berkeley) 10/10/96@(#)ex_init.c 10.26 (Berkeley) 8/12/96@(#)ex_join.c 10.10 (Berkeley) 9/15/96@(#)ex_map.c 10.9 (Berkeley) 3/6/96@(#)ex_mark.c 10.8 (Berkeley) 3/6/96@(#)ex_mkexrc.c 10.11 (Berkeley) 3/6/96@(#)ex_move.c 10.10 (Berkeley) 9/15/96@(#)ex_open.c 10.7 (Berkeley) 3/6/96@(#)ex_perl.c 8.10 (Berkeley) 9/15/96@(#)ex_preserve.c 10.12 (Berkeley) 4/27/96@(#)ex_print.c 10.18 (Berkeley) 5/12/96@(#)ex_put.c 10.7 (Berkeley) 3/6/96@(#)ex_quit.c 10.7 (Berkeley) 4/27/96@(#)ex_read.c 10.38 (Berkeley) 8/12/96@(#)ex_screen.c 10.11 (Berkeley) 6/29/96@(#)ex_script.c 10.30 (Berkeley) 9/24/96/dev/ptyXX@(#)ex_set.c 10.7 (Berkeley) 3/6/96@(#)ex_shell.c 10.38 (Berkeley) 8/19/96@(#)ex_shift.c 10.11 (Berkeley) 9/15/96@(#)ex_source.c 10.12 (Berkeley) 8/10/96@(#)ex_stop.c 10.10 (Berkeley) 3/6/96@(#)ex_subst.c 10.37 (Berkeley) 9/15/96@(#)ex_tag.c 10.36 (Berkeley) 9/15/96@(#)ex_tcl.c 8.10 (Berkeley) 9/15/96@(#)ex_txt.c 10.17 (Berkeley) 10/10/96@(#)ex_undo.c 10.6 (Berkeley) 3/6/96@(#)ex_usage.c 10.13 (Berkeley) 5/3/96@(#)ex_util.c 10.23 (Berkeley) 6/19/96@(#)ex_version.c 10.31 (Berkeley) 8/22/96@(#)ex_visual.c 10.13 (Berkeley) 6/28/96@(#)ex_write.c 10.30 (Berkeley) 7/12/96@(#)ex_yank.c 10.7 (Berkeley) 3/6/96@(#)ex_z.c 10.10 (Berkeley) 3/6/96@(#)exf.c 10.49 (Berkeley) 10/10/96@(#)getc.c 10.10 (Berkeley) 3/6/96@(#)key.c 10.33 (Berkeley) 9/24/96\^:   }) 00123456789abcdef01234567@(#)line.c 10.21 (Berkeley) 9/15/96@(#)log.c 10.8 (Berkeley) 3/6/96@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1992, 1993, 1994, 1995, 1996 Keith Bostic. All rights reserved. @(#)main.c 10.48 (Berkeley) 10/11/96@(#)mark.c 10.13 (Berkeley) 7/19/96@(#)msg.c 10.48 (Berkeley) 9/15/96@(#)options.c 10.51 (Berkeley) 10/14/96@(#)options_f.c 10.25 (Berkeley) 7/12/96@(#)put.c 10.11 (Berkeley) 9/23/96@(#)recover.c 10.21 (Berkeley) 9/15/96@(#)screen.c 10.15 (Berkeley) 9/15/96@(#)search.c 10.25 (Berkeley) 6/30/96@(#)seq.c 10.10 (Berkeley) 3/30/96@(#)util.c 10.11 (Berkeley) 9/15/96@(#)v_at.c 10.8 (Berkeley) 4/27/96@(#)v_ch.c 10.8 (Berkeley) 3/6/96@(#)v_cmd.c 10.9 (Berkeley) 3/28/96@(#)v_delete.c 10.9 (Berkeley) 10/23/96@(#)v_ex.c 10.42 (Berkeley) 6/28/96@(#)v_increment.c 10.12 (Berkeley) 3/19/96@(#)v_init.c 10.8 (Berkeley) 3/30/96@(#)v_itxt.c 10.16 (Berkeley) 10/23/96@(#)v_left.c 10.7 (Berkeley) 3/6/96@(#)v_mark.c 10.8 (Berkeley) 9/20/96@(#)v_match.c 10.8 (Berkeley) 3/6/96@(#)v_paragraph.c 10.7 (Berkeley) 3/6/96@(#)v_put.c 10.5 (Berkeley) 3/6/96@(#)v_redraw.c 10.6 (Berkeley) 3/6/96@(#)v_replace.c 10.17 (Berkeley) 6/30/96@(#)v_right.c 10.7 (Berkeley) 3/6/96@(#)v_screen.c 10.10 (Berkeley) 4/27/96@(#)v_scroll.c 10.9 (Berkeley) 4/27/96@(#)v_search.c 10.18 (Berkeley) 9/19/96\ @(#)v_section.c 10.7 (Berkeley) 3/6/96@(#)v_sentence.c 10.7 (Berkeley) 3/6/96@(#)v_status.c 10.9 (Berkeley) 5/15/96@(#)v_txt.c 10.87 (Berkeley) 10/13/96@(#)v_ulcase.c 10.7 (Berkeley) 3/6/96@(#)v_undo.c 10.5 (Berkeley) 3/6/96@(#)v_util.c 10.11 (Berkeley) 6/30/96@(#)v_word.c 10.5 (Berkeley) 3/6/96@(#)v_xchar.c 10.9 (Berkeley) 10/23/96@(#)v_yank.c 10.9 (Berkeley) 5/19/96@(#)v_z.c 10.10 (Berkeley) 5/16/96@(#)v_zexit.c 10.6 (Berkeley) 4/27/96@(#)vi.c 10.57 (Berkeley) 10/13/96@(#)vs_line.c 10.19 (Berkeley) 9/26/96@(#)vs_msg.c 10.77 (Berkeley) 10/13/96|/-\@(#)vs_refresh.c 10.44 (Berkeley) 10/13/96@(#)vs_relative.c 10.11 (Berkeley) 5/13/96@(#)vs_smap.c 10.25 (Berkeley) 7/12/96@(#)vs_split.c 10.31 (Berkeley) 10/13/96$OpenBSD: cchar.c,v 1.8 1998/11/18 23:26:13 deraadt Exp $$OpenBSD: gfmt.c,v 1.4 1997/09/01 18:30:33 deraadt Exp $$OpenBSD: key.c,v 1.8 1997/08/24 06:49:30 deraadt Exp $xyxyxzTxxzTxp|xhztxXzxPzxH{,x@{Xx8}dx0{x(}dx |x}x}x|<x|w|w}w},w}d$OpenBSD: modes.c,v 1.5 1999/10/26 22:53:52 deraadt Exp $$OpenBSD: print.c,v 1.8 1999/10/26 22:53:52 deraadt Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: stty.c,v 1.7 2000/10/06 02:49:55 aaron Exp $@(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.4 1996/12/14 12:18:01 mickey Exp $@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.69 2000/06/30 16:00:08 millert Exp $h`XPH@80( hxp88888880( 88888p88/tmp/EdDk.aXXXXXXXXXX A$OpenBSD: dkcksum.c,v 1.2 1996/06/23 14:30:05 deraadt Exp $$OpenBSD: editor.c,v 1.74 2000/10/22 23:59:40 millert Exp $PH@80( Pxph`X            X  AA?DISKLABEL(8) OpenBSD System Manager's Manual DISKLABEL(8) NNAAMMEE ddiisskkllaabbeell - read and write disk pack label SSYYNNOOPPSSIISS ddiisskkllaabbeell [--nn] [--ccdd | --rr] [--tt] [--vv] _d_i_s_k ddiisskkllaabbeell --ww [--nn] [--ccdd | --rr] [--vv] _d_i_s_k _d_i_s_k_t_y_p_e [_p_a_c_k_i_d] ddiisskkllaabbeell --ee [--nn] [--ccdd | --rr] [--vv] _d_i_s_k ddiisskkllaabbeell --EE [--ff _t_e_m_p_f_i_l_e] [--nn] [--ccdd | --rr] [--vv] _d_i_s_k ddiisskkllaabbeell --RR [--rr] [--nn] [--vv] _d_i_s_k _p_r_o_t_o_f_i_l_e ddiisskkllaabbeell [--NNWW] [--nn] [--vv] _d_i_s_k ddiisskkllaabbeell --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k [_d_i_s_k_t_y_p_e] ddiisskkllaabbeell --ww --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k _d_i_s_k_t_y_p_e [_p_a_c_k_i_d] ddiisskkllaabbeell --RR --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k _p_r_o_t_o_f_i_l_e [_d_i_s_k_t_y_p_e] DDEESSCCRRIIPPTTIIOONN The ddiisskkllaabbeell utility can be used to install, examine, or modify the la- bel on a disk drive or pack. The disk label contains information about disk characteristics (size, type, etc.) and the partition layout, stored on the disk itself. It is used by the operating system to optimize disk I/O and locate the filesystems resident on the disk. The options are as follows: --nn Make no permanent changes to the disklabel (useful for debugging purposes). --vv Print additional information during operation (verbose mode). --rr Causes the label to be read from or written to the disk direct- ly, rather than going through the system's in-core copy of the label. This option may allow a label to be installed on a disk without kernel support for a label, such as when labels are first installed on a system. This flag does not work on a num- ber of architectures, thus it is not considered the right way to put a new label on a disk. Its use is discouraged. --BB Install bootstrap code. The --rr flag is implied by --BB and never needs to be specified. --bb Specify the single level boot program, or the primary boot pro- gram, depending on the system boot architecture (single or two- level). --ss On machines with a two-level bootstrap (such as i386-based sys- tems), specify the secondary boot program. --dd Use the _d_e_f_a_u_l_t label. This ignores any existing OpenBSD parti- tions on the disk. Note that this option will only work for disks that are capable of reporting their geometry, such as SC- SI, IDE, and ESDI. May not be used in conjunction with the --rr flag. --cc Clear the system's in-core copy of the label and update it based on the on-disk label. May not be used in conjunction with the --rr flag. --ff _t_e_m_p_f_i_l_e Write entries to _t_e_m_p_f_i_l_e in fstab(5) format for any partitions for which mount point information has been specified. The --ff flag is only valid when used in conjunction with the --EE flag. If _t_e_m_p_f_i_l_e already exists, it will be overwritten. --tt Format the label as a disktab(5) entry. --ww Write a standard label on the designated drive. --ee Edit an existing disk label using the editor specified in the EDITOR environment variable, or vi(1) if none is specified. --EE Use a simple initial label editor, using the command-driven built-in editor described below. --RR Restore a disk label that was formatted in a prior operation and saved in an ASCII file. --NN Disallow writing of the pack label area on the selected disk. --WW Allow writing of the pack label area on the selected disk. The first form of the command (read) is used to examine the label on the named disk drive (e.g., sd0 or _/_d_e_v_/_r_s_d_0_c). It will display all of the parameters associated with the drive and its partition layout. Unless the --rr flag is given, the kernel's in-core copy of the label is dis- played; if the disk has no label, or the partition types on the disk are incorrect, the kernel may have constructed or modified the label. The second form of the command (write) is used to write a standard label on the designated drive. The drive parameters and partitions are taken from that file. If different disks of the same physical type are to have different partitions, it will be necessary to have separate disktab en- tries describing each, or to edit the label after installation as de- scribed below. The optional argument is a pack identification string, up to 16 characters long. The pack ID must be quoted if it contains blanks. If the --rr flag is given, the disk sectors containing the label and boot- strap will be written directly. A side-effect of this is that any exist- ing bootstrap code will be overwritten and the disk rendered unbootable. If --rr is not specified, the existing label will be updated via the in- core copy and any bootstrap code will be unaffected. If the disk does not already have a label, the --rr flag must be used. In either case, the kernel's in-core label is replaced. In the third form of the command (edit), the label is read from the in- core kernel copy, or directly from the disk if the --rr flag is also given. The label is formatted and then supplied to an editor for changes. If no editor is specified in an EDITOR environment variable, vi(1) is used. When the editor terminates, the formatted label is reread and used to rewrite the disk label. Existing bootstrap code is unchanged regardless of whether --rr was specified. The initial label editor mode is only intended for new disks as it will move partitions around as necessary to maintain a contiguous pool of free blocks. Some commands or prompts take an optional unit. Available units are `b' for bytes, `c' for cylinders, `k' for kilobytes, `m' for megabytes, and `g' for gigabytes. Quantities will be rounded to the nearest cylinder when units are specified for sizes (or offsets). Com- mands may be aborted by entering `^D' (Control-D). Entering `^D' at the main `>' prompt will exit the editor. At prompts that request a size, `*' may be entered to indicate the rest of the available space. The edi- tor commands are as follows: ? [command] Display help message with all available commands. You may specify a _c_o_m_m_a_n_d for which to get more detailed help. There is also (simple) context-sensitive help available at most prompts. M Display this manual page. u Undo (or redo) last change. Entering _u once will undo your last change. Entering it again will restore the change. p [unit] Print the current disk label. If a _u_n_i_t is given, the size and offsets are displayed in terms of the specified unit. e Edit drive parameters. This option is used to set the follow- ing parameters: sectors/track, tracks/cylinder, sectors/cylin- der, number of cylinders on the disk, total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. b Set OpenBSD disk boundaries. This option tells ddiisskkllaabbeell which parts of the disk it is allowed to modify. This option is probably only useful for ports with fdisk partition tables where the ending sector in the MBR is incorrect. The user may enter `*' at the ``Size'' prompt to indicate the entire size of the disk (minus the starting sector). This is useful for disks larger than 8 gigabytes where the fdisk partition table is incapable of storing the real size. r Recalculate free space. This option should really not be nec- essary under normal circumstances. a [part] Add new partition. This option adds a new BSD partition. If no partition letter is specified (a-p), the user will be prompted for one. c [part] Change the size of an existing partition. If no partition is specified, the user will be prompted for one. The new size may be in terms of the aforementioned units and may also be prefixed with `+' or `-' to change the size by a relative amount. d [part] Delete an existing partition (or `*' to delete all parti- tions). If no partition is specified, the user will be prompted for one. You may not delete the `c' partition. g [d|b|u] Set disk geometry based on what the _d_i_s_k, _B_I_O_S, or _u_s_e_r thinks (the _u_s_e_r geometry is simply what the label said before ddiisskkllaabbeell made any changes). D Sets the disk label to the default values as reported by the kernel. This similates the case where there is no disk label. m [part] Modify parameters for an existing partition. If no partition is specified, the user will be prompted for one. This option allows the user to change the filesystem type, starting off- set, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all pa- rameters are configurable for non-BSD partitions). n [part] Name the mount point for an existing partition. If no parti- tion is specified, the user will be prompted for one. This option is only valid if ddiisskkllaabbeell was invoked with the --ff flag. s [path] Save the label to a file in ASCII format (suitable for loading via the --RR option). If no path is specified, the user will be prompted for one. w Write the label to disk. This option will commit any changes to the on-disk label. q Quit the editor. If any changes have been made, the user will be asked whether or not to save the changes to the on-disk la- bel. x Exit the editor without saving any changes to the label. X Toggle ``expert mode''. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). z Zeroes out the existing partition table, leaving only the ``c'' partition. The drive parameters are not changed. In the restore form of the command, the prototype file used to create the label should be in the same format as that produced when reading or edit- ing a label. Comments are delimited by _# and newline. As with --ww, any existing bootstrap code will be clobbered if --rr is specified and will be unaffected otherwise. The final three forms of ddiisskkllaabbeell are used to install bootstrap code on machines where the bootstrap is part of the label. The bootstrap code is comprised of one or two boot programs depending on the machine. When installting bootstrap code with the --BB flag, if the names are not explicitly given, standard boot programs will be used. The boot programs are located in _/_u_s_r_/_m_d_e_c. The names of the programs are taken from the ``b0'' and ``b1'' parameters of the disktab(5) entry for the disk if _d_i_s_k_t_y_p_e was given and its disktab entry exists and includes those param- eters. Otherwise, boot program names are derived from the name of the disk. These names are of the form _b_a_s_e_n_a_m_eboot for the primary (or only) bootstrap, and boot_b_a_s_e_n_a_m_e for the secondary bootstrap; for example, _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d if the disk device is _s_d_0. The first of the three boot-installation forms is used to install boot- strap code without changing the existing label. It is essentially a read command with respect to the disk label itself and all options are related to the specification of the boot program as described previously. The final two forms are analogous to the basic write and restore versions ex- cept that they will install bootstrap code in addition to a new label. EEXXAAMMPPLLEESS disklabel sd0 Display the in-core label for sd0 as obtained via _/_d_e_v_/_r_s_d_0_c. disklabel -w -r /dev/rsd0c sd2212 foo Create a label for sd0 based on information for ``sd2212'' found in _/_e_t_c_/_d_i_s_k_t_a_b. Any existing bootstrap code will be clobbered. (Normally you do not want to use the --rr flag though.) disklabel -e -r sd0 Read the on-disk label for sd0, edit it and reinstall in-core as well as on-disk. (Normally you do not want to use the --rr flag though.) Existing bootstrap code is unaffected. disklabel -R sd0 mylabel Restore the on-disk and in-core label for sd0 from information in _m_y_l_a_b_e_l. Existing bootstrap code is unaffected. disklabel -B sd0 Install a new bootstrap on sd0. The boot code comes from _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and possibly _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d. On-disk and in-core la- bels are unchanged, but on some systems other information may be de- stroyed. Use with care. disklabel -w -B /dev/rsd0c -b newboot sd2212 Install a new label and bootstrap. The label is derived from disktab in- formation for ``sd2212'' and installed both in-core and on-disk. The bootstrap code comes from the file _/_u_s_r_/_m_d_e_c_/_n_e_w_b_o_o_t. FFIILLEESS /etc/disktab /usr/mdec/_x_xboot /usr/mdec/boot_x_x SSEEEE AALLSSOO disklabel(5), disktab(5) DDIIAAGGNNOOSSTTIICCSS The kernel device drivers will not allow the size of a disk partition to be decreased or the offset of a partition to be changed while it is open. Some device drivers create a label containing only a single large parti- tion if a disk is unlabeled; thus, the label must be written to the `a' partition of the disk while it is open. This sometimes requires the de- sired label to be set in two steps, the first one creating at least one other partition, and the second setting the label on the new partition while shrinking the `a' partition. On some machines the bootstrap code may not fit entirely in the area al- located for it by some filesystems. As a result, it may not be possible to have filesystems on some partitions of a ``bootable'' disk. When in- stalling bootstrap code, ddiisskkllaabbeell checks for these cases. If the in- stalled boot code would overlap a partition of type FS_UNUSED it is marked as type FS_BOOT. The newfs(8) utility will disallow creation of filesystems on FS_BOOT partitions. Conversely, if a partition has a type other than FS_UNUSED or FS_BOOT, ddiisskkllaabbeell will not install bootstrap code that overlaps it. NNOOTTEESS On i386 machines, installboot(8) is normally used to install boot code. The --BB option to ddiisskkllaabbeell can still be used to install old style boot code, but this usage is deprecated. BBUUGGSS When a disk name is given without a full pathname, the constructed device name uses the `a' partition on the tahoe, the `c' partition on all oth- ers. In --EE mode, ddiisskkllaabbeell is far too quick to shuffle partitions around; it should keep a free block list and only move partitions around with the user's permission. Also, in --EE mode, partitions outside the OpenBSD portion of the disk should be changeable. OpenBSD 2.8 October 27, 1997 5 $OpenBSD: ar_io.c,v 1.20 2000/06/09 16:37:54 espie Exp $$OpenBSD: ar_subs.c,v 1.14 1998/09/20 02:22:21 millert Exp $$OpenBSD: buf_subs.c,v 1.7 1997/09/01 18:29:46 deraadt Exp $ $OpenBSD: cache.c,v 1.7 1999/04/08 03:50:58 deraadt Exp $$OpenBSD: cpio.c,v 1.5 1997/07/25 18:58:28 mickey Exp $$OpenBSD: file_subs.c,v 1.13 1997/09/01 18:29:48 deraadt Exp $$OpenBSD: ftree.c,v 1.9 1998/06/09 07:28:41 deraadt Exp $$OpenBSD: gen_subs.c,v 1.8 1997/09/01 18:29:51 deraadt Exp $$OpenBSD: getoldopt.c,v 1.4 2000/01/22 20:24:51 deraadt Exp $$OpenBSD: options.c,v 1.42 2000/06/09 16:37:54 espie Exp $abcdfiklnoprstuvwxBDEGHLPTUXYZphǬٴ#hLŨǠǬh#`n˸LǬ#Xn0L#P(mx'\oXj'\sHjjnH(wLvwjw}jj#$OpenBSD: pat_rep.c,v 1.11 1997/09/01 18:29:56 deraadt Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.15 2000/06/09 16:37:54 espie Exp $$OpenBSD: sel_subs.c,v 1.7 1997/08/17 23:05:09 millert Exp $$OpenBSD: tables.c,v 1.11 1999/04/29 12:59:03 aaron Exp $$OpenBSD: tar.c,v 1.15 2000/01/21 05:11:36 tholo Exp $$OpenBSD: tty_subs.c,v 1.6 1999/08/09 22:22:52 pjanzen Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.41 2000/01/22 20:25:04 deraadt Exp $8"3.? ;A??zG{A.@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cat.c,v 1.9 2000/01/22 20:24:45 deraadt Exp $@(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ifconfig.c,v 1.40 2000/08/03 07:34:41 angelos Exp $7#7#6#6#6#8(#7#7H#7,#7#6#6#6#7#6#6#6#6#7#7#7$OpenBSD: cmp.c,v 1.3 1997/01/03 22:36:07 millert Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ls.c,v 1.14 2000/07/19 19:27:36 mickey Exp $P.$OpenBSD: print.c,v 1.15 2000/01/06 21:32:40 espie Exp $$OpenBSD: util.c,v 1.6 1999/05/05 07:06:01 deraadt Exp $@(#) Copyright (c) 1993 The Regents of the University of California. All rights reserved. E F8 F0 F( F  F F F F E E H H G G G G G G G G G G Gx Gp Gh GX GH G@ G0 G  G G F F F F F F F F F Fx Fp Fh F` FX FP F@ HH H@ H0 H( H HP IX IP IH I@ I8 I( I  I I I I H H H H H H H H H H H H H H Hx Hp Hh H` HX I I I I I I I Ip I` K K J J J J J J J Jx Jh JX J@ J0 J  J I I I I K( K Kx Kh KX KH K@ K8 'DTL D\ dX dP d d dx dh d d iL j j jxd k k kx kp kh k` kX I@ kP kH k@ k8 k( k  mH m8 m0 m  m l l l l l l l lx lh lP l@ l( l l k k k k k k k mx mh mX m n  n n m m m m m m m m m n( m m m j j m m mb| l<L|\ o o o o o o mH m8 p p p p px ph pP p@ p0 p  p p o o o o o q8 q( q q p p p p mX ph$ H rX n( mH r` m m|@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cksum.c,v 1.4 1997/06/28 22:24:24 grr Exp $$OpenBSD: crc.c,v 1.2 1996/03/27 19:32:21 niklas Exp $$OpenBSD: print.c,v 1.2 1996/06/26 05:32:03 deraadt Exp $$OpenBSD: sum1.c,v 1.2 1996/03/27 19:32:22 niklas Exp $$OpenBSD: sum2.c,v 1.2 1996/03/27 19:32:23 niklas Exp $ <$OpenBSD: termcap.c,v 1.2 2000/08/02 04:10:50 millert Exp $          p4444HHHH\\\\ e j   ky JKYdu f   bvz!w"F2R r u'g<<p%{{}}{}(())()[[]][]#$G>>P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:p:x&-/:ttso_|%v !+ HhVq:q:QZZ  lhbwixX  0 $ k j  is a directory is not a regular fileXXa#aP x Xb #e H 8B#a0  c#e hd#a H 0e#e  f#ex g#aD P h#e| HA#e i#aL , x ` 8j#ad ( kH `lH m#e n"#e o pO `pH P  Pq#e ( r!#a` s!#a x XS!#a H 8t 0T p u"#e V \w!#aX `x$#e P 0XA#e  y#e z#at p? #Z (press RETURN)... (interrupt to abort)?n?f%f .?m(file %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(file %i of %m) .?e(END) ?x- Next\: %x.:(?pB%pB\%:byte %bB?s/%s..).%t?f%f .?n?m(file %i of %m) ..?ltline %lt?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(file %i of %m) .?ltline %lt?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tH 290@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $  @(#)getmntopts.c 8.3 (Berkeley) 3/29/95 x h X H 8 ( (  D  ` | 0123456789A:B:C::EFGHIUVX:abcd:e:f:hiLlnqrsuvwxyZz D@A D0G D B D Db CC Cc Cd CE Cf Cl CL CF CxF Cp#k C`i CPn C@x C8#l C(h Cs CZ Cz Bq Br Be Bv Bq Ba BU Bu BV BH Bxw? SuccessNo matchInvalid regular expressionInvalid collation characterInvalid character class nameTrailing backslashInvalid back referenceUnmatched [ or [^Unmatched ( or \(Unmatched \{Invalid content of \{\}Invalid range endMemory exhaustedInvalid preceding regular expressionPremature end of regular expressionRegular expression too bigUnmatched ) or \)N  d   d   <   <   t  @(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: basename.c,v 1.3 1997/08/17 21:25:01 millert Exp $@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.11 2000/07/27 20:06:00 millert Exp $@(#) Copyright (c) 1983, 1990 The Regents of the University of California. All rights reserved. $OpenBSD: rsh.c,v 1.19 2000/02/01 03:23:37 deraadt Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.8 2000/02/28 17:03:26 millert Exp $@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: slattach.c,v 1.6 1999/06/02 18:45:39 deraadt Exp $% 9P 9@ 90@(#) Copyright (c) 1983, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: route.c,v 1.40 2000/09/24 01:02:24 millert Exp $0123456789abcdef a8 h 8  X ( pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATICPROTO2PROTO1UPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD    x p h ` X P H @ 8 0                  x p `! X" P# @$ 8% 0& (' ( ) * + , - . /$OpenBSD: cmds.c,v 1.34 2000/06/21 19:22:54 itojun Exp $ ( p h ` X P X H @ 8 0#X $OpenBSD: cmdtab.c,v 1.14 2000/06/21 19:22:54 itojun Exp $send account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote ftp servertoggle carriage return stripping on ascii getstoggle/set debugging modedelete remote filelist contents of remote directoryterminate ftp sessionexecute macrotoggle use of EPSV/EPRT on IPv4 ftpset file transfer formattoggle gate-ftp; specify host[:port] to change proxytoggle metacharacter expansion of local file namestoggle printing `#' marks; specify number to set sizeprint local help informationget (set) idle timer on remote sidechange local working directoryprint local working directorylist contents of remote directorydefine a macrodelete multiple fileslist contents of multiple remote directoriesget multiple filesmake directory on the remote machinelist contents of multiple remote directoriesset file transfer modeshow last modification time of remote filesend multiple filesget file if remote file is newer than local file nlist contents of remote directoryset templates for default file name mappingset translation table for default file name mappingview a remote file through your pagerenter passive transfer modetoggle use of PORT/LPRT cmd for each data connectiontoggle preservation of modification time of retrieved filestoggle transfer progress meterforce interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandreceive fileget file restarting at end of local fileget help from remote serverrename fileclear queued command repliesrestart file transfer at bytecountremove directory on the remote machineshow status of remote machinetoggle store unique for local filessend one fileescape to the shellsend site specific command to remote server Try "rhelp site" or "site help" for more informationshow size of remote fileshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle packet tracingset file transfer typeget (set) umask on remote sidesend new user informationtoggle verbose mode  h 0 ` ܈ ܠ ܸ x px h ` `  Ƙ X@ Px HP @ @ 8 0  (( ̘ P @ x , x ޠ ݠ x  \    0 $ h d ߈ P  ߰  l   ̘  | ( ɘ @ L p x ֘ p L h d ` X l P( H( @@ 8x ̘ 0 ( ݠ x  l 0  ,  8  |     H @ x   \  4  h ( k H  ܨ p ׸  x P p `P X p Pp H @  8  0 x (  ( x @ X x @  h dS$OpenBSD: domacro.c,v 1.7 1997/07/25 21:56:19 millert Exp $$OpenBSD: fetch.c,v 1.33 2000/06/30 16:00:15 millert Exp $$OpenBSD: ftp.c,v 1.39 2000/10/18 06:53:24 itojun Exp $@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.47 2000/06/21 19:22:54 itojun Exp $$OpenBSD: ruserpass.c,v 1.12 2000/07/27 19:59:13 millert Exp $      $OpenBSD: util.c,v 1.24 2000/05/15 18:27:27 deraadt Exp $ KMGTPA.A.>?P$Id: dhclient.c,v 1.11 2000/10/30 02:35:33 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. Q X p $Id: clparse.c,v 1.5 1999/12/04 00:15:08 angelos Exp $ Copyright (c) 1997 The Internet Software Consortium. All rights reserved. $Id: raw.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: parse.c,v 1.1 1998/08/18 03:43:26 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. ;Zx0N$Id: nit.c,v 1.1 1998/08/18 03:43:26 deraadt Exp $ Copyright (c) 1996 The Internet Software Consortium. All rights reserved. $Id: icmp.c,v 1.1 1998/08/18 03:43:26 deraadt Exp $ Copyright (c) 1997 The Internet Software Consortium. All rights reserved. $Id: dispatch.c,v 1.3 2000/07/21 00:33:53 beck Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: conflex.c,v 1.1 1998/08/18 03:43:25 deraadt Exp $ Copyright (c) 1995, 1996, 1997 The Internet Software Consortium. All rights reserved. $Id: upf.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: bpf.c,v 1.1 1998/08/18 03:43:25 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. ( 0(EHC$Id: socket.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: packet.c,v 1.1 1998/08/18 03:43:26 deraadt Exp $ Copyright (c) 1996 The Internet Software Consortium. All rights reserved. $Id: memory.c,v 1.3 2000/07/21 00:33:53 beck Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: print.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: options.c,v 1.1 1998/08/18 03:43:26 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: convert.c,v 1.1 1998/08/18 03:43:25 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: sysconf.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: tree.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996, 1997 The Internet Software Consortium. All rights reserved. $Id: tables.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $8$8$8$8$8$8$8$8p$8`$8 P$8 0$8  $8 $8 $8$8$8$8$8$8x$8h`$8H$880$8$8$8$8$8$8$8$8p$8P$8 @`$8!($8"$8#$8$0$8%$8&$8'$8($8)$8*h`$8+H$8,0$8-0$8.$8/$80$81$82$830$840$85p$86PH$878$88 $89$8:$8;$8<`$8=`$8>`$8?`$8@`$8Ap`$8B``$8CP`$8D@`$8E0`$8F `$8G`$8H`$8I`$8J`$8K`$8L$8M`$8N`$8O`$8Pp`$8Q``$8RP`$8S@`$8T0$8U `$8V`$8W`$8X`$8Y`$8Z`$8[`$8\`$8]`$8^`$8_`$8`p`$8a``$8bP`$8c@`$8d0`$8e `$8f`$8g`$8h`$8i`$8j`$8k`$8l`$8m`$8n`$8o`$8pp`$8q``$8rP`$8s@`$8t0`$8u `$8v`$8w`$8x`$8y`$8z`$8{`$8|`$8}`$8~`$8`$8p`$8``$8P`$8@`$80`$8 `$8`$8`$8`$8`$8`$8`$8`$8`$8`$8`$8p`$8``$8P`$8@`$80`$8 `$8`$8`$8`$8`$8`$8`$8`$8`$8`$8`$8p`$8``$8P`$8@`$80`$8 `$8`$8`$8`$8`$8`$8`$8`$8`$8`$8`$8p`$8``$8P`$8@`$80`$8 `$8`$8`$8`$8`$8`$8`$8`$8`$8`$8`$8p`$8``$8P`$8@`$80`$8 `$8`$8`$8`$8`$8`$8`$8`$8`$8`$8`$8p`$8``$8P`$8@`$80`$8 `$8`$8`$8`$8`$8`$8`$8`$8`$8`$8`$8p`$8``$8P`$8@`$80`$8 `$8`$8`$8`$8`$8`$8`$8`$8`$8`$8`$8p`$8``$8P`$8@`$80`$8 `$8`$8`$8`$8`$8`$8`$8`$8`$8$8249:;<=   !"#$%&'()*+,-./017>?@ABCDEFGHIJKLNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ðàÐÀp`P@0 ° €p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 p`P@0 $Id: hash.c,v 1.1 1998/08/18 03:43:26 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: alloc.c,v 1.1 1998/08/18 03:43:25 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. $Id: errwarn.c,v 1.2 2000/06/29 00:25:42 deraadt Exp $ Copyright (c) 1996 The Internet Software Consortium. All rights reserved. $Id: inet_addr.c,v 1.1 1998/08/18 03:43:26 deraadt Exp $ Copyright (c) 1983, 1990, 1993 The Regents of the University of California. All rights reserved. $Id: dns.c,v 1.1 1998/08/18 03:43:25 deraadt Exp $ Copyright (c) 1997 The Internet Software Consortium. All rights reserved. $Id: resolv.c,v 1.1 1998/08/18 03:43:27 deraadt Exp $ Copyright (c) 1995, 1996 The Internet Software Consortium. All rights reserved. /etc/resolv.conf@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.10 2000/06/17 20:23:24 niklas Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.18 2000/04/30 17:30:34 millert Exp $$OpenBSD: buf.c,v 1.10 2000/04/01 17:19:09 deraadt Exp $$`$OpenBSD: cbc.c,v 1.5 1997/06/18 19:22:35 kstailey Exp $@ $OpenBSD: glbl.c,v 1.7 1998/04/30 05:55:05 deraadt Exp $$OpenBSD: io.c,v 1.7 1997/02/01 12:03:07 tholo Exp $!P$OpenBSD: main.c,v 1.19 2000/05/01 18:30:52 deraadt Exp $!!H$OpenBSD: re.c,v 1.7 1998/01/21 03:51:50 millert Exp $$OpenBSD: sub.c,v 1.6 1997/09/01 18:29:31 deraadt Exp $$OpenBSD: undo.c,v 1.4 1996/10/12 19:38:43 millert Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.14 2000/02/20 23:03:55 ericj Exp $h$OpenBSD: utils.c,v 1.14 1999/05/06 17:19:47 millert Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cut.c,v 1.7 2000/06/04 23:52:19 aaron Exp $8`H@h8@p8a(c cddfhlLnNqqrStTvV1x9pZhbxHX X0%h°`XPH@8%h°`@`@@@@      %%!`%%X!%"L           #+3;CScscc !1Aa  0@` ?? w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.12 2000/07/31 19:02:38 ericj Exp $@(#) Copyright (c) 1988 The Regents of the University of California. All rights reserved. $OpenBSD: chroot.c,v 1.3 2000/08/17 15:28:36 mickey Exp $$OpenBSD: dir.c,v 1.7 1997/10/06 20:22:31 deraadt Exp $} ... ...$OpenBSD: inode.c,v 1.14 1999/08/06 20:41:06 deraadt Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.16 2000/01/22 20:24:56 deraadt Exp $$OpenBSD: pass1.c,v 1.7 1999/03/01 07:45:17 d Exp $$OpenBSD: pass1b.c,v 1.4 1999/03/01 07:45:18 d Exp $$OpenBSD: pass2.c,v 1.7 1999/03/01 07:45:18 d Exp $$OpenBSD: pass3.c,v 1.3 1999/03/01 07:45:18 d Exp $$OpenBSD: pass4.c,v 1.4 1999/03/01 07:45:18 d Exp $$OpenBSD: pass5.c,v 1.7 1999/03/01 07:45:18 d Exp $$NetBSD: fsutil.c,v 1.2 1996/10/03 20:06:31 christos Exp $$OpenBSD: setup.c,v 1.7 1999/08/17 09:13:14 millert Exp $xph`XPH@80( 0(8 ```````XPH``@`8````$OpenBSD: utilities.c,v 1.8 2000/09/30 16:06:34 aaron Exp $-?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@.../$OpenBSD: append.c,v 1.5 1999/05/24 17:57:17 millert Exp $$OpenBSD: fields.c,v 1.4 1999/05/24 17:57:17 millert Exp $$OpenBSD: files.c,v 1.6 2000/06/30 16:00:23 millert Exp $$OpenBSD: fsort.c,v 1.7 1999/05/24 17:57:18 millert Exp $$OpenBSD: init.c,v 1.3 1999/05/24 17:57:18 millert Exp $$OpenBSD: msort.c,v 1.8 2000/06/30 16:00:23 millert Exp $@(#) Copyright (c) 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sort.c,v 1.14 2000/06/30 16:00:23 millert Exp $ /dev/stdinr$OpenBSD: tmp.c,v 1.3 2000/06/30 16:00:23 millert Exp $@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.20 2000/08/20 18:42:39 millert Exp $< $OpenBSD: dkcksum.c,v 1.2 1996/06/23 14:30:05 deraadt Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: newfs.c,v 1.22 2000/04/30 05:07:46 bjc Exp $( @ @%s: can't read disk label; disk type must be specified$OpenBSD: mkfs.c,v 1.14 2000/09/22 19:21:30 millert Exp $>......$OpenBSD: getopt.c,v 1.3 1997/01/15 23:42:32 millert Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_kernfs.c,v 1.7 1998/12/21 16:14:40 mickey Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $$OpenBSD: acu.c,v 1.5 2000/04/20 06:19:33 deraadt Exp $$OpenBSD: acutab.c,v 1.2 1996/06/26 05:40:41 deraadt Exp $`x8TXxPrtuH@\8\$OpenBSD: cmds.c,v 1.8 2000/04/20 06:19:33 deraadt Exp $<<xph$OpenBSD: cmdtab.c,v 1.2 1996/06/26 05:40:42 deraadt Exp $!5H),<5(>5t4,p4"t|4h$4$C4p&c4X+ .4H+4H+4(040s3.?3U#30`$OpenBSD: cu.c,v 1.4 1997/09/01 23:24:24 deraadt Exp $$OpenBSD: hunt.c,v 1.6 1997/09/01 23:24:24 deraadt Exp $$OpenBSD: log.c,v 1.3 1997/09/01 23:24:25 deraadt Exp $$OpenBSD: partab.c,v 1.3 1997/04/02 01:47:02 millert Exp $ !"$'(+-.03569: } ${PS3=#? } ${PS4=+ }KSH_VERSION@let||&&!()]]<>[[[x[p[h[X[P[H[@[([ [[[ZZZZ ZZ ZZ ZZ ZxZh Z`ZPZHZ8Z0Z ZZYYYYYYYYYYYxY`YXYHY@Y(Y YXXXXXXXXXxX`XXX@ X8X(@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QB&z _@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: sleep.c,v 1.9 2000/01/05 01:58:03 pjanzen Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mv.c,v 1.15 1999/12/24 22:38:06 angelos Exp $@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: dmesg.c,v 1.8 2000/02/22 19:27:38 deraadt Exp $@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: hostname.c,v 1.3 1996/08/02 12:40:55 deraadt Exp $xphXPH@80( 0(@$NetBSD: getrawpartition.c,v 1.1 1996/05/16 07:03:33 thorpej Exp $$NetBSD: getmaxpartitions.c,v 1.1 1996/05/16 07:03:31 thorpej Exp $&@$\]^7ba_`c8V9Mdefg:U;J<H=>LhW?O@NiAB CD  !"#$%E &'()*+,-./F 0123456789G :;<=>?@ABCH D E F GIJKjkLMKNIOP[lmcnoQRpqRSrZstuvwxSyz{|}~TPUQVTWl  @%&*!#%%p%c%%{10}%%/%%{16}%%*%%p%c%%{10}%%m%%+$OpenBSD: read_bsd_terminfo.c,v 1.9 2000/10/08 22:47:02 millert Exp $c4d8=A@A$OpenBSD: truncate.c,v 1.6 1997/04/26 08:50:13 tholo Exp $$OpenBSD: tcsetpgrp.c,v 1.3 1997/07/25 20:30:15 mickey Exp $$OpenBSD: tcgetpgrp.c,v 1.2 1996/08/19 08:34:40 tholo Exp $$OpenBSD: tcflush.c,v 1.2 1996/08/19 08:34:39 tholo Exp $$OpenBSD: tcdrain.c,v 1.2 1996/08/19 08:34:38 tholo Exp $$OpenBSD: cfsetspeed.c,v 1.2 1996/08/19 08:34:37 tholo Exp $$OpenBSD: cfsetospeed.c,v 1.2 1996/08/19 08:34:37 tholo Exp $$OpenBSD: cfsetispeed.c,v 1.2 1996/08/19 08:34:36 tholo Exp $$OpenBSD: cfmakeraw.c,v 1.3 1998/08/20 19:45:57 deraadt Exp $$OpenBSD: cfgetospeed.c,v 1.2 1996/08/19 08:34:35 tholo Exp $$OpenBSD: cfgetispeed.c,v 1.2 1996/08/19 08:34:34 tholo Exp $@H`p p  `X$OpenBSD: vprintf.c,v 1.2 1996/08/19 08:33:13 tholo Exp $$OpenBSD: setbuffer.c,v 1.2 1996/08/19 08:33:05 tholo Exp $$OpenBSD: puts.c,v 1.3 1999/08/07 17:35:58 millert Exp $$OpenBSD: fscanf.c,v 1.3 1997/07/25 20:30:09 mickey Exp $$OpenBSD: freopen.c,v 1.4 1998/11/10 22:10:21 deraadt Exp $$OpenBSD: fputc.c,v 1.3 1996/10/28 05:32:54 tholo Exp $$OpenBSD: fgetc.c,v 1.2 1996/08/19 08:32:27 tholo Exp $p/etc/rpc$OpenBSD: regexec.c,v 1.7 1997/04/30 05:51:10 tholo Exp $$OpenBSD: engine.c,v 1.4 1997/04/28 20:44:57 millert Exp $$OpenBSD: regerror.c,v 1.5 1998/03/19 00:30:10 millert Exp $SS`SPS0S SRRRRRRRpRPR@R RQ QQ QQ QQ QpQHQ8Q QPPPPP$OpenBSD: regcomp.c,v 1.6 1998/08/14 21:39:35 deraadt Exp $WXWWWVWVVWVVWVVxWVpVWVUWUUWUxUPWUHU@WU8UWUTWW[[[[[[[[[x[p[`[X [P [H [@ [8 [( [ [ [ Z ZZZZZZZZZZZZZZZZxZpZhZ`ZXZPZHUH Z0!Z "Z#Z$Y%Y&Y'Y(Y)Y*Y+Yx,Yp-Y`-YX.YH.Y@/Y8/Y00Y(1Y 2Y3Y4Y5Y6X7X8X9X:X;X<X=X>X?Xx@X`[XP\X@\X(]X^X^W_W_W`W{W{W|W}Wp}Wh~W`$OpenBSD: ethers.c,v 1.11 2000/08/22 19:04:41 deraadt Exp $xx:xx:xx:xx:xx:xx$OpenBSD: sethostent.c,v 1.4 1997/03/15 21:53:50 pefo Exp $$OpenBSD: ns_ntoa.c,v 1.7 1997/08/24 21:25:48 millert Exp $$OpenBSD: ns_addr.c,v 1.4 1997/07/21 20:31:05 deraadt Exp $$OpenBSD: linkaddr.c,v 1.2 1996/08/19 08:29:27 tholo Exp $0123456789abcdef$OpenBSD: iso_addr.c,v 1.2 1996/08/19 08:29:23 tholo Exp $0123456789abcdef$OpenBSD: ipx_ntoa.c,v 1.2 1996/08/19 08:29:20 tholo Exp $xxxx.xx:xx:xx:xx:xx:xx.uuuuu$OpenBSD: ipx_addr.c,v 1.3 1997/07/09 01:08:39 millert Exp $$OpenBSD: inet_netof.c,v 1.3 1997/04/05 21:13:13 millert Exp $$OpenBSD: inet_makeaddr.c,v 1.3 1997/04/05 21:13:12 millert Exp $$OpenBSD: inet_lnaof.c,v 1.3 1997/04/05 21:13:11 millert Exp $$OpenBSD: getprotoname.c,v 1.3 1997/07/09 01:08:32 millert Exp $$OpenBSD: getproto.c,v 1.3 1997/07/09 01:08:31 millert Exp $$OpenBSD: getnetnamadr.c,v 1.13 1999/06/04 06:38:10 niklas Exp $$OpenBSD: getnetbyname.c,v 1.5 1997/07/09 01:08:29 millert Exp $$OpenBSD: getnetbyaddr.c,v 1.5 1997/07/09 01:08:28 millert Exp $$OpenBSD: setlocale.c,v 1.6 1997/07/09 01:08:21 millert Exp $CCCCCCC$OpenBSD: morecrypt.c,v 1.9 1998/03/22 19:01:20 niklas Exp $:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ $OpenBSD: _warnx.c,v 1.3 1996/08/19 08:21:38 tholo Exp $$OpenBSD: _warn.c,v 1.3 1996/08/19 08:21:36 tholo Exp $$OpenBSD: _vwarnx.c,v 1.3 1996/08/19 08:21:35 tholo Exp $$OpenBSD: _sys_siglist.c,v 1.2 1996/08/19 08:21:27 tholo Exp $$OpenBSD: _errx.c,v 1.4 1996/08/19 08:21:21 tholo Exp $$OpenBSD: _err.c,v 1.4 1996/08/19 08:21:19 tholo Exp $$OpenBSD: vis.c,v 1.5 2000/07/19 15:25:13 deraadt Exp $$OpenBSD: utime.c,v 1.2 1996/08/19 08:27:24 tholo Exp $$OpenBSD: ttyname.c,v 1.7 2000/01/06 08:24:16 d Exp $$OpenBSD: times.c,v 1.2 1996/08/19 08:26:43 tholo Exp $$OpenBSD: strtofflags.c,v 1.1 2000/07/19 19:26:04 mickey Exp $$OpenBSD: sleep.c,v 1.7 1997/04/25 04:20:41 tholo Exp $$OpenBSD: setmode.c,v 1.9 1998/11/18 23:28:34 deraadt Exp $$OpenBSD: setjmperr.c,v 1.2 1996/08/19 08:25:52 tholo Exp $$OpenBSD: sethostname.c,v 1.4 1998/05/13 08:51:00 deraadt Exp $$OpenBSD: raise.c,v 1.2 1996/08/19 08:25:33 tholo Exp $$OpenBSD: pwcache.c,v 1.3 1997/07/09 00:28:23 millert Exp $$OpenBSD: popen.c,v 1.9 1997/09/11 18:51:04 deraadt Exp $$OpenBSD: nlist.c,v 1.34 2000/10/12 12:47:58 art Exp $8h$OpenBSD: nice.c,v 1.3 1998/05/06 23:11:43 deraadt Exp $$OpenBSD: glob.c,v 1.8 1998/08/14 21:39:30 deraadt Exp $$OpenBSD: getttyent.c,v 1.4 1997/07/09 00:28:22 millert Exp $$OpenBSD: getpass.c,v 1.7 2000/01/13 19:36:21 millert Exp $$OpenBSD: getmntinfo.c,v 1.4 1999/06/01 15:31:13 millert Exp $$OpenBSD: getlogin.c,v 1.5 2000/01/06 08:24:16 d Exp $$OpenBSD: getloadavg.c,v 1.2 1996/08/19 08:23:39 tholo Exp $A$OpenBSD: getgrent.c,v 1.13 2000/09/24 14:35:10 d Exp $$OpenBSD: getbsize.c,v 1.6 1998/06/23 22:40:25 millert Exp $$OpenBSD: fts.c,v 1.24 2000/08/24 17:04:12 deraadt Exp $$OpenBSD: fstab.c,v 1.8 1999/09/03 16:23:18 millert Exp $$OpenBSD: errx.c,v 1.3 1997/07/25 20:30:02 mickey Exp $$OpenBSD: disklabel.c,v 1.5 2000/07/19 15:25:13 deraadt Exp $QQQQQQQQQQQQQQQRRRxRhR`RXRHR@R8R0QR(R RRRRQQQRRRRRRRRRRRRRRRRRQRR$OpenBSD: confstr.c,v 1.3 1996/09/15 09:30:55 tholo Exp $$OpenBSD: basename.c,v 1.4 1999/05/30 17:10:30 espie Exp $$OpenBSD: alarm.c,v 1.3 1996/09/15 09:30:54 tholo Exp $]h^_$OpenBSD: tcsetattr.c,v 1.2 1996/08/19 08:34:42 tholo Exp $gxhhj k@$OpenBSD: sscanf.c,v 1.3 1997/07/25 20:30:12 mickey Exp $$OpenBSD: fwrite.c,v 1.2 1996/08/19 08:32:50 tholo Exp $$OpenBSD: ftell.c,v 1.3 2000/02/21 22:11:22 millert Exp $o$OpenBSD: regfree.c,v 1.3 1997/04/28 20:45:01 millert Exp $qu$OpenBSD: herror.c,v 1.4 1997/03/13 19:07:28 downsj Exp $yhyXy8y y$OpenBSD: getservbyport.c,v 1.3 1997/07/09 01:08:35 millert Exp $$OpenBSD: getprotoent.c,v 1.4 1999/09/03 16:23:18 millert Exp $$OpenBSD: getnetent.c,v 1.8 1998/03/16 05:06:57 millert Exp $$OpenBSD: gethostnamadr.c,v 1.42 2000/07/30 14:07:14 itojun Exp $gethostby*.getanswer: asked for "%s", got "%s"$OpenBSD: verrx.c,v 1.2 1996/08/19 08:27:32 tholo Exp $$OpenBSD: waitpid.c,v 1.3 1997/07/25 20:30:06 mickey Exp $$OpenBSD: wait.c,v 1.2 1996/08/19 08:27:41 tholo Exp $$OpenBSD: siglist.c,v 1.2 1996/08/19 08:26:05 tholo Exp $$OpenBSD: getpwent.c,v 1.19 2000/04/25 19:11:48 deraadt Exp $*netgroup: %m$OpenBSD: getcwd.c,v 1.6 2000/07/19 15:25:13 deraadt Exp $$OpenBSD: getcap.c,v 1.16 1999/02/25 21:40:17 millert Exp $$OpenBSD: exec.c,v 1.11 2000/08/22 18:46:04 deraadt Exp $$OpenBSD: err.c,v 1.4 1997/07/25 20:30:01 mickey Exp $0@0$OpenBSD: vfscanf.c,v 1.6 1998/01/20 21:25:39 millert Exp $  $OpenBSD: ungetc.c,v 1.2 1996/08/19 08:33:11 tholo Exp $$OpenBSD: fread.c,v 1.2 1996/08/19 08:32:44 tholo Exp $$OpenBSD: inet_network.c,v 1.7 1997/07/09 01:08:37 millert Exp $$OpenBSD: verr.c,v 1.2 1996/08/19 08:27:30 tholo Exp $$OpenBSD: warnx.c,v 1.2 1996/08/19 08:27:50 tholo Exp $$OpenBSD: warn.c,v 1.3 1997/07/25 20:30:06 mickey Exp $ $OpenBSD: strtouq.c,v 1.4 1996/08/19 08:33:53 tholo Exp $$OpenBSD: strtoq.c,v 1.4 1996/08/19 08:33:52 tholo Exp $($OpenBSD: vwarnx.c,v 1.2 1996/08/19 08:27:39 tholo Exp $$OpenBSD: vwarn.c,v 1.2 1996/08/19 08:27:38 tholo Exp $$OpenBSD: printf.c,v 1.3 1997/07/25 20:30:10 mickey Exp $ <x$OpenBSD: res_send.c,v 1.9 2000/06/22 07:31:18 itojun Exp $$OpenBSD: res_query.c,v 1.13 1999/09/27 23:58:26 alex Exp $$OpenBSD: setbuf.c,v 1.2 1996/08/19 08:33:04 tholo Exp $$OpenBSD: setvbuf.c,v 1.2 1996/08/19 08:33:05 tholo Exp $$OpenBSD: res_mkquery.c,v 1.8 1997/04/13 22:37:21 provos Exp $$OpenBSD: res_init.c,v 1.19 2000/06/22 07:31:18 itojun Exp $/&$OpenBSD: inet_addr.c,v 1.6 1999/05/03 22:31:14 yanick Exp $gethostby*.getanswer: asked for "%s", got "%s"$OpenBSD: syslog.c,v 1.9 2000/01/02 23:35:58 hugh Exp $$OpenBSD: gethostname.c,v 1.3 1998/05/13 08:50:58 deraadt Exp $qPqr@(#)strftime.c 7.62y $OpenBSD: vsnprintf.c,v 1.5 1998/07/27 02:28:28 millert Exp $$OpenBSD: fgets.c,v 1.2 1996/08/19 08:32:33 tholo Exp $$OpenBSD: send.c,v 1.2 1996/08/19 08:29:52 tholo Exp $$OpenBSD: res_debug.c,v 1.10 2000/07/07 20:59:47 deraadt Exp $ d'B@;$OpenBSD: res_data.c,v 1.1 1997/03/13 19:07:36 downsj Exp $Ը԰ԨԠԐԈxh`phXH@8Ը԰0( $OpenBSD: res_comp.c,v 1.8 1997/07/09 01:08:49 millert Exp $$OpenBSD: nsap_addr.c,v 1.4 1997/07/09 01:08:45 millert Exp $$OpenBSD: inet_pton.c,v 1.3 1999/12/08 09:31:15 itojun Exp $01234567890123456789abcdef0123456789ABCDEF$OpenBSD: inet_ntop.c,v 1.1 1997/03/13 19:07:32 downsj Exp $%u.%u.%u.%u$OpenBSD: inet_ntoa.c,v 1.2 1996/08/19 08:29:16 tholo Exp $$OpenBSD: getservbyname.c,v 1.5 2000/01/06 08:24:17 d Exp $ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/$OpenBSD: toupper_.c,v 1.2 1996/08/19 08:26:56 tholo Exp $$OpenBSD: tolower_.c,v 1.2 1996/08/19 08:26:52 tholo Exp $8$OpenBSD: time.c,v 1.2 1996/08/19 08:26:39 tholo Exp $$OpenBSD: getdomainname.c,v 1.3 1998/05/13 08:50:55 deraadt Exp $`H @(#)localtime.c 7.70$OpenBSD: localtime.c,v 1.19 2000/04/16 16:24:03 d Exp $WILDABBRGMT@(#)asctime.c 7.9$OpenBSD: asctime.c,v 1.7 2000/01/06 08:24:17 d Exp $$X%%x%  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~$OpenBSD: wbuf.c,v 1.4 1997/05/31 22:41:32 tholo Exp $$OpenBSD: sprintf.c,v 1.4 1998/01/12 06:14:31 millert Exp $$OpenBSD: perror.c,v 1.3 1998/09/10 06:44:53 deraadt Exp $$OpenBSD: fputs.c,v 1.3 1999/08/07 17:35:58 millert Exp $)@,(2H22$32P3h6X99T9t:(9=XFHItI4I|II$OpenBSD: getservent.c,v 1.5 1999/09/03 16:23:19 millert Exp $N NxO OPPQ(Q$OpenBSD: rewind.c,v 1.2 1996/08/19 08:33:02 tholo Exp $$OpenBSD: fseek.c,v 1.3 2000/02/21 22:11:22 millert Exp $$OpenBSD: fopen.c,v 1.2 1996/08/19 08:32:41 tholo Exp $Z[] ]^ ^_4_`d`deeHf|fgg$g\deff|fgg$gdgh,hklHm$OpenBSD: catopen.c,v 1.8 1996/09/15 09:31:23 tholo Exp $$OpenBSD: catgets.c,v 1.5 1996/09/15 09:31:22 tholo Exp $$OpenBSD: catclose.c,v 1.4 1997/07/09 01:08:57 millert Exp $}hP88$OpenBSD: opendir.c,v 1.6 1998/08/15 08:10:14 deraadt Exp $$OpenBSD: getpagesize.c,v 1.2 1996/08/19 08:23:54 tholo Exp $$OpenBSD: closedir.c,v 1.3 1998/11/20 11:18:37 d Exp $($OpenBSD: seekdir.c,v 1.3 1997/09/22 05:09:39 millert Exp $$OpenBSD: telldir.c,v 1.2 1996/08/19 08:26:35 tholo Exp $$OpenBSD: readdir.c,v 1.4 1999/09/01 23:19:41 deraadt Exp $$OpenBSD: fdopen.c,v 1.2 1996/08/19 08:32:20 tholo Exp $$OpenBSD: ftruncate.c,v 1.7 1998/11/20 11:18:52 d Exp $$OpenBSD: rget.c,v 1.2 1996/08/19 08:33:02 tholo Exp $$OpenBSD: refill.c,v 1.4 1999/08/07 17:35:58 millert Exp $$OpenBSD: flags.c,v 1.3 1996/08/19 08:32:37 tholo Exp $$OpenBSD: fclose.c,v 1.2 1996/08/19 08:32:19 tholo Exp $$OpenBSD: db.c,v 1.3 1999/02/15 05:11:23 millert Exp $$OpenBSD: hash.c,v 1.8 1999/04/18 17:08:07 millert Exp $$OpenBSD: bt_open.c,v 1.7 2000/10/03 18:16:48 mickey Exp $$OpenBSD: bt_get.c,v 1.4 1999/02/15 05:11:22 millert Exp $$OpenBSD: bt_conv.c,v 1.4 1999/02/15 05:11:22 millert Exp $$OpenBSD: bt_close.c,v 1.4 1999/02/15 05:11:22 millert Exp $$OpenBSD: snprintf.c,v 1.6 1998/01/12 06:20:56 millert Exp $$OpenBSD: mktemp.c,v 1.13 1998/06/30 23:03:13 deraadt Exp $$OpenBSD: hash_log2.c,v 1.4 1999/02/15 05:11:24 millert Exp $$OpenBSD: hash_func.c,v 1.5 1999/02/15 05:11:24 millert Exp $ـ$OpenBSD: hash_buf.c,v 1.8 2000/10/03 18:16:48 mickey Exp $$OpenBSD: bt_put.c,v 1.6 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_delete.c,v 1.5 1999/02/15 05:11:22 millert Exp $@(#)bt_split.c 8.10 (Berkeley) 1/9/95$OpenBSD: bt_seq.c,v 1.4 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_search.c,v 1.4 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_utils.c,v 1.4 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_overflow.c,v 1.5 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_page.c,v 1.5 1999/02/15 05:11:23 millert Exp $$OpenBSD: mpool.c,v 1.6 1999/02/15 05:11:25 millert Exp $ $OpenBSD: fprintf.c,v 1.3 1997/07/25 20:30:09 mickey Exp $ 0000000000000000$OpenBSD: fvwrite.c,v 1.10 1999/08/07 17:42:48 millert Exp $$OpenBSD: umoddi3.c,v 1.2 1996/08/19 08:30:48 tholo Exp $$OpenBSD: qdivrem.c,v 1.2 1996/08/19 08:30:42 tholo Exp $$OpenBSD: isnan.c,v 1.3 1996/08/19 08:17:39 tholo Exp $$OpenBSD: isinf.c,v 1.3 1996/08/19 08:17:38 tholo Exp $Z@Z\`}?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒCAy7FnM8O?ZwH02uOs<<Ҳ؉9I#ը32D=%[ό (doCA@???5?55?5A??҇coCa?Ɗ(`ȳ?DPy?@$@@?$OpenBSD: wsetup.c,v 1.2 1996/08/19 08:33:16 tholo Exp $$OpenBSD: makebuf.c,v 1.3 1998/11/25 05:18:49 millert Exp $$OpenBSD: findfp.c,v 1.2 1996/08/19 08:32:36 tholo Exp $({pP<< <DP$OpenBSD: fflush.c,v 1.2 1996/08/19 08:32:26 tholo Exp $$OpenBSD: _def_numeric.c,v 1.3 1997/07/23 21:14:39 kstailey Exp $$OpenBSD: _def_monetary.c,v 1.3 1997/07/23 21:14:38 kstailey Exp $8$OpenBSD: flt_rounds.c,v 1.3 1997/08/01 21:36:33 deraadt Exp $$OpenBSD: infinity.c,v 1.2 1996/08/19 08:17:37 tholo Exp $$OpenBSD: isatty.c,v 1.3 1998/11/20 11:18:39 d Exp $$OpenBSD: ctype_.c,v 1.3 1996/09/15 09:30:56 tholo Exp $ ((((( AAAAAABBBBBB H($OpenBSD: tcgetattr.c,v 1.2 1996/08/19 08:34:39 tholo Exp $$OpenBSD: malloc.c,v 1.40 2000/04/10 19:36:29 deraadt Exp $$OpenBSD: stdio.c,v 1.3 1997/11/09 23:40:41 flipk Exp $$OpenBSD: fwalk.c,v 1.2 1996/08/19 08:32:50 tholo Exp $$OpenBSD: sysconf.c,v 1.4 1998/06/02 06:10:26 deraadt Exp $$OpenBSD: signal.c,v 1.4 1998/06/26 02:12:49 deraadt Exp $`$OpenBSD: mmap.c,v 1.8 1998/01/02 05:32:50 deraadt Exp $$OpenBSD: lseek.c,v 1.6 1998/11/20 11:18:53 d Exp $(($OpenBSD: sysctl.c,v 1.3 1997/08/24 21:25:46 millert Exp $($OpenBSD: scandir.c,v 1.4 1998/08/14 21:39:32 deraadt Exp $$OpenBSD: rec_open.c,v 1.5 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_seq.c,v 1.4 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_get.c,v 1.5 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_delete.c,v 1.4 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_close.c,v 1.6 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_utils.c,v 1.3 1996/08/19 08:21:12 tholo Exp $$OpenBSD: rec_search.c,v 1.5 1999/02/15 05:11:25 millert Exp $$OpenBSD: hash_page.c,v 1.7 1999/02/15 05:11:24 millert Exp $$OpenBSD: ashldi3.c,v 1.2 1996/08/19 08:30:16 tholo Exp $$OpenBSD: hash_bigkey.c,v 1.7 2000/10/03 18:16:48 mickey Exp $$OpenBSD: rec_put.c,v 1.5 1999/02/15 05:11:25 millert Exp $#!/bin/sh - # $OpenBSD: MAKEDEV,v 1.63 2000/05/06 20:30:58 miod Exp $ # # Copyright (c) 1990 The Regents of the University of California. # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the University of # California, Berkeley and its contributors. # 4. Neither the name of the University nor the names of its contributors # may be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE REGENTS AND CONTRIBUTORS ``AS IS'' AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE # IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE # ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE LIABLE # FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL # DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS # OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) # HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT # LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF # SUCH DAMAGE. # # @(#)MAKEDEV 5.5 (Berkeley) 5/28/91 # # Device "make" file. Valid arguments: # all makes all known devices, including local devices. # Tries to make the ``standard'' number of each type. # std standard devices # local configuration specific devices # # Tapes: # st* SCSI tapes # # Disks: # sd* SCSI disks # cd* SCSI cdrom drives # xy* Xylogic 450/451 disks # rd* "ramdisk" pseudo-disks # xd* Xylogic 753/7053 disks # fd* Floppy disk drives (3 1/2", 5 1/4") # vnd* "file" pseudo-disks # ccd* concatenated disk devices # raid* RAIDframe disk devices # # Pseudo terminals: # pty* set of 16 master and slave pseudo terminals # # Printers: # # Terminal ports: # tty[a-d] onboard zs serial ports # cua[a-d] onboard zs serial ports # # Special purpose devices: # ch* SCSI media changer # uk* SCSI Unknown device # ses* SCSI SES/SAF-TE device # ss* SCSI scanners # audio # openprom # bwtwo* # cgtwo* # cgthree* # cgfour* # cgsix* # cgeight* # cgfourteen* # tcx* # bpf* Berkeley Packet Filter # lkm loadable kernel modules interface # tun* network tunnel driver # *random inkernal random data source # magma* magma card (makes 16 tty and 2 bpp) # spif* spif card (makes 8 tty and 1 bpp) # bpp* bpp # xfs* XFS filesystem devices # ipl IP filter log PATH=/sbin:/bin:/usr/bin:/usr/sbin this=$0 umask 77 if ! [ "$os" ]; then os=OpenBSD fi # SunOS shell support functions if [ "$os" = "SunOS" ] then PATH=$PATH:/usr/etc # SunOS has chown in /usr/etc add () { expr $1 + $2 } mult () { expr $1 '*' $2 } hex () { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } trunc () { expr $1 : $2'\(.*\)' } unt() { expr $1 : '[a-z]*\([0-9]*\)[a-p]*' } fi # OpenBSD shell support functions if [ "$os" = "OpenBSD" ] then add () { tmp=0 while [ "$1" ] do tmp=$(( $1 + $tmp )) shift done echo $tmp } mult () { echo "$(( $1 * $2 ))" } hex () { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } trunc () { # XXX pdksh can't seem to deal with locally scoped variables # in ${foo#$bar} expansions arg1="$1" arg2="$2" echo ${arg1#$arg2} } unt() { # XXX pdksh can't seem to deal with locally scoped variables # in ${foo#$bar} expansions arg1="$1" tmp="${arg1#[a-z]*}" while [ "$tmp" != "$arg1" ] do arg1=$tmp tmp="${arg1#[a-z]*}" done tmp="${arg1%*[a-z]}" while [ "$tmp" != "$arg1" ] do arg1=$tmp tmp="${arg1%*[a-z]}" done echo $arg1 } fi for i do unit=`unt $i` [ "$unit" ] || unit=0 case $i in all) sh $this std sd0 sd1 sd2 sd3 sd4 xd0 xd1 xd2 xd3 xy0 xy1 xy2 xy3 sh $this cd0 st0 st1 rd0 sh $this fd0 fd0B fd0C fd0D fd0E fd0F fd0G fd0H sh $this uk0 uk1 sh $this ss0 ss1 sh $this ses0 sh $this pty0 vnd0 vnd1 vnd2 vnd3 audio tun0 tun1 tun2 tun3 sh $this ccd0 ccd1 ccd2 ccd3 sh $this raid0 raid1 raid2 raid3 sh $this bpf0 bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 sh $this ipl sh $this bwtwo0 cgtwo0 cgthree0 cgfour0 cgsix0 sh $this cgeight0 cgfourteen0 tcx0 sh $this lkm random local sh $this xfs0 ;; floppy) sh $this std random sh $this fd0 sd0 sd1 ;; ramdisk) sh $this std random sh $this fd0 sd0 sd1 sd2 sd3 rd0 cd0 st0 st1 sh $this bpf0 ;; std) rm -f console drum mem kmem xf86 null zero io tty klog stdin stdout stderr ksyms rm -f eeprom openprom tty[abcd] cua[abcd] fb mouse kbd mknod console c 0 0 mknod tty c 2 0 ; chmod 666 tty mknod kmem c 3 1 ; chmod 640 kmem ; chown root.kmem kmem mknod mem c 3 0 ; chmod 640 mem ; chown root.kmem mem mknod null c 3 2 ; chmod 666 null mknod zero c 3 12 ; chmod 666 zero mknod eeprom c 3 11 ; chmod 640 eeprom ; chown root.kmem eeprom mknod openprom c 70 0 ; chmod 644 openprom mknod drum c 7 0 ; chmod 640 drum ; chown root.kmem drum mknod klog c 16 0 ; chmod 600 klog mknod stdin c 24 0 ; chmod 666 stdin mknod stdout c 24 1 ; chmod 666 stdout mknod stderr c 24 2 ; chmod 666 stderr sh $this ttya ttyb ttyc ttyd sh $this cuaa cuab cuac cuad mknod fb c 22 0 ; chmod 666 fb mknod mouse c 13 0 ; chmod 666 mouse mknod kbd c 29 0 ; chmod 666 kbd mknod ksyms c 122 0 ; chmod 640 ksyms ; chown root.kmem ksyms ;; fd) rm -f fd/* mkdir fd > /dev/null 2>&1 n=0 (cd fd && while [ $n -lt 64 ]; do mknod $n c 24 $n; n=`add $n 1`; done ) chown -R root.wheel fd chmod 555 fd chmod 666 fd/* ;; bwtwo*) rm -f bwtwo$unit mknod bwtwo$unit c 27 $unit; chmod 666 bwtwo$unit ;; cgtwo*) rm -f cgtwo$unit mknod cgtwo$unit c 31 $unit; chmod 666 cgtwo$unit ;; cgthree*) rm -f cgthree$unit mknod cgthree$unit c 55 $unit; chmod 666 cgthree$unit ;; cgfour[0-9]*) rm -f cgfour$unit mknod cgfour$unit c 39 $unit; chmod 666 cgfour$unit ;; cgsix*) rm -f cgsix$unit mknod cgsix$unit c 67 $unit; chmod 666 cgsix$unit ;; cgeight*) rm -f cgeight$unit mknod cgeight$unit c 64 $unit; chmod 666 cgeight$unit ;; cgfourteen*) rm -f cgfourteen$unit mknod cgfourteen$unit c 99 $unit; chmod 666 cgfourteen$unit ;; tcx*) rm -f tcx$unit mknod tcx$unit c 109 $unit; chmod 666 tcx$unit ;; audio*) major=69 audio=audio$unit sound=sound$unit mixer=mixer$unit audioctl=audioctl$unit rm -f $audio $sound $mixer $audioctl mknod $sound c $major $unit mknod $audio c $major `add $unit 128` mknod $mixer c $major `add $unit 16` mknod $audioctl c $major `add $unit 192` chown root.wheel $audio $sound $mixer $audioioctl chmod 666 $audio $sound $mixer $audioctl [ -e audio ] || ln -s $audio audio [ -e mixer ] || ln -s $mixer mixer [ -e sound ] || ln -s $sound sound [ -e audioctl ] || ln -s $audioctl audioctl ;; xfs*) rm -f xfs$unit mknod xfs$unit c 51 $unit chmod 600 xfs$unit chown root.wheel xfs$unit ;; openprom) rm -f openprom mknod openprom c 70 0 ;chmod 600 openprom ;; bpf*) rm -f bpf$unit mknod bpf$unit c 105 $unit chmod 600 bpf$unit chown root.wheel bpf$unit ;; ipl) rm -f ipl ipnat ipstate ipauth mknod ipl c 59 0 mknod ipnat c 59 1 mknod ipstate c 59 2 mknod ipauth c 59 3 chown root.wheel ipl ipnat ipstate ipauth ;; tun*) rm -f tun$unit mknod tun$unit c 111 $unit chmod 600 tun$unit chown root.wheel tun$unit ;; fd*) umask 2 ; typnam=`expr $i : 'fd.*\(.\)$'` unit=`expr $i : 'fd\(.\).*'` case $typnam in 0|1) typnam=; typnum=0;; # no type specified, assume A A) typnam=; typnum=0;; B) typnum=1;; C) typnum=2;; D) typnum=3;; E) typnum=4;; F) typnum=5;; G) typnum=6;; H) typnum=7;; *) echo bad type $typnam for $i; exit 1;; esac case $unit in 0|1) blk=16; chr=54;; *) echo bad unit $unit for $i; exit 1;; esac nam=fd${unit}${typnam} rm -f ${nam}? r${nam}? basenum=`expr $unit '*' 128 + $typnum '*' 16` mknod ${nam}a b $blk `expr $basenum + 0` mknod ${nam}b b $blk `expr $basenum + 1` mknod ${nam}c b $blk `expr $basenum + 2` #mknod ${nam}d b $blk `expr $basenum + 3` #mknod ${nam}e b $blk `expr $basenum + 4` #mknod ${nam}f b $blk `expr $basenum + 5` #mknod ${nam}g b $blk `expr $basenum + 6` #mknod ${nam}h b $blk `expr $basenum + 7` #mknod ${nam}i b $blk `expr $basenum + 8` #mknod ${nam}j b $blk `expr $basenum + 9` #mknod ${nam}k b $blk `expr $basenum + 10` #mknod ${nam}l b $blk `expr $basenum + 11` #mknod ${nam}m b $blk `expr $basenum + 12` #mknod ${nam}n b $blk `expr $basenum + 13` #mknod ${nam}o b $blk `expr $basenum + 14` #mknod ${nam}p b $blk `expr $basenum + 15` mknod r${nam}a c $chr `expr $basenum + 0` mknod r${nam}b c $chr `expr $basenum + 1` mknod r${nam}c c $chr `expr $basenum + 2` #mknod r${nam}d c $chr `expr $basenum + 3` #mknod r${nam}e c $chr `expr $basenum + 4` #mknod r${nam}f c $chr `expr $basenum + 5` #mknod r${nam}g c $chr `expr $basenum + 6` #mknod r${nam}h c $chr `expr $basenum + 7` #mknod r${nam}i c $chr `expr $basenum + 8` #mknod r${nam}j c $chr `expr $basenum + 9` #mknod r${nam}k c $chr `expr $basenum + 10` #mknod r${nam}l c $chr `expr $basenum + 11` #mknod r${nam}m c $chr `expr $basenum + 12` #mknod r${nam}n c $chr `expr $basenum + 13` #mknod r${nam}o c $chr `expr $basenum + 14` #mknod r${nam}p c $chr `expr $basenum + 15` chown root.operator ${nam}[a-p] r${nam}[a-p] chmod 640 ${nam}[a-p] r${nam}[a-p] umask 77 ;; ccd*|sd*|xd*|xy*|cd*|raid*) umask 2 unit=`unt $i` if [ 0$unit -gt 15 ] then echo bad disk unit: $i - $unit exit 127 fi case $i in ccd*) name=ccd; blk=9; chr=23;; raid*) name=raid; blk=25; chr=123;; sd*) name=sd; blk=7; chr=17;; xd*) name=xd; blk=10; chr=42;; xy*) name=xy; blk=3; chr=9;; cd*) name=cd; blk=18; chr=58;; *) echo bad unit for disk in: $i;; esac if [ "$unit" = "" ] then n=0 while [ $n -lt 32 ] do sh $this $name$n n=`add $n 1` done fi rm -f $name$unit? r$name$unit? minor=`mult $unit 16` for slice in a b c d e f g h i j k l m n o p do dev=$name$unit$slice mknod $dev b $blk $minor mknod r$dev c $chr $minor minor=`add $minor 1` done chown root.operator $name$unit? r$name$unit? chmod 640 $name$unit? r$name$unit? umask 77 ;; vnd*) umask 2 unit=`unt $i` if [ 0$unit -gt 15 ] then echo bad disk unit: $i - $unit exit 127 fi blk=8; chr=110; for name in vnd svnd; do case $name in vnd) off=0;; svnd) off=128;; esac if [ "$unit" = "" ] then n=0 while [ $n -lt 32 ] do sh $this $name$n n=`add $n 1` done fi rm -f $name$unit? r$name$unit? minor=`mult $unit 16` minor=`add $minor $off` for slice in a b c d e f g h i j k l m n o p do dev=$name$unit$slice mknod $dev b $blk $minor mknod r$dev c $chr $minor minor=`add $minor 1` done chown root.operator $name$unit? r$name$unit? chmod 640 $name$unit? r$name$unit? done umask 77 ;; rd*) umask 2 ; unit=`expr $i : '.*d\(.*\)'` rm -f rd${unit}* rrd${unit}* mknod rd${unit}a b 17 `expr $unit '*' 16 + 0` mknod rd${unit}c b 17 `expr $unit '*' 16 + 2` mknod rrd${unit}a c 106 `expr $unit '*' 16 + 0` mknod rrd${unit}c c 106 `expr $unit '*' 16 + 2` chown root.operator rd${unit}[ac] rrd${unit}[ac] chmod 640 rd${unit}[ac] rrd${unit}[ac] umask 77 ;; st*) umask 2 case $i in st*) name=st; blk=11; chr=18;; esac rm -f $name$unit n$name$unit e$name$unit en$name$unit \ r$name$unit nr$name$unit er$name$unit enr$name$unit sixt=`mult $unit 16` mknod $name$unit b $blk `add $sixt 0` mknod n$name$unit b $blk `add $sixt 1` mknod e$name$unit b $blk `add $sixt 2` mknod en$name$unit b $blk `add $sixt 3` mknod r$name$unit c $chr `add $sixt 0` mknod nr$name$unit c $chr `add $sixt 1` mknod er$name$unit c $chr `add $sixt 2` mknod enr$name$unit c $chr `add $sixt 3` chown root.operator $name$unit n$name$unit \ e$name$unit en$name$unit \ r$name$unit nr$name$unit \ er$name$unit enr$name$unit chmod 660 $name$unit n$name$unit \ e$name$unit en$name$unit \ r$name$unit nr$name$unit \ er$name$unit enr$name$unit umask 77 ;; ch*) umask 2 case $i in ch*) name=ch; chr=19;; esac rm -f $name$unit mknod $name$unit c $chr $unit chown root.operator $name$unit chmod 660 $name$unit umask 77 ;; lkm) rm -f lkm mknod lkm c 112 0 chown root.kmem lkm chmod 640 lkm ;; tty[a-z]) unit=`expr $i : 'tty\([a-z]\)'` rm -f tty$unit case $unit in a) n=0 ;; b) n=1 ;; c) n=4 ;; d) n=5 ;; *) echo unknown tty device $i ;; esac mknod tty$unit c 12 $n chown uucp.dialer tty$unit chmod 660 tty$unit ;; cua[a-z]) unit=`expr $i : 'cua\([a-z]\)'` rm -f cua$unit case $unit in a) n=0 ;; b) n=1 ;; c) n=4 ;; d) n=5 ;; *) echo unknown cua device $i ;; esac mknod cua$unit c 12 `add $n 128` chown uucp.dialer cua$unit chmod 660 cua$unit ;; pty*) case $unit in 0) offset=0 name=p;; 1) offset=16 name=q;; 2) offset=32 name=r;; 3) offset=48 name=s;; 4) offset=64 name=t;; 5) offset=80 name=u;; 6) offset=96 name=v;; 7) offset=112 name=w;; 8) offset=128 name=x;; 9) offset=144 name=y;; 10) offset=160 name=z;; 11) offset=176 name=P;; 12) offset=192 name=Q;; 13) offset=208 name=R;; 14) offset=224 name=S;; 15) offset=240 name=T;; *) echo bad unit for pty in: $i;; esac case $unit in 0|1|2|3|4|5|6|7|8|9|10|11|12|13|14|15) umask 0 n=0 while [ $n -lt 16 ] do nam=$name`hex $n` rm -f {tty,pty}$nam mknod tty$nam c 20 `add $offset $n` mknod pty$nam c 21 `add $offset $n` n=`add $n 1` done umask 77 ;; esac ;; spif*) case $unit in 0) nam=j;; 1) nam=k;; 2) nam=l;; *) echo "bad unit for $i: $unit"; exit 127;; esac rm -f bpps${unit}? tty${nam}? offset=`expr $unit \* 64` n=0 while [ $n -lt 8 ] do name=$nam`hex $n` mknod tty$name c 102 `add $offset $n` chown uucp.dialer tty$name chmod 660 tty$name n=`add $n 1` done mknod bpps${unit}0 c 103 `add $offset 0` ;; magma*) case $unit in 0) nam=m;; 1) nam=n;; 2) nam=o;; *) echo "bad unit for $i: $unit"; exit 127;; esac rm -f bppm${unit}? tty${nam}? offset=`expr $unit \* 64` n=0 while [ $n -lt 16 ] do name=$nam`hex $n` mknod tty$name c 100 `add $offset $n` chown uucp.dialer tty$name chmod 660 tty$name n=`add $n 1` done mknod bppm${unit}0 c 101 `add $offset 0` mknod bppm${unit}1 c 101 `add $offset 1` ;; bpp*) unit=`expr $i : 'bpp\(.*\)'` mknod bpp${unit} c 104 `add $unit 0` ;; fga*) unit=`expr $i : 'fga\(.*\)'` if [ "$unit" != 0 ]; then echo "bad unit $unit for $i" exit 127 fi rm -f fga$unit mknod fga$unit c 98 $unit chmod 600 fga$unit chown root.wheel fga$unit ;; scf*) unit=`expr $i : 'scf\(.*\)'` if [ "$unit" != 0 ]; then echo "bad unit $unit for $i" exit 127 fi rm -f scf$unit mknod scf$unit c 107 $unit chmod 600 scf$unit chown root.wheel scf$unit ;; flash*) unit=`expr $i : 'flash\(.*\)'` if [ "$unit" != 0 ]; then echo "bad unit $unit for $i" exit 127 fi rm -f flash$unit mknod flash$unit c 108 $unit chmod 600 flash$unit chown root.wheel flash$unit ;; random|srandom|urandom|prandom|arandom) rm -f random urandom srandom prandom arandom mknod random c 119 0 mknod srandom c 119 1 mknod urandom c 119 2 mknod prandom c 119 3 mknod arandom c 119 4 chown root.wheel random srandom urandom prandom arandom chmod 644 random srandom urandom prandom arandom ;; uk*) unit=`trunc $i uk` rm -f uk$unit mknod uk$unit c 120 $unit chown root.operator uk$unit chmod 640 uk$unit ;; ses*) unit=`trunc $i ses` rm -f ses$unit mknod ses$unit c 124 $unit cho . ..MAKEDEV MAKEDEV.localqconsole tty kmemZ  mem nullZ  zeroZ  eeprom openpromYdrumZ klogZ stdin stdout stderr ttyaZN ttybZN ttycZN ttydZN cuaaZN cuabZN cuaccuadZN  fbmouse  kbdksyms  sd0aZ !rsd0a "sd0bZ  st0#rsd0b $sd0cZ %rsd0c &sd0d'rsd0d (sd0eZ )rsd0e *sd0f+rsd0f ,sd0gZ -rsd0g .sd0hZ /rsd0h 0sd0iZ 1rsd0i 2sd0jZ 3rsd0j 4sd0kZ 5rsd0k 6sd0lZ 7rsd0l 8sd0mZ 9rsd0m :sd0nZ ;rsd0n <sd0oZ =rsd0o>sd0pZ ?rsd0p @sd1aZ Arsd1a Bsd1bZ Crsd1bDsd1cZ Ersd1c Fsd1dZ Grsd1d Hsd1eZ Irsd1e Jsd1fZ Krsd1f Lsd1gZ Mrsd1g Nsd1hZ Orsd1h Psd1iZ Qrsd1i Rsd1jZ Srsd1j Tsd1kZ Ursd1k Vsd1lZ Wrsd1l Xsd1mYrsd1m?XZsd1n[rsd1n \sd1oZ ]rsd1o ^sd1pZ _rsd1p `sd2aZ arsd2a bsd2bZ crsd2b dsd2cZ ersd2c fsd2dZ grsd2d hsd2eZ irsd2e jsd2fkrsd2f lsd2gZ mrsd2g nsd2hZ orsd2h psd2iZ qrsd2i rsd2jZ srsd2j tsd2kZ ursd2k vsd2lZ wrsd2l xsd2mZ yrsd2m zsd2nZ {rsd2n |sd2oZ }rsd2o ~sd2pZ rsd2p sd3aZ rsd3a sd3bZ rsd3b sd3cZ rsd3c sd3dZ rsd3d sd3eZ rsd3e sd3fZ rsd3f sd3gZ rsd3g sd3hZ rsd3h sd3iZ rsd3i sd3jZ rsd3j sd3kZ rsd3k sd3lrsd3l sd3mZ rsd3m sd3nZ rsd3n sd3oZ rsd3o sd3pZ rsd3p sd4aZ rsd4asd4bZ rsd4b sd4cZ rsd4c sd4drsd4d sd4eZ rsd4e sd4fZ rsd4f sd4gZ rsd4g sd4hZ rsd4h sd4iZ rsd4isd4jZ rsd4j sd4kZ rsd4k sd4lZ rsd4l sd4mZ rsd4m sd4nZ rsd4n sd4oZ rsd4o sd4pZ rsd4p xd0aZ rxd0a xd0bZ rxd0b xd0cZ rxd0c xd0dZ rxd0d xd0eZ rxd0e xd0fZ rxd0f xd0gZ rxd0g xd0hZ rxd0h xd0iZ rxd0i xd0jZ rxd0j?Xxd0kZ rxd0k xd0lZ rxd0lxd0mZ rxd0m xd0nZ rxd0n xd0oZ rxd0o xd0pZ rxd0p xd1aZ rxd1a xd1bZ rxd1b xd1cZ rxd1c xd1dZ rxd1d xd1eZ rxd1e xd1fZ rxd1f xd1gZ rxd1g xd1hZ rxd1h xd1iZ rxd1i xd1jZ rxd1j xd1kZ rxd1kxd1lZ rxd1l xd1mZ rxd1m xd1nZ rxd1n xd1oZ rxd1oxd1pZ rxd1p xd2aZ rxd2a xd2bZ rxd2b xd2cZ rxd2c xd2drxd2d xd2eZ rxd2e xd2fZ rxd2f xd2gZ rxd2g xd2hZ rxd2h xd2iZ rxd2i xd2jZ  rxd2j!xd2kZ "rxd2k #xd2lZ $rxd2l %xd2mZ &rxd2m 'xd2nZ (rxd2n )xd2oZ *rxd2o +xd2pZ ,rxd2p -xd3aZ .rxd3a /xd3bZ 0rxd3b 1xd3c2rxd3c 3xd3dZ 4rxd3d 5xd3eZ 6rxd3e 7xd3fZ 8rxd3f 9xd3gZ :rxd3g ;xd3hZ <rxd3h =xd3iZ >rxd3i ?xd3jZ @rxd3j Axd3kZ Brxd3k Cxd3lZ Drxd3l Exd3mZ Frxd3m Gxd3nZ Hrxd3nIxd3oZ Jrxd3o Kxd3pZ Lrxd3p Mxy0aZ Nrxy0a Oxy0bZ Prxy0b Qxy0cZ Rrxy0c Sxy0dZ Trxy0d Uxy0eZ Vrxy0e Wxy0fZ Xrxy0fYxy0gZ Zrxy0g [xy0hZ \rxy0h ]xy0iZ ^rxy0i _xy0jZ `rxy0j axy0kZ brxy0k cxy0lZ drxy0l exy0mZ frxy0m gxy0nZ hrxy0n ixy0oZ jrxy0o kxy0pZ lrxy0p mxy1aZ nrxy1a oxy1bprxy1b qxy1crrxy1c sxy1dtrxy1d uxy1eZ vrxy1e wxy1fZ xrxy1f yxy1gZ zrxy1g {xy1hZ |rxy1h }xy1iZ ~rxy1i xy1jZ rxy1j xy1kZ rxy1kxy1lZ rxy1l xy1mZ rxy1m xy1nZ rxy1n xy1oZ rxy1o xy1pZ rxy1p xy2aZ rxy2a xy2bZ rxy2b xy2cZ rxy2c xy2dZ rxy2d xy2erxy2e xy2fZ rxy2f xy2gZ rxy2gxy2hZ rxy2h xy2iZ rxy2i xy2jrxy2j xy2kZ rxy2k xy2lZ rxy2l xy2mZ rxy2m xy2nZ rxy2n xy2oZ rxy2o xy2prxy2p xy3aZ rxy3a xy3bZ rxy3b xy3cZ rxy3c xy3dZ rxy3dxy3eZ rxy3e xy3fZ rxy3f xy3gZ rxy3g xy3hZ rxy3h xy3iZ rxy3i xy3jZ rxy3jxy3kZ rxy3k xy3lZ rxy3l xy3mZ rxy3m xy3nrxy3n xy3oZ rxy3o xy3pZ rxy3p cd0aZ rcd0a cd0bZ rcd0b cd0cZ rcd0ccd0dZ rcd0dcd0eZ rcd0e cd0fZ rcd0f cd0gZ rcd0g cd0hZ rcd0h cd0iZ rcd0i cd0jZ rcd0jcd0kZ rcd0k cd0lZ rcd0l cd0m?Xrcd0m cd0nrcd0n cd0oZ rcd0o cd0pZ rcd0p nst0Z est0Z enst0 rst0Z nrst0 erst0 enrst0  st1nst1Z est1Z enst1 rst1Z nrst1 erst1 enrst1 rd0aZ rd0cZ rrd0a rrd0c fd0aZ fd0bZ fd0cZ rfd0a rfd0b rfd0c fd0Ba fd0Bb fd0Bc rfd0Ba rfd0Bb rfd0Bc fd0Ca fd0Cb fd0Cc rfd0Ca rfd0Cb rfd0Cc fd0Da fd0Db fd0Dc rfd0Da rfd0Db !rfd0Dc "fd0Ea#fd0Eb $fd0Ec %rfd0Ea &rfd0Eb 'rfd0Ec (fd0Fa )fd0Fb *fd0Fc +rfd0Fa ,rfd0Fb -rfd0Fc .fd0Ga /fd0Gb 0fd0Gc 1rfd0Ga 2rfd0Gb 3rfd0Gc 4fd0Ha 5fd0Hb6fd0Hc 7rfd0Ha8rfd0Hb 9rfd0Hc : uk0; uk1< ss0= scan0ۀ> ss1? scan1ۀ@ses0Z Attyp0 Bptyp0 Cttyp1 Dptyp1 Ettyp2 Fptyp2 Gttyp3?XHptyp3 Ittyp4 Jptyp4 Kttyp5 Lptyp5 Mttyp6 Nptyp6 Ottyp7 Pptyp7 Qttyp8Rptyp8 Sttyp9 Tptyp9 Uttypa Vptypa Wttypb Xptypb Yttypc Zptypc [ttypd \ptypd ]ttype ^ptype _ttypf `ptypf avnd0abrvnd0a cvnd0b drvnd0b evnd0c frvnd0c gvnd0d hrvnd0divnd0e jrvnd0e kvnd0f lrvnd0f mvnd0g nrvnd0g ovnd0h prvnd0h qvnd0i rrvnd0i svnd0j trvnd0j uvnd0k vrvnd0k wvnd0l xrvnd0l yvnd0m zrvnd0m{vnd0n |rvnd0n }vnd0o ~rvnd0o vnd0p rvnd0p svnd0a rsvnd0asvnd0b rsvnd0bsvnd0c rsvnd0csvnd0drsvnd0dsvnd0e rsvnd0esvnd0frsvnd0fsvnd0g rsvnd0gsvnd0h rsvnd0hsvnd0i rsvnd0isvnd0j rsvnd0jsvnd0k rsvnd0ksvnd0l rsvnd0lsvnd0m rsvnd0msvnd0n rsvnd0nsvnd0o rsvnd0osvnd0p rsvnd0pvnd1a rvnd1a vnd1b rvnd1b vnd1c rvnd1c vnd1d rvnd1d vnd1e rvnd1e vnd1f rvnd1f vnd1g rvnd1gvnd1h rvnd1h vnd1i rvnd1i vnd1j rvnd1j vnd1k rvnd1k vnd1l rvnd1l vnd1m rvnd1m vnd1n rvnd1n vnd1o rvnd1o vnd1p rvnd1p svnd1a rsvnd1asvnd1b rsvnd1bsvnd1c rsvnd1csvnd1d rsvnd1dsvnd1e rsvnd1esvnd1f rsvnd1fsvnd1g rsvnd1gsvnd1h rsvnd1hsvnd1i rsvnd1isvnd1j rsvnd1jsvnd1k rsvnd1ksvnd1l rsvnd1lsvnd1m rsvnd1msvnd1n rsvnd1nsvnd1o rsvnd1osvnd1p rsvnd1pvnd2a rvnd2a vnd2b rvnd2b vnd2c rvnd2c vnd2d rvnd2d vnd2e rvnd2e vnd2f rvnd2f vnd2g rvnd2g vnd2h rvnd2h vnd2i rvnd2i vnd2j rvnd2j vnd2k rvnd2k vnd2l rvnd2l vnd2m rvnd2m vnd2n rvnd2nvnd2o rvnd2o vnd2p rvnd2p svnd2a rsvnd2asvnd2b rsvnd2bsvnd2c  rsvnd2c svnd2d  rsvnd2d svnd2e  rsvnd2esvnd2f rsvnd2fsvnd2grsvnd2gsvnd2h rsvnd2hsvnd2i rsvnd2isvnd2j rsvnd2jsvnd2k rsvnd2ksvnd2l rsvnd2lsvnd2m rsvnd2msvnd2n rsvnd2n svnd2o!rsvnd2o"svnd2p#rsvnd2p$vnd3a %rvnd3a &vnd3b 'rvnd3b (vnd3c )rvnd3c *vnd3d +rvnd3d,vnd3e -rvnd3e .vnd3f /rvnd3f 0vnd3g1rvnd3g 2vnd3h 3rvnd3h 4vnd3i 5rvnd3i 6vnd3j 7rvnd3j 8vnd3k 9rvnd3k :vnd3l;rvnd3l <vnd3m =rvnd3m >vnd3n ?rvnd3n @vnd3o Arvnd3o Bvnd3pCrvnd3p Dsvnd3a Ersvnd3aFsvnd3b Grsvnd3bHsvnd3c Irsvnd3cJsvnd3d Krsvnd3dLsvnd3e Mrsvnd3eNsvnd3f Orsvnd3fPsvnd3g Qrsvnd3gRsvnd3h Srsvnd3hTsvnd3i Ursvnd3iVsvnd3j Wrsvnd3jXsvnd3k Yrsvnd3kZsvnd3l [rsvnd3l\svnd3m ]rsvnd3m^svnd3n _rsvnd3n`svnd3o arsvnd3obsvnd3pXcrsvnd3pdsound0 eaudio0 fmixer0 g audioctl0h audioۀi mixerۀj soundۀk audioctlltun0Z mtun1Z ntun2otun3Z pccd0a qrccd0a rccd0b srccd0b tccd0curccd0c vccd0dwrccd0d xccd0e yrccd0e zccd0f {rccd0f |ccd0g?X}rccd0g ~ccd0h rccd0h ccd0i rccd0i ccd0j rccd0jXccd0k rccd0k ccd0lrccd0l ccd0m rccd0m ccd0n rccd0n ccd0o rccd0o ccd0p rccd0p ccd1a rccd1a ccd1b rccd1b ccd1c rccd1c ccd1d rccd1dccd1e rccd1e ccd1f rccd1f ccd1g rccd1g ccd1h rccd1h ccd1i rccd1i ccd1j rccd1j ccd1k rccd1k ccd1l rccd1l ccd1m rccd1m ccd1n rccd1nccd1o rccd1o ccd1prccd1p ccd2a rccd2a ccd2b rccd2b ccd2c rccd2c ccd2d rccd2d ccd2e rccd2e ccd2f rccd2fccd2g rccd2g ccd2h rccd2h ccd2i rccd2i ccd2j rccd2j ccd2k rccd2k ccd2l rccd2l ccd2m rccd2m ccd2n rccd2n ccd2o rccd2o ccd2p rccd2p ccd3arccd3a ccd3b rccd3b ccd3c rccd3cXccd3d rccd3d ccd3e rccd3eXccd3f rccd3f ccd3g rccd3g ccd3h rccd3hccd3i rccd3i ccd3j rccd3j ccd3krccd3k ccd3l rccd3l ccd3m rccd3m ccd3nrccd3n ccd3o rccd3o ccd3p rccd3praid0a rraid0araid0b rraid0braid0c rraid0craid0d rraid0draid0e rraid0eraid0frraid0fraid0g rraid0graid0h rraid0hraid0i rraid0iraid0jrraid0j raid0k !rraid0k"raid0l #rraid0l$raid0m %rraid0m&raid0n 'rraid0n(raid0o )rraid0o*raid0p+rraid0p,raid1a -rraid1a.raid1b/rraid1b0raid1c 1rraid1c2raid1d 3rraid1d4raid1e 5rraid1e6raid1f 7rraid1f8raid1g 9rraid1g:raid1h ;rraid1h<raid1i =rraid1i>raid1j ?rraid1j@raid1k Arraid1kBraid1l Crraid1lDraid1m Erraid1mFraid1nGrraid1nHraid1o Irraid1oJraid1p Krraid1pLraid2a Mrraid2aNraid2b Orraid2bPraid2c Qrraid2cRraid2d Srraid2dTraid2e Urraid2eVraid2f Wrraid2fXraid2g Yrraid2gZraid2h [rraid2h\raid2i ]rraid2i^raid2j _rraid2j`raid2k arraid2kbraid2l crraid2ldraid2merraid2mfraid2n grraid2nhraid2o irraid2ojraid2pkrraid2plraid3a mrraid3anraid3b orraid3bpraid3c qrraid3crraid3d srraid3dtraid3e urraid3evraid3f wrraid3fxraid3g yrraid3gzraid3h {rraid3h|raid3i }rraid3i~raid3j rraid3jraid3k rraid3kraid3l rraid3lraid3m rraid3mraid3n rraid3nraid3o rraid3oraid3p rraid3pbpf0Z bpf1Z bpf2bpf3Z bpf4Z bpf5Z bpf6Z bpf7Z bpf8Z bpf9Z  iplipnat ipstateipauth bwtwo0 cgtwo0 cgthree0Ycgfour0cgsix0 cgeight0H cgfourteen0tcx0Z  lkmrandom srandomurandomprandomarandomxfs0Z # $OpenBSD: dot.profile,v 1.14 2000/10/25 16:38:13 millert Exp $ # $NetBSD: dot.profile,v 1.1 1995/12/18 22:54:43 pk Exp $ # # Copyright (c) 1995 Jason R. Thorpe # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Christopher G. Demetriou. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export HISTFILE=/.sh_history umask 022 set -o emacs # emacs-style command line editing alias dmesg="cat /kern/msgbuf" # XXX # the TERM/EDITOR stuff is really well enough parameterized to be moved # into install.sub where it could use the routines there and be invoked # from the various (semi) MI install and upgrade scripts # terminals believed to be in termcap, default TERM TERMS="sun vt* pcvt* pc3 dumb" TERM=sun if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES # mount kernfs and re-mount the boot media (perhaps r/w) mount_kernfs /kern /kern mount_ffs -o update /kern/rootdev / # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T 9600 # get the terminal type _forceloop="" while [ "X$_forceloop" = X"" ]; do echo "Supported terminals are: $TERMS" eval `tset -s -m ":?$TERM"` if [ "X$TERM" != X"unknown" ]; then _forceloop="done" fi done export TERM # Installing or upgrading? _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall, (U)pgrade, or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi @h 8`@#`3"" $@``T@1#H3b@%"@H*/+,2"c  0  "#,"# *,"# !`,"#@>> OpenBSD BOOT %s bsddevice[%s]: boot: open: %s: %s Booting %s @ 0x%x 㿘@4@- h@ 3!`L@ 3!313%3/+3)3-'3 5@a(@h $hh `@!@rM! 2%`@ P@iLP 2@B  Ȑ8@@@aBad format %d+%d+[%d+%d]=0x%x boot: short read x@s ;%?@ ?# @!2?3܀a"0?@ ?# @!2?%܀a""?@ ?# @! 2?܀a "?@ ?# @ 2 ܀`@"0@"?@ ?# @!  a ܤ` ܐ@܀?@@ ?# @! a "?@ a?# @!"  @ .@`@ 2.@"@?@k@2@ 䀤 .@?`耣 C.@ .`".`.`@`@Ő耢@F#2@ bܐ@  < b.@ .` .` .`b܀  ?`@2'@"@`? ? @3"@@"@o,c 2#3!@ b1  Ā 0@ː",? Ċ`Ī@` Ē`IJ@` @ dvma_mapin㿘? #@(1?@ #(1?dvma_mapout㿘 #@(1@#p1㿘@ " ْ㿘 @ʒ㿘1#H` @, "cp3  @/ #H $#H㿘1cH ? "cH,@}cpboot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s 㿐',@ p?73"(!' @@'@ p )32 @a-! 12p`#X@  23#X!' @h@#X'p@ 3 3 ȁ 2 3 Ё㿘3` 231"А#P"`"`"`"` "`"`" @`  "`Ȱ? 3  ?3 㿘  ; < 㿘 , @@B   @7"&  ?  promprom0㿘,#`2@2c  $  31 c`"3"!JJ`  -2*@3!@ (*`J@ @ *`  1cp3" J  *@J` )*@c 3`"!``%J@ -! @33 *:  d` s ahJ@h J@  h#aD @"hJ@  @Can't open device `%s' Can't open network device `%s' 㿘@0 ,#`  @aĔ8$` $`%32# `( $ 3`€   aD$` $`$@ @!p02@ $`&` 2!22,cP @А"V @Ɛ!0",c @,c4 @ , "cl#,`#x $$ 㿘#2c`   ``*  `c   '@`2`0`,6 * '@ 㿘  В& `& $& (   €Ӓ " '@ 㿘 ` @ 2# `( ( @0@ 㿘   2  @! $ ?2`$ *㿘2#` `0`4 㿘2#` `?`8 ? xmit: not a network device 㿘  ,`@!?Q@ Y`?㿘 ,;`€D㿐2 c` (`P#    #O/O O /O㿘㿐2# `      O ? X/O O /O㿐2#/  0T@㿘  㿘2#`t€㿘@,@㿐2c    #X# p@%x mac-address drop swap 6 cmoveX,#` #21 ##` 1   Њ@+`  .@ .` .` .` .` .`c` `€0 `@ c|@ielefdxyxdstsddevice_typeblocknetworkbyte㿘2#` !,`@@Xaа@a ' a@  @a   #`#N@J@2J`N` " 2 node %x property %s length %d > %d 㿘2#` € 0"@ 㿘1#ޖ ??" ,Invalid controller number prom_iopen: "%s" error=%d 㿘)2 쀢 ?N  @ 3"`p`p$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $` @T#+  " * @F $`0 "$`4 " @\$` @ 2 &  %  @*# 㿘#2`쀢  @ 4 "$` & 4$`prom_mapin: length=%dprom_mapin: invalid maptype %d㿘,# *`@ -!@b ` -,#        !@K` `,#@ ,# 8 <?*  d آ&@  ` ,#d@㿘?(1,12\&# H L` T ` X P d l$ p  t @2 .@2.1 @ ` J@(8(8    `J/`? `2A ` `!J@(8(8  . ` J J#   J@;..2J`;2 , `J@; @Є 8 <` CD001㿐@T( ( @`  -``( ( !@j     2` * @h * *` * +  *+`  h  @;(g 8@ @`-`  ` ΀ǰ    *` *   *  M `N JL *  2D     !*  *` * @*@  @  @ L  *  "M  !   L  *  2 M  : L  *    g2 @P``  `-`( U(  gh 8  *   *` * ƒ  @ @@ ˀg@+ @V   >>>&`>  * *`   * & +` * +   :>@^0  @X @U㿘  @N&  㷐 R@ N`@4 @H``@C@2 *@ `  @,  ( )􀢨$ 2@` ' 8'" w@'@@ @ B <@&hhB <@2&     ":?"   ? @ : ` :?  $2`"`"`  :`0 pؒ  @c@' 8 'pt@d ,  $ #`a#\b` @ ? 3 H "`؀`3@E  " Ȱ?㽠P  x@,  'P $` $` $`  $$` ($` ,$`@$` 8 t@ $`   h #`ab`$#\ @ ? 3  x 0  &,& &&& D& &(&$@㺈 ` ($a b ????#\#`  @k ? 3  `  dh@Ɛd .@  ?nfsread: short packet, %d < %ld 0  '  $  $  (  ,     $$L#`a $b (#\  @$ ,? L `" H3" Ȓ?@T@~0  #@w3 H"`Ȱ?㿘@w -3 "` 2" 6 & 2 ?  " $?!$ "  ?nfs_open: must mount first. 㷈2""`  @8  N  m `/2N N /" N a  0 ] @> x  <$N O  N  /  .ɔ A.0 0 2;@@ $+  (@;@O`/ @% x@! x  @ x N  &`  @ x@ x㿘  "& @ x&  nfs_read: hit EOF unexpectantly㿘' #3!3% @y   ݖ? `2  !D @X  ; B& > @ 2&     D  "; ?  ?  @ ;   `; ?  -0p( 4 2`:2` <"` @"`D :`0 㿐``@P 0@ `@`@o @͒ * @g   @%@ x ` *  d,  0 2 0 0@" x @ *  @`?``"? 6"?%` 0@9㿘 `  .` 8@ ^&  @   @`&@``@@6``,`G D& h`?  ,` @@!  @0$@     d ,  0 2 0 2 %@` ,`@@,`& 㿐   e<`P @@l 4`0*:  8  2`0 @8e<`0e<eD `L  Ȁ)n 2; @l`0$  " @'  `d  *  0 @'$ $  $&@&    b 8   @   " & 㿐`@͐  <@`@-5 2& :@ "   2  @  " *@B<@@` ڐ2 ``@Ӑ 㻀@  Ц @  &`@ @ $`   `  @2 %\F!T@  0@@eg0   @ t,   $@  '` L@  @5<`/2L@`L@ /"`L@"y   נ  / ``4k `L@  /`,@P谒 \,@+ W(  2LL@@  $H  E;@ E%( 8@ ="@ W 0 K䰒 *@ `  d*  0` @ O / ' 'ܒ L@  @   0@ P @ J@ G Ё㿘 &     . @ "  @ 50  .  "  @ *0 @ '@ $ а 㿐 @ Ɣ@&B<@@`@@ ``@0 2&     ":?"   ? @ : ` :?  2`"` "`:`0㿐`  8 `@@2.@``@.@+?) @ " " ""@@C <@  @@ @ B <@ rarp: bad socket. %d No response for RARP request 1 @ !J?  .@  7Ɛ(   , 4 , 4 ` 44 `~4 `4 `4 `b4 `4 #\"̐ .@ɚ @ !(? 32b( b(2  b( @ 0- ? @ -??"a( $`㿘- @ǘ 5㿐@ݘ3!"   5@2?@ 2?`(2?`&2?` 2 ? `@  ??bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d p k3"(1a"'А $  $ $ ''X@ג 2W?-`??"`4` $@!#`"#@ #\ @  !2@ S#<?#3!a@S!*`4a' @k2 6`@ :##?2'ܢ ܔ"""2a@ ?3"H2bXH@w  ?2@a ? ?  P2"2a''@H 2C?@ @? 2:?-`2?"`6 "&#`a#@b#\ @y   3 H"`Ȱ''@( 2?@J 2?#'@ ? ?㿘`&"@  &@  㿘`&@   ? & @ .@&  @""#d d " e" f" g"#" ?  +d +e +f +gd"@#callrpc: error = %d 㿐\@?<6   '?'?@ R?2ؐ '?` '?`@"آ"?'?Đ #`#` #`#`#\ #`a$ !@? 3` @``2"@ , (3 H"`Ȱ?recvrpc: reject, astat=%d, errno=%d 㿘!3$ @S 2"@ 2?`2 ?`` $ Ȑ!X@ ??"@?232`( 2  2 2 *?3  #  2(`"# " " " getport: %s㾐a"@3 o'?(' "p #\#` ""   6   p'0 #3!`@t"ؒ@ H$`Ȱ?  @(*`  bad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentUnknown error: code %d㿘`W1"p*` €10 1- 1* 81' P1$ `1! x1 1 1 1 1 1!1 !01 !H12 a` @Ґ8E8F8FL8FL8F48E8FL8F(8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8F@8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8F8FL8FL8FL8FL8FL8FL8FL8FL8F8FL8FL8FL8E8E8E8E8E8E㿘  ,  ". /.".+."&  "!"..ܐ 0א Ր ?Ґ 0ϐ @͠Lɠ *L0Ð 0 0sendudp: bad write (%d != %d)x&$`$` $`$`$`$`<* @ *@@ &  ,`,` 4` $`  $`@4`  6 4 4 `'`'` '`'&$`,` '@4` 4 쀣?&$`$`$`  $` -!    2`'!'ܐ@ܖ@՘( @? @7readudp: huge packet, udp len %ld x@Ԙް zހ( (  t?@so?2m?<@ 2f? 2b?6` <`\@u 2X? &T?``  2L?` &@  "@4  ` 2=?` 5` %@l"0? ,  $ $ ' '`'''4 @8  ?$$ $ $ $ $$ $ $ $ ` ??sendrecv: short write! (%d < %d)㿘\   )3 <+`% (?@ @a@|,`4 2  Ȁ   $$@Ӧ` l J` Є * (Ж  (8. 53 ".?" 8" ?#  0 `(?`d((  `d(h(*  ?#㿘@㿘2!A,@  .  @ 0,@@ = "@  0,@@ 2  0,@,@6 ` "@(* 8("@ Є (@ 㿐 "= N -N`$* `.! גN*`? @ . Ȓ?N*`# @ .   J `   `&     ,` ` `   ( `߀` ܗ(2 ?# : :* arpwhohas: overflowed arp_list! arp: no response for %s- @ - @  'h@@C`@ `   $@"@ƒ  .@ 7Ɛ(  , 4 , 4  ~4   44  4  4  4 hc4 j4 h $@#\ .i? h!'l"hl@ ` `4` 4`  $4`㿘-@r(㿐@3-" (2*?@ 2&?`(2"?`&2?`  @??- -*@ *`@ `@  ??㿘@ /`(+`&'` # `@z   `6`6`` ` 6``6``6`6` 6` 6`   .6`  `6` (@6`㿘 3` 3` 3`  .+`+`+`+`3` *+` ??㿘)  @,   -a@%  "` ?` ?72-H :  0 *@ `  *@`*@`2*!H" @ ` ?  2   㿘2a`'H'L'P'T 'X @"a`@H@# exit㿘#㿘3"0 , @` @ , 㿘@@㿘@ 㿘 < " ? 2  @13 D& @=  $  Ȑ `$ <?$ 8 D$ ?$  @`$㿘אԐ* А* ̐?. ?$`8㿘-!  , @     & &"   & L`?& & S`?   2?  ?B& 8     `* ??w?2? o  e  "  < Z   <  ?& 81.1.3㿘@В?.`,@ P2!h. `"  P @H?@I 8 `@ &`D&@a&`@0 @ `@ǒ P@)?㿘 3 "`?3"0. @ 2. !h @ D@@ P@ 㿘2!h.  8?? ?2$  ?$8$ L "88 @.  "@"$ $$$$ @  43 Ȁ`$<" $& @$$$<S < D!3$ Ȑ@ $ Ȁ $<D$@ #$8 H@ " $H H ?$88 @W$$  @ ؔ $H8 2  < 2  2L H@ Ɣ" $H&㾘 3 3"0- @2@9!h-  `L @?2+$`)'$`" ` 3f c3b @F ` 42$`@   @ ?L @`D P @MH?@ 8$@$`D$`@.` 4@ 1@ /@ f )`' a !ڒ: @3  Yd 4 `0 Y"`Ȱ??㿐3. "0 @@  3 ,"`" @ * 2`      3 "` B< ' 3 "`&?㿐3"0 @  `  ` 3 D"`$@$`$` 'ꮔ 83@`` / "`J ,`)$@&$` #l@  2" € ` `#l `" ` @3" $@?㿘3. "0@ @  3 "  3  Y :@B: Y"`Ȱ? ?   ` 㿘3. "0 @  @  3 $"`2  " @      @ $3" Ȁ`3 " Ȱ?2|( |㿘!2!'L'P'T'X$!|@L!|*㿘'H'L'P'T'X#Ԓ@ H㿘#Ԓ@8N@`N@`%` N@`|` *` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @L N@ @C N@ @: N@ 0 x  @, N@ % w ls8f8gh8g8hl8hl8hl8hl8hl8hl8hl8f8hl8hl8g8h48hl8hl8gx8hl8h8hl8hl8hH0123456789abcdef㿈 @A @,@ڐ  ?L?|/-\㿘-!` 2!x apJ@ #!xꉐ (@ @   @ *0   @ *`-ḔḖ ? * `:```? -a "a"    -Ḑ?"  Ḁ@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  J@   J@J`   J "  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2* ?: :  *2@ : @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@㿘 ?`2"`0"`"`   "` @} 㿘 ? ` $ 2`0 " $@7 $  (€ $ 㿘"M?N 12I?8 D?2 @? &  @& & ( $ 2  `& $   (  )& "  `"   "`  ( ?"  `  %# *@D  "` ?㿘 unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check㿘 "@?  "<? 7` ?? ` .#Г*` € %  $ $  @  " `$  "bH 2    "bh " `  $ $    $`*   &@ݒb`   &@&@  ސ? `$ $    * "` $" `˒  $ $    *` " $" `  $ $    *` " $"    $ $  @ ` " $ $ 0" "b $ " @?   " F"" s @ `  5"@ "@  a? `$ $    * "` $" `N  $ $   *` " $" `9  $ $   *` " $" `$   $ $   " $@  "b $  " " ??8{,8{8|H8|8|8}<8}8}8~<8~8~8088㿘    "#? ? @۔ 0  ? & 06 * ?$@ @U  "@ 㿘 A?`2@0;  "@"` 20?  -!  @`#@  ?( "$$$ "` $$ "@?㿘 " ?   ?  @     㿘" <&? 8`$`(€  2 ( @  (& 8& 0& & & 4   & <&`0㿘`  `( @ 2` *  `(% $ $`(`$€ 0`  `(  $ ($ ,$ 8$  `( `$€ $`(`$€invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeath 0 4@`  "? ,"` '$!l*` €̨?  *`` 4  `&  `-`0  `4 $@&إ4@@耢 & & & @&``$  &`&@& 4?  &4 &#&`4& & @&``$  &`&@& 4֔??  *`` ?#4* @  &#&`& & @&``$  &`&@& 4?`&  m p  `& & @&``$  &`&@& 42D  , ` 0 ( @ "?"`22 & 4@  0 4 "@ ,? ," ` 0 ( @ "?"`2 & & @&``$  &`&@& 4U 8o "@`%%@ &     &?  *``  ?, & 4   ! !& &`& & @&``$  &`&@& 4? `  `( & & & @&``$  &`&@& 4? &4&   2  @  "?  *``   *@ *`"  & 2  4     "* *`"  &  &   $ @  `$`(€ 2&  && & @&``$  &`&@& 4&&  4   ! @  1!#`0 @,  ]?  *`@ ,   *`    $@ * "  & T4    @  A?  *`@ + 4$@  4 @ ! @$@ 4 2!  `$€`( &&`& & @&``$  &`&@& 4'?  ( ? + "@ &  4   ! @     4  $ `#\#`&    `''#d@5!`$`(€ ?"&& & @&``$  &`&@& 4@؀ 2& & & @&``$  &`&@& 4ʔ?&& & @&``$  &`&@& 4@  @ 0 4@`  "? ,"   g&&& 4@ 4 0 0 4@& & @&``$  &`&@& 4 && & @&``$  &`&@& 4q & & @&``$  &`&@& 4c?& & @&``$  &`&@& 4U& & @&``$  &`&@& 4G& & @&``$  &`&@& 49& & @&``$  &`&@& 4+& & @&``$  &`&@& 4& & @&``$  &`&@& 4& & @&``$  &`&@& 4?@88,88888@88h8㿘. `( `$€ (`(`$€ $`(`$€㿘 ( (@& 0& 4`?w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-$"(`Y G8$( @0(` @(` @0(` @0(` @0(` @0(` @0(` @0(0` $( @0(`8㿘?6  ` W R !6& @`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ @β` @`@J#F#񀦠,` #+3;CScspp !1Aa  0@` 'H'X\H'L'P'T''''''''''''''''@(@`&@H X&#1 @  .@"@ * 􀠠  (`@"@8 # (.@@  ,`(`@??&@0 '48' - @ `  @ `.@(&@h H`@*@ @ h'H'0?'p  '(+ '$??Hh((+`', M+`$   % ` d#,@   @&@ .`@8, . ``dp&@&#//! $0@8 '.@&@&X& 4#/,@  /@L   `/@`'LT (P/@ P(@`'0@ (?  ?..`& &   (@" @6@2@ .@@? '  .@+`@?2[  H+ ` 2?oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths tree㿀   ( ' #?#d#`#\#h   z ??(  ' (@ 2 (( ' ? ( $€oversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengths㿀d !  ( `' R?&&8!#\#`#d#h! ?  ,??(!-$ +('!&&\#`#d0"#\#h  ? 2 (??(! $ ?("("($ ? ( $€0 ( $€ --"!-"@1"" 㿘 (    * * " " "invalid literal/length codeinvalid distance code㿘 0 4 @`  "? ,"@` +!h*` €)` '& & @&``$@&@&`& 4 ` ``@.` 0 4@ `  "@? ,": $@ ` `$` $`$@` 1`  *  1c+`@ ` * @  @$ 4  $`$@  @ $` $`$@_   $@)$@ H&`& & @&``$  &`&@& 4?` 1``  *  1#+`  ` ` `$`$ $` $`$@4 ` 1`O  *  1c+`@ ` * @  @$  4 $` $` A$@ @ $` * 8$`)$@ h&`& & @&``$  &`&@& 4M?` 1`  *  1#+`  `  $` $ $@4  ( `   ," "@` "$@27  ,  0 ( @ "?"2% & 4@% 0 4 "@ ,? ,"  0 ( @ "?""&  ( ,   (`? $`$@2D `  ,  0 ( @ "?"22 ` & 4@ݐ 0 4 "@ ,? ,"  0 ( @ "?"2 ` & & @&``$  &`&@& 4 (k$@ & 4?`@ 4 0 0 4@& & @&``$  &`&@& 4r $@& & @&``$  &`&@& 4b & & @&``$  &`&@& 4T?& & @&``$  &`&@& 4F& & @&``$  &`&@& 48& & @&``$  &`&@& 4*& & @&``$  &`&@& 4& @&``$  &`&@& 4& & @&``$  &`&@& 4?@888808,88888؝㿘`(`$€invalid distance codeinvalid literal/length code㿘04@`  , 1. .`( ` (@( @ @+Ȑ#` !h6 . !`  6@(  ` (+ @@#` !96` ( &@(  `. '!@ 6'/ / , @ &@?/ (/ X @2 `. `(. @@@1  3"` @ . `. @(@@ 2```!/6/ 1 ` @8.`!" "@'@`'@"@"`"`"42 ` "`@8.`!" "@'@`'@"@"`"`"4? C `1  @8.`!" "@'@`'@"@"`"`"4 㿘 4 0@`  ,"` " `"&`&` 8 <& <&`0 ,@@ ' 4  (& 4 4`"   " `"&`&` 8 <& <&`0”@&` & 082868687`87h8788!8"8#l8#t8#8(8+08+x8,48,<8,8 88 88 8 8@8 8T8 8888888   8x@` 0123456789abcdef/8ΰ inflate 1.1.3 Copyright 1995-1998 Mark Adler `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`??8 8B8[P!84- 8ɀ58m:8C8r(I8IR8[8 f8$ u8k@z8 8 8T8=8 8Ʉ 8Ɉ88w8t 8ɐ8|8>8+8-88QhB8K 8X8t_8Rj8pr8|}8L8N8p88V8J88(8O\8z 8e 8!8+8 88B8+0M8r(T8e\8Ug 8t8!8 8P8B8q8'$ 8X8?488 888U8X`&8C/8p<8$J 8S8&Ha8+xk 8v8Pd8@8,<8 88(,8#l88T8,8ix89H88" 8X*8 9 8`H8 T8c8X@l8v886 887h8D8Ex88P888W 88f8788-8?@8U8k@[82e8pu8xx88x88@@888m88 8h 8p8 8̨'8i/8,4:8 D8Q8cY8?l8it8( 8̬8d88;88#8 8̰8W8888W8"8 ,8 &8#t38=8D8R 8̸Z8ba8ph84r8VT}8 8x8888|8\8\88B87`88 8 8" 8@(8Op/8 58l<8WB8LH8k(N8M,X8_8_ 8Df8\(m8 8H848jp8H8 8P 8ΰ888G8r 8 8h8a 8͠ 84 8z$ $8 0 8ͤ @ 8ͨ F86 Q8L a8$ q 8( w 80 ~8x 8 8 8 8 8 8 8 8 8 8 8 8 8 +8H 78  C8  R8  d8P p8 z8 8 8` 8p 8 8 8 8ǀ 8 8Ǡ 8 8 8 %8` 78d D8 U8x _8x n8x 8 8$ 8- 89 8; 8@( 8C 8D 8G 8H 8Qh 8R@ 8U 8W8 8W 8W 8W 8X@ 8a 8b $8c ,8d 48e =8i F8i O8jp W8k@ ^8m d8p m8p v8p ~8q 8r 8r( 8t 8w 8x 8 8( 8 88 8 8 8 _getsecs_rpc_fromaddr_open_dvma_mapin_gateip.rem_adler32.urem_sendudp_getprop_netif_put_nfs_getrootfh.div_devopen_socktodesc_obp_close_bp_getfile_inflate_codes_new_bp_server_addr_strtab_inflate_codes_free.umul.udiv_hostname_getchar_xdr_string_encode_inflate_trees_bits_nfs_readdir_in_cksum_pgofset_hostnamelen__udiv_arpwhohas_strcmp_net_close_inflate_trees_dynamic_inet_addr_strlen_inflate_set_dictionary_ether_sprintf_readudp_inflateSetDictionary_nfs_open_inet_ntoa_inflate_sprintf_netif_debug_freelist_netif_close_net_open_nfs_close__urem_printf_sendether_file_system_cd9660_close_inflate_trees_fixed_swapip_rpc_pmap_putcache___ashrdi3_nfs_readdata_domainname_xdr_string_decode_ufs_readdir_putchar_inflate_copyright_arp_reply_zcfree_strncpy_netdev_sock_nfs_lookupfh_rpc_xid_nfs_readlink_nfs_read_strtablen_ip_convertaddr_obp_strategy_nfs_seekstart_nfs_root_node_nfs_mount_cd9660_write_inflateSyncPoint_prom0_iclose_nfs_stat_twiddle_rarp_getipaddress_hz_getdevtype_rootip_net_mountroot_rpc_pmap_list_prom_ioctl_inflate_codes_zcalloc_rpc_port_obp_xmit_ufs_read_promvec_ufs_seek_obp_recv_strerror_prom0_close_file_system_nfs_inflate_flush_arp_num_closeall_bootfile_vprintf_ufs_stat_prom0_strategy_prom_getether_xdr_inaddr_decode_inflate_blocks_free__div_ufs_open_nfs_stat_types_inflateEnd_netmask_inflateReset__rtt_rpc_call_inflate_blocks_sync_point_file_system_ufs__rem_dvma_init_dvma_free_prom_boothow_prom_si_getpropstring_prom_bootdevice_memset_nfs_write_rootpath_cd9660_open_olseek_xdr_inaddr_encode_memcpy_get_crc_table_nameip_oclose_inflate_mask_bp_whoami_cputyp_cd9660_stat_pgshift_rpc_pmap_num_memcmp_prom0_iopen_inflate_fast_panic_cd9660_read_netif_open_prom_open_cd9660_seek_peekchar_etext_donottwiddle_ifname_oopen_bzero_getticks_readether_prom_init_inflateInit2__inflateSync_ndevs_loadfile_dvma_mapout_read_inflate_blocks_reset_arp_list_rpc_pmap_getcache_ufs_write_prom0_recv_errno_sockets_esym_intoa_nbpg_nfsys_exit_main_free_sendrecv_lseek_debug_close_inflate_blocks_new_domainnamelen_crc32_alloc_edata_cngetc_fbuf_end_dvma_alloc_bcea_gets___main_netif_get_version_oread_prom_bootfile_file_system_cd9660_inflateInit__prom0_xmit_bp_server_port_dbuf_ufs_close_inflate_blocks_cd9660_readdir_myip_files_devswsrt0.oboot.ogcc2_compiled.___gnu_compiled_cconf.ogcc2_compiled.___gnu_compiled_cdvma.ogcc2_compiled.___gnu_compiled_cnet.ogcc2_compiled.___gnu_compiled_c_open_countnetif_sun.ogcc2_compiled.___gnu_compiled_c_netif_prompromdev.ogcc2_compiled.___gnu_compiled_c_filestore.9_boos@$@P rHP lHP hHP dHOHiHP XHP LHP RHP LHP HHP DHP @HP |HP ?xHP @tHP ApHP BlHP ChHP DdHP E`HP F\HP GXHP HTHP IPHP JLHP KHHP LDHP M@HP N |HP ? xHP @ tHP A pHP B lHP C hHP D dHP E `HP F \HP G XHP H THP I PHP J LHP K HHP L DHP M @HP N |HP ?xHP @tHP ApHP BlHP ChHP DdHP E`HP F\HP GXHP HTHP IPHP JLHP KHHP LDHP M@HP N;;;;; ;(;0;8H )@`  >! !7 >00+0;"+,+0΁`#@ 0΁1 !>&;8>0)@09`")@)@0΁`# 0΁1"; > 9`9`9`9`9` 9`(9`09`86`@!`xH )@` !!! P -@ @ @"P/> P-> %)>Ш x %"+/> ->+cP>"`""#t@>͐ ;x ;"`;" @a@Ҋ@@2 @ 0P -@ @ @"P/> P-> %)>Ш x %"+/> ->+cP>"`""#t@;x҂@ ;Ԃ@`;"k  ւ@ ؂@ " +?P `* -` @t x ``-`ā @  tx  )>!4@! P-> %)>Ш x %"+/> ->+cP>"`""#t@;x;;>!<!@ ;`#h#l;;;;@``htxs ;`#h#l;;;;@W``htxZ )>)#D@)>)# P -@ @ @"P/> P-> %)>Ш x %"+/> ->+cP ;`@;h#t;x;;;;;`@ ;`htx />->+cPۜP -@ @ @"P/> P-> %)>Ш x %"+/> ->+cP ;`@;h#t;x;;;`;;@b;`htx́ -?P -@-P -@ @ @"/>/> />6PP-> %)>Ш x %"/>/> />P;x>"`""@;,/,;@ ;`,)>Ш!;h %)>>" #p "`@ x|  +?P`-@-?P- %0P -@ @ @"/>/> />6PP-> %)>Ш x %"/>/> />P;x>"`""@;,/,;@ ;`,)>Ш!;h %)>>" #p "`@   @@`x P -@ @ @"/>/> />6PP-> %)>Ш x %"/>/> />P>"`""?P * * ;`@;h09P -@ @ @"/>/> />6PP-> %)>Ш x %"/>/> />P>"`""?P * * ;`@҂@ Ԃ@;h ւ@ ؂@@`h ?P `*  P -@ @ @"/>/> />6PP-> %)>Ш x %"/>/> />P>"`""?p " ?P "  ;`@;h@`h ?p " e @/>  @̀-> $)>Ш x %->+cP->Ь NP @ H ,@`#>`$` (08 @̀=)> 00+0;"+2+0 `# @ 05-" % >&q 8 >0-@0=`"-@-@0 `# @ 05-"U  ->%- +cP ;`@;h #t;x;`;;;;@ g;`htx ->& 0! H,@` !`hpx (08@HPX @̀H,@`%> $ (08 @̀@ @̀  H ,@`#>`$` (08@̀42O?@ @̀='>00/0?"/2/0 `# @ 05-"$>& 8>0-@0=`"-@-@0 `# @ 05-"  ?  H,@`#>` $` (08@̀ ->Ь  @yP->"/>?4  ! H,@` ! (08@HPX @̀>Жx `?* `"" * `@">Ж  * `@&* *  ֊@* "``'1@'0@ )>+>%@#'$(  В`Д Д  c  mt@ >   >  @@   >  @@ #>%> `@%  '`@`@ 7  '`@`@ 0, *H Ѐ(H+ `!Ђ* ր  Ԡ҂2`*`D4`@ D֠ 0 !Ђ* ҂2`*`D4`@ D>%b@>" >" ( *>" ,!`>" 0H(  /  > ==>ϜPH >" 4>L#> c@vP"@!>$#H``>"b$  !>%#!>'"0$ $ >%# 2> " > " > "!> "!(>#"">#"">#"#>#"#,>$"!>$"!>$""D>$""l>*" ,>*" 40>+""@Y@d#@+`;h;p;x;;;;;;;;;;;;;@L@P@ `hpx gP   d#@+`;h;p;x;;;;;;;;;;;;;@H@@ `hpx d P    ">> >  ">>@ >  >&c # J@*@`  ?"@ 2"#   "  ?J*@`8  ?"@ 2"> * >Ё >@ *>Ё >&#Ď@" >" >"   >4``6 >` >Ў  !!`>ǜ @ǂ>!`"!>"`"" >ʈ >>!`2$j0>'@  >'@  >'@  switch rqswitch wchanswitch SRUN> >: H>" (o!`j> !>:">*"2J "2 J    "2 J  J " >՚b+  @ #@"   *@ * lH1 >"",$ `!"I"j > ܒ`" ܝj ` *@  ( !>!x` (08 2㿠@>`` Ъ@@>`€"Т@: H"  h `>   >>'" " " ?" ?> >>'" " > >>'" " > >>'" " > ؀ >>'" "" > >>'" 2" > >>'" 2" > >>'" *" >>'c" `2 `2`2" >>'c" `2*`22`2"" @>'c" Њ@" " @""@" "`""@ 6 :@ 6 `6:   6  J?*@``";" " J `*"J*@ `"" "R2@ `4"R2@ `"" ""@ `""@ `":@ `""@ `R2@J *`2J*@   6 " J"`*@`"(" " " J"`*@"" J"`*@"" "" R"` 2@"" R"`2@"" "`"@"" R"`2@2J?*>`>)` #` 6 J *@`#`  `"<" " J *@`#`  "J *@"`" "R 2@`8"R 2@"`" " "@`" "@"`  :@ ` " "@` R 2@J *`#`  2J#`  *@#`  #`  H@ `*  @ : " : : : : : (: 0: 8: @: H: P: X: `: h: p: x 2@ *  @ 2* H@ `      ( 0 8 @ H P X ` h p x 0000H ?P *H ?P +*?p` "@?p`"@@* ?P` <@ "@$@% #@%"$@% #@%&؃%"@ւ"%ւ"&؃"@  >* "2 J "2 J   "2 J  J  @ @: `  : `z Z@  r R@  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@a>` """"""""""""""""@2?# * 2  `c  @ `> ? @ 3 >!\ c@  Њb@&""""  >a@ @>b$ ``44: " longjmp botch@" `&"`㿠>+@"6 0drivevectoffsetslotluntargetphyleveladdrstates=> GOT_BUS GOT_TGT SENT_CDB XFRD_DATA GOT_STS GOT_SNS XFR_CMPLT status=> Disconnect Sync_xfr Parity Bus_Reset Device_Reset Aborted Timeout Negotiation%s Config WaitWaiting for AL_PAWait LoginReadyLoss Of SyncErrorRe-InitNonparticipating0x%xPort DiscoveryWaiting Port Discovery ACKPort LoginWait Port Login ACKProcess LoginWait Process Login ACKLogged InPort UnavailableProcess LogoutWait Process Logout ACKPort LogoutWait Port Logout ACK%s %s index %d: %02x 2X001240%s: bus %d is in %s Mode 1280108012160LVDDifferentialSingle-Ended%s: unknown mode on bus %d (0x%x) %s: unknown chip rev. 0x%x- assuming a 1020 10201020A10401040A1040B1040C%s: Differential Mode %s: Ultra Mode Capable chip reset timed out%s: MBOX_BUSY never cleared on reset NOP test failedMailbox Register test didn't completeRegister Test Failed%s: F/W download failed at word %d ram checksum failure%s: skipping f/w download failed to set clockrate (0x%x) could not get f/w started (0x%x) %s: Board Revision %s, %s F/W Revision %d.%d.%d loadedresident%s: in 64-Bit PCI slot %s: Last F/W revision was %d.%d.%d %s: could not GET FIRMWARE STATUS %s: %d max I/O commands supported %s: can't setup dma mailboxes %s: WARNING- cannot determine Expanded LUN capability- limiting to one LUN 㿀 .   ̐ 2`. Ѫ`2   `@  7@@2  6 6 6   &  `    `@ Ɛ ` >, ``"P`  2  1** `  <.   " " O d . ΀ 2  `v€a i"d"  ƀ@2    $ ƀ   2  av€a i d" r @2o   d$ @ €  ?`*`>0! €>,"@    (   (     <. .  `v€!@ @*@$@ ` € ̑* 2``2   @ $@ < . ΐ @  @ *@$@ .`"   ΀@: /.   `" Ɵ@ ƀ  `   d !   "   B    `   d !      @   `  ` #֐ d? >, ƀ   @€  "  0 @€   ƀ   `   `   % @ d ƀ 5  `, @€ * 2 `  !  @€  * 2 `   @@€ * 2 ` @  .    0  `@   ` @ #V d?  >, @€* 2   @7>,@Qc0 ƀ ?7b </)!777777@耢>,@2c07"@>-/"@>-?#@>-!@>-)!@>-@`0 `   π  "1 $`       %, 7&7 @ @m7耢>-   7&7@^@ >-@Ԓ`@0 >- X@N   7`& "7@D! ƀ   ΀  477@5@>-@- x 7@)>- @ 0L Ɛ  @€ 6 6 6  7@ 耢>-*!P@p6  @ >-! р`  .   ƀ  & @& Ȁ  >- & Ȑ@]c0 #@ڒ 0 @֐! & ȁ$,㿘@  ƀ   2 Ɛ@  Ɛ @m0@h%s: failed to set retry count and retry delay %s: failed to set asynchronous data setup time %s: failed to set active negation state (%d,%d),(%d,%d) %s: failed to set tag age limit (%d,%d) %s: failed to set selection timeout %s: set of response queue failed %s: set of request queue failed %s: cannot enable FW features (0x%x) %s: enabled FW features (0x%x) 㿈    2 ̠  ̑2     `. 27 ` 7 `  7 7 @(7>0" 67@2` `72 @7耤>0}"H 57@2`2` `@ 722   @7耢>0@23 23 "x    `@  37 `7 @7耤>0 `" @ג 0o 17`7 @7耢>07"@  ƀ   2 @     777777@>0#   !77776 77@耤@>0#8@ 0(6  ƒ J Ԑ?6 ֐ 7耢 7 7 Ɛ?  7ꀤ  @u耢>0#`@l  ѐ  . с%s: cannot set initiator id on bus %d to %d %s: skipping target %d bus %d settings %s: failed even to set defaults for target %d %s: failed to set device queue parameters for target %d, lun %d 㿈.*   *  07@@.  7 @@ >1@#H @ 0 - * @ `&  ̀  >1#x @? 8  @2  4! >@ *`*  @@ 2? #1aͿ#..- @@ *  8@777  2*@ 7@ǒ% 1!777  2`*` 7@耢>1# @- #Д@ '@* @ w2 Ȁ   977`7 2 @7@>1 Ƞ   m- %s: bad frame length (%d) from NVRAM- using %d %s: bad maximum allocation (%d)- using 16 %s: bad execution throttle of %d- using 16 %s: INIT FIRMWARE failed (code 0x%x) 㿈 # `@i0 , 4 ƀ 2 ǀ (4D?!4  * *`   44 4 π `44* 2 '@ 4>2 "@$$4*`  4>2 @#( 4  4>2  @#X 4  <,  k4, ,@"= ,+ 3`,+ 3`,+ 3`, ,3 ,3 ,3 , ', * 2`, * 2`, * 2`@ , , 2 , 2 ,  2 , ?ؐ*@4! 4$4& 4( )>24* 40 @542# x$ `7777777@7  @# @# `6  6 6  ѐ  .  ђ `` . с ? (? (%s: DMA error getting port database %s: Param Error on Get Port Database for id %d %s: error 0x%x getting port database for ID %d 㿈  d7.`#7c7 77@(7 @ ">34 @ >3耢@>3c  Vt  @ #p? ̀ (?>3# @? #@?㿈.` j7耦  7`7 @@3   3 3 *`*-5,`4      5`-    -4,  -`,  6    F Port (no FLOGI_ACC response)F PortN-Port to N-PortFL PortPrivate Loop%s: Firmware State %s -> %s %s: GET LOOP ID failed %s: Loop ID %d, AL_PA 0x%x, Port ID 0x%x Loop State 0x%x topology '%s' (  p @@ 2  [>4"x  >6 * €>, >, >, >, >, >,!>, !>, !!>L#>,a(@p@2  >5#* €>, >, >, >, >, >,!>, !>, !!>L#>,a(@F@`2`@2   " @t d d@2    ?7@@>4 @"?/` ƀ` 2 @ 8 @ *  @'@ ?'@@ ?2  `/``'@ ~ 2@ ƀ @ ? '@ *`@  '`'@-,`+`(  5   @ 6`.   @-5`- .`-`    k? +`(  ,`5- @  6`. @-5`- .`-`    ? k 0* * @'k@* *`  ' /kk   'k@@k *'k'`'@ (4@LX\htӀӌӘӤӰ   `2 `2  @?  %s: giving up on synchronizing the port database %s: Target ID %d Loop 0x%x (Port 0x%x) => Loop 0x%x (Port 0x%x) %s: Target ID %d Duplicates Target ID %d- killing off both %s: remap overflow? %s: retained login of Target %d (Loop 0x%x) Port ID 0x%x %s: Logging out target %d at Loop ID %d (port id 0x%x) %s: Retaining loopid 0x%x for Target %d (port id 0x%x) %s: command error in PLOGI for port 0x%x (0x%x) %s: could not get PDB for device@port 0x%x %s: PDB loopid info for device@port 0x%x does not match up (0x%x) %s: PDB port info for device@port 0x%x does not match up (0x%x) %s: Target %d (Loop 0x%x) Port ID 0x%x dumped after login 㾸'D ' 'H@@2      ~'' ~' ( @e/ '@ ܒ *` * D'$@ 9 2   -$  @' D.  9 2   $  @  9 '$D' Ք$   2   M?2   @  }'`D>6 @7? +`(,`  5-   6`.   @-5`-   .`-`    9 +`(  ,`5-  6`. @  -5`- .`-`    9  0* * @'H`* *`  ! /H'$*@ *``(F $@ ' @ ('?@c'#@' `(+l@ *` *  ( @ " (}  @'?#*` *  ``  @  (@ " ('8 >6*` *  ` u+` *  @mi@ (  D ,#\@@*` ** @  *` "`,*`(+  * ( "( *` * } @  <"(,* ? c3>6* *  @2   2Da@*` * ( "( ( @$ (  }ܦ  `}' }^+ @ `8*`     @ `~``}@2``~2 'D>6@!P;'*` * * (0* ** @  *` < +  *   >@+  * `( @D  #`(*@ *` `#`( #`,@&6 @'@ *  ( %?ؒ"@ *` *  *  *    2   @ < 'D ' @&   @c     (:U  ', @E '|@@2  Ӕ D'  , 'T'd'D'l  ?h'L't?Ht?pT'\?Pd'<l?`6 D--`tL?@  6 @ *h H\+?Xd@0D. 0`@* <(@ ?8l@.* <83* d.`+D  @+ @ L  \X@<*`@ *+2@@\@@@@.  @  @ 0  3@A@* *`   27 23 2/ 2+ @2'2` 2!@@ D! ̀`}?ؐ"* * ** >6 !h:@*j?ؑ2 '0 +'4 q7 *D' 77@7 *@!D ̀`& *` ** *  >6D' !:@` 0#* *  *  *  : ')| ',6  W ` oD7` |*`777`7D' @4?@` 8 >;"*` €0 +D `̀ '0" * * **   D>6' !:@`  !` )D>6' |@" !'  ``D' L   D>6 "P@z   >6 D' "@m * *`    D 0*@ * ! +`(,`  5-   6`.   @-5`-   .`-`    9 +`(  ,`5- @  6`. @-5`- .`-`      @#9   @0&* *  *  *  @ !: 'D@#В !>6' "@ڒ  @*@! >6 #D' @̒` q 7 * 747D@7 (,*  ($\x%s: SNS failed (0x%x) 㿈 ## !@` !04`4`a4  !2 4 4 !4 4 4  n 777`77@u7"  ̀ >;"@@h ? *`* @ @  @#K  ?`2"  %s: adapter not ready %s: unsupported cdb length (%d, CDB[0]=0x%x) %s: target %d is not a target %s: Request Queue Overflow %s: Request Queue Overflow+ %s: out of xflist pointers %s(%d.%d.%d): START cmd 0x%x datalen %d 㿀*@ $$, `ё2   >;`@#  `ƒ ,42  >; @#@` $, d ``P ``} D$, ?2`  2}$:$,2   c@F   2     $,h g d ,E  ,*  ( 2`  2` 2 `̀ >< `@ $,n d `р "`@G``€4``7`7*`  7 @  77 `̀ >< ( `р i `ƀ       Z) `ё2  : N@_/ @ .   , , 4 ,`̑2  2 ` ,  ,, , `̑2  "` , , `` `4`@€ 4``7`7*`  7 @  77   `̀ >< H @^ޒ @ ,  `Ɛ   ,  ,,, ,  `Ɛ  , $(J`  `* @`"   "  4   d, `ƀ "` ,  4   4 ,  @\j#* `4   4  `р "`   4 `Ę `ږ    `쀢 "   *@`22` ?*"@ `Ā" 4`ڐ " ` `̀ >< h@_` $,= e @ f"$, `.`Ā@*`* &"@ `̀  ><` `2 $  #\@4`` `4``Ґ 4` `р`  f `ѐ ,`Ѱ f%s: isp_control unknown control op %x isp_control SCSI bus reset failed%s: driver initiated bus reset of bus %d %s: isp_control MBOX_RESET_DEV failure (code %x) %s: Target %d on Bus %d Reset Succeeded %s: isp_control- cannot find command to abort in active list %s: command (handle 0x%x) for %d.%d.%d aborted %s: command (handle 0x%x) abort failed (%x) 㿈>?!* €>>K h Ɛ 7耊`7 `7 7 ƀ @  7 7  ѐ *2 ѐ *  `@. ѐ@ @2>>@`?@?# :., @  777@ k>> @b ?>> ! @Z ѐ *2 ѐ *  `@. y ` `  Ĕ   *@ * `2` >>!P@1 [?  Ɠ2` `7 Ȁ , 7777,   7.* @ 76`77@   ̀ >>` `! @# >>! @ @  Ɛ kc@  Ɛ w??($4\%s: isr unsteady (%x, %x) %s: sema unsteady (%x, %x) %s: isp_intr isr %x sem %x %s: mailbox0 unsteady (%x, %x) %s: Command Mbox 0x%x %s: Async Mbox 0x%x %s: interrupt (isr=%x, sema=%x) when not ready %s: mailbox5 unsteady (%x, %x) %s: null intr- isr %x (%x) iptr %x optr %x %s: not RESPONSE in RESPONSE Queue (type 0x%x) @ idx %d (next %d) %s: continuation segment %s: internal queues full %s: bad header %s: bad request packet %s: unknown flags in response (0x%x) %s: bad request handle %d %s: NULL xs in xflist (handle 0x%x) %s: check condition with no sense data %s: unhandled respose queue type 0x%x %s: cnt %d rsd %d %s(%d.%d): FIN dl%d resid%d STS %x Skey: %x BUT NOT SET XS_ERR=0x%x 㽈 ƴ >    € @€ * 2 ,`2  $  >?!@    € @€ * 2 , 2  ">?$ >?!@ɒ    € @€  ̀  >?,`, !22@  Ɠ,` 2` ` `,`   `,  ,  y2.   € @€* 2 , 2   $ >? @x" `    `@i @€$,  Ѐ6 ܤ   ܢ <  @€5  `.  ƕ, >?"(2@@  ơ2 @ ̀ >?"@@1 `@  Ɛ 2  ё2   2  ё2   ">?5`6` @"X #` €* 2  `   `@ `     ؀`+7 )  € @€ * 2 ,2 @$   `@>? "@ϖͰ  ` €5`  `    `@,2 @ 5 @€  ̀  *>?"6`2@ 5t+  ̐ , 2`@7`   @ , ,@  , ,  @ @\ O @ >?"ؖ@l D   .   ̀ C>?# @\ ? "  ̀ >?#@@Q   >?#`@J    >?#p@B   >?#@:    @ >? #  * ?`>? #@ ``  *2  * "@   `  2  d   ѓ*  . р  $`, ,`X ƀ ",   `4N  $`,  ":`,` `$ `*` *  @ " `   d   ѐ  . `," `  8  !`4 $`,  4 2 `, ̀ >?#@ﭒ `, 2 `X 2  $`, `, 2!  @B  >@   (,`X$`,`,  @ `,`2 Ɛ $`, ƀ "  $`(("`$ $`( ̀`>@`$ H @h `$ "      ̀  $`,  ` >@` ```$ `X`(#\@G  @">@ `6>@@? `,`">@>@@8 >@`,@4  Ҁ - Ґ?6 ғ-" 5 !     €6  6 ؀ ,`"@ΐ&, %s: Internal FW Error @ RISC Addr 0x%x %s: Request Queue Transfer Error %s: Response Queue Transfer Error %s: timeout initiated SCSI bus reset of bus %d %s: device reset on bus %d %s: extended message underrun %s: SCAM interrupt %s: stalled SCSI Bus after DATA Overrun %s: SCSI Bus reset after DATA Overrun %s: Transition to LVD mode %s: Transition to Differential mode %s: Transition to Single Ended mode %s: Transition to unknown mode 0x%x %s: fast post completion of %u %s: CTIO done %s: LIP occurred %s: Loop RESET %s: Port Database Changed %s: Point-to-Point mode %s: Point-to-Point -> Loop mode %s: Loop -> Point-to-Point mode %s: Point-to-Point -> Loop mode (1) %s: FATAL CONNECTION ERROR %s: Looped Back in Point-to-Point mode %s: unknown async code 0x%x 㿐 ƀ   2 ' ` €* 2 ' ` @>C7``@" ` `@"r  `@͐`@W>DŐ (@p>C`@n>C>D@~>C ` `@l`@o>D (@r>C` @p>C>D@>`!`@ ``@"c `@" >D@`@>D@>C `0`@,` @" y>D@1`6@"L q>D ѐ 2*   ѐ *  `@. ѐ @d`€* >C 2@톐 0HM!K!0`€M>C @u!X0d>C @o!0^6!4!2!0"`€* 2 @h" >C4d.>CA"@=>C>C @L"8  *# * "  -" @9"X   " * # * ">C @%"  *@"  " * ""@  ѐ 2*  ѐ *  `@. ְ#`€ @€`*  ͡, 2 `à>C"В @"`€ 2`  "  xa" є . k ̀ >C# ѐ  .  "  xaV">  ѐ  .  "  xE"-  ѐ  .  "  x4">Ca# ѐ  .  xb&" ̀ Z>CP#(   "@j L @  ?  "@ >C  . #H "   @]#.`€* 2 `">F (*` €>C#h>C#>C #>C @>#@  ?>D @6  ( @0%s: unhandled response type 0x%x 㿘@>F @ @?%s: Selection Timeout for %d.%d.%d %s: command incomplete for %d.%d.%d, state 0x%x %s: DMA error for command on %d.%d.%d %s: transport error for %d.%d.%d %s: bus reset destroyed command for %d.%d.%d %s: command aborted for %d.%d.%d %s: command timed out for %d.%d.%d %s: data overrun for command on %d.%d.%d %s: command overrun for command on %d.%d.%d %s: status overrun for command on %d.%d.%d %s: msg not COMMAND COMPLETE after status %d.%d.%d %s: No MESSAGE OUT phase after selection on %d.%d.%d %s: EXTENDED IDENTIFY failed %d.%d.%d %s: INITIATOR DETECTED ERROR rejected by %d.%d.%d %s: ABORT OPERATION rejected by %d.%d.%d %s: MESSAGE REJECT rejected by %d.%d.%d %s: NOP rejected by %d.%d.%d %s: MESSAGE PARITY ERROR rejected by %d.%d.%d %s: BUS DEVICE RESET rejected by %d.%d.%d %s: IDENTIFY rejected by %d.%d.%d %s: %d.%d.%d had an unexpected bus free %s: HBA attempted queued transaction with disconnect not set for %d.%d.%d %s: HBA attempted queued transaction to target routine %d on target %d, bus %d %s: HBA attempted queued transaction for target %d lun %d on bus %d when queueing disabled %s: invalid IOCB entry type detected %s: internal queues full for target %d lun %d bus %d, status 0x%x %s: SCSI phase skipped (e.g., COMMAND COMPLETE w/o STATUS phase) for target %d lun %d bus %d %s: Auto Request Sense failed for %d.%d.%d %s: Wide Negotiation failed for %d.%d.%d %s: SDTR Message failed for target %d.%d.%d %s: Bad LVD condition while talking to %d.%d.%d %s: Port Unavailable for target %d %s: port logout for target %d %s: port changed for target %d %s: port busy for target %d %s: completion status 0x%x ` `+t>K!*` €` b2  ̀  >F ` 3 ` `@9 b +``>F`2 `   @,3`U  >F`l  >F` `2 ` @!>+H c/H * *` 2 *` !OH>+#`  J 2 * *` 2 *` "OH>+#`  J 2 * *` 2 *` $OH>+#Ѐ`  J 2 * *` 2 *` (OH>+#`  J 2 * *` 2 *` @OH>+#`  J 2 * *` 2 *` @OH>, `  J 2 * *` 2 *` @OH>, `  J 2 * *` 2 *OH>, `  J 2 * *` 2 *` OH>, 0`  J 2 * *` 2 *` OH>, @`  J 2 * *` 2 *` OH>, P`  J 2 * *` 2 *` OH>, X`  J 2 * *` 2 *` OH>, h`  J 2 * *` 2 *` OH>, x`  J 2 * *` 2 *` @OH>, `  J 2 * *` 2 *` OH>,  ` J 2 * *` 2 *H>,`@e  ̀  >F `!8`2 ` @V   2  d   ѓ*  . ђ q&, >F`!h`2 ` @;   2` `$`` ѓ*  . #  ̀  >F `!2 ` `@ G  Ɛ " `>&(>F` 2 `!`@  4&, >F`J! >F`E" >F`@"H >F`;" >F`6" >F`1" >F`,# >F`'#H >F`"#x >F`# >F`# >F`# >G`  Ɛ "&,`4&( >G` P2 ` `@絔 ސ  >G` 3 ` ` >G` >G!P@硒 ʐ  ̀  >G `!x`3 ` X@瑘 X  &, >G`{! >G`" 2 ` `@| 0 >G`"P`3 ` @q  ƀ`"&, `$  `?ȑ*` *  *@ 2  `* *  @ "    d   ѐ  . r&, >G`"`3 ` @<  ƀ`c  `$  `?đ*` *  *@ 2  `* *  @ "    d   ѐ  . <  >G`"3 ` `@ 0  ̀ >G `"@ %  ̀ >G `#@   >G`#0@  &, >G`#P@   &,>G` #p@ؒ  &,* 4 H'P'(0(l(((() ) )4)H)\)p))))-h-h)**4*H*`***+,-h-h-h-h-h-h,,- -D%s: command for fast posting handle 0x%x not found 㿘`2 Ā  * ? >K"@@慒 0 *2  * "@ $$ (  , X  @4 Ҁ  Ґ?6 ҁ%s: unknown command 0x%x %s: no parameters for opcode 0x%x %s: mailbox timeout %s: mbox cmd %x failed with INVALID_COMMAND %s: mbox cmd %x failed with HOST_INTERFACE_ERROR %s: mbox cmd %x failed with TEST_FAILED %s: mbox cmd %x failed with COMMAND_ERROR %s: mbox cmd %x failed with COMMAND_PARAM_ERROR %s: mbox cmd %x failed with error %x 㿘 Ɛ >՘# >՘#( ^@ `>K6@#P Ƒ,  ``2  ?  `  ?   ܀  `>K6@m#p   --" 4@ `@@4@5@  ` .  `@ u    ! Ѐ   Ѐ >K#@呒    *" @ 2@  `@? ` &>L#*` € ̀ +>K#>K#>L  >L  Hd)j>L x @Z0* 2**>L  @J23333$3x303D333couldn't GET FIRMWARE STATUS%s: %d commands on completion queue couldn't GET DEVICE QUEUE STATUS%s: lost command for target %d lun %d, %d active of %d, Queue State: %x lost command㿀 7@>L@yc0/ꀢ>M @ `&` " 7* 7耢>M@Z`00` >M` X` #\@>M@J`%s: %s biu_conf1=%x biu_csr=%x biu_icr=%x biu_isr=%x biu_sema=%x risc_hccr=%x cdma_conf=%x cdma_sts=%x cdma_fifostat=%x ddma_conf=%x ddma_sts=%x ddma_fifostat=%x sxp_int=%x sxp_gross=%x sxp(scsi_ctrl)=%x mbox regs: %x %x %x %x %x 㿘>M !@} ƀ`!>M  !€* @o2`  !>M !؟€* @b2` %>M € * @ €4` * @4 € * 2 @G !>M@) @"€* 2`@; ƀ`` ` @ ' %>M €  * @$€4` * @4 €&* 2 @ %>M@@€P * @D€4` * @4 €F* 2 @ %@'>M€ * @€4` * @4 r€* 2@ߐ  @  +>M€b %@* €5  * @€4 * @€4` * @4 €* @㭛3` ``@%s: isp_fw_state 0x%x %s: GET FIRMWARE STATE failed (0x%x) 㿈 Ɛ F   i74 ̀ >N"P@z ?ߐ#@` >N#*` € ` 8"$4  8!$`  8$ ̢`>N"h@P 0 *  @$;H;P;l;l;$;x㿘 р    ѐ :  @5 ѓ,@ ђ@ `  .  р  %s: skipping target %d bus %d update %s: bus %d set tgt %d flags 0x%x off 0x%x period 0x%x %s: failed to %cet SCSI parameters for target %d x Ɛ .`*   *  , )>O ` 2` ̀ y>O H @s` - 87 @7@7  2`*` 7 ? *  * (@ 4 $  ̀   p `#\3` @ⵖ '2` @ (7 *@$ '.`,` 7@ >O`   s g@┖$`䀢   ё2  ѐ *  `@. `2,  *@ * .`$ @4 ' @``` %s: Node WWN 0x%08x%08x, Port WWN 0x%08x%08x could not GET ACT NEG STATE %s: defaulting bus %d REQ/ACK Active Negation is %d %s: defaulting bus %d DATA Active Negation is %d %s: bus %d tgt %d flags %x offset %x period %x 㿀 Ɛ N.` *  a $!    k$4, 4, ,,   :,@  B 2  <2<?#? @ <  *` @ < <  ϐ B 2 @ )  >O$#0 @ޘ0.`*   * ` @$ π`@2 @  π @2) %7@ ` ̀ >O@Ა#`* 2  *@ * $ 2  * * @$  $ ̀  >O2#  @ጔ ̀  >O2#  @ၔ???è#c !+>O 4  $ , 4  ̑2  `` ƀ `2  ƀ (  ΐ? :( 2  2  0   ?        $ ,  π @2= ͐ (,`778@2?`4 4 ,  2  *  @@$  d  @, 2` `*`  $  ΐ? :(  ƀ 8   0   $ ,  ̀  c 3`   `#\ @``{ @@ *@*  $ ƀ <*$* $ !   <44,#, , , @  `    "` ` %s: isp_restart cannot restart ISP 㿘 ё2    ё2    ѐ  0.  ё2   >Q!@  Ģ 6 Ҁ@. `@(  ,` ? `"  $ Ā@8 $ " $ " $ (   $$ ( $ ,@ 2 Ģ`@֤%s: invalid NVRAM header (%x,%x,%x,%x) %s: invalid NVRAM checksum %s: version %d NVRAM not understood %s: NVRAM is valid 㾘 Ɛ ` !       @  `!S@2  P=` ̑2  2j?>Q#P @`?  @Y `    @ ` >Q @#x@?>Q @#7? Ɛ `   @@ !  @    ` @@   @B @. ̀ >Q#@߲  㿘      `     Ɛ ` 2` 8`?`f a `&&6* 2 <        `  ސ    ֐ <<6 *`6   Ɛ  @€   6ع  `  ر < `  ئ  *`2  6truefalse%s: NVRAM values: Fifo Threshold = 0x%x Bus Reset Delay = %d Retry Count = %d Retry Delay = %d Tag Age Limit = %d Selection Timeout = %d Max Queue Depth = %d Async Data Setup = 0x%x REQ/ACK Active Negation = %s Data Line Active Negation = %s Data DMA Burst Enable = %s Cmd DMA Burst Enable = %s Fast MTTR = %s %s: not supporting QFRZ option for target %d %s: not disabling ARQ option for target %d Target %d: Enabled %d Throttle %d Offset %d Period %d Flags 0x%x 㿐`  2 `  ` * * $`2 * * $`?, `, ` , ` * $ ƀ  3  4 ` $    $` 2  *@ * $` 2  * * @$` 2  *@ * $` 2 * * @$` , ` ` * @4 ``* @4 ` ̐ * *@ &  ̀ i>S @  >S `@ 8 >S@ ` >S@ >S@ >S@  >S@! >S@!(>S2` `@!P>S2``!x> > @ݐ >S2``!> > @А >S2``!> > @Ð >S2``!> > @ݶ  >S2``"> > @ݩ ?ä# '>S`  2 *@ * $ `* * @$ ` @ * @$ `,  ƀ   ,  2`   @02`   @  $ 4 ` !4 ` >S"@ @i $4 ``2`>S"p @]` "` (4 `   4 `   4 ` @  4 `2     4 4  ̀    2 2 #\2 @)``` %s: ISP1080 bus %d NVRAM values: Initiator ID = %d %s: not supporting QFRZ option for target %d bus %d %s: not disabling ARQ option for target %d bus %d Target %d: Ena %d Throttle %d Offset %d Period %d Flags 0x%x 㿐.`*   * 2` `**` $`  * * $` `,  `,  , `  < * * $`  2  * *  `$ 2  * * @$2  *@ * $2  * * @$` ` `* @4  `! * @4 ̀`U >U@\ X>U `@W >S `@R 8 >S@N ` >S@J >S@F >S@B >S@>!>S@:!(>S2` `@4!P>S2``!x> > @' >S2``!> > @ >S2``!> > @   (   7>U`+   2 * * @$ `) ` **` " +   `<*` * " `* `*`4  !4 `  >U @ۼ `$4   `>U  @۫` ` (4    4 `   4 ` @  4 ` 2     4 4  ̀    2 2 #\2 @d` ` `Z %s: ISP12160 bus %d NVRAM values: 㿐.`*   * 2` `**` $`  * * $` `,  `,  , `  < * * $`  2  * *  `$ 2  * * @$2  *@ * $2  * * @$` ` `* @4  `! * @4 ̀`U >V@ΐ#p>U `@ɐ >S `@Đ 8 >S@ ` >S@ڼ >S@ڸ >S@ڴ >S@ڰ!>S@ڬ!(>S2` `@ڦ!P>S2``!x> > @ڙ >S2``!> > @ڌ >S2``!> > @  (   7>U`+   2 * * @$ `) ` **` " +   `<*` * " `* `*`4  !4 `  >U @. `$4   `>U  @` ` (4    4 `   4 ` @  4 ` 2     4 4  ̀    2 2 #\2 @֒` ` `Z  Max IOCB Allocation = %d Max Frame Length = %d Execution Throttle = %d Retry Count = %d Retry Delay = %d Hard Loop ID = %d Options = 0x%x HBA Options = 0x%x 㿘` `+``(`,`` ` `5-   @  6. @5`-- .  -``   ) 3 `` <? < @ <?#?  @ <<  @2` $@2 `   *` @ < < ` ` * @4` ` * @4`, `,`,`, `4 ̀`%>S @ >X@!>X@! >X@ ! >X@ " >X@"( >X@"H>X@"h>X`F@"states=> GOT_BUS GOT_TGT SENT_CDB XFRD_DATA GOT_STS GOT_SNS XFR_CMPLT status=> Disconnect Sync_xfr Parity Bus_Reset Device_Reset Aborted Timeout Negotiation%s Config WaitWaiting for AL_PAWait LoginReadyLoss Of SyncErrorRe-InitNonparticipating0x%xPort DiscoveryWaiting Port Discovery ACKPort LoginWait Port Login ACKProcess LoginWait Process Login ACKLogged InPort UnavailableProcess LogoutWait Process Logout ACKPort LogoutWait Port Logout ACK%s %s index %d: %02x isp%s: waiting 4 seconds for bus reset settling %s: waiting 2 seconds for loop reset settling 㿐 >֐  0>Z. ђbĖ & | 0& &  x$$$  4  Ɛ >[ & x!,4>Z "& x 4  4 Ɛ *@6  2 Ɣ T x"""  Ė 2 2$ `22 ̒  *@6  ƀ ''  ƀ    >Y  '>Y @͐#B5!0+>, >Y @Ð#+  +>,)Р   2 @ 2@"@ @2`  22`  4 ` `4a@  ƀ   $a@ 㿘 <?#@@& <@㿘 2 +*   `*  `+`: %<`!``2(`*  @ " 2  `є  `ё*  `@+`* 0@ %s: blocked 㿘h>\a@Ņ@ؐ  H /d * % `ё2   4B```  H `ё2    `ƀ ``  0`   H 0 $, d ` `Ɛ  0,`р` ``   ``   ` & `̀ >Z#@В`   $,H 0~ ` "$``"$`$H 0n ੐`. e"$  f d" 0 gh0  h@>a#>Xz  >]c@>!X @H 00; e", f d 0 g 0   ,   $,  @J "  2  ⟔ ",,   $,H 0%s: finished command on borrowed time 㿘 @  &   " @ِ h @"   >[ #@#` *@& @㿘" `` x#贆 %s: watchdog found done cmd (handle 0x%x) %s: recursive watchdog (handle 0x%x) %s: watchdog cleanup (%x, %x) %s: watchdog timeout (%x, %x) %s: possible command timeout (%x, %x) %s: watchdog with no command 㿈  H /d * %  `Ĕ `*@" * " `   `>\ @բH p@0@  >\ `@ՒH p@0&  ` € `@€ * , @" `ƒ*`2 # `Ɛ    " \ "   "  `̀ , >\!`@R2 @*@,& @+ ፔ $` , ` , >\!82`@3"  `Ā`* "@ *  & ,& 0x `̀ , >\!X2@` @*  & @<ؒ#>X @j h``€4``7`7*`  7@ @  77"  H 00? & @>Ȓ @   , 4 , ` $` , `̑2  2 ` ,  ,, , `̑2  "` , , ` `4`0 >\!@ԩ`H 0㿘H o *@ e   ` H 0%s: isp_command_reque: queued %d.%d %s: EAGAIN for %d.%d 㿘  H /d * %  "%   " 0+"$ ,0(>]`"`@U` ` h>\a@¢ @<#>X+ @¤0>]`"`@;` ,  & ,H 0%s: botched command restart (0x%x) %s: requeued %d commands 㿘 H /d4 * % J  A +>^& $    ƀ   `   `f    `f@`0 ,` $ ,   "  @;#>X̴ @- h Ħ>^ X@”H 0, 16 bit wide , Tagged Queueing Enabled , 16 bit wide, Tagged Queueing Enabled %s: Bus %d Target %d at %dMHz Max Offset %d%s%s: Bus %d Target %d Async Mode%s%s: SCSI bus %d reset detected %s: Loop DOWN %s: Loop UP %s: Target %d (Loop 0x%x) Port ID 0x%x role %s %s Port WWN 0x%08x%08x Node WWN 0x%08x%08x Target/InitiatorInitiatorTargetNoarriveddisappeared%s: Name Server Database Changed N_Port NL_PortF/NL_Port Nx_Port F_port FL_Port E_port?%s: %s @ 0x%x, Node 0x%08x%08x Port %08x%08x %s: no more space for fabric devices 8'DH /`* %`q'>`".` €Dƀ 9 ̀ 4?: @ +  *   *@ * *` @     2         2  @0  D>^"@Ҹ 0$D >^#@Ұ"0D>^D`t$@@ >^"@Ҡ0 D Ɛ 0D ̀ ,>^.഑*  (@@>^#>^#%> 3$#\ #`#d#h D#l @m0D>^#@g0  * !, !-`  ! /`' -' !' !  ' .' !! ' ??? '? !"'?5 ? 5 @  +ԟ- ?ب*`4 ܴ@2 , @ ?@Ć  * *`І+*`2  ܘԧ+ 2Ԕ@@  -  +@  @D -   !#@+/   @    F@C  @     , *  (@2 2  2  2  @  @   @2 !2"D>_ h@ї0::H 0 |}~~ ~`,DespAM53C974FAS216FAS408ESP406NCR53C96NCR53C94ESP200ESP100AESP100out of memory %s: unknown variant %d, devices not attached : %s, %dMHz, SCSI ID %d 㿘( 2(  @S &(( 2(  @J &(( >`( 2(>`@4#80=>>`#H@, 05!P* (>`(@##x(Ԓ @8  `. z . z(ԓ*"@ *`"  z*  , @8ב*  . {. z& p @.((ږ >,6 N6 R& d& \& h H@] %s: unknown revision code, assuming ESP100 㿘 l @!>!8!>a!@ْ  l .(`  !8!" l>a!@ɒ  l.(   +!(܀`>>a>a#t*` € l  y  l` x (` l&(  v l` u  l` t  l` z  l`   l` { (ܒ @}! l` t  l` z  l`   l` { (܀  l` x t\88888%s: resetting SCSI bus 㿘 l@>a#@B >a8!>a!@:   l.(`  [NCR_INIT(%d)] 㿘>!8`>b @!( 2%  & & &  & &  & &  @9' '>t'  @^$ $  "@& `` L@9 0  .(  "`,@    " ,@ 2 !&(&( '(  p`: @? `: `!`*(`**`` .(!8!>a!@Ϲ   l.(`  0 .(@regs[intr=%02x,stat=%02x,step=%02x] [ncr53c9x_select(t%d,l%d,cmd:%x)] 㿐` `,`"* '` >!8`>b`-"`@π .(`` 2  l>!X`Z`@7;#@ѐ l `    ( v (ԒF @7' ,`"* (@7* &`(   28( w(܀  `"?`(  `  l   l   l   ` f>!t`C`-`< l&(&(`(̔(Ж '@ l   l`  u @ l` 8!>a!@  l .(`  8!" l>a!@  l .(` l `< `- l    8!>a!@ɒ A A l.(`  A0!t`PO 2.`,`<`, l &(&('(̔(Ж @ l   l`  u @ l` 8!>a!@΋  l .(`  8!>a!@|  l .(`  Ÿ l @0=  l `   8!>a!@Y C C l.(`  C0`< `- l    8!>a!@: B B l.(`  B㿘H /d * % &`  &@ " &  & &`@ @O H 0especb㿘H o4 *@ e  `#>d  `@  ` ` "`$  " & H 0[ncr53c9x_scsi_cmd] [0x%x, %d]->%d 㿘 !>!8 ` >d@ͻ!!8 >d  !`@ͱ   2$ K  $  $ < $  $ D  -  $ < $ @ $$ D, HH /d * % $$ "@$ @pH 02  @! " @ @  @ [ncr53c9x_poll] [ncr53c9x_poll: rescheduling] 㿘>!8`>d@F#h"" !>d l@ "`@ ` "(  a8 @+#@ƒ#贆2 l [ncr53c9x_sched] ncr53c9x_sched: not IDLE (state=%d)%d:%d busy 㿘>!8`>e@ X(`" >e@ˆ p '#>e  `*" `* 'Г:@ `8` "`&  "@& L0  @ڐ` 2 requesting sense 㿘` * "@*`g >!8``->e@̽!@6  .`-  *`, , `   4 #&` &`<&`@&`D&`` $`` ` `*@* 4` @` &` 0@ &@ " & &  &`(`s[ncr53c9x_done(error:%x)] resid=%d sense=0x%02x error=%d 㿘` *`" * '>a8  >e ,@X"@` , 2 `H, X` @  $ , $ ,`H > 2`D`D$ (o0=$ ( 8 `$  (`" ,>e@,# ,`2>e>e 4@$#` @ #(`  `*@* 4` @ (  &  .( @  Ւ@`@i$@` @` " `@ ` ? "` ` " @` %s: reselect with invalid selid %02x; sending DEVICE RESET %s: reselect from target %d lun %d with no nexus; sending ABORT %s: reselect: target %d, lun %d: should be busy ncr53c9x_sched_msgout %d 㿘hؐ  h* *@@ >f !`@˙`!> `?`        @ 2  22 >f! @o`!>ր`"`$`"@  *`" * '@,h$`` : 2` >f`!@O` *@6`` ( `v`hԒ'`@3 . "* h@3* & h ` 28h `wh܀  `"?`h  ` `l  `l  `l    !>!8 >f" @ !8!>a!@ `l ,h`   h h @` @!8 >f" @ !8!>a!@ڒ `l ,h`   h h @` ,h,h@ $hD;$h!8 >f" @ʿ !8!"`l>a!@ʷ `l ,h`   h h`@ !8 >f" @ʣ !8!>a!@ʜ `l ,h`   h h`@ ,h,h [ncr53c9x_msgin(curmsglen:%ld)] %s: msgin: no msg byte available gotmsg(%x)cmdcomplete %s: %ld extra bytes from %d:%d msg reject (msgout=%x) noop disconnect save datapointer restore datapointer extended(%x) SDTR period %d, offset %d %s:%d: async max sync rate %d.%02dMb/s %s: unrecognized MESSAGE EXTENDED; sending REJECT ident %s: unrecognized MESSAGE; sending REJECT %s: reselect without IDENTIFY; sending DEVICE RESET %s: unexpected MESSAGE IN; sending DEVICE RESET 㿘>!8`>g(@" l@€  2(>g"@ޒ 0 " l(&(Ȑ .( l@€  8 >g#@ɒ((* (8!>a!@ɼ  l .(`  >g(Ȑ#(@ɮ 0](Ȁ  8 >f" @ɢ 8!>a!@ɛ  l .(`  (( .(`A(.( &((  `  (-8`2*8(Ȁ ( @   8( `  88!>a!@_   l.(`  08">g @O#0(  >h   `(*" * '`l>j#*` €8">g@0#@(6   >g` #P` `@# &( ! ( % D " ( .(8">g(@#p(  @8( .(  `,(  v l   l`   l`  88">g@#88">g@ݐ#  $(`s.( !o% 8">g@ː#(% @(d% D8">g@# @&( DY&(8">g( @ȳ#( ` >h8">g ` `@Ȧ#( ` 8 `,(   `,,(䀢  "  `| >h`  >`@Ȇb(`2  C,a @0D  @0>!-`@*`@*`" (R@03 ,`"* (@0+* &`,`"* (Ԑ@0!* , @` >h @O(`2.  (䀢@6 (,   ,  `,8 >f" @5 @8!>a!@.  l .(`  (( @`@.(.( ,( .( `( v (Ԓ @/ؒ ,`"* (@/Б* &`(   28( w(܀  ` "?`(  `  l   l   l   v8 0@Ԓ  88">h@̐ h>h p@Ȓ 8 >f" @ 8!>a!@Ǻ  l .(`  (( @I`(  >h @Ǥ  8=8 @Ǜ 8 >f" @ǔ 8!>a!@Ǎ  l .(`  (( @`8 >f" @y 8!>a!@r  l .(`  (( @` .(.(8!>a!@]  l .(`  ( .(&(ȁP0[ncr53c9x_msgout(priq:%x, prevphase:%x)]%s at line %d: unexpected MESSAGE OUT phase %s at line %d: no nexus 㿐>!8`>j(#@(( @( "<(!8!>a!@   l .(   n .('&(  >j!8 >f(@" !8!>a!@  l .(`  (( @(.(@ .(# @۔%( 2(( ( @?*@.(.(&( ?.(>l!h+  €      `(**(" *`(* '*` (*  (* (`&(  , ( v (Ԓ @.c ,`"* (@.[* &`(   28( w(܀  `"?`(  `  l   l   l   =(( >k ( @Z%+  ` ( ,*@( ( .(*@   `*" * '  ``,( *@(   (  *@( *@(  (.(*@(&(((耢@8 l '(( @ l   l`  u @ l` !8!>a!@  l .(`  !8!" l>a!@  l .(`   l @$$$$$$$$$$$T$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$[ncr53c9x_intr] %s: SCSI bus reset %s: nexus in reset state%s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: DMA error; resetting %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %x %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: SCSI bus parity error sync nego not completed! %s: unexpected disconnect; resetting sending REQUEST SENSE %s: waiting for SCSI Bus Reset to happen %s: target didn't identify <>ECB_NEXUS while in state %x backoff selector %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] selid=0x%2x %s: identify failed esp: no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %d left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] %s: stray interrupt %s: ICCS: : [intr %x, stat %x, step %x] %s: STATUS_PHASE: msg %d %s: invalid state: %desp no nexusMESSAGE_OUT_PHASE MESSAGE_IN_PHASE %s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] COMMAND_PHASE 0x%02x (%d) DATA_OUT_PHASE [%ld] DATA_IN_PHASE STATUS_PHASE %s: unexpected bus phase; resetting 㿈>!8`>l@"h l@ 2 l  € l. }@€  l . ~@€  l. |`$`" |@ | 2! } &(8 >b |"8 }@ ~ < | -& < l@€  8!" l>a!@ђ  l .(   2 ( >l @"  = >l"@=  |0@Y  } @( l@€  8!" l>a!@Þ  l .(    (  2$  "`,  @"-((  .( (>l( ("@t( l@€  8!" l>a!@e  l .(   Ɛ ( ` l.( € "C } l@?2  l>l @D"  l @ 2а  }2* }( "& }(`2(( >l( |# ~ #\ @!  } 2 }>l |#` ~  ?D#\@ } >>l @#(`8 >f" @ 8!>a!@  l .(`  (( @` >f" @ 8!>a!@ݒ  l .(`  (( @`.(.( |` 8 >l }#@ ~ l@€  8!" l>a!@µ  l .(    8!>a!@¤ D l D.(`  D(?`O>s#h*` €  "`,( ">l@(` >l@‚#` *(" * ' `.(  , ( 2>m @l  `>m@f 8Đ>m@a H@   "`, $ " & &  $& (?`>s#H*` €>m  (  $ 4 $ ($ $$ ,$ 0    ( ' $ 8 $   %@&@㿘%1 2 x | & | & x X `@@U  0@x%s: overflow %s: receive buffer error %s: dropping chained buffer 㿐!L; 2  >x!@ϒ  >x!(@Ȓ  | & |    >x@!H |` & |, !h@*`    :/77 !D " !`,     " @&!L%s: transmit buffer error %s: underflow %s: lost carrier %s: excessive collisions, tdr %d 㿐!PX#>x`@ ;>6 d @>x"@d  @>x"@[ 0@hǐ0P! `>x@"@F @  &   @7b `&   & ``  "   &   & !H " !X?&!X!X  , !d   `" d 0@&!P!X "6 b%s: memory error %s: receiver disabled %s: transmitter disabled 㿘 €  G @!     & ( | & | >y @ǐ 8'   >y @  |`*& |  $>y @! `&   "ɐ"" - %s: device timeout 㿘>ybp @C  T`& Tmissing buffer, no_td = %d, last_td = %d 㿐 4 $@ @XaT0 ",@,@al*`  ΐ  6 20 /77` a  HaH " aX  $aX 4$&6 4ad,@`   >y 4d6 4aX"@1aT    & & $  ?& 2 ($aT㿘H /f * '  0@   H 00\a2@a1@5a @a@"4G 0!5@70 !6@3 0<4 44 ` @Q0.@  24ѐ4 ?#44 2 @ڐ0@Ւ@§ 4+  ! !@ H 0㿘㿘 4!9<6`6`6`6@ & @!  *;n # ?  @?`   @2?26 @22*@  * @6@ 2  ؐ 4 = 6 4 4<"6 46@6`6`6`㿐!8'@㿐!8'㿐!8'@!+rdramdisk: multiple attach calls? ramdisk: malloc for attach failed! rd%d㿘>Mጀ >z@#0.@ 0+ $  4 >>M!"ጒa "@"! %>{ ؒ @  ">{@  ؑ,`$$ H@#  @ `@ ؁㿘>֐!`&`&`X@`0 >M 6 >M* " Ȁ" đ2  >M:`@6 >M*`*`"2  " А *    8(>Mᐅ("@  Ё 㿘>{>"Ș" @㿘>{>"Ș" @Җ 㿘 G:`>M!*` Ȁ 6  23 <& $" $ 4@ 00 T <* & @Ā@   0@"0" 8  0@   H @ H  @" & @ <& @ 0 (& 4& 0@&  : >M!+  m@ M  "@Oe e@ 0q "@R+  j e`g@f`f@ d Ȁ ] @e /i!U Q`N  @ E e g@A4  *  ? >{bȔ@G2Ȁ -, * + #@ %  &&&#@  Ȁ     0  @a@n RAM diskfictitious㽘'>L@!@" "$ ($ 0`đ2 $ ,$ 4$ 8 d$ 8>|b @  4 >| b(@  ,. (4 H2`  $ <4 J$ Xb$ $   aW4 $$ , @6  `*` 4  ? >{bȖ@  㿘>` c@ג  & & &   㿘@=`# @@ :$   ` $ $ @ $ İ$ $ rd_idle㿘+>)>} ' @ >̀ a $$ T$ $ <* $ @Ā@   0"   " @8  0@  H  H  @"$ @  0$ 4($ 0@%́㿘> #> c܀@  @!>M$!@!"cܐ! "`"@"`   `2  >> ܀   ksymread㿘` \ %>#>!>M@`  !``?&@ &`>}@!"!a"  `    ;` 7!  ` 2@@ (@@! @ 8 @ @    @!  a#@ @   8"  @`  "@㿐@”.`? ?*@   .   ` 2 㿐  + >@[ %s symbol table not valid ] [ preserving %d bytes of %s symbol table ] 㿘 @ >M"!@ >M  ` ?  ">~ X@0  @k?>~&@ x@ޔ   (* * *  : 㿘@.` .  㿘  : #>Ma܀4 >M!ؒ@ `"   2   @ʔ _  * 㿘  A >M>M46 "2  2- ")  @ $&@`2   2 "  2 "  * 2&& ` >M4 >M؆ "@ "gcc_compiled.㿘 ? ? J '>M%>M/>~   @>Mؐ >MJ g2 !܀@4 ؐ @ 2 ??    d D 4 ': ܀@   2    ': V  * ` && ???㿘`F   A` $2:  6 :1# 2-#@6*#5>M >M3>܀`! a@  H:2H:"(: # @&# *  X_db_stub_xh: no lkm for symtab (ghost?) 㿘@w ">`! &@&` >"" &`&`&`  @xG >D @ >(&`<&`@d"x  "㿈  "@ 6! @ * @ *`   @k "@ 8  &@a &@ " @6 ?" 8 &  bsd㿘@ > > c܀>  HAll breakpoints used. 㿘>aĀ "> "aa> > "a@  >"  Already set. Too many breakpoints. 㿘@< >@Ґ!0 >>@ɐ! 0 a""" """"aȁNot set. 㿘>֢!@ @ "  2  $@ >@!0㿘>!Ȁ " @ϒ "  2  2 㿘@Ґ㿘>à  >!Ȁ  #$t@    + $   D`   $́㿘>à  >!Ȁ "$a@   *   $á㿘B    & & & && & $t  0>@+!  㿘   9No breakpoints set Map Count Address %s%p %5d * 㿘!>!Ȁ >>@ (0@ @!Ȁ > `#>@B ">> p x@  @ ے @`  㿘@+!㿘" @!㿘  >㈀@"  ㈀`   >㿘@ @ @ "  JK2 ` 2"  `@2@%-12s㿘  !>@{"@ ǐ   2? No such command Ambiguous Bad modifier Count missing @m  >"'t'x'|r/   @h 0>W"`|#> %>!>b|  | DB#`@; c`| `C|@/@) >&#> b@$0@ /@ߐx x>> "c" ># 'x@  @ʐt  |># @@@ ?'t| `|1|  & xt| a>!Ѐ`> >"> "cA@ߞ>#>"b㿘N>2 f`?@sMalloc debugging not enabled. 㿘>@!㿘N>2 f`?@̔㿘@calloutprocsmallocextentsobjectmapwatchesbreaksregistersalldumpcrashsynchangmanhelpbootshowpscalltracematchnextuntilccontinuesstepwatchdwatchbreakddeletewwritesetsearchxexamineprintmachine>ց 㿘>"ԁ ddb> 㿈>b>c'>>>"b# "L#b>bL )>'>%>#>!>@ ] "$D@#$D@ @`">"L`>""㿘 @@>bBad function Too many arguments Argument missing %#n P@Ā  >) @Ā (@Ȁ   >@  `@ ` @@  >" >!@@̞t`  ȑ,``` "@#\#`#d#h؟Āܒ>@!㿘@~e(㿘@~b)㿘@~_)㿘J@ !>@ "  @: = 0x%lx %-*lr%-*lx%-*lz%-*ld%-*lu%-*lo%c\%03o㿘 >آL@  `@  @ > >@F">"`Ē`1`>"H*` €        >"@*`  >"@t`ؔ  >"@g`˔  >#@Z`  >#@M`  >#@@`  >#@ܒ3`   ^ >@ΐ# %`>@ɐ#( ` ` ^8>>@# @#( w  0   @`@ "L@@L@O6E>""<8l%*r%*x%*z%*d%*u%*o 㿘N >*! ! ?* : `6*`> ` €@ 7 ->>#>#># @5  >>#(>#0@+ >>#8@$ >  ^8>>@# >@#(>@#@LLLLLLLLLLLLLLLLLL㿘@  >@"ؐ@  @(*` Bad modifier bhlAddress missing Value missing Count missing 㿈@ $ @ "> >?! ">a0@ > a8@ >  @{a@ > @@t >!H@l >!`@e ?'@  @Z쀢  >!p@|@0@?'@㿘!>؀   ?>" Đ 2$"Symbol not found Syntax error 㿘@]  > "@} < >3#H ># ># >   >" > # $ @ @ @ >#`@# >#` @ 㿘@   2>#`  $ 2>#`  $ @Divide by 0 㿐ϐ / 0=  >ɐ#`   >!@  @'@- '@|?'@? π ̀ @ $@㿐 % @? !>  }#`  " @'? @x $@Negative shift amount 㿐̐ , @g?  #>!> Jc`  D# * 2 @I'? @? $㿘̐㿘 N@P  a "@$a> a a*`: @P.@!`"@*@ې a !֒"@ !"$!㿘!> %>  !#> Ӑ"! cΐ"c$$!^R 㿘`~>!@*` €1> > #!@ ( @P !?&!1> > !a耢:ܰ @PJ! &!> > !܀ ͪ @P| !cܐ? &!ð > > !耢  !@PiJ@!!  &! > > !܀  J   n c܀@ J  0> > a܀ [  > > a耢 0> !> a耢|" H y j 0u> #1> !` m J *!@P*@P !@PJ!@PJ^ >,> #P@  ",#>a( $!,>!('>א0@%> +> )> 1> a,  ? $!,$!,!,J`a,)!,0@a(#O` @$!,$!,c$v%!#O` @$!,`$!,c!,%!J`e `a*@(`#aJ  S!>>!,!0@  J@ >!(> cO  `,  ",#!,!, "!,J ,!,0>(> #O@  $!, $!,+> !,0)> c%> %!J`  a*@(`#aJ  !$c!c"@ >!P] 1> > #!耢@( T"@> ! Z"  >>!, 4+>  )> 4'>c!耣@  K`"KK@@2K>!(> cP!   " `@" KK"KK@" K c!耣@ !0`$!,+@%!Y c!耢 0 #4> #P>ׄ!0 *(  #!0$0!00* $00 !$!,* 0%!> >! @Nؐ % ^ >    * 8 *!`$@N%!!"@! Œ"  $4$$"0$"!4$$"$h\$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$㿘@ܲ> > >>   "#"a""@Mv @7 !*!cܰ"@㿘@  02 @   * ?㿘>ؠ" x > > "ax"ܰ >؄> >  x" >8 >  8> x@?J@`"܁>ׁ 8>ׁ <㿘>a< "a<@$㿘>>"!8"a<Bad character in number Bad escape String too long Bad character 㿘0? ?߀ ] ?Ѐ ` 0 >!X O o T  t X   x> !X>"# |$ /  9 7 0 ?Ѐ ? ?  ?Ѐ ` @?4ޢ??Ѐ  ? ?  _>Z!@a ?  ?  _ \C >  \ "< ?2,><!`,> #h %>#>+? ?  ?Ѐ  _ \ :2, \2 , ?2,`, ap0H `??*`>! €> <  .4 0 . , * ( & $ "       <   >  Ӑ>@Ð!?-----------------------------------<-,- -4-----,,-$,,,-------------D,-d㿘>>H a@@ >!L@F@a@ @@$@L; @L4 `@@>@$H--db_more-- 㿘>JcX cX#> %>L@L L @K c"$aD q aD ?aD?$aD$aD $aDLh  hL@K L  㿘>!P` >!D ??߀ ] !>@Kѐ>!@>T`"!@@ a@@K >aD$!H "aD$a@a@($!H @K >D>א >"D"@"aH0 !>#>!La@@ !L $a@ >a@ "a@@K >ׁ@ 㿘>!T>@"@ >@!Ё%-12s%#*ln %s+%#lr 㿈>@>?!cX 1#>@ @b@8 @W 쀢>!l >􀢀  >@v"`">>@o" >@l"( Ւ> bn` [after %6d] 㿘@ ː " @ ? "  " &@8  > `& & >&@   &"$ > cؐ? "c>  0`>@# '>@#(    " ̔  㿘>Ѡ        > c #c ` i  $ i@>     Jp"  >> > > >>> " 0 L#`""\# 㿘N>фp`? 3> 5> 7>9>> #&`0 L&&\' 㿘N p`?3>Ѱ ;>> 5> 7>9>>&` 0 L'b&&\' Jc>   > >>>  L"#"a\">M  㿘>!``>M"  !`  @p !`?"""""" ">M""@"!` $!`ddb: %s symbol table was not allocatedddb: kernel symtab delete㿘@? #>@:  @  a`>#`@(a`? $a`>@#`"  "`>M"" "@@q 㿘 @   2?   2>M㿐@Ŕ >M!@* *`` :*  **`'􀢠!㿘@  2N    @ `?㿘@'D @D  invalid symbol table name㿘N   )>L : ,    :`@ q  :`,!L 瀢 :`ː    `>"#X㿐>!d `  @6   蘿   [  㿐>"#X?'L  殺@` $X9 &㿐 &@ܔ >#X(&@&%s+%#r [%s:%d]%#ln㿀>!h /є$>!l@  >쀢 > @ H``>@ P`@䀢  > X@0> h@֒㿘>cX㿘>cX㿘?㿘f㿘bAfter %d instructions (%d loads, %d stores), Breakpoint at Watchpoint at Stopped at 㿐 ' >  '> "4 "> #` >@!>\>>@x" ">>@q" "@m"@" > r"8"\ linestabstopsmaxwidthmaxoffradixUnknown variable 㿘\ *>>>!ap  #> @ b  *>@>?!cX #> @ b &   *> #` 㿐̐ @  㿐'D @D  㿘  &@ 㿘  @"@ No value ? 㿐 >ؐ#` >ѐ#`  >!  >!0ƒAll watchpoints used. 㿘>a "> "aa> !> "a@! >"  No map. Already set. Too many watchpoints. 㿘 >>@z"h0,! @ "   2  > 2  >@Z"0 @W"x0 @$ $$ $ >$"!Not set. 㿘>! !z "  8   @ $@0   2>@(#xNo watchpoints set Map Address Size %s%p %8lx %lx * 㿘!>! >>@ 0@ (! > H%>#>G ``h  @#  㿘6㿐  ,'U㿘㿘>a  >! >̤"(#>  8  bğ @  2 $ᰁ>ׁ 㿘>! $ >̤"(ْ "   @: 8 8    @* 2` >"! Unknown size %#8n = %#8n Nothing written. 㿐N h  l  b> ">"   T?'>%> : >@@"   2&>3"&$~$℁㿐`b ?`\>!*` €>א!X>א !T>א!L>א!P@=!>"L'@ 2 / "L> !`$ $"L! !>"P'@g    "P> !` $"P  -H@HXHHpHI㿘>J!`!>ע! А *`: ?Ѐ@E~L@  @Ez  @Ev:  L 2 L !   ` * ` *: @: @EVJ @ER:  L  @EK @EI (L   a`_2 @E> L   @E6 )@E4 㿘>"'>M`I1>M %>ג -* **>Mc,*@  `* @+&# @ k+\@+@ cc6``>McJ :$J    8 $J 2 %""N# @D  `   ,# *`: J`-## " *:  " `J@  @  >M;`?" *@ ";` _* # ?&# # >M#`# 5 # (# >M#,`""J  >M  ` 8 ` c*: ?*: ? + J  # "@Dk # %"`?㿘N s >MN`/`94>M>M"#,>M "c,!   @*@`  `*``  @*@`  @ `*`*@`  @ `*`*@`  ` @*@*``㿘㿘ܔ@ * @*`*@@ * @*@*`  `(`  @(`cdlinemicheadphonesspeakeraudio`? audio: missing method audio: could not allocate play buffer audio: could not allocate record buffer recordmonitorsourceoutputmaster`>@!@?> ;> 7> 3> />$ 2(` '>( 2,d >, >0 >8 >@ >D  >H >\ `>@w!H&`4&`8&`4&`0 @ @ >&`4@g!`0`` @@  @2>&`4@W!0>LL&` &`  &` ?&` ?&` &`L&a &a &a &a  &a .`@&a@ @{@y@Ȑ&a(&a0.a4&a8&al&at.ax&a|&a'  >a@̀ "  >a@֐̀ "Ȑ 'H€ >>׸" b,'/>->+>)>"!> a(#\@#\ala@!䀢 Ȑ@! &aȐ 'H€ ``""!  - auddetaudiodetach: %s didn't detach 㿘 &!@ \@ XH /d * % !? &!>!X>*`" З*!@/  >!@ H 0@` @] `>>! @ 6 >9!|>`l  !| `@ ( 2` @!<   @!7   @!2   @!,  h' @  Ȑ ' 4 H€ 0 ̰?㿘\@ &`@ ~ ?  &@@ 6 ( @**@``$, @@ڐ 2(`@ * %`*`$ ``4*" &``  &`(`@ *@`2( =.` ; &@@ 5( @**@``$, @@ 2(`@ * %`*`$ p``4*" &``  &`(`@ *@`2(audio_attach_mi: NULL 㿈  >'''@ >@"( oplmpuaudioprint: unknown type %d%s at %s㿘` ">  "> >">> !(""@">@e" 㿘 0 4" l   T &@ h` @ &`  L    &`   @g= &` `   㿘 4 P  0` 0` @h 㿘>אb|   b|* @ "- ! " 4'  2!"   `$!``  `2  @@!? $!@!㿘    0   0 @@ 㿘>א|   |* @ 2!&  "!!   `$!``  `   !@ !? $!@ʐ!㿘>א|   |* @ 2!&  "!!   `$!``  `   !@ !? $!@!㿘>אb|   b|* @ 2!'  "!"   `$!``  `2  @Z@!? $!@[!㿘>א|   |* @ 2!"  "!   `$!``  `@W !? $!@)!㿘>א|   |* @ 2!"  "!   `$!`` ?`@p?!? $!@!㿘 `$ @x @q  ? & & &  . ;@& & & & (& 0. 8. 9. :㿘 4ِ `  =   l p 0" Ő &  "  = "     0"  `` ("`8"``""``"```  "`audio_open: 0 precision  r `< n `4€`0 f&`P&`X&`\.`&`.`.`&a&a &a$ `<  .`< `<` .`<2a>LL&a&a&a &a &a&aL&`&`&` &`&`&`a >` p>@#&   @$a'a'a 'a'`'`'p`'|`'t'x&`d&`@  "  `4 @`0&a$.`<.`=㿘H /d4 4* % 4 4  !$ " 0 =  0€ H 0㿘H /d * %   4&!`4 0€ H 0audio_drain: copying in progress!?! aud_dr㿘M ׀   4 k 2.L`9`` `@$`" @`:` H /d * % `$`$`@aH 0 =L`9 >@C",`9`0 H /d* %! >Ф \+>!Xbȑ*`" * >!( % \! @}!`% \ `0 >БH 0㿘>װ "|. @ 4H /d * % ` 䀢 " !$  40,@". 0@ 0.  `&  倢 " N Ԁ 2 4V 2  4 `" 4@ 0 4 ,@ 0.  @ 0` < = `. <. =" &!$ < = `. <. =&!$& PH 0 aud_hraud_rd㿘>"| . @`M ;  $ u = r` H /d * % "@ #>5b0X>!( $X ! @}  `$X  )"@ 怎H 0`*@J@$`  0H 0 #H 00H 0 #H 00H 00|` y wH /d * %   '!> 䀢 "8@ Ҕ"8X>!( $X ! @| `$X    ު  - 9H 0  ""@@& `*0@uV @@ %@ H /d * % % % - 9H 0`  㿘H /d4 * % 䀢   X  X@}А & X 4 0@ 0.  倢  \  \@} & \ 4 ,@ 0. H 0㿘 ؀  4`!   `>"K@@$#G` E``B2 ` ?€ 0$   >d(  U        ` *@`0`*@`4*@oopppppooppppppppx!  `  @ 8  8@t&@`  aud_wraudio_write: cc == 0, swcode=%p, factor=%d 㿘>"| . @L;  `   $$  =` `&`@ B >``23` `. 8 ` <`B#&`>` "$ ``2`̰ H 0İ #H 00>@!@,9 `  H /d * % $ !>Ӕ!8\>!( $\ ! @z Ḱ`$\  $  ,9H 0$"@  " @ @ @&`* @s` $@0  : H /d * % $$L:`$ @ϐ% @ʐ%  @n% "@ ,:,9 倢  L8 @`H 0 `  S㿘>"| . @  4@ )!@ " @ "V !@ 0@" | !@ " 8!"!@"!$ @"`\  b}@"+ !@"`8!@ "!@ 00!@"b~@ٰ 0!@0"!@ 0΀ "$ P P "$ Pư  H /d * % Ɛ " =H 00  倢  ` @O  =   䀢 `@H 00&&H /d * %  &   d@Ր" & l  t$ "@ &H 00dH /d * %    "   @@ :  &   @" & $ &H 00=<&@7@2P -``)@ 0% <&` € 0&`\@ 0  `<  0€ " $!$02 0@ 0&㿘>װ "|. @H /d`* %` `" =0, = "|@0 @ H 0 @@H0 @ H 0  @-@H 0 㿘>"| . @ 4\@ 0 "3?X  @  )?L ; 2  0 , ;   H /d4 * % 倢  @3H 0X 0 㿐 4`d !#\`d> 0!h l p d >`(h 0 l@ d 2 .  㿐N ׀ 2  4  @6 4  ``  #\``> 0!    >`$ 0 @ 2 .  㿘 <  4  @Ӓ   $  $  @| (L ;@$ ( ` > $  0@0 "$ L 9 "  x, : @$@$ @VL 8 " 0 4 $ 4 $ 0! @ &!  " ܐ@    " @   @ ( "@ * &     & &   @@ :  $  $@ +$  ! ܐ@ @  #@@@  @  ( `@" * &  ה  `& &  ϔ ` 2 = $> 0 ἟@ " =h = "!$L 8 2!$   4!$ \  \@y8 & \@ސ @ P "!$@mA !$  X  @y% X H@& X P @m. 㿘 < ` ^ 4 @    $  $  (L ; `$ (`d H> `(h @ 00? L 8 ` $  4"   @ $ 4 $ &`dL 9 2 `d 0"   @ $ 0$ $ `d 2 X `(> h 0@ " X X  X@x & X@g H P @lʒ ``   "`2 ``+  "`` 2` "`` 2` "``>(``"`  `   ȝ㿘  &`&`.` .`  4 @€ 0 2  :  &`.`  4@ 0 㿀     &  :  @ސ" & : @2` `2'g [ ,'`4 '`D`0€ R` H`$`4  耢@2  ?' ΀ 03 / `4 '`D`0€ (` 耦 `$`4 "`? 'k "` "` @K㿘 &` 4 D€ 0  ` &` &&` 4D 0 ` && p@ '؀'`z ''іr` /' 4 '`D 0€ b`  \'`$`4  耢@2` ?'؀ Hؠ A 4 '`D 0€ 5`  '䀤@ ''" , `$ 耊 `4 'zЀ ܢ`Ж  ''` , ` @'@'؀  &.*`&@*. @& @"@.㿀` 2@J @F ` '> '  `$`0 2`@ 4'@ 0"` '䀢`' `$ @@`'耦" 4耢 2 4  @€ 0 @>㿀@"/ ` '    4' D€ 0   ` ```"@`0 ``@`H`4`8 g ` ` '` '`'`'`'a'a'a'a 'a'a@'' `䀢? `' `8?"` 'Ȧ ` ?" '  ?"`'̦`?"' ?"`'Ц`?"' ?'Ԧ qȰ  jఒ    ` 1  ''ܠ   ` %  '' `?`2``   ,`= ,`= `=` a$  `,`=\\@`0 2 `=  ?''' '2 `=?'''' `= `0@Ȱ Ȁ  ''' ' ''''$a$a$a$a $a$a$`$`$`$`$`$```d " `Ӓ В `? `2``oal b ? `2`a( S `?al`  B?a( 1`3 al`3   3 a( 3ِ `p?"`0a `4`s '''/D€`0 `0 ` "' 0,``0 2" 0 `倢 2 0 `= " 0H /d * % H 0  0 ` "'`t,` 0 2"`t `䀢 2`t `= "`tH /d * % oH 0 `t?`2`tː`t      ,`€`0$`$`d,``?" `=   `= "|``@`0 p`"C`xH /d * %  )``d" `= `=   `倢  (  `=    `䀢 H 0 .`x? ` 8 ( `ؐ $``|  `?8`ː $``x?2``|?  ```" 4$` 㿀4 `8v (&@&`8&` $&`$&` B$ l$=&`8`k$|&``HE`@`3"&`p4  '''D€0 2&`p&`p &`|$Đ" &`("@$(&`,$, .`0 ,0̀@ .`1@ ,1,2.`2 <2  .`6 < `,6 .`7 ,7&` `$ &`t@&&`x@"&`| =&` 㿘 T  T2  &@Z 0 2㿘 T   @g  2 㿘>"| . @֒ 㿘>"| . @0!@ * 4 ! !@ "}@  05@!0!@ 0-    @X  T" "$ T `8`H`D€ 0`@€ 0  `` @ 0 ccdattach: count <= 0WARNING: no memory for concatenated disks 㿘 4. >@G!* *`  @W#>$`\ @W `\%>`$0 2>>@!`\ "0@Yk 0  @Ye 0"" @0@ccd%d0>*` * \ * $ >$ $ b@ 0  * * @Wz    $    a     @$@I"$`  `@W[ ` $` @@+ } $``h @+ p `  2 `  (* @@X  @X  O ` @>& Y:$`$` ` $ @ `  `  &!: @&`   % `"`   " ` @X  @X K  "3 *`  * @@:$` `* @ *` @ *$`  2  : ` @X  @X 0"` @X  @X  $ @" (' ''  @i('    $ $ $㿘   *  @V@~&           @V $ $ $$   "@``  @a$     * @Vs $  *`  *  @ " @:  *"<$ @$ $   *`  *   @ " *` *  *  *   ,`: " ` *`  * *$$ @א㿘 >":@ C ,`* >`\* @א 6,`$   `* p `@b`  "  @6 ,` ` " l" h l$ l$ h l h $ p@㿘 >":@ ,`+ * >`\* @ ",` &"  h  l l **@$ l **@$ h l h @ @$ p㿘 G : +  * > `\* `2  < 0  <(& 4& @& 00& $+ #@`  `@  <& @H /d * % @ H 00@㿐>* 0* @` 8@ `G !"@``T *`@`@    @U9*  @*``H` >`,?"`< `<0#\@L)`0`\`h "`h@-R `"$ 0@2 $  \h`"h@-B $<` @զ  @%,`"  0\`h "`h@-$  `@,`@V ccdbuffer㿐`\ ` `  @      Q& @`@n`` "$ $@ *@`  3  :`@ * 2`@ @D:`2`@ :` *` *  @ * @@0@H- @*`  2$"* & - @   @TR @2 > ,@ @TH $ - @" $$`0> @b&0&X`,@&,&T&D&<&\&x&|@&&&H'>M#>)>0@h`<  $ Hb $b0!@m  H 0$ '` : 0@5  @S @ݒ > ,@ @S $ @~D   $$ D$ \$ x`% *` *  *  *  : '`$ <'@$<!>̠"( H * @@  8*@&8* "*` " $㿘`0("`<`<&`@`< 8`@@~," @F (mirror)%s: error %d on component %d%s ccdiodone: count㿘 >- *  |\*   ` "0($0 4`" >$4">4" @O`0 (   @ />M3>>̬"( ,` ` H @*    @  0@f\ Hb 0@nc&b  @T <@T @@(">@"  $@- *  \* @fH 0㿘 >": * >* \ * @` >>"" @V1 㿘 >": * >* \ * @` >>"" @V  p >":  - * >`\* @  "@"`  m@"`e e@8 0  h@; 0 e`f@ `g@?0"@| ` x u @X p>  `, ''`'a:` @ߐ 耊`"`'  @Ri*   @Rc* z* I#  @p " @8 .` ` @#@& +``''' " @ .` ` @#@& >* \* @@ Ȑ@SҒ @Sϒ @0> 0*` |] &!>M#0` `&耊  `0>c#\ܔ @c $#0`0$``@{`8@T@Ґа ˰ @ Ƒ- $ `p*@  `h " ``l "`@  %>`8 `  @#"`  @St `&`` @ "``.@` @Sc `.`2``@SZ `@SW `0,  ?@$``@SM 0 @SH 0@{ܔ @{ĐH/ /@d@X ȑH 0Y ` D`{!P ` ;- `$ &`*`` B&` .= @  8`$`` @]`İ 2`@2`5 * -  >``@b` @$` " 0` 2  `$` $`  㿘!>"    :* >*  `\*  *`# ? * `? b  ?  @'''''ܐ @!n 8 4   @'i`@@"0 ) `@@$P   @'U`@@" 0P @'G &   @'A`@@"  ccdfictitious㿘 : - * >`\* !@h@e"  $ < $ ($ ,$ 0 }R$ 4$ 8>b @  4 >b @ . 4 H4 J$ X$   !W 4 $ $ , $@y6  `*`4 -  >Ēb@ @ default label㿘  * > c@ ccdlck㿘  1> @$ ! 8@i "    @   $ 㿘  `@&  ?& @k?MSG_INMSG_OUTUNSPEC2UNSPEC1STATUSCOMMANDDATA_INDATA_OUT㿘 X @  *@E b? }F  d ` ? 2: X 2  3  T* X  * X`* d> @ "?,  X}  d @ 렄? X `*   $ X d `@> X `*@&㿘 X D ` b? |  d ` ? 29& 2  2  T .   X`* d> @ "?,  X|Ő  d @ 렄? X `*   $& d `@>װ&㿘 ""? "ȑ*` `  "? `*` `  6 :&#& * X *@ \* d*@ p d *@ `@㿘 X *@|v! X * \a*@ `"* p @|i㿘    `@@   @4  @㿘 `" @   & #̀ 2   X  ``*|3#̐ &#@ `@ncr5380_cmd_timeout: no scsi_xfer %s: cmd timeout, targ=%d, lun=%d 㿘H /d4* %  >@!0  ` >   @" `&  2   " * *`@"  @vH 0ncr5380: scsi data uio requested%s: polled request aborting %d/%d ncr5380_scsi_cmd: polled request, abort failedncr5380_scsi_cmd: poll didn't finish㿘 >`  ` 2`d>@#(H /d * % `  >  #P@ :  >@#x  ē+` `Ě``+`+ $ `4`#   ?# #   #  $# # #   $ 2$" @    >@c#H 0ncr5380_done: state=idlencr5380_done: current=0ncr5380_done: dma free did notncr5380_done: sense asked for sense %s: target %d, bad status=%d ncr5380_done: bad state㿘 2 >@%! 2 >@!  @ " >@!Ȁ ,  $,, 25    `%` `>!   # !$,   >@e!$,$ & &  " *`*  )"  $,>  "@O $, 2& >@ΐ"0 " *`* @" >@p"<$ & `@l$& ncr5380_sched: not idlencr5380_sched: current set%s: reselected while polling (abort) %s: select found SCSI bus busy, resetting... %s: ptr but no data in/out flags? 㿘  ` @ " >@{ "">@u 8&"   Ć Ȅ ̚"ȗ+  "  - ,@@ Ę     2    `@0& @ƒ -   |> @ X #̒` & r&#̑, ""&    &  `& &#&#&#&#``0  > @ }$, &#& & &#&#&#   $  & >&#̀ ;b !5&#@2  > @e &  "  |"    @& € "   `" @   >!Xy*@ #>"<@ov @ "E ncr5380_reselect: current set%s: reselect, BSY stuck, bus=0x%x %s: selected as target, data=0x%x %s: bad reselect, data=0x%x %s: reselect, SEL stuck, bus=0x%x %s: reselect, no REQ %s: reselect, phase=%d %s: reselect, not identify, msg=%d %s: phantom reselect: target=%d, LUN=%d 㿐 " d>@~d  >" @`>y9  d ΀ @2y0  T  2 > X     *@" >  @ 01  X *@"+>y  d "  X`> @  X* d*@ p d @ b? x  d ` Ԕ? > @o U 2  >   `* T @ /> @X > *, "0> &  &  &  & @&#&#&#&# \*  \ $*@   `@  0* 0@" 0#! @    X & *@x~   | &#&#@, ` *@ d* p d @* ?& 㿘`  ``*`X*@`\*H /f * ' `T *@`\ *`X $`Xx@ `X? @ @ x8 `X @ 2 `X *@x/ `X ` "`\*`\*@H 0ҐT *`d*@H 0` `T* *`X*@x  `X * x`d @'a?w `d `@?  `X*@w `d `@2`X`` *@`X *`\ *@`d*`p`d @*0`X *` `\`\ $*@ %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT 㿘   ` * X# @ #<" ?& #&#  d @> ` "? w  d `  ?  2   2 h ` " #̀ 2   X  ``*wd#  `&#&  2A X`$ T#̀ 2   X  ``*wK#  `&#*& > ` `#*  &## (: ``27 ``# ` .`$  X#䀢 # @$ ` X* d> @ "? w   d @ Ơ? 2 X *@g `` 8> *` €X#̀  # X  ``*v#H#Ԁ "5 D X` ` > %  9%  &  4& #怢   >#h@}X #>#@}R #̀ 2 # X  ``*v# 4( #̐ ` &  X  ``*v#̐ &# X* d> @ "? v  d @ ܠ? 2 X *@X0Dӄӄ %s: SEND_IDENTIFY while not connected; sending NOOP %s: unexpected MESSAGE OUT; sending NOOP %s: weird MESSAGE OUT; sending NOOP 㿘 `   * X  *#Ȁ` ##؀@|("##А &#&###В  *  &#&#Ѐ` 2&#> @*` € 2 >(  :     2  .#       .#ئ >!@|  .# >!8@|  #K&# `@N>"u  d `  ? 2> X 2   28 X2 ##̀ 2 # X *@u #&# > T *@ X*"u  d ` ?  2 X *@ `4 d#̀ o` X *@`"֜hxּֈּּּpּּּּּּּրּּּּּּּּּּּּּּּ㿐   `*` /  *`// ///     @` $ , #̒`  &  X  ``*u<#̐ &#́ %s: sense phase error %s: aborting, but phase=%s (reset) %s: data phase error %s: too much data padding 㿘 ` @`><! `*@4   j   `>גb* @ >!@{ 0[2   @>! 4` `   d  d @2  ; >"@{f $ "  ` & ` @) `*  t  x    @ " $ $ #̐ ` $  X  ``*t#̰  $#́ncr5380_status: none? 㿐 `  *@   >& @{  ncr5380_machine: state=idlencr5380_machine: no current cmdncr5380_machine: unexpected disconnect. %s: no REQ while aborting, reset %s: no REQ for next phase, abort ncr5380_machine: Unexpected phase 0x%x %s: parity error! %s: reset SCSI bus for TID=%d LUN=%d %s: %d extra bytes from %d:%d %s: Target %d LUN %d stuck busy, resetting... 㿘 2 >@y7 2>@y1 m  d @ @>@z Ȓ % ,X` @>׀` "'>?  C - s d d ` ? d @2   >"4,  €ɒ/m+F'##>!H@z^ #̒`  &  X  ``*s#̐ &#> @zH `&#Ȁ`") h   @ "   &  @ p `" h#̀    X  ``*s#̐ &# h ` > @z!p#̀`2 # X  ``*ss#̐ &#̀`^`` >`& !@y ```  `>! @y &  >% (`4> d `b@sA  d `@" X? >!@yȒ  X * \ *@ ``* d* p d @*  &#&#& & & & &#&#Ё PP0@㿐'P@]" "@〒 Po !P@  !P@ "P!P@Y"P 'P bWARNING: no memory for vnode disks 㿘 . * "* "*  @Eh  >@yX#0@B>>" <"bȁ㿘 `>"ȕ: ` * * " * " >`<* @ Q d 2 `d$ @Q ` !"@ h ` *  4`2  `   02`   *@$  $"  `*@ `" `  d d $ d $ ` d ` @ @$ h0@vnd devicefictitious㿘`!@Ɛ`@Ò"  d"$($0$,`@厒 d$4>aH $8@G 4> aX@@`Đ.(4H2`  $<4J$Xq$$  aW4$$,@mݐ6  `4*`   >`cX@~O 㿘 >"ȕ: */  * " * " >`<* @2   ! &"  `  d d **@$ d **@$ ` d ` @ @+$ h` D :`*` * " * >А" <* > b 0 (& 0& 4 < T`& @ 0 (& 0& 4  !"@    @~  2 D@ܐ0: D  (%H /d * %  & $!$ `$!H 0 00"4("0 @%"@& @@豐 0 G  !"* `@  H' <`'''' T * : ?'' @ʔ h$  0 '  @ & 4!P " H < - T !P  H < " T' Ȓ @ & 4!P  H <  T  $  @P 4` 0(& 0@N& @! H /d4 * %  ! $?$ $!H p@  G `  !"*  Ȓ`@ H@  0-`  @ @L ~ H 'Ĕ@P`@/ Ȓ ̖@Ħ Ȓ @Ȁ?" @Ò %Ēp/ *  @CK ̖"0"< 8"4"8`t? ?`x "D"Dȑ< @"H"T ,>̐!d","X"\ "h "l `"` d"d p"p t"t"x "|"@H /d * %  @k ! Ѐ@`$!@H 0@㿘  0 $@mW&  0@ \`h "`h@-㿘 | D : * * " * " >`<* H /d4 4* % 4    0h$ 0@2$ 4 < @ " @D~$ @ @ < "@@[a  `0@m9` "a0?$aH 0㿘 >"ȗ: * * " >Б* <" * @` >>#X" @E 㿘 >"ȗ: * * " >Б* <" * @` >>#X" @E  vnd%d  : @@J!6 O>"Ȁ 6K ,* "* >А"< b* @   m@"(e e@߰ 0/  h@ 0) e`f@ "`g@0"@ ` @  @   @'x'P't'T'|P @ " @0@`  `@  @`&  @`$+ 3`  $ @ 2  & @AԔ jj    `@.@0’  @A H$P@ո @ߚ@Cu $P@Ģ* &`$@߇ >c@uÐ>גb̠0$@k$X@z@Q   @.    !&h*@  `  d @3t @P @N P@C) @k0H/ /@@>!XH 0T $Mk!K $D & !&*  @;&$56 @֐ 1$ @{A 2@24  *  ! >cX@{o ~@$02  " =$  p>"@I$ ̐" @@  ą* 'Є" Ȗ   ?''''''`@ ̒ @  Ȓ @o@B >`L   "  Ѐ " Ё㿘>"Ȥ*` * " >Б* <" *   @Ƞ!X* @*`"@*`"@`<*` * vndioctl: null vp㿘>"  Ȑ ?`& >@s" ̐ @ @H & & & ́ : * >Ѕ(< (>ׄ ȅ(@`2`Đ? vndlck㿘 1> @$ !#@Yߖ "    @   $ 㿘 `@& ?& @[m㾘@8> ! 2`8 @H >  a a ? *a a` `,a@} @ @ a @ ,a ` @ ,@ a,@ >Є@( @ <CB8 ( 8(H 0㿘>!X>ّ*` * "@>"d"@b9*`㿘>cd >  "cd> !!> !` +!#! @ !+!  + ! +B; 㿘>cd >  z"cd> !!%> !`*!"! ` @ ! `@ *! `  * ! * !` ! `*!"! ` D ! `@ *! ` (* ! * ! ! ` `*!"! +` !@ `*!  * ! * ! < ! `*!"! ` +` !@*! `  * ! * 㿐>al A >ʔ  @ @" >   #`>" @@"!>Ѡ @'gl>@ "!`"@@ *`> !  *?@7 >> 8`@a` >>"aL@aZ    $al    ;n vAMaX ֣d° x㿐 >ʓ.  @ . @6ؐ`  􀢠K@` `" #@ `& & 4 4 :?  ; ?# :  :  : :2 > !` @ >Д@x`B _:x$`$`$@2 Ho o>a`2@>А @ pB: pH p@0>!>"a(` > ` ` ` @ @ ` `) B ; ``!B =. !>   %@@B =B$ ؐ :  $@@  >$@@` 8H 0㿐>@`ސ 8>Ж@h`B :h -> />͒` >?"  %''a #aH 0#> a> ! a  c" 0@(@ @$a1  #g, *  c*`᜖ * * # *  (     * 0@ ??# '> > !    c" 0@(@ @$1  #g,*  c*`᜖ * * # *  (     * 0@ ??#  @@B > @ ""    `> " @X!Ho o؀NH 0 "@0 y> ! @ 8"2," " ",`~7>  @ɐ@Ԓ@>!@ > `$`!`` `` @ `  `.@`.``.``.`` `  `  `@ .`.`.`.` ` @" !2*  c!!1  #g-`*  c@*`᜖@ * *@ #@ *  @( @    * 0@  @ g? @ھ X@ڻ >Д@@B :rndrd`   ` @8Ho oa> - €[ > a  R #>Ж@ X> ``C :X>!Ȓ! @V  =! 2`@8>Д@`B :?#0*`,`:`#?#?cii,`,  $ 0?# ,  0 H 0   ?#@NƔ ` {DL p`` 0>  @    2`r  m ?#@8*`2  @N W ` , *`2 `*0` , 2 <> > !` !! ` c" 4@,@ @!!1  #g(`*  c*`᜖ * * # *  (     * 0@ $  `   >"#d㿐 @"@% "@ "D 8""@"5 Y @"H T  "@"  L b~@Hb}@ EF@> ! d =!6@C 27  d > ! @@ *"("!6@C 2" > "! !6@C 2 > ! `?> #"#d!6@C >  @@#" @D    `  ``\ ("  `X8 @ "8 "" h  @ ''?'  ' '" ऐ @   H <`"?  А@Ŕ \  @D@/  @d @ 27܀  @  @ ܀     @> `D @x܀`   @) @ f "!P' 'M =`?'؀ Ԭ'̀   (`"$ , X@@$ ,  ' $ , :`   @g Z>ڒc` ' "` X' ,  " ,@% , :   @D 7 H ` , *s ` w  q `  !@k7!P "@ ` `ؓ2` ``?@UԀ M ."!\򀢠6 M`! @pM`! m; ,@˔`!  ` @`T*  ,$'2/$ 0! , @T* $ 0 0@42  @ѐ V  ,$ , , l&$ 0 ,耢 B :@:@ @ۃ;`   @  `H$$ , ( ?7$ , "@c@@̀  r p?@$ 0䀢` >ڒc` "` ̀ ,$ ("( 0@6 @ 0@H@ @ . `@ 0?܀ / ,@   '@0/   @@ @ϐ"H@ @ @ ܀  @ "@@@ޝ 㿐`  `@o ?@p "`@`" ` H @#` "@㿘>ap> 9 @L@>>"b"x 㿘>"'>%>ڑ6` @ *  " @ @2 2  `@ 6` 0 2  㿘 > 2 @>ڐ@ * >ـb 2  @2 22"&& # 4 @/    2   " "cd9660_inactive: pushing active㿘 > c    4 >Ő#@ $ @ x`@  cd9660_reclaim: pushing active㿘 >c    4 >Ɛ @e@; " @\$  @9ؒ :&  㿐  '  6`x6``@     `. :  ` @􀦠< H 26  @`x!6`x @2 `x @6`x  2 `x 6`x  2 `x 6`x  2 `x 6`x  @2 `x 6`x  * @&`|  * @&` `x&`!m6`x&`| @ٓ㿐'􀦠 `  `  *@ :  ` @􀦠'`H ` 2! ```=@ ` @@`p ````d&`p&`t`@`h ``p`t&`h&`l` `p@ `p`t&`h&`l&``&`d @?㿘 gl '    &`&@H đ*` * " * " `  @* @, : $ @ d@? * @,`,`* :`* $ @ې"?, * * "@*`@*`" 0*  d ,:`*`" *  * $&@&`   * ( ?А㿐 ?/  /  /  / ޒ / ڒ  //}   (  *  * `(   (@2 x   *  ( @* | ` *  ` `(@*   *@ 2`"`RRIP without PX field? 㿘>@jy"@m ..RRIP with incorrect flags?㿘  `(@`$F`0`2 `,6  /,@ ` >Ǩ# ` ! >Ȑ ԓ*` €  $@ `$@  `@>>! `@  >@j,#`,``,`   @`(&`$2&`0   0`( &`0&` `$" &`$2`  ?&`                            RRIP with incorrect NM flags? 㿘N >Ǣ#`  >Ȑ"*` €  >>! `@   ?>@i!X`,``(@2*``,2`@  ` `(&``$""@&`$2`$``$&`$ `  ?&`!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!㿐> `$* * *N !   !`a\  #\ `$ `@`(0`( `( 2@   (  *` *`  ( "`"`JC   `( x0"`㿘  (  2 "@@ڒ`h  @  h  @Β`` @ h l" `" d  -@`p.` 2  "@@`h  @ h  @`` @ h l" `" d  @`p`@ h l" p" t` ?&` 㿘@5 㿘   ( ` .`( `(.`. (0(@& ` ` 㿘 `? @`@&`!h㿘 . (. &`` / ``..> >`  .  (.&`$IEEE_1282IEEE_P1282RRIP_1991A㿘  2-    2% ` 2  >ɒc0 @l 2   2` >ɒc@@_  >ɐcP@X  `" =&`㿐 `!`' `!a\@`2`  *` * + `  H "X`!T  ?#  ` )&` `  "`L@L@2 L`L @2 €` 2  ` (`@`: `` ,`) ``! :` B8 2  + ?@A  H`` @ @Ֆ  2  €   2 ` '>א''ܔ\X6  !\ x`!7'' '''ܐ !@N>״#@` Ĵ ?'Đ8`$  7>א'6'''Ĕ'& SP`>ʢ# "&aX@e     1&aX@\  2?"'>'ܐ"?  *    ? * 㿐Lf ;) ;Z  А S, * @ ?Ѐ –.`@*`@ <$    ? ,"@ *"@  " . ; 0`;   ??? 㿐`\    =. `.c  ;` .F6cd9660_mountroot: can't setup bdevvp'scd9660root_device >">>a >@5a\  >>LcL#>@-`d >@fW"07>>ː#c @偔 /`d'@   ?"@d@4 0>՘`" "`@  #b` "@b`"` D@@G   Z p  <`@| @   @4o @&(&&$&&,@ጐ dt "x@:[ >9 `x& @0Q ``@ @@! @縐0; @q<@@2  @9  @ ! YZ Z`@ϗ$@ Z  Y `@ό$@ L[ p@ D0@ߐCD001%/@%/C%/E㿈 x  '`< ''   b @ѐ ]@V > d T `@  @= I쀢   ?@ݖ >  (2 ^4(?@ؘ > Hb @`  2   " 4 :0 - ''&l 'X>̒b@9  " >̒b@1  " >̐b@)  "   2  @'􀤠c( @'? * b> ?   9@0!`@ǒ!`$`P ` `+  P* `@ @ *@ $`a$[- "  +  *   *` $aH ` `+  গ* `@ @ *@ $aL$`]$a\?$`0`%0@ҙ&a&`d` `< &`h&`<&`@$`$`$`  x" l`2%l aH?`* ` @` P3H $aTl l ?&l`0 "`0@c'l  $@` $aP $aPaP #`!a$Z "  *  *` * $aH ` * `@ `* @*@ $a\$aL0 &0$ @,    @# @   쀢   @?`@1 9&a㿘@J($`D   '>̑,($`<$`T$`0@8$`@@@w I`H @  B > c$, 5? * b ,( (@Z  8 @V  " "   !W<  @&&&.6&&&&.&@X6 `0 $`0@Ѥ 㿘6` @朒 a   x?# @4 @ @1_ 9`<*@$`<$a㿘!!$ǐ!P `?@v -㿘! D @ &`&` &`&` &`&`&` `TY̔ Z `YȔ Z!LaYĔ p&`4  㿐 `` & x` &@- & F㿘 @1 isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] 㿈!K & >"ܒ @"  & :@. @ڒ >ϔ 4 @% "`$$M$  @$ "!2F'6@ @䳰 F> @`!  @䧰 F>ϐ 8@b0Ӓ , ?@C  @䗰@Р>ϐ `@b0 H @ @@ " @Ћ >ϖ  x@b@  F$  @B$ 6@$\@s    @ @]0 H   * *   *` $T ` *` ` `* * $X @ $\"tP ' "' ` *@ :   @Z'/쀢 " @! "x@x< @ >ސ#X2`  `&"t>А!H*` €>#"`L>#" L@ >`$ "`" L@B@$'TH@`0 "`0 &AAA@@AA@A  2@ "`\"`㿘!@`  `0`4&&  `@, `2- ` 2) `$2% `,2! `?2 `2 t`"  t >Є(    BBBBBBB  㿘  x /| @ `   `$ `$ `x /4 `4 `|$ `$ ``$ $`d$ (`h$ ,`l$ 0`p$ 4`t$ 8`$ D`X :`< `X .  t 2*   @-O$      $?'''''''''''@]耢 А$ < @.  $ <$ @`$ `X :< H t$ 㿀   1 6 @ 0 %  `@ `  ` @" 8 X @:b   2p `; k ;  >Ѐ ( , > ,h'`X* ) :`#\  @L?"@ `X* `?'#\#`@Y ?@*%@`@%8 `H@?`@  X: @   `0 "`0@j "u㿘 0"z@"      @    㿘``*@ `  ? 6`#0@* &#@#D`#H 4"@&#@?#H`?&#D&#H @>#0 2>#8 㿘"" N" =`?  " !!? 2!@5 ""!  # ! 2%.!   # ". "   ?  6"#(!># VQ"  #(>#VI" ..㿀#Pऒ `   @+' '쀢 ,!, ,",!, $#0 $#D  2 '* @+Ȕ $#D$#H $#@ <#(#,   @ɘ @-s 0 `X#(  @  "#(@͈#(   @  H ` 8#(  @ @ 8 Co<#(` ϐ  ˬ `!@,"  $"T* $"#(  B<#(!P >Ң""ʘ ``>,"#(7!X `!X," "` 4"L! 2 "," % "  L! 2!P ,"!P!`  !\ #\`? `"~ `,"!P`2#(#(" #(>`e #,8`#(  !P  ,"ǐ & ` @,  #H""@"@ "#8@#8?  #@@,#㿐    !P " V ? ?2@*@  @N  +   H   (`@̡ :  $@ @* <  ` @,^ @̄ 0@́`  `@" $` "@"  "@=@,> 㿘  @ @R 㿘  @ @H 㿘   @!̐ 4㿘 औ  4 @!`cd9660_strategy: spec㿘` \t? >@\# T P@2 T   T@ "  T 0h$ 0@$ 40?2 T H@ <$ @ T?> x` $ D $L*` € 0@η tag VT_ISOFS, isofs vnode 㿘>@] ȁ 㿘 `@  4`>Ԅ(`!P`     %` $` "`     QQQQDQpQ|QQ㿘` `* @?2 "! @ "8! !0@! @ @@/ @8`exec: a VTEXT vnode has writecount != 0㿘`&`(`&`,` &`0` `@&`4`&`D``2` ` ` `  8` 0 d >@["0 "0``@*`@ې``>ړ* @` &`*`" ` $ `($ ` $ @`  $ $ ``@*`@``* @` &`*`" ` $ `0$ ` $ @` ` $ $ ``@*`@``>ۓ* @` &`*`t" `  "``0 """ @L"㿘`&`(`&`,`c  2 * &`0` `@&`4``&`D`@*`@i``>ۓ* @` &`*`" ` $ `($ ` $ @ގ`   $ $ ``@*`@I``* @` &`*`" ` $ `0$ ` $ @p` `  $ $ >,``0`4@ * @ "@ ``@ >@``>ە*` ``&`*t"  " " " " " @ϒ㿘`&`(`&`,` &`0` `@&`4``&`D`@*`@``>ۓ* @` &`*`"  `` $ `($ ` $ @` >̐   $ $ b(``0``4 *  " "(``@ >@``>ە*` ``&`*t"  " " " " " "(``4 *  , &`4@h㿘@) 2 ` $ \ @SF2  @2  2   "   ` ӄF2'  @2   >٘`  *@8 *  2   2    * 㿘?"`  &   " &   @&"@@2   '@`'@  `'@>  'b(`" 8 E@  @  @ >ړ* @  & *`"  $ `$ $ @"$ @$ @ "B @* @ڐ >ە*   & *#  "@$ `$ $ @$ @$  @* @ >ړ* @  & *`"  $ `$ $ @ߐ$ @$ (@@ @8 @  @ >@ >ە*`  `& *t"  $" " " " @" 'x   #`#\#d#h#l @k 2`   D 'p'''''@d   t w `@@$ o H <`i `@@h! 2[`x  4 2Q`   w D  ,  @& 25`0 'l %'h !` plh  l@ p   @ "@&D&pl 'p`@ՠ ` @@( p@4'exec: a VTEXT vnode has writecount != 0㻀`  ` 3'/(   ? 2 ` `8 " ,`0 ذ >@X# ,  @&$`  ?&`4&`,/, >ْ  2,#`  >٠  >ِ!&`T>ْ? '. 0  `"@`: " @` @   `v . 0, 4 , ?'''䀢`$>ؐ#*` €``Y ` `쀢 @ &`(&`,&`0&`4, ё, ? O>b,`0@*@ 'O   @%$  @%~ OӔ$&``&`d$ *$ ,$ $$ &`X&``&`D@'& ` 0@"0@' @` b(bbbcbP```d'V `XX  @& @& @̐`0C` ` `@`€@`@   "`@ & ' '' >"( ''  ''''  ''''`\'''M @@& @&    #!exec_script_makecmds: epp already has a fdexec_script: copyinstr couldn't fail/dev/fd/%d㿐`H`? )?` %>ْah@K  2 `  @ 8  @ L  2` , @ J@ 2`*@@ *L     J@ "` "` L %  J@     2`J@ "`$*@`J@ "` "`J@ " `$ `J@ *@`$` , ` `!@`  "``H ">@V̐!p@ F`P |`H  &`H2` >ߐ h"` "(2`` "` ?"`H  &`H@$.   ?@$) @$@ ` ? @$$`@Ơ`$ ?@$ $`H  >ْ @$Le   >@V!`P a@X# $`&` `   4@@ 2"``H  &`H@@N @% `H&`L`$ &`Hh@2`$" d. `$+" " 4`H   &`H ?&`H`P@ Ր `@@& ` 4@%y@  `@%r ?  @%j ?@?vm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapvmcmdset_extend: not necessary㿘  >@V" , & ?* * @#y  ,  Mʕ* @%. ?& 㿘   :    " @ٙ   ` && @% ?㿘` %>",`@ 2! ` "`  @m  2` Ac@  ``@=;`  `€ 0 㿀`+>̠"(` c* &` ` *   @=? 2&  #`#\@ ` #d`` ` #h@t#l 2`2`   ` @  8  @C @ 㿘`>̒b(`A`c*&```  *  ` @<ݘ?  㿘<>&`<&`8 >b,4` `* &`@+``>ە* ` &`*t"@ `<@ `@`8" " "``8"`"`"` "```*``` * ` &`*"@ `@@ "``@`<" "`"`"` "` vm_map_lock: failed to get lockvm_map_lock_read: intrsafe map swappercannot mount rootcannot find root vnodefork initpagedaemonfork pagedaemonreaperfork reaperupdatefork updatecryptocrypto thread㿈@>>٢ h@FD"b@ >@V.!P>@V+#8@1@K@@#"@&> `$``"` "$` >b$a>  "b" " >"b$`D$`@>Ж   # >"b  $`,$`>,`1,a a #@LS >b`p@D@>a`@D;> !$`@*5" `>"@`>h">3 `"`2`&2`$`("h  `x`"`p"`"`%->1>)>9>+>7>5> ?  $`$` : : >!t`p  @@< @4$!>̠"(  8+@ 8  P< @  !><`!$> @DcP> Ē P$`$`$ $a$$` @&A @=|@0'@W@͂@*@@@ws@rG|   @  2 @H /f* '@WJ @,H 0@9>" @Բ "`>@S#H< "<"`  €" ">@S#`ah @$ " @@_$  b%b"`b"`P`#`&P"'""`"$`@.1$`  @– ">@S}#x@&!>ݢ@&#@Yϒ>>ې!D㈒ @ ">>@Sf#>ې!p㨒 @Ք ">>@SZ#>ې!X @ɔ ">>@SN#>ې!ؒ @ >@SB#@@@@ >@/" |/sbin/init.bak/sbin/oinit/sbin/init/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d P>ݐ"X @ '''''@  `>>@Tw"h0@Tt"0@ּinit: couldn't allocate argument spaceexec %s: error %d init: not found no initp>""ɐ>"( >"@ 'cԖ @:^?  >@Rǐ# > bT"bT؀7> F -/"(ጢ `  s/ِڦ  * "$@ HĒ@Ő $@ H ?I ?I?I'''@ r >ݐ#H@S 2 ->@S#`>@Rp#x㿘@W㿘>@ߞb㿘@I㿘@нP !6@( J@  '''''ܐ@] ;@\ t    @@ , >#`#>a "@>M@BH#8 "a @@ $a$@ >M#8` $>ߒb`@Aؔ@@>#  ` $ @+$#?: IƔ Ȕ@*$ @7@7`'H /i* * > aؒa"'`" 'Вb@ ??H 0 @`7Д̒b?' '?/a ?>!XK>!\@" 7``` @А 7`0 `,@5 7',  ' ` "? l?' 7 /@@  #`#\#d#h#l  ( @Z @*$㿘@a . c   6  `  # (.` 6 `.` @.`6 Accounting resumed Accounting suspended #>a`%!>`t 2 `H  ?@ F$a P >bKk\@D dd@/>a>"$ab0@Q, '>#`*`t 2 `H  ?@ܖ $# P >bKD\@ dd@>#$a$#bH@Q >!X>K3ؒ@@weird hz㿘 >M>M"#T@y"cX> `!>!X> ""@>H>р"`>!\"H!X d> ! @"  ` <>0>0> $  >0 >0 "c>   "c "c>  "c@P#㿐>"&!> @` !\` " `@?]` 2`@-- ` !\`  >@?M` >͐@- > `> @ː> a> (a>!\ `"(p'`'> #@ p >ڔВ@"?@"?/!@"−`">>b?c   #b :`+ #b $ #:+ "#b Р@"?'>R">> "?/!@ #"'6'>"0* €>"䀊   ($b& $$bTa@ː >ے? $b'T a@ >ې $b ' $b>"䀊`0"$b>耣`>"䀊` >b ;4> 㨔 ?*@ $"䀊` >b ;4> ##@ + $$> >#  㨔 "  : "@$ "@;  $>!(>X㨀 `*@  $ d <`6:` :  "@ @6: : "$$"@? / >БH 0!@?0 >  *` H 0H 8hܝ㿘H > !!  # " H 0  А"@? - (c(c' >Г, "@*`" * * >А\?@2  !X1#@3 #IJ>Р\@   #㿘 , (>! `& ,`!"!> `H /m * . > >a>M>M"T@"cXH 0㿘 , &>! ߒ& ,`"!>`  H /m * .  >M>M"cT@"XH 0㿘 @$>M>" ,`  @Tv >McX ? S"cX L! `B < >a8` 2"`>a8 -"a8cX ? ;"cX >> b > ؒ`B < >a8`  "`  > В`B < Д8 ">a8` "`>M#T "X d>aT  $ d>McP  "cP@8T㿘>"䀊`Z􀢀>@ "b? >> "b * "">b䀊 ># > > !##b#`"##`%!>@,* ## : "@$#:d!>H8  >" #*`: " "#*`:  $#>"#@4$# @&$#㿀>\>!X>>>'!`''``'' @2n 8 **6*  6 *  ? * "?fd_unused: fd_lastfile inconsistent㿐 @ @.`   @ @dup2: fdalloc㿐 ``@@.`@   ` 2* ` (& >!t @ 2`& @p 2">@M!@@Ix@@ @,`@ ", `` '>#*` € ``   ` >!t  @0ܰ  ܐ@ @ &`  @  @ ?*@   *`:  *`?:` @& ؒ 34 ` %  ̒@ 4  `'ؐ~ Ґ  `@' } 2 İ  4 ' ~0T 2  ( `(& `w &T  `  ("(`",@ "0   &`@ 2!  &`   `v`| PT w ` (Bg  nW W @ B ?W "#   0[ 0X  ",`$,   ,`$,   @@9T 3  ( `B$  +W    0" @ B ? W      @^ @ `B   *`  ' (`" 8` +`* `#   @ +"@   2   3`* @ `+"@ @4! " 㿘.`"  @ >`&  *@ ?2   2*`   * *#  `  * *"  @>@Kw!Ґ& 㿘 .` `2 5 @  ?*@" *@ @>`$  *@ ?2   2*`  * *#  `  * *"  @>@K=!$ @㿘 @`@ fstat8 @`*@@ 2R / " (>>@ꞔ  (@hՒ  (@e֒ @J"p2 !6@  2'`A  `fpathconf㿘 @`@*@ 2R  " (>`   ""  @'`>@J#p㿘 >ж at@ @ & : > @ !` >  "@, @ ?2 ?2,   2  2 *  ?, @?2,   , ?Da8?O  ,   : "@,  ?2 ?2,   , ?D<8??,* 6$> +    +@@"  2 3 * +@@" 4$ $$ &v r  1 2*  8, ' @* A$@tA@k$ @B ' :`: ` :`: @7,` ' @q,` ' @k :  : * A@@@$ :  : * A@3$@ :  :  $ $@ '@ '$$>a<$$$  "a< >t " "@`  +  " ?,  2?`쐂? file㿐 ɔ >k>at0  @;`&  *@?2   2*`  * *#   ` * *" @>@IR!> & >@I= 7 "㸒 & @Ð 0@ 0 @`" >@ $@" "@ $ `x`x $" "`x$   `* "@ $ $ @ 2@&@& 㿘`"  "` "@@ >c& ?"c@? &㿘   '@v!@V!  @$` $` @>" `(`x ``4`&4`$$@$`$`$`$`$` $` &0& 㿘  ' @J!@ (@  " @  `6 & ( x&&   `c*`@,`4`@: `c,` * @4`,` '@ & &`:  :   '  &  &  @, & ,  '@ & & ,`@W@S < < , @L , @H  `#`" `  ""` 㿘 &?* `14&`  "$@- &   @{ ' :  :  @p '@m '@ "@@b 'closef: count < 0㿀 `" `, " T 2  (   ??77 @w @ ? $ ' 6 >@G"/*  @2  (   ??77 @W    € Ð㿀 ``@@.`@@`2V` 5 2 -`(  ?7 ? 7`?А*@6`   7􀊠27 ` 6`   0   @ "\ 㿘.`   . @   5 2{S  " s #@2" l  >` +`* ` #    +  "  @ ?2   3`* `+@"  @4K& J "  >` +`*`"@  * (   "  @ ?2   3`* `(@"  @4&  >&  *@ ?2   2*`  (*"   ( * "  >@G!2 [&  㿘  `` `|` $`x`(D$($$@ &` t    `@@`$ 24H < 2 2 `$`,(2`$` &`(``$` 32``@@Ւ @ 2|4`$` I 2`s @@瘒  2l4`  #`#\` #d` #h#l@傚 J> ` "   &` >٨ đ, €  2`H`H  <a  ,  >`D@8 `,@@ ` `4   $   V` @V`@@ 4@r 04@n @Ɋexecve: argp == NULLexecve: no vmcmdssys_execve: falloc indx != i`>@!DH`)>>!`>ٔ   D@8&!D?@ ''H!D ?'l'p'L@i't!D'"'''''''''ؐ 5>>c8 @'b 2>@Eʐ"`  "  J@,`J@   @@ ?  @ ?ؐ ?'``  2` В;t԰  ?Ԣ` ?%@'Ԑ;  Ѐ `` ?;V԰  ?" 0Ԣ`?%@'Ԑ;  Ѐ   ` 0* 4 ?"  a " А ? ' '@6:> >$`0 ( 2 $$Đ 2 $В@ 2@ $$  >@E("x  @ €@ ` - t''>`$" ؐ c#=c;  ]` c0"@; R=@ @8  '<?,6c 46@Ȕ @, $, $ ?H@-x$,   @,*@$, , ",䀢   $@ @"@쀊("쀊$",! >ߤ`h$, `'@,  '̀R ( `   '̀ 21    ݔȀ =Ȁ>@DX"@ s@ƤĀ @JĀ ``8 "`8̔ 2`2 "`"(  $$@ >$, " ", '#8H /i * * @4+$$$$ࠖ *@" " @ "`"`H 0#8@$|@-  @@D ,€ U (,(@   ?@ $ @`E @+@ Ӑ؀  ?'C@侒 @ |@ #8@$W@ ?0# @[V>耢 "|@ؒ |@Ւ  @䟖@#8@$;@ǒ ?@| @y? 㿈`` ''9  2V  T,  **` ` '&@'9}  .99쀢 7  @ ?' '9c  ? &`9Y   9쀢  ?  '9B   㿘@@ *` init died (signal %d, exit %d)㿘 4 'H>">`@B` ,  H  @u H ,@ w&!8`& , w H@+& ,?&! @3&  `Ȁ `Ā @oO@l4`Ā 2! @Z>! `@2"!` "&`` `|2``x  @ @w` ` " &`@侒 ` "&`@k&`&`!@Q  䀢`& @  . 1 8`" < <"`< < 8"@ ` "`   ">䀢 &  "` "&  T`>@+*b`H%>`L@ `,( 7&`,@, 2`L` H6!4 :5!8!8`@  !8@C`H ,@& h H ,@ " ,>" H@ T 2 ,@* ,@@" @* >@h"b@H& 㿘>TT & 8 !T 8"`<"T& <@*Ӑ reaper㿘#>%>aTaT   @)aT 8`" < <"`< < 8"@@# ,     H@, 1@* HaT@aTwait㿐@ 2`!` &@`?" T  l  , c@" L 1 4  ! @ 2W LL 1 3  4&``  !4'7ܐ 2g` `"  X!87Ҕ H 2] X " `@@ I ` $ `@ 8 & `4!4 !8@ H @`0B 2 L 2 L `   4$ ,&``  !4*  '7&  L 2 , 2` 2&>H! @(p " T @ $ X@ @*   H LP PPL `T "L`TL P"`T`T"P"H㿘!8@t @ `"  "`   "@ L`" P P"`P P L"@ @\? `? "` @@ @P * 쀢 "@@G )>c?"c㿘  @5 㿘  @, 㿘@` @ "  $  `@    `@2`@` 2a @  procppwaith>!l>  c'L'P 'T 2> >@@#߰ #@  :   p  > t c@ے?ɰ #>c@! '  ) @ !@  @'`  T'ܖ`@6`''Ԓa`''>ؖ`'''>`| ` "'>%> +> ->/>#%""#c@  X(@c%"$" X?\@  ?ܺ p7'̐c$ *>>4 bb  #b4  @ b 4$b   4$24>>"ц >>" " , 1$ 4 $  "` $$ $ $ 4` * @ $ 8@  8"`<` 4 @ *`"  4 * $ <$@N$7>@/>@/ ,  ` $ ,$  ,! , @ $ ,  *@ I   $ 7   " @ 2 쀢 $ @ ` $ Ր$ א$  ` "$ @ $ ` "`! `  ,  , $ ," @ , $ , @`$ @ @"`D$ D& @$ H؀ , $ , T`$ L L"`P$ P& T$ T @"  $ $ @Ž쀢`  ` $ `&   <@-y $!$ L@;P耢    %`` @%"`  "`` @"`"  "`` @ "  " `` @"H /m> * .>   " "4!6, 1@ ʐH o@ >̒(&  " "Ѐ  "" 4 , "  4#> c@%  ,`  4 T"`"@㿘Ho o>" "a @%˒ H 0 %:㿘>#'P'L'T'X  L5>0? ? >5>8?> @㿐>'T'X h   ˜ @@DԔ ,"' ,! @@%T2& WARNING: thread `%s' (%d) exits with status %d 㿘  !>">`4!Pa @?̖"L. unable to allocate kthread_q㿘  @ Ĕ  2>@><!@ $ $ $>ےc `""`㿘>#   $ $` @ @ a  2㿘 䀢 ` @? 䀢 & @㿘 ,@g @l6 `4a &  5Ք h>"Ȑ $  @ h 6 $@$`  `*" 'Ȑ@'@  *@$X>" Ȑ $   ''Ȓ7''@ *@$ h>" Ȑ $  @Ɛ'Ȓ'@ *@$ h>" Ȑ $  @'Ȓ'@ *@$ h>ـ`N"` $`>b(  8 Ȑb  @  `'@'`'`'Ȑ@a %"@&`&' ` "@&p 8 @43P א@ q `*@$`X>" Ȑ $  .` >`''Ȓ''''@ *@$ `>" Ȑ $   ''Ȓ''@ *@$ P` ` @  *&   $ @ @'''''ܐ!@ 2|  @t`  @@ۭ  *@& l `> !`X`䀢2`@ &` ` ``2`B2` =  !@E  "5  `/` @i@1`@``@ `  @M@"  @@B  *@& 㿘@ ( 2`-`&` `2`  &`?* &`&` ` @` `` 㿘 ǘ T`  L " Hktrace write failed, errno %d, tracing stopped h>٢ -"@  ,Ȑ  '?''''''̀` '`(`, ''''@4` @݀ @ >  b@;> !  䀢2 $    2  ` 2 2  2  2`   㿘@  p?& & 6 & & &P  2 lockmgr: using decommissioned locklockmgr: non-release on draining lock: %dlockmgr: not holding exclusive locklockmgr: upgrade exclusive locklockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: pid %d, not %s %d unlockingexclusive lock holderlockmgr: draining against myselflockmgr: unknown locktype request %d㿘 ?4 0 @@ p`  >@:!8> >!`@:  *@& `  & `q>!*` € (  'f   '  `&   *` @!ד:` &   M J  & 0E  &  >  >@:! ? *`:` & 6   ;& & 0 !  ?& 0" >  >@:! ?&   !2   4   !/  !&    `&   *` @!u:` &   M  >&  $& &   "א >@:K!   @"  @>@:6"  6 0   '   " 0 &  `&   *` @!':` &   M  "& 02 M   ! `&   *` @!:` & 瀎   =& u $& &   "g >@9ې!   @>> " @9͔H ?6  ` ? ;& & 0   ?&  D@"h0@ >@9"` '4   0 ,    h&   *` @ :` 2 21 M '     & &  6 0>"@9s  (" '2  2  2    w& @"xج؈,ې4 lock type %s: SHARED (count %d) lock type %s: EXCL (count %d) by pid %d with %d pending㿘 > @:!   $> !V @:  `>@:">M` ` lkmopn㿘  0%$ >c(  #>`#(#(`&#(!b@  2#( `#(>c0 $#( 㿘 H @f >c0?& $ "c0& D& & &>M#`  & "" 㿘`"  "`>M"#d "@@ >c0?"c0 2>M`x ز  . &% >M#`/  ,@ 2 >#0  & >M#` 2  &㿘>c, % >M#h``,  #h " #h`D?"#h #h"$c," $c,>c8 @ #h" $c,㿘1>#( #( >M#h`#(#( @ &#( DDB symbols added: %ld bytes 㿐 c @' #@> #@Ő c'c@] ]'0# @"30# @  P'10 #@#@G > !`4D "A >M"#h`6 #@  "`h1>$ &#8@" h0 c""@ & `"h"4#8"<@Δ h"`8"`0 & h0 #@"`8"`4"`0& >ې "c,> !` 1>#,? 8   >M#h`` " (` -@ 'h``    &#,h "3>c,?   " >M#h`8`4" (`0 -@ 'h 8 4@@   &c,h`8"`8> !` !` >۰#,   2 7>M>M#h @  "@ @ hv h  "(   ' &#,Wheh`0 "``8`4  `, `< h>"D<@8h` "`G&#,> !`C 2> G1>M 6&#h`(   .  >l"c,#h(11>M  &#h$>&, &,& &,@  #h &`, &`,`&`,, '㿘@~㿘@H 㿘>M#` "  , ,`@ 2  "  2 , 㿘 ,`8 >`< "` 5 a >ِ"h >`     `a .`@ 2`a > > "h.``.; `.7  $` ` >ّ.`bh `.- 㿘 ,`  4`2   @@³㿘 ,` `} "`   "8`  ` `>9!x  >8">`$  " `@  2`ax@ .`h 9>9!x@ 6b .`$>8", `-ʔ `5 `>>!  >9!|>`$  !| `@ ( 2`a@ .`5 >>!@ .`- >9!|, `- (` (-$` ` ` .` .`">8* b `-} 0 >9* a| `-t (㿘 ,`A I`G "` @ `>!  >ِ  `  `@ .``2`!@ ># >!@ >  .``-5 `-1 >"!D $` ` >ْ`.` `-% >"!D㿘,` >"x*` €      0DlXp㿀@ # H /i * * @v>>"b''?H 0@+  >b @@2 `a   b"`l>ې &>"&P@ * D z a6`@  qH /i * * )>%# '>$ %>$  #>b# ? @ $b䀌 1>&"쀌 >w>"耢 6: : '#>'>''b'"#H'''БH 0@* D b @@2 `a   b"`l>ې &>"&㿀H /i * * @>>"b''?H 0 @ temprp_addrip6rrNDPip6_optionsmalloc debugmemdescpipeUSB HCUSB deviceUSBpoolUVM aobjUVM amapRaidFrame dataIPv6 if infoSec AssocIPv6 fragqIPv6 discqVM swapVM page bucketdirremmkdirdiraddfreefilefreeblksfreefragallocindirindirdepallocdirectbmsafemapnewblkinodedeppagedepvfsxform_datatdbpfkey datapfilEXT2FS nodeadosfs bitmapafsIP queue entadosfs anodeadosfs nodeadosfs mountmiscfs nodemiscfs mountexecttysMSDOSFS nodeMSDOSFS fatMSDOSFS mountISOFS nodeISOFS mountmrtether_multiin_multiip_moptionsNFS daemonNFS uidNFS srvsockExport HostNQNFS HostNQNFS LeaseMFS nodeFFS nodeLFS nodeLFS segmentsubprocproclockffile descfileVM pgdataVM pagerVM pvmapVM pmapVM objhashVM objectVM mapentVM mapshmUFS mountUFS quotanamecachevnodesNFS nodeNFS mountNFS reqfhandlemountiovsessionpgrpcredmapmemioctlopsgprofnameisonamesooptsifaddrzombiefragtblhosttblroutetblpcbsocketdevbufmbuffreemalloc - bogus typemalloc: out of space in kmem_mapmalloc: allocation too large???vm_map_lock: failed to get lock%s %d of object %p size %ld %s %s (invalid addr %p) Data modified on freelist: wordprevious type%s %d of object %p size %ld %s %s (0x%x != 0x%x) malloc: wrong bucketmalloc: lost data㿈> !.`@`>@2u#h` ` `5 3 `@0 . ba) ' d$ "  @@0@  @  @@@   @  > "- @H /f * ' @?>ۦ#c<.`  4  @# @񀎠 *@  $ @ r!>>`, * @ $`>̐b(  @ *  />> 0!> (@ >ۧ:@ (8!, @$ 2` >@1ܐ#H 0 >`> "  (&  ,:@ a*`$` * 2 @ ?#$2>@1#$`2``@ $`, (@"7o$@   @b" *"@2`"@" "`` "$`@ $@ *`2` >ې#<:` >>">#`#d `h:`@2Z>> @`7>ۦ c8`| 8>" `R  >@1^ 8 `" ` @!ݖ 8`| >" `: `?@>#`>> 0`h`#\ @2$@?"  6   7o"" *"  7o" 2#\ *>b (&: > a* &R@>@1   ?>@1 H 0 2` *@$`$`` $`$ $$H 0free: unaligned addr %p, size %ld, type %s, mask %ldmultiply freed item %p free: duplicated freefree: multiple frees㿘>b>`(> &a: * R> "> + .`@  * H /f * ' >"( A>܀h!<`b` `@`3 1 / - da( $& $ ," ( @@40@ 4 0@ < 8@4@@ D @@ L HT!<*` " >>ې#<.` >#@0K`,* '>(8@+ (`*@ " $`44``  6@@@ ?$@$ H 00]7o"@ `>'> 2`#@1@0Ѐ`     7o""@`@ *"@6  4 * 2  &`$ >@/# @$`  $ ` " `` $  $` 6@@@?`$@$ " & $ H 0kmeminit: minbucket too small/struct freelist too big㿐'>,@* #>b(@%> @- > "ab(!>#>ɠ"a)>Mcp#\  @ ,> b>"8`  ,@$?@$??`*` $` b(!> " )ϐ* @*`@ /$? 6$physbuftodo < 0; minphys brokentodo > MAXPHYS; minphys brokenphysiodone < 0; strategy brokendone > todo; strategy broken㿘>"`  `  ` @- @ @ @ @  `&@`?@H /d * % `0 # !>`0@&`0 !p@  `0``0 &`0H p@&`D&`4&`,&`x `@-   "` &`0`*2 @ &`T &`<&`H`<6@>@.ː!x$>@.Ő! $`H  @ @4D@H /d * % `0" #> a@ `0b" `0 &`0H p@@4q`H@ k?$`0h"`<`4 " `<`@@@>@.z!$ >@.u! "  $ $`;`` B# ?` '`@   ` &t@H /d * % `0?# @&`0@00  `0 @`0*@&`0@H 0㿘   |@ |!P?#!$ h$ $ lputphysbuf: private buf B_WANTED㿘 \ @Ɛ 0 @">@."H  <@4" <㿘> "!>"b>"!T>!>!l "a >  ) : @!l>"b:>ڒ ) @!l> "c:>ؒ )@ >"` chgproccnt: procs < 0chgproccnt: lost user㿘>!> @ *`  ! 2   +" 6>@-#Ѐ`""`"@ ג )  > @-# )   "" $""" >"   42 H 2 4 > > @( "   4  8 2 4 >>  @( "     2  enterpgrp: setsid into non-empty pgrpenterpgrp: session leader attempted setpgrpenterpgrp: new pgrp and pid != pgidenterpgrp: mksession and p != curproc㿘 "!>@-"!  @`>@,"8O@  4>@,"h  e  k   d ! $$ $ $ `   $  ,>b ?& ,  $` >@,ː"! $` @ "@$`$`>> #@* `$@" #@* @"@$`$`"% @W !@S  @` D"`D D @"!` 2&!@# &!` & @` @"`D`$`& D 㿘 @` D"`D D @"!` 2&!@ &! 㿘  `"`x""`x`"  "` "@ ? "   㿘 H!@` ` 2 T` &`? &`@% T !@" L` 2 L 1?  ` "`? "`@  L 2!㿘  L 1 2 @  @Ғ @ϒ  @ 0 2L 1 4" H4 " H4 "! "㿘@` 4@"!{ 2!  !`   ! `&㿘@` 4@"!_ " !!`    ! `   4& ` "`"  " , "" ` "`"  "㿘@`  R` &R @:`   !.  2& 㿘! 4 @ "  " 4 J  4 &㿘` 6@A ` 4@"!ސ "5  2!. !`  2(  ,@"!! ! `" `` 4&`@"`̐ "  ` !  ` 㿘`@ @ @ `@ @a6 `@ @a6 2 @"$ *?' $ $ @հ $" `,!$`,㿘`@ @"  @@a6  @ $" `,!$`,㿘`@ @ @ `@ @la6 `@ @ba6 2$ $ @ $" `,!$`,㿘`@ @"  @@Ea6  @t $" `,!$`,㿘`a6@2 2@  @\&`` },  22` `, !$`,R` `(@ :    *   ` @2@㿘   P@ P 6㿘H /f * ' ?* `6W H 0㿘  !ٔ Pא 6㿘Ġ!̔ P 6㿘`  &`!` `  @㿘 !6   !  @` ?" 㿘@  )  "`M "'`I   R 2:N! 9 )` ![ . )  * )N! & @ 2N!  ) >  `&`> !  )` `2 N! &  2  ) )?&  㿘@    "`R "-`N   A`@D; ` ! 1`  -``@. @ `"` >  `&`> ! ` ``2  `@`  2 `` 㿘    `` 4 &?Na 6 .a !6  .a @  㿈`  @@㿘`(     .`@    @ 4  2  @(  !6r "۰@4 2   @( > ` ``  `"`@ & `0>` >``j>cx    #x #x#x >#x  #x2 #x c|    #| #|#| >#|  #|2  #| >  "`> "@ " "  "  >",8   @  @ @ E!t:`   !t !t!t :>!t:  4)!t2+ &!t" >!l:`   !l !l!l :>!l:  4!l2  !l :> << 㿘@ 4   * ` 㿐H /m4 А* .   ؑH 0 D@B2 >'@'`&@ u&`'r' "   @>""`" "@  < 3`+ @+` b 2**@ b 2`* *` B 2**@ > C@^@1 Д @+@&@Д @@&`@H@ Д @@'@А @@ '`@0@ Д @@'А @@' 㿘@ `   \ `  H`8 H@Д""?`"?/""`" ` " ?/"" `&"  `@"` 㿘 * X   $ $ 㿘 ? &  * A2 ,!  ; ,4>  * "* @"% @ 0   " @  @"  @   (`(`(`))))))(`)))))(`)(`(`))(`(`)))))))(`(`㿈@   $` ` `2`Z ` G,`@ `'@ $ $  a*@ 2$ a 2a  $ a "a   $ a `  @$ 2  , " ,  $  ,@"   $   2   $  `* $ $ 2`   "@  `$(H*`"  ("?`" `,#`, " `,`4`,`,(#`,8"8"@  "  " "`>H2,, ", >܄*` 2a`耢` #`a#aa  a #aa #aH>ܖ  *``*!"!``*`㿘! ! $>ܤ!!  * 8 &!*` " ! &! & *$@!`2! $a $a$a$a ,*@& , " H "`  "` "` ? "("?"H   "pause㿘 $?! `$!$!@ 3> & !(cx@ ܖ  㿈 $! 2`!  $! ``!ܔ *@ $ ˔   !  ! ?$!#@  ! $!$!$!$!  㿘`` / @  2`$  2` ` @3 `    @㿘 $ > !L4 $,"2} `@24/ " ! 2 (  !4 $@,"2@T  ` 1? @͒@24  㿘 I)  B  >   "  "   2 @@ @ 倦0g    "  "   @x㿘  Y @ 㿘    , @Y @ 㿐 ,  $* =!":$a( 26$a( <  "< @ ` .` @D  ' @ `@  & a@`!* &!>ܐ!`" $@!&!$@$a(@ psignal signal number㿘 (>> @#3!!.`   ,(*  !   !   N!  .!  ! `   *@& 萊 *@&  耣`  & 耣 lN 1 hHo oN 1  %>G" , PhK `"1 耢?`2>!`A 6!4*  H& ,`  @ې02 ,h/` & `` * & "! l  . 1" l * & 耢 `@ ,0  >?  "c4! 2 2.!@ aH 0Process (pid %d) got signal %d issignal 㿘>ܤ!   , ,@  * T  ?* !,@ $  ,("  , h(20 $@@ 4!4 , 1@ @  , H @b@ @?  ,((" !4 " ?  *@ 2  * $  $. @``. 7  4`> @#  ,(2 ! `2 H2  H4!4`,  ̒ @@ U 2   2  ,(2| >@#j w  $ 㿘 ,*   H. 1@ & ,postsigpostsig action㿐>"  $>@!Ґ#x ? * * . $ ` @ a  a  䑘  @k0G> >@!#H/` /a  ?a$a `@  $ a@ !* $!>ܐ!`"$@!$!$@H o@ < "<a$@ a($a('  `  pid %d was killed: %s sorry, pid %d was killed: %s 㿘 4> @!~a` 4>!x@"Q 㿘!6>ܐ 6!6a.`@ $@ "a$ "`/%s.core㾈, a6 ,!>"`ݰ >  خ ( *  @: @̰ D `8$`  >$`b8@" '''''ܐ#@! 0P@* t  T?@*@2 @9  ?h @™@'6$46d0!@$@Mep '@ $>'$(' ('$'( Ԓ(*', ؔ*'0 ܖ`+@@ +@ @''4 H -( ('((   0 #\;`#h#l @w . >(#`* 0"( ` *  4 #\#d#h#l@7  #`#\#d#h#l   @J @g @/ "㿘  N㿘@ &&  & ` >"*` €& & BtB|B|B|BtB|BtBtB|B|B|B|B|B|B|B|B|B|B|B|B|B|uiomove: modeuiomove: proc㿘  >@"  `>" `>@"U Q` `?&?&8  "'@ "@  2@@ؔ "@0# 2@@@ @&@`@"$`$@@"B &>` 2ureadc: zero residureadc: non-positive iovcnt㿘` 2`>@| ``4@>@u   2` &`&@  "   6 *  `?$ $```B >`&`hashinit: bad cnt㿘 >@>!Р 4< , $, < 쵑,  @*``@&?&㿘  죔  2"   " > pp`""`"p" shutdownhook_disestablish: hook not established㿘> !p 2 2>@"`" "` "㿘>!d` > !p   @  2 㿘  T  2&  & >ܒ"`" && "" "powerhook_disestablish: hook not established㿘>""@  @ ` @@@2@`2>@  "@ "` @"@Β 㿘Ho o >ܐ"  €  2 0""    € 2 H 0X`    '`a6 `  @*^Ȱ Ȓ?` #> *` €>`  ( >!>%#\>x# > #,> #\> > X -` .  O` &@Ĕ >NC `  `  @$    `$  $``@ ```` #\Ā``@>N `"  @"  ` ` J(JPJhJ\JJDJJJJt㿐` \  ?) ?`%#> *` €>L>LÐL>L>L@ >А˘!p>АĘ!l>А!t!> !'@R ؀ ! 6 $!@6$!`4 ɰ $!ư > @@~!  >"!>ΐ"@n!  > "#!> !'@$!Z>PS @} @@ޒ{pak f a \ W 舒W>ސ$ x>ސ |>ߐ `>А@"@8,>ܐ"@*     >   a@"   @ -LLLLMM M<MXMlMNdNNNNPOO(O<OPNN$OdOxOPLOOOOP,PTPhP|PPP㿘`"B ?`=>"*` €>@>X@*  >>"`(* >bH>">(" * >"(@2 -QQR R R8RXR㿘  @     `&@   㿘'P` @     `&@P 㿐@#\㿐 #\@㿘\@ؐ `  @@  `,  `% ` "&@@   ?*?@@@*&@  /㿘@   @     &@㿘  @ ` `&@h Y㿘` @   ` &@G㿘@  ># ` *` *  (&@`!>"&@ x,   x&&@   `/ 0   0&&@   ` `2l   > d > !J "G``->!4*` €`4 "@a   `, "1`a ` "+` l @` ` `   `,"2`P@1!@ a@! b``2N`1 >"  $@& & XlWWX|XX@XX㿘&@!` `  P&` &` &`  &` &` &` &` -N 1  1 8 &a<&aD&aH&aL@&a< Ԑ`&aD ؔ @&aH &aL H "&a\ 4&a\! &a`! 6ad , ?` `?`l&ah`x " #&al`|&ap&ah`  @ &a! `2 &a `at@ `6a`&a|6a6aa@ .a a@ .a    P>a㿘#>N`>c@ !>N (>`@ @@<㿘>">БH /m4* . "  "H 0 >aX >?>"c4 @",@ diagnostic ../../../../kern/kern_synch.cphz㿘>>!`*>!> ! i+> 1 ?` $   $ >" h 2 `P$ hH /m* .  >>`P``@L d h  d d* *  @* @$ h `$ d@($ `@l !1>"  ! L 1 2,! ,  22@" ,!@" ! @,!0,!H 0  2 1@ > @ؐ!>!X@㿘>!ȡ*` *`@  `& `&  & ( c@< "& ` ? & & `@tsleep㿘>" `@ @a  ޔ Ho o> `>>>!`>>cXH 0 H 0  >L 1 >  >@#(> >ה #a($ ,!$ l$   " ""$ p@|`"  ,  ` $ ,( @    l  @ , 1 2     , 1@ @"@ ! >*cH 0 , d$ , { $ ,  @ @`@D #  T > #`@w p`* 2  耢`"   ,( @ Ð   @ @`@2 $  ,  $?a *  ?  @ @`@     㿘H/` / l`N 1 @ؐ ,@ ,$& ,H 0sleep called with priority %d > PZERO, wchan: %p old sleepsleep㿘>"` >#@U>@ڐ#HHo o> `>>>!`>>cXH 0 H 00D >L 1 >  >@#X:>ז #a(,!$ l$ $   "  "#   , 1$@ "@ `@  @  چ @  @2 !   { ! >*cH 0Hl8>׆(  2 ` ""`"lH wakeup㿘H > >ג c!(@ :   > 1? >@/! l2%$ l"`"$`L 1 2 ( , , , 1` $ @ސ>>?"#4"b,> hʔ 2 H 0㿘>" ! ,!H /m * . @䶐  @`@9" @H 0preempt: cpu_preempt not yet implemented㿘>ـ ">@ʐ# ! ,!H /m * . @䇐  D`@ " DH 0㿐>"@>  "@ `Đ" ` А"@ А"??/!`$`$`< (2   #X    ; X7  @4  X  @X`B <X$```" `La 2` ,a @m`>̐ ?$`(d` "d@۰Ⰱ>Մ   setrunnable㿘Ho oN 1`*`>#P €>@!"  ,( !4  * @&  , `. 1@אH 0 ( , , & > h0 >! #  >>?"c4",jljjljjxjljlJ!  ( `  8  *! >@ >>? 4"",㿘 ` $ @8& `! 1! .!mawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %-10s %18s %18s %18s COMMANDSTRUCT PROC *UAREA *VMSPACE/VM_MAP PID %5s %5s %5s S %10s %-9s %-16s PPIDPGRPUIDFLAGSWAIT PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSG%5d %-10.10s %18p %18p %18p %5d %5d %5d %d %#10x %-9.9s %-16s %-16s %-8s %18p %s 㿐N   n.>J `  N@" L@`L@ 2`L@m> >@ >@| @>@y h>@v 0n!wa0/"0,>>>>> `@^! >>>>>>>#\!a@HP!X@La`>>>>>!h`@?!X%>)>N1 EH>4@2!L@ n"> w a"$7"'l3!  @,!؀ ? 4 l` N1, "#\#\#\ #`@>"  @ 2N1>" 2N1㿐H /i * * > !! " '`"'Вb@ ?#! #`H 0!>!P!Pb?`#!P #`?/a  #!P#`>""`#" #`?/a  #"#`@H 0@}㿈@  @ن*`" * `*'' / 㿈 !6 )@ % `   #@}2'> !`'> aa  0a d 㿐@   `  >!X'@} "'`  nanosleepx@ Ԕ  #@|''@ z H /i * * > !! ? @ ' '?/a  ?[H 0$ >N> @! ?"  #" ` >H /i * * aa ''ܑH 0ؖ"@'" 'Вb@ ?؀ ''ܐ*`" * `*'' W  㿐@   @ؓ@ E   ``>А!d ; denied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds 㿈 !6 2G@    >`    5@ ' @ >"> !`> ! ! 0 ! !>"@ "@5 0 C` >ad"ad" 㿐 !6j W@   O>ܓ*"@ *`" *  * " >!`*@ *`!`@|q @{’ ݒ & H /i * * >"p>""p"`H 0 ` !В"@@{'"@@|E'`x   㿈@ W H /i4@* *@ 3   ' ' ''쀣 1> ! !`&'0ᰀ''ᰐ "@ " ' 'Вb@ ' ' * ''''H 0` 㿈@ 4t `   2j`  &`  ] Y@耢 2T @ M H /i4@* *@ -  @א>  > !!  b? ''?/a ?m $ @n& & &  &  * """"H 0 㿘;   >  & G& ?/"?a  H /i * *      & @&  @ & &  !!@ 0ᰀ@  $ @ H 00H 00Á}x8   Є?   6  "@ @" "    "  "  " " "  `" Є@@" "   H(>#h#lH h #`l" #dІ@;``@d` h   l"" #H(>#h#lH h #` l" #dІ@;`` ` h l##  "@ @   @4"@#> >֒ "`>>x"!>  |  `   ""` ? " " " timeout_add: to_ticks < 0㿘`> @""@Ho o   `> "` "  "@& >>b(@& "& "(" $ && " "2& &  ""  H 0 H` @"`` > `@ ` ?"` H>>  (    㿘H/` />aB >"("@ `;`""`!" "@ " >` ` "" # "" H 0 Ho o!b(" $ H 0 timeout table full㿘$ H/` />` `>!@>! ""` "@H 0  `$ untimeout: not TIMEOUT_ONQUEUEuntimeout: not static㿘H/` />a4 2- 2)  >!@"x2>!@"`""`" " "> ` "" ""2 H 0 ticks now: %d ticks arg func ?%9d %8x %s 㿐>"(>!@#>!@#Ho o>! %>" l lؔ 2'>" ' @  2 H 0 㿘 !6A @߿@>Ά >  >Ɇh h >!>܆ "`"!  >>> probing for %s* %d mapply: no match function for '%s' device>>> %s probe returned %d 㿘   @>b,  `>"@!pV` `>">"@!V`@!2  @ 2 `>"@! , >"`!@   " &   "& B & &  : >>> %s probe won >>> no winning probe 㿀''''耦` `  ` @ >!' ,'"$  * 2  (*`: * @*``  2 v V  2V   2>",`耢 " >" >"@#(@#@㿘` `  ` @ >!Ѐ4*`$ %` * 2  ( `*`: * @*``  2  @C T ` 2T` 2㿀>Rbt'' ''''bt>Ѡ ,V* * @x} 2V  unsupported not configured 㿘8 @M"  !>ܠ"0ƀ * @ root device %s not configured 㿘  >#@m"  @# 㿘?` .@vϒ  0?.@v ` `0?.%s (root)%s at %s㿘  `  ` ` @ `* "@V   V `  6 6 > `&```&``""`@ː`>#>##@` >#`@ ` >!Ѐ"&  "  2 $V `@2 $V "6 V 2 $  6  $  뀢2@config_make_softcconfig_make_softc: allocation for device softc failedconfig_make_softc: device name too longconfig_make_softc: %sing dev arrayexpandcreatconfig_make_softc: duplicate %s㿈@ /`>$@ ! ٞ  2>$@ !@wyV`  && ("& V`V` & @   *`   @ &   *` 2 0V`&  @w  $`(>$@ א!ؒ  & $ -  , @, .`@$.`$.` <   &@>$ ">$"(>$"0@  *`@w@  $ * ` >$"8@  & ,config_detach: bad device fstateconfig_detach: forced detach of %s failed (%d)config_detach: detached device has children%s detached 㿘  ?* 2   >%@ _   @  € - `>%o  @ A  ` `>%`$2`@ 6`2`$>і ,`"! 2$R  R @"2 R 2 $ R @2$ 怢 `"  "`> "   "@@0 `@* "@>%!@@ o @$` 6`@@ 2 `   *`"` @ $`$@ 㿘`  ``(  -   $`(€ 2$`(㿘`  ``(  -  ?$`(€  2$`(config_defer: can't defer config of a root deviceconfig_defer: deferred twiceconfig_defer: can't allocate defer structure㿘 $ 2>>&@ { h# >&2@ p`2    2">&@ c " "# " "" 㿘># #  $@` $`$ " € ق `2 㿘>  Ȣ` `$` Ò  2`$config_activate_children: shouldn't get here㿘>  Ȱ #>&``$```0 -  A @ pbp - 㿘`  `@ @.`@ 2 (  " @ ," ,㿘 ,?  & , ``@ evcnt_attach㿘@tߐ (&>'@  @tސ&>ɐ h & ""  $"`$G" $`@@&$"="`$$@ @ $ @ 02`T T&*$$2$$"`$$2$"`$$""`$ $@ @  2`T T&$$2$$"`$"$ (   @*`2 %s%d%c: %s %sing fsbn readwrit%d%d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)㿘 G : ,`"@ a>ܐ@ Lb@>1 >2 ԑ,  0: >'a>'!>'"  '"` >'" <>' T": @ `' ` <`(@ `, !>' `8" @w`8@vn`,!>'@w"8`,@ve> >ف 㿘 >"`>  Ȁ "   (@s  2 ( 㿘 !  @ , $ , disk_attach: can't allocate storage for disklabel㿘 ,   (  !&  "  `& 2 >(@m @sВ! @s͒"H /i * * >""& h & lH 0 &>& "@">b "bdisk_detach: disk_count < 0㿘 {  x `"  "`>"  ">? ">(@ !H"HH(>"p"tH disk_unbusy: %s: dk_busy < 0 㿈 H??& H>( (@ e#H /i * * >"" ''H 0  p"@' t"'Вb@ ?? x | & x & |?/a  & x& |`& p & t ` P@ >`CB> `> P X 얂B> X*@ 㿘>"  ̃ 㿘>"  z H(  :`X:`P:``H(>"`h"`lH "`x"`|H rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs )>L#L ` !"@S 4`#L .  ` ! >)@!. @>9*`!|'>  ">)#L!@`e  `e@ ">)#L!@ - ` >)@ؐ" @ ">  " > @ 2 @ > ! ##, >)@7"@>c>N`L`L>N HH"`L`L"   `L " 㿘>N L@ "  @qؒ   2 㿘>N L@ @  extent_create: name == NULLextent_create: extent `%s', start 0x%lx, end 0x%lx extent_create: end < startextent_create: fixed extent, bad storagesize 0x%xextent_create: storage provided for non-fixed㿘@ \`>*@<! >*! @>*@0!X`+ >*@)!x  `>*  @!@q& ( 0& $`&    " " ' `" &    2&  & && & &  &  &   & /extent_destroy: NULL extent㿘 2 >*@Ր#p " `"`"@@    㿘      @ 9"'` '`  '@ "  & :'`  + `2@'  @ "" ' `""`"@@ @0 '` '` '@" ''`extent_alloc_region: NULL extentextent_alloc_region: extent `%s', size 0x%lx extent_alloc_region: bad sizeextent_alloc_region: extent `%s', start 0x%lx, size 0x%lx extent_alloc_region: overflowextent_alloc_region: extent `%s' (0x%lx - 0x%lx) extent_alloc_region: start 0x%lx, end 0x%lx extent_alloc_region: region lies outside extentextent_alloc_region: can't allocate region descriptor extnt㿘 >+@! @>+!@[ >+@!:  >+!@P>+@Ր"8@ * @(>+ @A"X>+"@<>+@"@ɒ 2 >+@1"3 `) `%>+`     &  !(믖 " @ے # ``(` Ϛ extent_alloc_subregion: NULL extentextent_alloc_subregion: NULL result pointerextent_alloc_subregion: extent `%s', ex_start 0x%lx, ex_end 0x%lx extent_alloc_subregion: substart 0x%lx, subend 0x%lx extent_alloc_subregion: bad subregionextent_alloc_subregion: extent `%s', size 0x%lx extent_alloc_subregion: bad sizeextent_alloc_subregion: bad alignmentextent_alloc_subregion: extent `%s', size 0x%lx, boundary 0x%lx extent_alloc_subregion: bad boundaryextent_alloc_subregion: can't allocate region descriptor extent_alloc_subregion: extent `%s' (0x%lx - 0x%lx), alignment 0x%lx extent_alloc_subregion: overflow after alignment㿘\ `d>,@͐ 2 >,@ǐ!@ *  @ >, !H@. >,!@)>,@!&@ >,!@>,@"(`>,@"P @: >,"x@ >,@"@ 2 >,@"    `&@  @ @&@  @@*@?      >,#(@֘>,@[#p *   " >? NL@*' @"`@   @@ :@ 8@( :  O" L:   "@?   ?Ȗ   " ," )      &  !>+( "Y @  #% extent_free: NULL extentextent_free: extent `%s', start 0x%lx, size 0x%lx extent_free: extent `%s', region not within extentextent_free: overflowextent_free: start 0x%lx, end 0x%lx extent_free: region not found㿘 >-@# @  @@ >-#@>.@p 0:  @>-#@ޖ>.@c hO  ? G@2  2 `""`"@@D  2%@  8@  0@  :@: ( " " &  "" &"    @>. @>.@  &    &  " ?& 감 㿘  +` #>+`"`   $ ` ! c(   `"  "`  "@  `  G   & 㿘 `", ` `  &` &@ " &  &`   &` &@ " &  &`     F& 0ѐextent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx 㿘 2>/@k >/   @    !>/ ! @  2 㿘`%`a>  "         @l a& & >>"a">Ȁ   Ȑ >> 㨁 klog㿘>   Ho o  #%>'>/ H 0D #`$! "  H 002 @『H 0>c ?"cߔ  `$  @&`$ ``     " 8㿘Ho o`>  ``  >H 0  @cH 0 㿘>!Ȁ`>#@? ?  ܌? > 5`? ?$? }@0  ~@w@=?0?@< v@)?07H >    H `6#">  @">㨄 㨄 >c"`  "` "`>" kernel %sassertion "%s" failed: file "%s", line %d㿘>0"X@%s: table is full 㿘>0b@4 panic: 㿘>##> a@?H'H 'L'P'T'X ! `!>N P @$a>0@]"@t>0@W">bL @ @㿘'L'P'T'XH/` /@   @ИLH p@>!Ȁ`L  @ %d㿀  <@A >1`H@GO`  >L @3  L   > @* 㿘'H'L'P'T'XH/ /   @HH p@>!Ȁ`H  @z ԰ 㿘>!`>"#@`  `>#@ ````@;w  ` `>c@""c@`- + ) ( >!`# >  * `  " `"@ &"   "" `>#@` ` `>"T@`Z^㿘>"'H'L'P'T'X`,  a  `   @H ,"  ! `" @"@! 㿘  ? &  㿘'L'P'T'X       @6̒    @L㿘'L'P'T'X  @L㿘'H'L'P'T'X   @H㿘!>"H 'H'L'P'T'X$"H  @H>!`2$"H$"H㿘!>"H $"H @t >a 2$"H$"H㿘'L'P'T'X  @_L.㿘!>"H $"H @R>!`2$"H$"H. 㿐'P'T'X`?' @7P*@?㿐` ?' @$*@?%qo%qd%qx0123456789abcdef(null)0123456789ABCDEFbug in kprintf: bad base8`' '   '  "Q. N nN % 逦``8  ''? N `ZY>6 ȓ*` €` ? ? N ? ?L@`: >2b`  `>2bȐ< O3>2bА1O ``  " . L L 쀦` @L@? * :   1`"̮ < ,*@ < ,L@  ".Ӕ`L@ ` L@ 4`L@ `U`  " >.I >DN`>aX !   ?    @?* : ?: X` - ,@ `>2"'  x ?     @?* : ?:   2  `` -`" N  ? ' '  +N`*   ?&?NЀ   , * ?РNЀ  &֢?ՒШ  , * ?РNЀ  ' @N l2    ?/    ?``    @?* : ?:  ` -` >!X   x u o  ?=t:  @ ?m" ?h2    ?   2   @  ? ? ^  ?>2bؤ '  S x ?`>2"  @g "@ @g(    ? 2   @  ? ? # >2">2"؀ ' ?  2   @  ? ?   2  `' ?`"R' ".  5,A>2 4, 40 - 806 03- @cV `0- @cX  8' 8'0-,4   4 - '#'@f '?`Ӭ/  @&+` ` 2`@  ' " ? `2 ' ". ϔ ?< `  ".'$  `  0" 0.`  "v. 2" ? 0`  0 "].~ ?# (? 0`  0"E.f ?2 M "2 .P퀦` # ٠? `  2..3 ?N`2&\\\\\\\\ \(\Шааааааааа\\\\\\\\\\\\\\\\\\\\\\\\\\`\\\\\\\\\H \\\ \\\ѐtΨҠ\\\l\@㿘` @@`% 2 v  H /m * . `"` " @"`1"H 0 㿘,  `@ &&@`   @a * 2` ` @  %N@? $`$` ,  & ,>? "c4㿐 , ,* ` @ $&@   @a * 2`@   @` Д   @7͔  rminit %s㿘 `/ >7 p& & &  & "*"rmalloc %s㿘`>7 x $    @" "  $     2    " "?"## rmfree %srmfree: map '%s' loses space (%ld) 㿘` >7 ,!@$s$  " h$?h$f$ B   >>7  @$P LI$  a  $ 5"9"?  ` `"@ $     ǖ ??  2$@ >7 ;"`""? "/?vverbosettimezonesshowquitLlinesllisthhelpffindqexiteenableddisablecchangebbaseaadd㿘>є, + >>АT.((S7>d#TP4P&d.`(@2>"b` \.`(, "` $> `"`!"`--- more --- 㿘!>"h  >"l 2 "h>8"8@>8"H$"h"h,`:` `q$"h`Q >p>x>܀@"t> `( "t %d㿘> #>8c @c1>"t>bx !>  @c︐@c"t@&"t>>tx >  ( >""p"t%d0%o0x%x㿘` >"X " >84 >8  >8>8%#0>8!#0#%s*FOUND***UNKNOWN*㿘. > . @>ѓ*` ,@ >9 pV `*`>9!8 €>8V #0 >9 x0>9 0>9 Unknown devno (max is %d) %3d at root%c disable ??? %s flags 0x%x 㿘>"\. >  $. >9!P0T@>ѓ*` ,@>9!p>9!xV? >9!V?"T #>9aV | V?T   4>9>9!>9!>ЖcT* R  >Ш#0  '>9Vᨕ* r ;V? >9h!㿘N -    N 02% N x  X2   `     ɠ    *:   2Ѐ  ? &@ 㿘     `O* Є 8O /`8 (. (> а`` ?O O "  "  " O?#66 㿘N?   +>J@    `,`bd:  4- *>Ч: c0,`: @ab2 `@`ɐ "`* bd:`@ - : ? &@?%s [] ? Unknown argument 㿐%>  +>:)>:'>:bM@" (@YL J@ "` "` "`J@    &@b   ؒchange (y/n) ? flags changed 㿘>"\ 4>9. : '>:%>:@x@;, <  y Y n N,`:  y Yt c. >ѐ`,*  `  `%>Ѐ `  "`$`" `$@ *``TR@?  `R@?,  ` RTR@?">:>Ю#0 T* S q@T?`>:#Ig`` ,` @` %` đ >9!p>>:#m!PError unknown state already disabled 㿘>"\ 7 . @>ѐ ,*`@R` "   "  >;4 >; 2` 2` >9">9!p. l:  >;w"( >; d$>;l"80>9h!P enabled 㿘>"\ 7 . @>ѐ ,*`@R` "   "  >; " >;2` 2` ?">9;!p. (:  >;3"( >; e>;(#H0>9$!Pcommand args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] %sshow attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know㿘><y X#>b|J@ h b|,@m@@_)>:`  %><c`` b|, @ ?* : `*=*`>=  €><M 06><I 02><E 0.><A!0*><=!@0&><9!h0"><5!0><1!0><-!0><)"0><><"(#b@0 ><"p0><"0><"#b|,J@b|ttttttttttttttttttttt ttttttt,t<Ttd㿘>ܠ ""h#>ё, :  , * `,@?+ ?$h%s 㿘>ܠ ""h #>ܐ#0,   >=!bd? >А?$hUnknown routine /%c/ 㿘>"\>ܦ   P"bh>>и#T`,* W ? >Г.#T:` ,1>=T- `2@@@" . :``e `s`d :0 :0   < W"@   T?͢` b\$?>"bhUnknown attribute 㿐L@?  ->L@    2`L@,L@` "`` "`` "`d:  4-`*>Щ: c0,: @]2 @]& "* d:`@ -`: ?2L@>=#0    >:G s0"㿘/ ?  c >""h> ,`Y ,.:   @]}`2L $ @\ 2D $.:    T `` 25 $T 21 $T  2+ $  *?  d e c >="@ f>="@G $/ $  $,`:  $?  $ `?  c>ܐ?"bhValue missing for attribute 㿐NN    2 NN "  "  " N >>M#0  >:.`.: :0="%s ? Not same device type 㿐?'>>Ѫ 0 ' )>>'#@U^ (L L "  "  " L < 2$L>"\􀢀 >9!P/`* * @@\  .`:  a>>#` ' ? q   f ` Q>:ې"` `No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')h@\ $>"`>b\   >?!0.:  >>?!0 , `  @\-`2 $@[ " $ 2 >?h!0>?"  a/̀?$* *,`>?` "(' '`'` '`'`'`'`''77ڒ i ̀? aȐ.ő: ,‘: "\ !̑+` * >ђ`, $  ?ܚ?## ?䀠 ?# ?# # ??# ?# ?# # ?>#(Ԓ@И,*`# ؔ@ "܀"" """" " >А# R>"x` >Ր"t  R"\, %"\` ? @[x`2$@Zޔ 2 $V  2$V4$ 2, @[U`2$@Z 2 $V  2$6$ 2 * Ƒ: Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d autoconf verbose %sabled endisUnknown command 㿐N  />N "  " N - N    2  |J@ ? @Z2  @Z7 "  J`NN "  "  "  M@ X >@"S *`| ?* : `*E*`>B"H €N >@"; z >:>1""lN >@А")  >:W"W N V >: ` `>@>""X>@# N i; N | >:Wo cN &  dذ  ϰ X >:WK dN >@a#0   e   / >:W" eN >@8# ϒ  * g:   d>:W f>Wv  0rN U>:5 0k q°?0fN F 0_ǐ\ N  9>:N#>Ѐ -%>@$ad  *`:   2 NN "  " N  r ad" S tad`ad^ }adadP ￐" >,>@`?p`",>@#>@#ﭐ  >@塚# 8 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0D< 0p 0 0 0| 0 0 0 0 0 0 User Kernel Config UKC> Continuing... 㿘z#>B>Bg">͠`cc@Q (  >BV#    N - 㿐 @`@ +`@@"  2`   `#\@ hВ ?'''''쀧 '4    @`2''@   耢 ?  #2   `  &  \  Ș \"㿐 @`@ +`@@"  2`   `#\@ 8/    $  ̔  _  '''''U N'   '  `=     @`2   ؔ@   耢 ?  # 耤$    v / \"( 㿐 @`@ +`@@"  2`   `#\@ h '''''''쀧 ':    @`2''`  耢 ?  #  2 [  `  &  \  Ș  \"㿐 @`@ +`@@"  2`   `#\@ 8/    $  ٔ  f   '''''a T'   '  `C     @`2   ؔ`  耢 ?  #  ʒ 耤$    | 5 \".  @ *@ ٰ   2`Ӱ b b> @ ?*@  @  *@  ,,2`     7 x `Ŕ `0@W   `$@ b|"9@"{"[T m b}b~2f @ 't    ?4    b~te@ 't  @  ?4    b}tQ'tT    ( "(  ", `A"0   'tܐ 2!5  't   `vt) 2  ( `(!$@ `w@ $@`  ``.`H select㾰 @ 4&@@`2 a ,`,`-  n  ܤ8@VI,` ','0''' '(88@V6 Xx','0?' '(` (ݔ 2,` ,Ԕ 2,` 0˔ 2z,` 2  2p, j H /i * * > !А! ? @ ' '?/a  ?H 0'>ծ '>,L`@%,(@i@ 27, 23,` 2 $*,Ho o,`@L H 0,%,>>E!h!MH 0 ",,? ?%,  #" 2(``" `D 2``; 2` ` 2 2(I 㿘`  2 *   61 >ܮ#4* @,   , `,@( `-      4 *  ,  &`㸐 "  & ב4  ˲@'  㿘@ 4 "&@L " &@ l>!h@2&@` 6`㿘 3  >`L  "`L>6 H!h+ "&Ho ol>!h2 ,J1 J 0 0 @ ?",H 0㿘` 'L'PA  * @  5  @ .2 *@`>ܐ@ %2 #>ܰc @    T @``  "  `   @4  `LL ŗ* P"pollp> at@``  * `   @ @`  `2@` `?<#@R/* "**% *"@ *`@ *`?Ѐ e H /i * * > !А! ?А @ 'Ѐ '?/a  ?БH 0->ծ ->,L`@$,`A 22,?vЮ $*,Ho o,`@L H 0,$,>>G!h!ϑH 0 ",,? ?$,  #" @ގ 2@ 㿈  h ܐ H@S h ֐ H@Mʔ ' 2 >2` #("`"(&  2`2 "`" ($ <& $<@>@<pipespace: out of kvm㿘>c@ & >H">N P "P㿘& & & && & @& <& DH/ /> & 0& 4& & $& (& ,H 0  @SE #& 8pipelkpiperd㿘 (  D $ D` "C @  "@@ 8 @8 @!%>H"$ @! 2  @!a$ @   ǣ @ ~b$ @ |$ @K ^    $ $ "M$ N  ?$ @3F   2A # @!#>H"$ @!cz 2  @!a$ @ 2> D 2 @$ $  @ ~b$ @ |$ @ @  ?$ @ @>H $ @!N 2 D 2o 2 DH > !!$  $ $H 0  D?  $ D @  ?$ @̐9 !T@2`* @ '!" #>H"$ @!c 2  @!" @ !$ @ 2 @ @$  ~$ @b$  |$ @ϛ @  ?$ @ϔ " ! @ @ ?$ @0  @   8#@  pipewr㿘 ( <   @ "%  ##>a 4   8  2  ` >NbP>" "bP㈒ @B a@$ `$ $ $$ $a  2' D @!#>H"$ @!c͐ 2  @!a$ @ [ @ ~b$ @ |$ @ D $ D" D  "   $ B@ :A @ #@ 4 @ 8  @!%>H"$ @!L 2  @!a$ @   . @ ~b$ @ |$ @֐ 2? D   $ $ /$ @  ?$ @  ( # @ @ ?$ @_  @   8#@ I  @>I $ @! 2  D @ 2  2 D?  $ D @  ?$ @΋   @  ?$ @~    " 2H > !!$ ( $ ,H 0   @ @ ?$ @  @   8#@   }@  ( ~@ @ 0@ @ 0@ @    88 "㿘 (`  <``"# @3  /  +  @ '0"$  @ 2   " !  @ @& @ 2  "  @  p  @ @$ @ 㿘@P `6`  &`@    @ C B?@M>`0>`8 &` $*`" *  * &` (&`  ,*" *  * &`$ 0&`( 4*" *  * &`,㿘 (@ $ (pipecl㿘 Z @ @ ?& @:  @   8#@ $  D !>K̀ @`& @ #XҖ  D` < "  @ @ ?$ @  @   8#@   @`Y$ @$ < ` (>N>a?"a>NbP>" "bP㈒ @6 Β hptrace: impossiblep@  ` 2@ @`#>M!*` € 44@  ,(    2!"  46  4 2&> !$&ְ  ,hҰ  Hΰ L 1 @2&0&@`# >M!,*` € , ( H$ ,4$ X `2` `  :Ѐ ?@ '''''''' @`     $  , 2`@@``" @ . ?$ @` 2L 1 H 4 X "  , >" ,*@$ ,$ XL 1 2` `͞4!4Z `W S ?P$  &`  , H($ ,`4@$ Xi &`  @S `    P?@ ?'''''' @# @ 2` Ѐ   !?@ ?'''''' @6>Lv ؁2@2d2d52`2`523325555555555555555555554440442114114111D14444444444444444444441111ԁ 㿘 (   @;) 㿘 (   @8Ӛ 㿘c  (J "7cE2I  "~ ""}2=  ##26  ! >3 E    X" |` X = | 3 |3 3 X1  8 # ( # ,`$# 0 (  "  2  " i r   @b   ` @   @g㿘 (H /``* !`  ``"H 40Z" \0W 8 H@   V   $ BH 0F  `"@ h d" 4  l    `  $  H 0#  t | 6 |   @ H 0 | P X 6 XH 0 㿘@M `06` `  @ 㿘 (  @6$ (㿘.   `@ 02 ``@j`  ``@j@    2@ 2` 2` 2` 2` 2`  "` "@ "` "` "`  2` 2` "`msginfo.msgssz %d not a small power of 2msginfo.msgseg %d > 32767msgmaps is NULLmsghdrs is NULLmsqids is NULL㿘>Є!    > *`2* ">Nፐ##@$> >Oᅐ  ؀  >O~ 0  ?422@ ``>2` >ـ"a>Oc @`  >   "`"" ` `  >>`P`">OF P  "`(2``\msghdr->msg_spot out of rangemsghdr->msg_spot != -1㿘  (>>>>OV >К!` >   ؕ*  2  ` 0 6 `&6 `"6   2V V ?"c>O"@& c㿘 &`  L&` `D&` $ &` (&`  ,&`$ 0&`( 4&`, 8&`0 <&`4 @&`8 D&`< Hذ&`@sys_omsgctl: msg_cbytes is screwed upsys_omsgctl: msg_qnum is screwed up@ ?@c ``>Ц!  6 * * >" `P* `(`" V@` @2| "4 0r\ 0o~ i` "`  ` `$" $` $`$Q 2 ` "`$>On# >Oh#$`(E V Ax T ;`(@  1  @8' #?$`$` > ` a  4`$`($`D%! 9I T  "&sys_msgctl: msg_cbytes is screwed upsys_msgctl: msg_qnum is screwed up8 ?@c ``>Ц!  6 * * >" `P*  (`"~ V@  @2x "4 0n\ 0k e `" `  $" $ $ $@`2` " $>P߼" >P߶"i$ (A  =Ɣ \ 7 (@` -  @8' ?$ $ >   a  4 $ ($ Ds!  ՛ \  "&㿘`  @`) >А  . >* `P"*  (`"  2  ` f& K  a: "> Cb?  >І . >* `P"*  (`2  "2  2$ $   a$ > $   $  `$ 4 4 $ $ $ $ $$ ,$ ($ 0$ 4$ <$ D ?#*`@& msgwaitmsg_perm.mode & MSG_LOCKEDsegs_needed > nfree_msgmapsmsgsz + msg_cbytes > msg_qbytesno more msghdrsmsqid_ds is already lockednot enough msgmapsnil free_msgmapsnext too low #1next out of range #1next too low #2next out of range #2didn't use all the msg segments㿘%?@` ``>Рa  * * >" `P* `(`  V@` @ |   @L?`(%>Q 8 `` "  @  @  >a耦@  >c   h  b4` !c ` 4` ư `( ̖ b">Q?#@$>Q9#0 >Q3#P2b>Q-#p4`? 4 4`)1>Q!>Q耢>#P  #>Q#А  &> >Q # ؗ*  `0 #3 4   S   ɐ`?! @;4`' /> ->Q+>R  +`: 4א@Ґ`.᜔@ %>  ؓ.` +`: ?"`>Rݺ ?a`( 4`d( ` 2`$`  #|`?! @4`Q0"$``> "`  `$ `$` $`$4$`,!=$`4'msg_first/last screwed up #1msg_first/last screwed up #2msg_first/last screwed up #3next too low #3next out of range #3㿘?@c` ``|`>и!  Ȱ * * >" `P* `(`V@` @ .! )>Q` A @" `")$` 1$`>S ` * >S   @4 @  "`   "$` $`2 $`>S!( 2  .!# ` `(  ?V@c` S  > ` `$" $` $`$4$`0$`< @8     09 #p03 *7> 5>S/>S!%@  *: 4ܥH@ܠXᜒҼ >  ؓ.`  e?'@ sema is NULLsemu is NULL㿘> !2> >Tt "耢`2>>Tm !  6 a "`2` `@a   >> "`"@ `d>""|semu_alloc - second attempt failed㿘 >>ڒ`  `> " >ڒ` 2 |"@"|"`%2``d`>T| `|R` 2 @"`" `2R`` !؀`̒ᘰ 㿘@2R>"|2&@2 R "G  2&@@ R @)  2`R2` 222R % *`: @2*  #  #  @ݔ  *`:   * `2 22"  >|1R @'   2R"S  (8@ 2( " ?"2 R`@ޘ 2R㿘 &`  06` `(&` $ &` (&`  ,:&`$wX ?@c ``[` >Ъ!  6Y > !, `""Q V@` @2K  C >V#D+  €! ;>  >`" * @*`@ *`@*`$@@ `:`#X$`" ##X,  *   `* @*`  " ` "`" a` > ! "" `(  `*` * ""  @4`    8 ?$`Ɩ$` > ` a  4`$`(! Đ̔  <Ȕ 8!  & `6 , `* @`!  & `6 , `* @`l!  & `6 , `* w@Y! s{  m   `c, `@ q   0Y;! U &S `6O , `* @E` ' A ? `;B  4, @*``2 !  %-     ` , ` @   ?V¬   "&V<WXXpXYY\YZ$ZP ?@c ``W` >Ь!  6U > !,  ""M V@  @2G  ? >X!+  € 7>  > " * @*`@ *`@*`$@  :`#X$ " @ ##X.` *    @* @*` `" `@ "`" ` @> ! ""  (   *` * "" `@@4 W y  s @ ?$ Ė$ >   a  4 $ (5! W  W @#! `&  @6 ,` * @`! `&  @6 ,` * @`! `&  @6 ,` * w@! s   m  ` @c.` @   ` 0Yʔ! U`&S  @6O ,` * @E`  A`?  @;є  4,`@*` 2 ! %μ    ` @ .`  @ά  ` ?;   "&\]d]^4^^_ __`X㿘@  `2` >Аa  > !.  ""  2   !> !.  D@ q` @&i  &\c _ `>Ж!@ U >#X"@ @  a> ! b    `@@"2 a  #> 4 a. "?" "" X* > " 222" +`> a * .`"("@@#X@CJ*` ? *`@ & semwaitsemop - can't undo undosp`?c` @'L '>!   > !- "V@ @    - ` ͻ* " 0   7  @@*` * U` `` # * `2  2 `2 @ ` 2   2 `@2 `@Ϛ`@C`$`ښ @?* @*``  " 2 `(2 #U` 2  4  4>X!B '" ?V@c "U`r  2 ?4 ?4 N  @J ܸ 5<R 8@  /Ԡ , * #>X@"?V@  @ "?c? / ?* @*`   " 2 0` @` *` * `4$LkL "semexit - semid not allocatedsemexit - semnum out of range㿘>"|"|  2 <T  $6 @62 ,` > a* V bV >Zy 8&>Zr X + @ *  @@ 2 @ *` 2 T `@԰ $ $> @ 6?>"`2` @ 8??@ >6 * > ( 2  :`   㿘 > ,? 4 @@a T > 0>`(>!` 4>& 4"#!`"6 " 㿘`?# @>,`"* @ > , @ @  ?&` $> !*`$ ,  4 $ $ > "! 㿘  Ȁ >И!      !?!@@! "    㿐  `Ȁ`>Р!   *    ?`"@ ` " M@ 2`d @!!p Y>Ж!  ` `?2 F > ,?`8    ``" > @ '@ 2+  'b,@ @*@ '4@. @@  @Ę  > $@@ $` 4$$ᰐ 4$$(&` @ 2`P `8M >[#*` €! 2@`$ 8 9 7 20` 8 2)?& ̖& >   a  6 & 0 2 & V $$` 6 @?c > " oo nnnshmget㿘>."* @  d@4 >\!$  # ``"` @ ` && ? #*`@'  shmseg free count inconsistent㿘>К! `'P`> "`@  > , >0> (>` @ :@ ` > s `? @ >/>  b2   `@ `8@""` @  >\, " >/> , $@,` ,5 @`?*@% 5     ?c ,  @$% 4% $  (5 % % `% > 0 4@ `(% 5 $% % ,% (:!`‒@ ᰐ % 0&P&!`" @  ?Đ*@5  㿘`@` !@   #`" ?㿘 Ȁ >(&`Ȥ!  ,  + Ȕˀ&`  >?"c`? * "@*` `$ 2`$ `㿘 Ȁ >А!  @ 6 Ȥ ?z `@   & ȁ㿘>"(!>!¢!`  $!>""2`2` `8> "!>>"b"!`㿘 &` &` &` $6` (&`  ,&`$ 0&`( 4T&`,h @ 2`T `8Q >]#*` €! 2DȐΒ`7 0 9 7 20`! 0 2)?& Ζ& >   a  6 & 0 2 & V $$` 6 Đ@?c > " w8vvpvDvD㿘H /e * & `p &`l &`p`@># &`t`p =&`pH p@ 㿘>c@""c@@ْ  & p 6 & x& | 㿘`l *`a(@`( `@a@a >!`D`"!ؔ &`D>!`$`"!&`$>"?`` ""7`?@ . 22V @  `x` @2)`p" `!@ ! "!@!  ( 퀌@`@"`p@`p  2?h2`*&`p!d=` 2  `` @ ^ @`p@ `p &`p ` ! @`*@&`@# @ m``( "`@ `&``6 2  ` 2 `@ @ I  `x 2   `@ @ 1`x  `p( 2 " `p2 `n>9* a|* `&`p@ € 0{"e`pw  2h`  2W`p2  `2`@2 `(2` @@'*?`p( ( 7&`p ) ! '" `  ^" ~  | { } \2?(&`p? ( 2  " ` " `p@-`@ `p2/  +`V``@` `"`p@`@ ` `p@ ` @ ``"6`@j`6``p>*@&`p 2B  >d< b`@ v@  ?"`p@ j@ސ?  >ܐ#  @@ X@̐?   ` @@i`p 2  d" @ `p 2` d` `x @2v`p@ r`p``( # V``H 6d`p @z_`p@ [`p`@) S  @ %@ K`p   2`րd  6`@`(@  `p`֒`*`:  6``6``p@*@&`p /@8V`Ԑ@  2`p `"`pV`Ԑ" 8  $ `p @ ?  `p! 2`   ` `p* &`&`p@ 㿘` 2 >  `d ``" &`d`H@ հ? 9  6 `2 `Ԕ   "! H /e * & >``H@'">͖ & `d" @&`dH 0`Ԁ6`?  2?  ` >  `d ``"  &`d @P`H " 6`} 6`Ԁ ` 2 ` ?  3? 0@`@-@?`>a"*` €  ' ! ^ ( ) \? @>a  \`d"a &`d@ `H <`@ >V`Ԁ "1?>  `d ``" &`d@`H  >ܐ#  `?`V`>a"h*` €4 6`` " 6`  ?6`԰?HX0PX@$$$$$$$$$$$$$$$$$$$$$$$$$$ /dev/console0 `@#`}@? ] r@<#> ``^@F!> \`{@Y`z+@@+#> ``@%`e@ `u@#>  ` @ B` @`@< h  g@ #>  3 `@/`@ -#> !>܀ %    a!#@  !|  ,` hx ` !  " h@"7`n@>`@+ `@` @`^@ِ`a@ؒ@"q h `o@`"@fȒs@w@ѐ @> "}@ 4 "~  @ ] r@@@Wv@l b@Ue@z  g@w  `@`@ 0ّH /e4* &  p p ?$pH 0o @j&H /e * & p$$pH p@U ` ` @L  4>#@  " >a p ( (>a: >a# @ '''''@J ,@n ` @@nӒ!@q @Qd $#@>c@""c@ @n "  0g , 6666!| 2  , 2 x !64  x "y w#H /e * &  $H p@˰ H /e * & p ;$pH p@ HHH /e4* &#@  @   H 00 @2@F  : Ȁ€ " pH 00{p2   2 $ ߐ"$p@$$$($(` |    @  @"<  ! @4`$@u-@( '''' ''('$,$(0$ 4$$8$,@$<$ $$0$4$8$<$@* $$($ ( 7&  @  $b H 0 ! l  hH / * & >ݠ *`  €. €  h*` €H p@0,hH 0 H /e * & pa   * ~$$p@H 0  `  ` >!|   , > h *`  €y H /e4p* &p n>9* a|* `$p@€ H 0V ! ` `O ` |" E  $|!$x! "`  , 9' ,n!| 1  , -2 )  & #$x@Ɛ  @7<   4 44x4  @=  㿘2  `*`>9 |* @H /e`* &` `"V 0@'   @ p  ធ 0 H  H 0  Ꮢ H 0 㿘 @" @ !  (    " 㿘 H /e * & # "'>ܟ@ H 2 p p * p`2  " Ā `& p H!@P  H  p` `2   Ā`H 0㿘 @ 㿘H /e`* &`  (`" @ ! ( `" p@   p>*@& p6 @6 @Z`>9 n p* ~|& p*  H` H@ K H 0㿘>ܐ#` b 㿘  ($   p ?& p!$  ( p @2 ( !"  ( % $"  "  @  H 2  p`@@6& p @@ ̀ €   p @& pttrstrt㿘 >f;!H /e * &  p @ & pH p@㿘 Ā`@ 㿘`C 05 㿘 p ` @` & pސ3 20  n>9* a|* `& p@€ !  p ` & p  @2  | "   "   `@y& p 㿘`" p p & p ` & p  @2  | "   "v ܒ   x   p*@  &  & p   ' ' '''''& & & @ '  p *@& p㿈>" 'L  '  H /e4* & H 0 | +,' x# 24  20 2-   '   > >ܒa㈐!@ " H /e * & !W      &S p0+  *  *  *  *   B  쀢 > ! ! '  v  > > ! !  ''> ᰔ"*"@ *`" *  * "@  #@V'>!X0Дb? @2b@ ( G ( p   @  L  `H 0 ` H 0 # >#>ܖ#!@H 0  #q #" kH 03> 5>E 2  $$2  x ˔ `:a!@ 2 2 'В !`      $  @ Ӑ 6 H /e4 * &   @ H 0㿘 p @%  $" ` "  @  H 2  p & p @@ ̀ €  p ?& pttckoutq㿘V ڑH /e`* &` >"`  HȀ@#@!'>h`>"`耢"  pH 0 >aX & p  HÔH H@H 0 0` V ڬ  H /e4 p* & p*   @%  H 0  >ܑH 0 #【 !@ʘ H 0ހH 0>" | 2/`, "+` x& @" 2!` 2` 2`  s   > >ܒa㈐!@ d `\  @2&` H` d` 8  怤?) '>/> @1 ?6 @ 69 H `5 H10 H@ @6  Ԡ$ @ d6 Ԗ$ & d @$  H4 ``2 4 `A&` H?H /e4 H* & H  H 00" pH 0` &` #>ܐ & p㘐 H!@ H 02`0 ttyrub: would panic c = %d, val = %d 㿐` h  *@`{&`V`ր &`֐> >ܐ#  `?f>j#p* €@ w`` @"s`֐@{ n`֑*`:  @0fH /e * & `p`  V`Ԑ``ؒ &`p&`@ 6` @@ Ҕ ` `p** &`&`pH 0V``Ԡ$  6`Ԡ ?,%`֐ ? `>j v`ր` `p 2 &`p \@j``@e`֐?6`ցx㿘`Ő   `㿐 @@ H /e * &  (@    @'@ Q @ y @@ C  p*@& pH p@ 6 6 ց㿘`p@2`` *@&`` (  ( @      ^   ^P  @ ?H㿘۱  p   x  @2``@2@?㿘 @.w 2`@: !4! & 6 6 ܐ (  h* h 4(  4@3V 3* @*`@*`6 ځload: %d.%02d not a controlling terminal no foreground process group empty foreground process group cmd: %s %d [%s] iowaitrunning%ld.%02ldu %ld.%02lds %d%% %ldk 㿈 >!#>k*` ,  , $4 b d@. d@.$ | 2 x>k b`2`>kb؀  >kb|6 ֦@y 2 @ L1>k4#`    >k#0>k#8 ̖ cДb? '?/!`''' @->kϒc@ '?/!`''@-!>k#PŸh d* * " *  * $@-2 L1>k 1` #`   @@ ŕ6 ց Z  1   `1@ "H 4 ```+8 1`4  ?@ ") $ `"`4` ,`, 2`4 `44  㿘H /e4`p* &`p ( (  H 0? 2 H p@ 㿘 ސ "V , : @ ?>߆ >ց 㿘&>ߔ& "@">>f "aM tty_detach: tty_count < 0㿘>`? "`>ml!`"  "`>"! "㿘  >ې @. $ @ $ @ ( H$@ 㿘@ɐ @ǐ (@Ő H >?㿘>ݦ! ` *" >ӣ* a@@  $@ p p  $" ` 0B"$ p #" a %$ $ $ $ $ $ Ɛ Ā " p p $ p p`2 hb`$ p%>ܐ !=  p `"$ p h>ݒ`* @€@ 㿘 . "@>ӓ*`!@@> h*  @ڒ 㿘 . "@>ӓ*`@>@ @ " ` "h a | @ 7`, 3 x"0 (%)> '>a2c `2_  ` W   !!ј Ka |   `,  x2a ( 2 (6 #>ܖ㐐 (! "`0* $ (` "  (@ (˒  (  2 (@ ( ( 0  > h`* `@@R 㿘 . "@>Ӑ!@*`@ Ā   h>ݒ`* ` @  㿘 o>ӑ*"  p* a@  `  *"@! 㿘 o>ӑ*" * a@`    ?" `*`*``@ 㿘 o>ӑ*" * a@` 1  P`*  㿘>! . ) ">ӱ* a@  Y#& Ġ Ā   h>n>ݐ"`$ Ē`*@    w$ ,$,㿘 . "@>ӓ*`!@@> h*   p$ Ē $ p 0 . "@>ӓ*`!@@@ %>܀g e # P!v ] p `  ` `Ԓ L ` @  ,`@8 K,`> `" H ` "  H 2,`/ €`  +``   d H  @ T  H   p  ?$ p Hg 0 . "@>ӓ*`!@@@   `p w   "l``( m`")`(  d@ 8 #"  8ܔ o`p T @`(` `(#ܖ`(@j krT  d@ 8   F`p + >ݰ ``( # ``!2 `hM``p `h* ?  ` ͔ `p  2`>ܔ`! "{`p`&`&` # 㿘 . "@>Ӑ!@*`@@p '` ``) 0Z= 0WH /4p* &p H  ! H 0 < H 0 p ` ` *  ` # ]` ` "(  ( #Ѐ! @`  *  >Ӈ(@㿘 *"@ >Ӑ!@*`@@  `@$` "`  " ` `@,  `((" `   `@,  ` 7$`  6  * >9a|*@ >n#܀2 `h i@"S w@"*  _@"Xq `h @M f@"3h `h ` @ ` @@ p@"[ `h `@U`@*S `h2`H>H"@`x2İ  &       ?     ?$    ?$   `H@`H `h  ` s `x   `@R `h>ݒ`* `@@ % 6`  !@  `P, / X  `("/`  "+` ` @ ` @:  `@`}@`u@" `@" ` `@ `@* ` `@,  `"  2  "  `@     $ ,  0  `@  ߐ $ , ג 㿘 >, & '?@*`:   > &  Ӓ >& ?@) &  & & && &  㿘  " @)   >  " &  ,:`@)Β`  >& & ?H4($   "` `8("@82 "  " "" " H  㿘H /e# * &  @ "  " 4 & " @@ &@&  &  4 & & H 0$@ H4@(@8`2 `` ` `/`, a` $   `8(": ``0   ``HH(@"&"`  #  4   ""@ ""`4"" H putc: required clalloc 㿘H /e * & @`@`2` ` 2&`>s!$  " `H 08?&`&` ` *`` `"@!  :*"  *  +  :*"  * *+ @`  ``@ &@&` `&` H 0 ` `8( @"@**/+@` `8@ + "@8*  "  ( @ ( (+@   @ * +@ @ *   +@ +@  &+@b_to_q: required clalloc 㿘`U H /e * & @>`5` 2/&>t  $  ."& " " 4Y  "  @@ &&@& & `@& H 0  >N XX` X  `@"  @" "  "@  8("8" >N X  "@ "    8 ("8!"@ ?H4(&  2 "  "   ` `8 ("@82" " H  xH /e4* &  H 00?@ . `)&`' & '`'&  ` '&  `'&  `'&  `'& &`&@&`&`&` &`&`H 00H 00(?PTCLPTRTCN46㿘`h ) >հ# 4 >#   4  2 4쀦  &&  & @& `t &`&`t  㿐>ٔ 0" 'b@M 㿘 >a  p*    T` `  , .㿘`>a * R ! ` `   2  # #   *@ `# # S@ `   @(8(82??2 @("`J@("`J@"` @("`J@("`J@"` @(82 ` (82 2 @@`?22(8 08 (2J@("`J@"`?(2J@("J` 2 " ?(8* 2 J"J("J"J (2 " @ (#`J@*(#`J@:#`J@?(# `J@ (# J`# 3   3  3 ` `( ` (88 * 2 ` `( ` (88 * 2 ` `( ` (88 0* 2 ` ` ( `(88 * 2 ` ` ( `(88 * 2 ` `*  `(8: 0( 2 ` @((882 J`  `*㿘@  "@ "8"@ 0  "@ "*"@   @v 0w?# @q&>ݐ a* R ` `2c  $ @$?  $?# @ >ݕ*! $ "@ "p`@  " a`@  "  @ N`@ 0   @A`@ ) &? 㿘,   ` `@Y?@Z'@]B 0 㿘``,  a ` `@Yo?@Z@]$ 0 㿘``,  a ` `@YQ?@Z@] 0 㿘`, a ` `  a@ q @  a `  `, ?#`,@Z?㿘 , " ! `  @Z? 㿘!> P>ސ L>`" >"`"@d5$ P P>a "`$ P`%>` "```:` "`` 4* ``2`܀ >  $> " `>ؔ "@ "!>#>Nb`"">y`+!>N"x>y`\$- * >P" "2 :  R  4*R   >P "* "   2   : R  R 2  4R2  42 4" 4 *R  㿘`>*  P"& *`2 *8    P2404*P *㿘> P```:`  ` 4* ``2`㿘> P`>``:` ( "`` 4* (``2`>!X2`@ a:`㿘> P`>``:` $ "`` 4* $``2`>aX@  >mbinit㿘H /f * ' > ,@   * @   >yH 00<!xmb_map full 㿈> (>>c<>̲#4`?@i.@ <>БH /i * * > !! ''H 0 >N""" '`"'Вb@ ?耢 ; >y#"#`b @>!H @  ,G &': `>>aHb8&  # #aHb8` "`㿘  > >> * " 2 0   , @n>ݐ#p.` 3  6 H /f * ' >8.`  2 H p@  & && 6 㿘  > >> * "  2 ʐ . @.>ݐ#p.`  "6 H /f * ' >8.`  2 H p@   & 6 && & 㿘H /f * ' > P>̀`"b ``:` , "`` 4* ,``2`H 0>b8` "`㿘>ݐ#p.`   !6 H /f * ' >8.`  2 H p@  & && 6  㿘>ݐ#p.`  b #6 H /f * ' >8.`  2 H p@   & 6 && & .㿘>ݐ#p.`  0 !6 H /f * ' >8.`  2 H p@  & && 6  "  @  l㿘H /f * ' V >8* ?2 H p@   "4V  $`@,V H /f * ' > !>  "@ 2` ?*  + >!H> 8"  `#!H" H 0 V >ݑ* pm㿘 X>"8>ݤ #p#>͑H /f * ' T * ?4 H p@   "1T  $`@)T H /f * ' > !>  "@ 2` ?*  + aH "  `$aH& H 0 T * 㿘T >ݐ#p*  D "#T  6 H /f * ' T >8*  2 H p@  & && 6 А 2 p  &  N&   &   6 &   ?4 `_& ` " ?@& & m_copym: off %d < 0m_copym: len %d < 0m_copym: null mbufm_copym: %d not M_COPYALL㿐` >|!(T`>|!@M   2 `$@` 2 >|<!X@:沦">>cp"T x' *  " V  4 H /f * ' V *@  5@ H p@  $ $$ 4 < _$  $  N$   $   4 $ #$ $   "8$   " $  ,` > !> ! "@ 2`  * @ $  $$ $ ($ ( , $ , 0 $ 04   &  2V >|!p  >aH  "aH~ >aH "aHm_copym2: len %d < 0m_copym2: off %d < 0m_copym2: null mbufm_copym2: %d != M_COPYALL㿐 >} {`>} u   2 `$@` 2 >}d @:>"8>ݮ`"cp ' * Ԕ " V  4 H /f * ' V *  5 H p@  $ $$ 4 c $ $  N$   $   4 $ #$ $   "@8$   F``(E H /f%>͐* '%>H   ĒH$ > !>" a 2  * ` %`  $HH 0  (  $ 4 $ ($ $$ ,$ 0  )       &  2aV >}   >aH  "aH >aH "aHm_copydata: off %d < 0m_copydata: len %d < 0m_copydata: null mbuf in skipm_copydata: null mbuf㿘`>~ }6>~>~ w&@ ` 2 o @ :#>~ 2 d`А" 6& 㿘 2`  2&   ` @@ *` & `  @ & 2  P `&$ 8" "@ " " `4 4"  0"    "    "  , 2""" *" 2" 㿘` ````  ``@` ``` &@I }>T`#p*  ;  "#T``6 H /f * ' T`>8*  2 H p@  & && 6 ǐ  L& ` `& `N& ` & ` 6 & ` ?4`   ?&'> )`*` 8   $`;  &@@& ` " $` `$`ѐ`ڀ`` &Ɛ>b  "b㿘``^ɰ` h`( h@` h`   &@>T`#p*  ~  "#T``6 H /f * ' T`>8*  2 H p@  & && 6 "  yH /f!>͐* '!>!H    !H& > !>"  2` > * 8 ?"  @$!HH 0  (  & 6 & (& $& ,& 0  <& ` `& `N& `& `  6 ` 4` `` 8  `i  &@@& ` " $` `$``〤`` &K>b  "b`&  (""@`2 "` 㿘_o `l`"@` ` @8@`` $@ &  ??" 6 >> " `@$`@""Z@ T >#t}  6 H /f * ' >8 2H p@  & && 6   2 & % ! ` @$`` " &`  @@ 2@"@@ @@@ 2@"@&@㿘$@ Ͱ  @8  `W"T>ݐ#p*  }" "%T6 H /f * ' T>8*  2 H p@   & 6 && &  " & & "@& & $  R ` ``&  s&ِ$n 8 ` 2T f>ݐ#p*  |ɔ "#T  6 H /f * ' T >8*  2 H p@  & && 6 U Ȑ l " ?@&   "$   6  &  $& $ (& ( ,& , 0& 0 ,` > !> ! "@ 2`  * @ $ (&  ʐ& $ &$㿐'  >ݬ#p  |W ! 4 H /f * ' >8 2H p@   $ 4 $$ $  $   `  0$ $ `$ >"8 ,p  |  4 H /f * '  4H p@  $ $$ 4    ʐ l$ %@@8`(E H /f7>͐* '7>H   $ H$ > !>" a 2  *  $  &HH 0  (  $ 4 $ ($ $$ ,$ 0  (8 $   2$ >!ܒ @ 8$   $ $   % %&@`c㿘 &!>    @W `  @R l  " $ 2 >!a "2 J`2 (@=  2 m_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbuf㿘`># >>#(&@ ` 2 #耦@ :$ #> 2 `" @ ߴ&  m == NULL in m_pulldown()㿘 >q!`  &@`  (   " Ȁ`  "@" #@  & $& &    @@     $  > !> "  2 J`  `'`"      ( "  `@ ?& `   t & Ā`"*U   `  ??" U 4U 2U  "# ` "`    "& >ݐ#p*  z=  "#U  4 H /f * ' U >8*  2 H p@  $ $$ 4 ɐ  `id (E$ H /f5>͐* '5>H   F H$ > !>"  2` > * 8 ?"  @&HH 0  (  $ 4 $ ($ $$ ,$ 0  2$ &ː     "&     $   $&2&unix㿘>"Β "@ +  2V: + 5 ) y @j 4`` 4 ` $ `   $ $  @  `@j4 0`>H"@2 &@2&@  4 &@ 㿘H o *@ a   ` @ H p@㿘H /` * ! ` `   @ " `H 00 `` 4`>`x@>`x> |@&4` H 0 㿘      @ ʒ  @  \@0z soclose: NOFDREF㿘H /` * !     @  @W  2 @  @M    4  " 2 @Ɛ 2   "   !!" %>!>   !XyV  "!% "     `   @ `"  " >!p6 ~H 0㿘  `  @ soaccept: !NOFDREF㿘H /` * !    >ΐ#` ?( 6  `  @ H 0 㿘  , -H /`4 * !      `2 8@4 "   8 `  @ H 0㿘H o *@ a   ` @ H p@㿘H o4 *@ a `   9`  %  `  @ H 0㿐 >  'Tb'H'L'P L L   P`:  U `` ` ' T  `'T `4 "`4T` | )`)@\0% H 0|H 0|H 0|H 0| 5|H /` * !  Ϙ$ Ԁ 2`  `$2` 9`2` 9H 0|H  '`\ "@hd" 4 ` `'$     @  (@   (H 0o| <`D=  *@ (L $  !l! #| ? 5| ?5||@\H 0 IPO|H 0>P"8%L` 5>ݤ   P .p  v  6H /f * ' ` 6`H p@   &6&&&   `&)&  v  6H /f * ' ` 6`H p@ &&&6 !  l4'[`X'VH /f!>͐* '!>!H    !H& > !>" a 2  * ` &`  $!HH 0  ( &6&(&$&,&0  (P >"Ԑ%@ @8  &h8( %8 %P  L  `" ?@&Ls L` & %P `I"`` `P` 2`  5H /` * !  `   PT@HH 0   ?5'T'P  P L@| ? 5| ?5|ɐ|P TT` receive 1receive 1areceive 3㿈 ''H'X''` &@ 2'X   ? !2+ Đ `  @  @  ʔE`2c_2& $" X      @  X   @= 8  6 X H /` * !  Lo 8@ :j H@ @d <8a`  \` Z 2  $ 8 " $>b"耢  I􀌠6 $  = X "7  "1 2V  2   `"Ӧ 9  ̀˦ # X ? 6 X ?6 Xڐ X@ 8H 0"z X°` V > "'H    H"@p  8 @" & 8& @ H("@& @H "& LX&H /f * ' V>8* ?2 H p@  2>$`@+H /f * ' > !>  "@ 2` ?*  + >!H8 "  `#!H" H 0 >& LVp* uӐ LV >"8>ݢ #p    'u  8 @" & 8& @  ("@& @` " ' `2'€'& LR&H /f * ' V*@ ?4@ H p@  "2$`@*H /f * ' > !>  "@ 2` ?*  + >H "  `"H$ H 0 & LV*uE  L ' V w"&V '!2"2  * 2  ( >ؐ# ?6  4 "8 "8`2!`2H 0H /``* !` $@"& "~ 2  8 @" & 8& @ `("@& @%@& LY%@H /f * ' V>8* ?2 H p@  2>$`@+H /f * ' > !>  "@ 2` ?*  + >!H8 "  `#!H" H 0 >& LVp* tm L2& 4@`  %@ "@&&  8"& 8 4 `2 "  & 4  @Q6 OK@# 0  ,@ 8 " L X ? 6 X ?6 X XH 0 2     ` " $ V `   Ԑ `  2@ 82"& L` "   `  @ 쀢@```  ` X ? 6 X ?6 X. XH 0 X`2X X"@ X ? 6 X ?6 X XH 0㿘`  ``@`2      @ p 8   @ 4 @Ԑ0 4 H /f * ' @ ? 4 ?4 ͐  ' ' ' ' ' ' ' ''@h $H 0   `@@Ё㿘?#@'P  "Ǩ * `  @P° *"1`"6` 0/` *"+`@&` *"` *   )``| *4y *I`" ` 2 ` 6 `"| ` (x `` _6 *\6 "k ` (g ``$ " `  0H &F  8 \@i > L 7@86& l <@80& H"? ` 8`9 >!X+>a\@ c & !a\@ |`` 06 ~6 Z `  ` ` @P `홐㿘?#  " * `x@ v  G&` 4 "CV @">V "9V 0X"6V 0U"3V  ".V 0M ")V 0H  ", H    "& <4$ l "  `07 "`&  "V0- &`  ` "@V `(" V ` #"@ $"@6 $`"2V ZV ~>!X &` `@ ݐ$@ >\`$  *& 㿘 (  ,~ 0 P 2 㿘   ;  6 @ɒ @ @( 8    "0 "@ 8   @ \㿘  " `86 @ \@ 8   㿘  " h06 @ \@ 8   㿘T T *T @ @  @J   o  0 @ n    6 6  "6  (6  &  6 " `& ( <& @& @' `   @  @:q   `@ 8    " 6 "` 2 "`  0 2 "`  "   `"`2  2  2""" 㿘 `6 @B \㿘 ` 6 @9 8   㿘 !  @6  >R "p㿘  #>ސ  @4 ! `] "       4 㿘`` ? 6` ?6`  "  0 (}2 ,㿘 \@" @ 8  H 2 l & H l 2 l(& l l ` 8& l @ 7㿘` !> (@6* @   .`@&  & &  㿘@Ԑ& & 㿘`  2 "@ 0 @I㿘`+   2   &&  (& "& " "` 2 2@ 㿘`4   " R  2  2R @  &&  "(& "# "` 2 2@ sbappendaddr㿘 @ >P!       ` # 4 4^ @ l-># m  4`H /f * ' >8, 2,H p@ `$`$@$`4` > `2@- $` ` "$$@`   `&&   " (@&  2   " &    2 $  sbappendcontrol㿘2>̐#     ` `"   4 $"@#    `&&  "(@& 2  `" & `` 2`"` semi-panic: sbcompress 㿘 `V `` ` 2@ 2R  R V`@$%     @ VV`@` ( `  @ & ` @ &²"& &`   `&& ` `(@&  ?6& >6 sbflushsbflush 2㿘 " >"@  2 >  >"sbdrop㿘    >"8>ݦ]#p " &&   &@  ("@& H /f * ' T * ?4 H p@   "2T  $`@*T H /f * ' > !>  "@ 2` ?*  + >H "  `"H$ H 0 T * m` 2  `>#`( "$ $ "@& "s&  k >"8>ݦ`#p%> " &&    ("@& H /f * ' T * ?4 H p@   "1T  $`@)T H /f * ' > !>  "@ 2` ?*  + H "`  `$H&` H 0 T *mU " &  " "& & $ 㿘  h>b8 >ݦ`cp& %>  " &&    ("@& H /f * ' T * ?4 H p@   "1T  $`@)T H /f * ' > !>  "@ 2` ?*  +  H"`  `$H$` H 0 T *l 2 sbcreatecontrol: message too large %d 㿘` ? (> Y  f   lQ (C H /f!>͐* '!>!H   1 !H& > !>"  2` > * 8 ?"  @$!HH 0  (  & 6 & (& $& ,& 0  2 縐   ` ? & `$ $$ 㿈 S  2` 2 >ܐ#@"``@` QqS0" (&㿐 @@ ``@B  `(㿐 @@ `'(accept㿈`  `   @z@ H /` * !  ( `2  H 0  ! `2( $H 0w #` $   "! 4T    $    >ސ 54 $ $  4 $H 00MR찒  H 00? &   >]#H 00- 2`  2>ܐ#@" "`(1 d`` 8'\ `V  H 0㿐 @@ L`(  !!2`D %`@a  =W 21   !!߰ $0/H /` * ! #>    $   "!` "   $4 $H 0  ?4 ?" x`@`` V@`` MR; D '2  2` >ܤ#@""(R&ܰ *2 2` " "`('谒 ` 2 `  찒  `    RsORnOߐp`` ``'` @'''''И''@7؁8` r  )#% (`*` hʔ 䀢*Y  `@'@ 'jn h@Ӕ԰ Ȣ    '  '? '''' ` '  ` @H  "0' Q  @  @2   @2>` 2̀  `?"   ?"  `?"`  "   '̀` ` ` "`̀ 2 M 7?  "`"@"`'  @`2ܒ ,  hؔlԚ`( C̰ 耢 ?  #   w; `$'   \ i Ѐ 4p` n  "`0'`` `'` '`@''''Ԙ'@A؁8` M  3#/ (`*` g ` * ''*0 @@  `'% i? h''@԰     ? ?''''   ` 'ٰ      @`ܒ ,  gGؔԚ ( 耢 'Ș̐     Ȁ@ ?  #` `  Ȕ # \ hԒ  Ȓ"@' "0 'Ѐ2 'Ȁ 8' @" `2@` aȀ&   @Rа  M̀ @?#@2>& " 8&?" ` "` '̀`2&'Ȳ ` Ȁ@:`  &`F@`  ?ȶ"  'Ȁ "@`2` &'&Ѐ "̀ 㿐 @@ `(㿐 @@ h`(d ` Z Ő ``lCH /f1>͐* '1>!H   ᓒ !H$ > !>"  2` > * 8 ?"  @&!HH 0  (  $ 4 $ ($ $$ ,$ 0   s 7 2`  7 ` "` 0 $ `(``㿈 @@)'찒 6` " '`  0)`(`Q` 2` `쀢  8' s `l 쀢 㿈۔谒 ''@S  LL㿐 @@ -`6  & `(]  2  7`  @  8' ` ` ̐㿐 @@ 3`(  $ + 9`  $ "  2  7`  @ ` 8'`` `ݔ ⑐㿘8\ Y  ᑒlCH /f#>͐* '#>aH   ` aH$ > !>"  2` > * 8 ?"  @$aHH 0  (  $ 4 $ ($ $$ ,$ 0  2  7 $ | ې0$ *  @*`2P   &" uipc 1uipc 2uipc 3uipc 4piusrreq㿘>" `  Q -`   ` `; -```25 `/.`># €`* 8@M&@# @`   @@M `    2  >& ` Y@ V  2>>ѐ"` 逧  @`  \`h"  &`h @$`  8```#  &`` 8{$`Ӏ " @ɒ ɀ V < v>`  8@  `  9`  >ޒ `8- C`     7 @   "`   >c" `8   `8q` `@  h" " & h` `@# ` `8 `" " & `` `8# `  N 1"@ 5H  `&@V  ?` "?`8@&@?&``2`$>b$` "b`$ &(`(&&&,& &$`-&` "&  & `` ` "&   "&  & `   >" ༐ැffffgg<i0g|gh(j8kTjLfHftjkg(kTk`unp_attach㿐 ` "V <  ,V ">ހ "> >> >  #" , c  " 7@ ,& $@[ * "@*`@*`$ ($ $㿘  " " x@B &  "  @ @3 6  2 ;" D >!8` *d @ܞd 㾀  ` @?? jN `@B,  'x'T'P't'|@JP 2=` d@8td@0@@* 0@ '$8 !7d@6 d`@5˔t 2`$ x&  ୖ & @9   P` D`  ` '''''K?  (0>* @ 9 t 3 & @6 * x`"& =T@V@@! )`  ``  2` =  沔 [ &`@ @unp_connect2㿘V@V@  )`" V  >""  "   Punp_disconnect㿘 '& R`` 2  $   2 >f 耢2$ & ` ?2`'$$ 㿘R`   㿘4 $   $  cv unp_externalize㿐 > 2`Jp  "4 ( @z'&? * (')>+> IS b8ޔ * #@  `!8 ?%!8? 㿐    `?#@2X  @Q 2  @  @` '* @`2` < c "8 ` `2 @&@  '>Ӣ * ` {' `  "` 8 "`$8` ,a  7  㿘>c  > x>  %  "c?#  4  2 `x 5?>ި#`L#>%> `(  c4  $c 2 @ 4 T 2 (" `2 ` "L@U@ 2  `x>c  &`* `x  ` @2    2  $@ ` $  2 @R` 2 ?`( "??` @J ?`b3 &%㿘 >@`x㿐 2 +?#R 2" (` 2` 2@?2  `  @`? 2R  @>  @2㿘 >8" "8J bremfree: lost tail㿘   >͔  >       2 2 >o  ` "`"  "㿘>͔  ->>!>>""*"H>ږx s  >"bhH @#L#L@0HH@F!P#!3> ? +>bD |@>",`@ $ H$ D$ h$ l$ @$ x`,`,$ 8 8$ 0`> >͔  $  "` ""$ >bb $b" "b$ H`@Ħ|㿘 @  0"2' 0 & 0  h? 6& h@7>b, ",'@Ð㿘\ @ 0"`0 &0? h? 4&h@7y>b, ",``2" @@ 2)@@ @Ƙ 0"0  "0? h? 4"h@7K >b, ",@ Ӳ`@g㿐\#`'P'T#\PT 㿘 0 2 \ \ " \ H "  \ < @" \@QM ``t 2`H`x ` `"`p`t "`t "`p 0? 0a $ 0H /d* %  \@  \>"`0 "0 \h "hH p@ 0@ $ 0@6Ӑ` @@r㿘 0  >9 0 & 0H /d * %  \@ڐH 0>"`0 "0>9!x F *>8"@ "*`  @0  0 & 0 0b& 0@3㿘 0`& 0@6㿘> 0` " 0 & 0H /d * % @ \H 0```0 "`0㿘H /d * %  0  0 7& 0 0"@ 0 & 0 0@" 8 0*@& 0 0 @Mܐ 8 $ x 0@, x > #`@ 0 \ ?& 0`" 8@8@ 8 >>   &  "` ""&  0@>   0 > >͖ &  & "@" 0?ߐ# @& 0H 0>cH cH"cHx  0 @ 0*@& 0x㿘 @4>bx>Ր bh*  "  P2  \2 0  2 P getblk㿘 @ >bx>Ր bh* @ <> P24 \20H /d * %  0  0  & 0vH p@ հ 0J 0@&H 0 2 P 7@ "@@ &@" $@& & P& TH /d  0`0& 0H 0ۀ * % @H 0@3㿘!>Ր @   0 & 0"" &"" $"& @allocbuf: buffer larger than MAXBSIZE requestedallocbuf: negative bufsize㿘>",@@ * ( 8>" "s& <:: 8'>Ր @s   0 $ 0⠀ $" $$  8 8$ @ 8  H H @ @4" 8& 8 8 <"@ $ 8$ < 8 >"PL 8 ͐  8(6& ͐* %>   H 0& <3 0 $ 0H p@ H 8 H@" 8"$ 8& 8 0@ $ 0$ <& <getnewbuf㿘#>͑H /d4`* %`     > "#H>#HxuH p@b  0@ 0*@& 0 0`& 0H 00 0 & 0 0`" \H 0 0`& 0؀ @H 0 x > #`" h@ h ?& 0& D& P& T& X& 4& @& <& d& `& t& pd & h l?"c& l`"  "` "@biowait㿘H /d * %  0"  #>bu   0b H 0 0$ 0  ;$ 00  0(  4 " biodone already㿘 0">Ԑ# 0 x"& 0`> #`@ 0@@ 0 @  0  X& 0€4 0 0 0 *@& 0v]>  㿘> `2*@&  >͒a`` "` * &>>  D !ؑ*   2  D@2L 2@ ! 2 2 >͒a``  s"`2 >͒a`` D"` 2  D `;&>͒a`` "` `  "`   "@$ >ߒa`$ `""`H   >͒a``  "` a` "a` `  "`   "@$ >ߒa`$ `""` ?'&@ `> "`  "   "@` "` "$  $  "`  "`"$  cache_enter: name too long㿘 $>>֐#h `\#>>!pat@ >ߒ  ZJ @@* @at%>ߐ $at!! E ` "` "  "@ ` ` 2"  "@$ `$ `D $ $  D !$ , *n:$ ` $ `""`>  D>c !ر* @@ $@" "@$ 㿘>ߒ!"!"`!> >ap> m% $!؁>X X"`D>> !؇(*X  2 :X"X"`D>`5 `",`H""`&`"```  # ` ` ` @2 `@ "`ᨆᨀ"`a` ` ""` 2`cluster_read: size = 0cluster_read: DONE bp㿀 >"  \ "`0` )   ܒ@   `0>b&`0`,  "`, > Ȁ`" &  @`  & &  ?    ; @ 8`@`  @/Ӕ `?$ 4    : @*&  @ `*` 8 &  &  4'  #`#d#\Y[  ; @M&`T8g`@b`R ]`@/| T`?O$ 4    : @*&  @ `*` 8 &  &  4'  #`#d#\ @f . `0$`0$`T@`  >"`, ",` ``0">#@0``0" `0?# @$`0C`@0`"` ``<@ `P@& `cluster_rbuild: size %ld != filesize %ldcluster_rbuild: too much memory㿐H L\` d>   ; @<8@ v   0& T& 00j#\@e 0"^. + W &&&&  L< &`@& L.   | `8`@@ `H@ >E 8`0 &`0  @{`0&`T&`0  *`"`& @ ( "͒ 2  0 & 0& L& XYX +p㿘`  - `0"\&`T\XՐ`0> @cl&`T&`X&`0cluster_callback: too little memory㿘 0(  4 L& L  H??@$  H@ 8$ <`$ 8 0$ 4($ 0 8"& 8  $  86 H>#H$ @" @$ & <& XX + 0 0 0 *@& 0rE㿐 P \ $`$`$`$`` "`H` 2 `H <`;`  T "``H@L@ `?`O' <``8# >@Q ` `@2  <2 <` <@ *` @.M   *Xu + <` @| < ! (X` +@$` < ; @>@"  T@-?  T? >$` T$`$`"$`$``2$`$`0$`$`    @5 $`$`ܐ$` T$`cluster_wbuild: size %ld != filesize %ldClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocks㿘 H L >#?   2 ` А0Ő  ƞ  `0 2`<?֐`8@?͐?/  + U `<$`8>$$$ `Ll$`0$`X`H @$`0@$`Lh  s  0 2 c   $ `8`T:  T@ >`P# T> P#>+  0?! @$ 0 0 x $ 0`> #`" H@ H@W`<`8@$`<$`8 8"$ 8H /d * %  \@ \h "hH p@- "@@   ``  `0 $`0$`L$`XW +?")㿘 + "  *  UA  & @&  ,` `<?`@  ,`" `& vop_generic_revokevop_generic_revokeall㿘> `"> h  0(0! >"& 0 n 0(!(& 0 x@  " 0x`  t t@2  " @ ͐  0(2 x 0 >& 0@ ڒ 㿘 㿘  $V   㿘    L*  㿘   K -operation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operation㿘 2 !>!  T* !@k*`"  >>#> > "  bXgxb * $  2vfs_opv_init: operation vector without default routine.㿘>*` 2>>Ɛ#x!䀢    `* " 㿘>ޢ b@ " b   b@   ̠  >ބ >ِ  2>p "a   "a㿘@>@Ԑ >>"b""؀ "bܢ  @?`(㿘   7`K W` F  "@A @ B&: `` @2`?? DB? ( (S ` \< < $ $ 4 4$ $ $   0@@'@~UK (0UH ( lf_setlock: lost lock㿐V  $   (a  @U/ ( ###> @    @2`lU ( `lcP`@ >#H @   @ @2`?*  @  6 @ѐ 6 @M& cPl     $ $$ $   >"Tؒ (@, 2'  @@  `*`>#4 €`" "|& V   R` @E   (T2j V R 2T (_  @  @ " `B  & :@@F V   R` @ ``$ $@& $`  " ` '&  "@TY (  & "   B?:@'}`" "&  `B :@  @㿐  2'0O`B L:@@?`C> *` € ( "T05 @   @"  @e $"  ( "S   B?: ' `B  : @W  @d㿘@( "  6`6` >@ 2   ?2    @ b `B >` @?  4&`&`6` 㿐'  V   `   @ 2T lf_findoverlap: default㿘 'հ Ӱ `` `@> "  `@6  ? ? 4 @2 $        2     4   8  & '    @     4   42i    ?] 4 @@  ? @ 4 2E   ? 4   @ 422  @  ? &  4> @ @ 4   8 2>?>  >p!Ѐ 6 `  $2$" $$2$ $㿘 `@2   ` @2 ``B > (&` `@ ( `@  (` B?> &` &  P ({  (`$ $` B?> &` & B< $ 㿘 $  & $ $ "`$k"` namei: bad cred/procnamei: nameiop contaminated with flagsnamei: flags contaminated with nameiopsp,$ `@$0` ">``2$>"?"`>ސ"Ѐ $>ؐ"`$ PT $` $`xі$`x`  @` E `   "  "``Q $@"$ `@? J? /2 `? *`L /"?` ""$, $  $ >"$ `J`/2  @  `Q 0~@  K  $ O `'` $  ?'''''''@%а   (P`Q K`$ # ?( `z`Qy $`*@@$`J`/@ @U`$`@4$ @`@ @@d`QT  $` 2  @&#  `$  >`Q> @@X$leaf should be empty㿐$`$  `` `"` `@$` b*$``$@"-`J /2#$` J /"`""@$$`t v J 2` 2$k $`  +$`$` $`@$`J  /2``"`$`Q ?$" $J`/2`J /"" "$$` $`*@$` J 2`` `*@$``  $`  * $`` 2``J` .2 `J@ .2`` *@$``@"%$ ' @@q`@! >" 20$$@`` "$`!"H$$@! "8`   >#0?0 ?H`< ?'`@h@6`@!_$` ` H <` $@  `*@$`` ""@$` "@$$` J`2`  $`  @A 2t  €@W 2g`@$t `x at  @@  @@"$$` S$``@ = ` @2 @$`@E`@? `( H <`# H <`` `@ @$2`@`  @$r  `   @@@$f @ @$relookup: null namerelookup: lookup on dot-dotrelookup: symlink found.㿘 ` @*@ b&`@ yJ@ 2>!@"> "@  "@@ ?>#0Q O  H <`J@I @ E  t @">"0?  &  H <`!`" H <`" @`@`2@  @#ؒ     @@#͒ @p@ &@㿘> >N>" 8"b">ڒ!"!"`>#P"#P"`> " >Րb`"b`@ j" vfs_busy: unexpected lock failure㿘 <@@` @& <g   @ D[   >f 㿘  DM vfslock㿘>>"b܀``@ꎒ 2`$`2  LȐ!@ꨒ!>   C   $ $ @ $ <$ $ `> `$` <*  $ <` @  /,   Yu$ &  %s_mountroot failed: %d 㿘>L#H ">ޟ "܀ " !> "  $ "i  $ 2  >``@" `d 2 @`h 2@ @ 2`d 㿐 >9 >Nx b * & d`& h`4b>bb`b`@ ''b `'4bǐ & dJ   *`J8*  ???: H2 " X": " <" @" 8" 4" 0" ," (" $" D" " " " " 2 vnodefree vnodefree vnode isn'tcleaned vnodecleaned vnode isn'tClean vnode has pending I/O's㿘>!p>>Nb aL>ِ +  #b#b >#P`#P>!`!b "  K @韒 aL S$aL 2 4>~#!&W  "  P>!@>~"!` T"`T" T P"@ 0 t*$ 0`$ |@ >!0@ɒ>~!@H /d4 h* % h >}!XH 0 $ 0$ @$ $ $ $ $ $ $ x~$ t$ $ L@ & $ 4$$   H ` X" \ \ \ \ X ` " H`" X` X \`"`" \㿘@  㿘@ 㿐?>&@ Ȓ  A &@$ t@  '@&@ 㿘t>ْ` "Y @ @>` ?>Б* b @@    x` @ t t@2 4 @: 瀦      t "  Jϔ $x@ " " " $@"" 0$0 0h@& 0 @!T@ L& L& W$tvget㿘@@@ 0a b& 0>` d# 8 @  4 ` <   P`2  T T> "!`" T T"`T>"#T T P"@ 0*@& 0 4` & 4@H "  4? & 4@  vref used where vget required㿘 4 4 >|ɐ#& 4Use count is not zero!vnode already on free list: vnode already on free listvput: null vpvput: bad ref countvput: ref cnt㿘>ـ ">| @ 4?`& 4 @  0A> 8 > P@H>| h`" 0>|}# "  <> @7>|r  `& 0>!>#P t 2& P & P P"`T P""& T P& T"@"@ + vrele: null vpvrele: bad ref countvrele: ref cnt㿘>ـ ">|7! 4?`I& 4> 8 >!@>|&!`" 0>| # "  <> @ڒ>|  `& 0>!>#P t 2& P & P P"`T P""& T P& T"@"@`@O @ǒ0<42<P"TT T> TTP "P>چP"T <"{# 0@& < 4  P`" T T"`T>"! T P"@& P>cP` P& T`""`㿘>"   : H/ X 0 2)"  4 8 "" t 2 4  " t? @ @,> $ L  2 H`  vclean: deadlockvclean: cannot reclaimvclean: not cleanvclean: lock not drained㿘 4  & 4 0!"!>{)!& 0@@`@-` ? @k  ` ?@!@ @$@  >z!3 4? .& 4 < $ 0>z! "  > @>z  t>P`& 0P & PP P"`T P"" & T& P P& T"@"d >  @2 >"@} I & >`? 0# @& L& & 0 =& 0c\㿘 4  @ 㿘>"@vgonemissing bdevmissing aliasvgonel: not clean㿘 0! ">& 0 a 0=  H   t? 8f 0 x`"b 0@`"x2x`"  x2x x "2 0>z=  0(4  x@  x  @ t t@2   `x  @ t t@2 `" `>z 2 0`0 7#`0 0 7& 0 xIG & x 0  *& t 4 & < $>>y #P@#P P` T"`T" T P"PP & PP P"`T P"`"PP& T;` ?>І(   x @t@2 " 㿐@. ߔ @ `@㿘 0(2 x" 4  0@ ` x` `t t@2  4  2x VBADVFIFOVSOCKVLNKVCHRVBLKVDIRVREGVNON%s: type %s, usecount %d, writecount %d, holdcount %ld,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT|VBWAIT|VALIASED flags (%s) X >z!X`t>ސ#ȕ* `8>`4!`z`<`0`/>a@x`0 >a@q`0 >a@j`0!>a@c`0">a@\`0$>a@U`0(>a@NO >!zn` >>zg!0zd!@@㿐`6 >"܀F    $=  2$6 \#\`,-    `% ->"ؒ\Δ > "܀   2$ ]b ( -kinfo: vp changed 㿐 >!L ` *` * " * " * N&@$@&@J >@"`"` ? />   / ''+>`H >#쀢`yΐ```Xno  2`nh 'ג`ǐ$@&@  x .  0* %x  t t2 x x `  t t2`"  㿘\`  <"t $`0`4o P 4`4 < "f$ <d  @ 1E\@<`Xm\ R `\@$d_,`d" \`mܒ ? d@$ g, `,  > P ``"@2``  `$€@2  7  @"  $`0`4o] P 4`4 F 1㿘 `  F 1㿘 %>    (F & 㿘@" < <& <! P " <!& < 㿘 Ր`  )>'> "@  x*x 2  >x #>x#ެ syncing disks... giving up done 㿘H o@>x >a >ڒ  @` h@  >>w 0w softdep %d 㿘>" >ڐ h @A  ' @c />3>> cH* D"@*` ? 3  )> 0  "  0 #DH /d * % 㪐 0 $ 0H p@h w!8 D?  >!Hwp@㿘`  2 -> !` >ސY#İ㿐  -\#\ِ vwakeup: neg numoutput㿘 0@ \*@& 0h? "h>uʐ#x0d  {"0^vhvinvalbuf: dirty bufsvinvalbufvinvalbuf: flush failed㿘`MH /d * % `hd$`0] `h 2`0`d .H 0@”  H /d4`h* %`h  `d >uo H 0@= 0H 0H /d * % ```` `P  ````P &````d` 0```P &``8  %>P &)0 0  "0  \' "``H 00)0"00``0 "0k Ҁ`` `d >t (H 0 vflushbuf: not dirtyvflushbufvflushbuf: dirty㿘H /d4 d* % d'  >0 0 tp0 "0H p@\` 0? 0є``2  hH 00 #> 0 hd& 0 c[  h`2 0H 0 d >#;0bgetvp: not free㿘`\ >ti!(&`\ t? ? x &`D&`D ` &` ``"`  `& `&` brelvp: NULL㿘 \2 >tC!!P#!@  `"  "`   "@& 0 @"& \d 2& \ *@"0l`"pp"`ppl"@& \b reassignbuf: NULL㿘`2 >u"0O!P#!@  `"  "`   "@&  0 `0 @2```d 2/ *@&`0`l``p"`p`l`p"" @`d`t   >#>#2`@ :``x `>c@ >#@ &  "` $& vfs_register called with vfc_refcount > 0 㿘  >u# >"܀ "ܐ @   $  $  > ؀@4"& $" (`" @ 㿘>"ܢ" $  @޻  2 $ 2     $$@܀     4 $ 2 >""ذ 㿘 4 " 0>sV# "  <> >sK  `& 0>!>#P t 2& P & P P"`T P""& T P& T"@"㿘!>N "$"  @ ">N @ ""*``@ "㿘H /d * %  0 @ > l`" p p"`p p l"@>#@4>`>N@ِ>N⸕* @ & l@  l"`p⸒ " & p 0 & 0H 0sched_sync: fsync failedsyncer㿘>">/>߬"ax+> ;>N9>N7> )>5> 3>aH /d * % b "*  %%H 0 @ (%>`@  @ʖ @@@2@ d > t ">r}#i@  `#@ # ?%#a (cYp 0㿘H/` />ax > l!@\ H 0>c>ޕ2 # :   >#`##"# 㿐>!̠ ͖ 0$  "`8>N>N b "`t"># >N⨓3 2   : :`#b  ">#2 :`#b"  $ 㿘  "H>#ܐ >  c  `< ?`$`< @    " `< @$`< o 㿘 4 2H  @ 0" l`"pp"`ppl"@"8  syncer vnode 㿘 >s# ( ">8o>s 8 vfslock> ``  6GS a`@ D'h'@'d'D'l T@`P 60 2HؐG  <  <@ @$ < l@  G!6 "0+``!* &` @i`@@  @  F6 "0`" `!  &`@  n t s @  f !>"@`` 2`$``[ʰ @ "܀``@. 2`$`2xH -  A  >]!@=!>   5F   H@>$ $ `  <* @ $ <`@۸ $ `$ l` " < < `@$ < <?ߐ# $ <`  ~ @  $ <` `@ <@ &W <@ $ < <@*@ $ <$ < <     L "$ $ 0C$x  25 ` $`>Ֆb`$$ b`  #"`""`" @2 @r <`2   D ` 0 " xӐ?u mount: lost mount㿐 4 6 x  € "> >p"H!`%>` 2  А<$  2 `Ɛ2$ ``2`$$PP@ D''''' . H`l   E6 "`<10`<@ 0 % !  7  `@ unmount: dangling vnode㿘 <@@& <A>  @` 4 < X& <  " < < 2   @ " @    %> < 2  <  2 <8 <@*@& <@`a4O  <@*@X <*@& <1"`"`@ "` `@"@ ` "`x  "  @>o4 8`a4  <@Wݐ>h  㿘>զ"` @+%>   "`<` 2` ?$`< @@`  @ "``< @$`<``@ڐ P@ @'''''   H `` `@`㽨@ @'''''֐ $ H  D  > <* $ D !6Du  f!','(`dɔ! L@ >@ #L`( H  D` > <* $ D !6DJ  Pf^!'t'p`d!``@ܫ!>"`"`@@F ?#P/>  ܖ `3@,*`D`` " `<@`<6 $D f!'t'pdU! a@Ȓ`@Ð` ( ''0' 㿐`@@  @ (:`@c t`  `@@% @W $ x`  f  ` €|    @ $/P@ D '''''@3 `} &`P !6 Cq 2@ D'''''@  " ][ $  $ 㿘ꖐ   t   `@@ @ ؐ0@ Ф4#0  ` @$`` @ 0'`48 '8$\@+ '\'<$'d 08  ;8@ b H$6  ?\ 0% ?0 u&?"g f0>$\ h ϔ 4`$`4` 0'$`(  ?7 ? 77   0 @+ @ 28T``@ ^`@4` 6@ @Œ``2`H  <` `t  @  H  ?`@;  @T``@ #0!+0 @ޔ0 &0 !6Bv & D@'''''鵐 ؐ@  H d' h' H$ `b 6BD'T ``  @`b \"X `@\b  | 2  FT` h T'T`t ` -  !@ u dT`t { @  vT @ b odT@L T @ T@ `틐  ?T@ ~ QT@  I`T`8 "`8>ߐ h `ϔ 6`&`6` T`01&`(  ?7` ? 77`  0T@  T @_ఒ  V`T@ `"ΐX ?0T`@ 2`@6`T @X  &"X (T `a6Au %x@aʔ   2  Ft`  t@ 4t `a ` !6AH 2/0@a  2'쒐 2   F` ,8 2, H P    <>*@`!'Pa{`a6A o` `j @ 't 'P'x'T'|GP ]` ( 윐`<`$ /`* `  7 '8    2  '' '  2d` @ dtd@  d@Xd0d`t@ Ζ@td D @  'P't'x'T'|ܐP 2-` d@t`@ ` `~ 0!  '$`  *7d@ { d`@ tP@ @'''''砐 : t   ` '''''ܰ & "`@>@7 ѐ 0 0 @ 9`@ 3 Ē@ ԰  7Ԑ$@$`) 2:`  'P't'x'T'|JP -` d@ t`@ `판 ` 뎐`$ `8 !7@ dd`t@ g9R P@ `'''''  . @2`@ @ I   D @ IJĒ@|  @ 2āP@  '''''ϐ '`0 @ Āx0 @H @ x  @ r Ĕ@ 8@`+ @@ 2T E B  (`t = ``? " `  & 00 0-` @ B &  @ B <  @  ``@ B  @ C < `2``  `<   >P`?@2 ` D $  ` $ @''''6'ܰ 2$ ``*`` !``2`@`@ܐ @ ;n$ $ @ D'x'P't'T'| P `@U`  !6 > 2'`_  `@ 'x'P't'T'|P `@n0`  !6 > 2'`^ `P@ D''''' `@  (@ '''''媐 ! t  `` `  ?''''''''@ (а`" &@ @'x'P't'T'|{P 8`` @ 9`@H`< & `?a6`> `@  ?   鬐``'@ 또0`@@ <`  (@ `@H`< ' `?a6`= `@ W ?   i``'@ \@  `?@- @ @'x'P't'T'|P !` @ `@0`H`<  3` /7@ %0`?@+ @N@ $  (@ w`@`H`<  ` /7@@  @ @'x'P't'T'|䈐P K`` @ F`@ΔH`< 9 `?2``?!<`a6= 2`>#Ā`<`@ ?Ð*@ <##詐`7`'`'@@꒐@'P't'x'T'|0P K`` @`@vH`< 9 `?2``?!<`a6< 2`>#Ā`<`@C ?Ð*@ <##Q`7`'`'@@A:0`@p@ N`  (@`@!H`< 9 `?2``?!<`a6#Ā`<`@ ?Ð*@ <##`7`'`'@@@  `  @+ '''\  D耢??'?2@?'@ @'h'@'d'D'l_@ - P @`@`H`<  + *" " * *   * *''''@@釐 牠`  @+ '''\,  B耢??'?2@?'@@  0   (@Ő`@M`H`<  + *" " * *   * *''''@@6@  @ @'x'P't'T'|ʐP +` @`@`t` @p @@Β  `?@0@*@ , 2(&  @N`@֔`t` @6 2Ր`? @Ȑ@ | 㿐@@   (`@@   > #`@@ V @# `'''''5 2t `,` '''h'l'"h  @֒ѐb|x`t `t ` ` `t  " "? $  @ @Ā  @@` @t @ @Ĕ|@x@@腐``"@zwusp3  "j3 ? @ `'t'x'P'T'|ᜐP /` d@MtdF0A ` '$`` *7d@= d`@_t `P@  '''''^ 2`t   Ā`0      @ @  @ Ĕ@R@Ā0灐8@@ z'` 2`(s '`t m ` `''''''''`@V   ?  @g'' @:  E`@ > d`ؐ????Ȓ@  (`@2`  0 "`  H`< "` ` '  "(k:`  YƐ`'"@ & $ "`2$@ @'x'P't'T'|P " `@ː    95!6  `4 `0(@w ( @*`2P   " 㿘`  6`>!66&& & &&&& 8  &$&  [  (D&(,<&,0 [&0TLZ ZZ ZP@ @'''''  H``D`  `Y!㾐 @ `( H``D`  `X!㾘>`"``"`@2` 9 />  @ `(!6  D ` JVXĔ! a7`ΐ` $ &&(0& 㿈 @`@ +`@@"  2R  (`t " ```? #\t 㿈 @`@ +`@@"  2R  (`t " ```? #\t 㿈 @`@ +`@@"  2R  (`t " ```? #\uO 㿈 @`@ +`@@"  2R  (`t " ```? #\u 8`,`d$b ;  $`(i$`$ L$`(ܐ ` 2`1`'7@ ``@r`$ {{#`@x`$``@p `  `h$`d }$`$a  D$`(ޤ Y`t  P -bL d` !@ @`dt 9 @; 4 @ -d @ @4`@Đ  ?@ @H ` 8 &8䠐㿘 H <`" 0 t` >ϐ"|*` €   0 " @~   >L>D>D>L>L>D>L>L>L㿘` 8?$ 8@ːp`d hl`@Y'\ '''?'쀦 '' '@r@$  "  @ 㿘( @`@@ > t * @<@$ @ C >@@Ē 㿘 ( `t   2   2  2  `H " < "  @V`@ސ@>@( @$B>@@ 8@ "K&@&` t?`>А"*` €  ( 0&  *2 @ 2 >`86`6` &` &`&`>`0&`&`&` &`$&`(&`,&`@&`D&`HAAAAABB8`( t?`->ѐ (*` €"@0@@< 8`$ " 3&"z@ T`@š%!@    @T`@  a@ ` " "`CCCCCCC㿘  (@V vn_lock㿘@? @c#> 0! "@@  @ $ 0 `hF  @@2 0㿘  (fV defaultvop_islocked㿐>  L ''*` €vop_lookup㿈>  L ''''*` €vop_createvop_create: dvp㿀> 0! ' 'ΐ 2'>_9!' L!'* '@vop_mknodvop_mknod: dvp㿀> 0!0 ' ' 2'>_"X' L!0'* '@vop_open㿀>!\ L!\'''''* @vop_close㿀>! L!'''''* @vop_accessvop_access: vp㿀> 0! ' 'Z 2'>^Ő#' L!'* '@vop_getattr㿀>! L!'''''* @vop_setattrvop_setattr: vp㿀> 0"  ' '  2'>^ x' L" '* '@vop_readvop_read: vp㿀> 0"8 ' ' 2'>^e!' L"8'* '@vop_writevop_write: vp㿀> 0"d ' 'Ԑ 2'>^?!' L"d'* '@vop_lease㿀>" L"'''''* @vop_ioctlx>" L"'''''''* @؁vop_select㿀>" L"''''''* @vop_revoke㿈># L#'''*` €vop_mmap㿀>#@ L#@'''''* @vop_fsyncvop_fsync: vp㿀> 0#l ' 'J 2'>]#' L#l'* '@vop_seekx># L#''??'(@؁vop_removevop_remove: dvpvop_remove: vp㿈> 0# ' ' 2`0>]s `0@ ' 2'>]f '# L* @€vop_linkvop_link: dvp㿈> 0# ' 'ؐ 2'>]C!' L#'* @vop_renamevop_rename: tdvpx>0 0 '''' ' 2'>]"(' L 0'* @؁vop_mkdirvop_mkdir: dvp㿀> 0 \ ' ' 2'>\"' L \'* '@vop_rmdirvop_rmdir: dvpvop_rmdir: vp㿈> 0  ' 'b 2`0>\͐#``0@ 'U 2'>\#p'  L* @€vop_symlinkvop_symlink: dvp㿀> 0  ' '1 2'>\ 0' L '* ''@vop_readdirvop_readdir: vpx> 0  ' '  2'>\u ' L '* '''@؁vop_readlinkvop_readlink: vp㿈> 0! ' ' 2'>\L!p' L!'* @vop_abortop㿈>!< L!<'''*` €vop_inactivevop_inactive: vp㿈> 0!h ' ' 2'>\"P'!h L* @€vop_reclaim㿈>! L!'''*` €vop_lock㿈>! L!''''*` €vop_unlock㿈>! L!''''*` €vop_bmapvop_bmap: vp㿀> 0" ' 'P 2'>[#' L"'* ''@vop_print㿐>"D L"D''*` €vop_pathconf㿈>"p L"p''''*` €vop_advlock㿀>" L"''''''* @vop_blkatoffvop_blkatoff: vp㿀> 0" ' ' 2?>[Z!0? L'* '@vop_vallocvop_valloc: pvp㿀> 0" ' 'ʐ 2'>[5!' L"'* '@vop_ballocvop_balloc: vpx> 0#  ' ' 2?>[ "h? L\' '''* @؁vop_reallocblksvop_reallocblks: vp㿈> 0#L ' 'y 2'>Z#'#L L* @€vop_vfreevop_vfree: pvp㿈> 0#x ' 'V 2'>Z#' L#x'* @vop_truncatevop_truncate: vpx> 0# ' '/ 2?>Z 0? L'* ''@؁vop_updatevop_update: vp㿀> 0# ' ' 2'>Zs ' L#'* '@vop_whiteoutvop_whiteout: dvp㿈> 0# ' ' 2'>ZL!p' L#'* @vop_strategy㿐 \>$''$L*` €vop_bwrite㿐 \>L''LL*` €    dead_read: lock㿘@  " >Z "`0   dead_write: lock㿘@y  >Y" 㿘@o   > "L*` €  㿘  \ " @U    `0("`0 0 㿘 @@ *@&   2 @7 >  ! L*` €㿘@&  "       tag VT_NON, dead vnode 㿘>[    dead_badop called㿘>Y ȝ㿘 0!   "& 0A  0!"fdesc㿐 <@@ 2 - @ 2+  &  "t0`"0 <&! & <"  YO& Z`@Ĩ"  @Ĥ Z>א!0Q   㿘!6` 4 ` ݗ 2 ފ!(a &! 㿘!> bC`l&@㿘      D `D*`"  * "" &`&` &`&`@&`&`&` d` P  `TP Z` P Z `@Ȕ   㿘>>! >1>> >9!|>wb  !|  ( 2 +  <㸐  9g &# 㿘> #>Ւ@ >ٓ*`" @ >N 2 `H2   i   =& 2 >N"` "`$ @ @>͒` $    % "`?$ $ $ $ $ @ $@" $@$  `$ $A fdttystdinfd/0stdoutfd/1stderrfd/2..㿐        I `2 N .2Q%@H " * ʰ 2 >ؒaؐ@æ  2 H  _ %@`"t' 2( >ؒa@Ì  2   , " ! ` 2H   :  %@"t`3   0$>ؐa@_   >ؠ! >ؒa@S  >>ؠ"  b@H   >ؠ"  =H  U  "`%@"t 0K  >ؒb@"    Hk 69 А  ,`*`* :` ?Ѐ@  N @ ,`  `2H  `  `" %@`%@㿘  `>ِ"`*` €र   "`\>b<    fTfTffTf4fdesc attr8`@. @ 2R [ " (  " (O>" (K>K H@ D?`# @?6`tɒ :V  qŒ 0Lؐ &@6`6`&`&` &`&`>`&`$&`(&`,&`0&`4&`8&`<&`@&` &`DЖ @ >`HV"xfdesc_getattr㿘  ` `W >ڐ!ܓ*` € `@` $ ` `` !m!m  4 $4 $ D`@` < >"<!   4 $$ D4  <  "4 4 < $$ D$ $ `H" d>$ $ P  $ 4< H$ $$ ($ ,$ 0$ 8$ < $ @` 8 >VO 0$`thxhxihxhxfdesc setattr㿘      )  @?% -#  `*@@ 2R     (  > @?  ->V !%d㾐  `   2  `    @Q   7` 2M, >* ` ~ >`\y @    2 ``, "'a `2 `? + @" `'` M/ `/ 5 H` B  \&@=? 69 41>ڨ/>آ  4   '/M^ `,@ /, @ '"W?// 5o   ? ` Ԁ < <㿘 `t "` `   -`@q 5I㿘  `  ->b<   㿘  `  ->b< &  㿘  `   ->b<   3  㿘  `  ->b< N  㿘   $ t 㿘  `"`" $/ &  `>ۄ̇(`  ` "`  `    oooooooootag VT_NON, fdesc vnode 㿘>V0#  㿘  r   㿘  h  fdesc: bad op㿘>T    㿐`x 9  "  $`x  \ # $`x $ N  $  " $  # ~$`x$ ` 2` 2      $    2  $<  "    $   2  $<   2 2+>) =!aȖ ;)  t 2.   #   %     +>) !aȖ ;  O 2      fifo_read mode㿘   x @>Sϐ# 2 5 "`!4`  ܔ     `@2 ` ?4` " ` >4`  #2   x` " fifo_write mode㿘  `x` >S  "  !4        - `ʔ `  >4 h  "~@"#      x 'p<  "  "  `x ' p+  h  `x 'p  "  "  `x 'p|   㿘   -  "       㿘    x`? $`m`  " 4` ? $` k@4  @`"  $xtag VT_NON 㿘>TB#@ >ݰ T<#, fifo with %ld readers and %ld writers㿘 x> #T( " "  "    "     -fifo_badop called㿘>R  kernfs_get_rrootdev: no raw root device 㿘>Ԁ #>LL ">>!  %> cL,  @ @$cL   &cL?>$Sː kernfs㿐 <@@>4 -!P  2, @   "t0`"0 <&! & <"\ H Y Z`@"  @ Z>ސ!I   㿘!6` 4 ` s 2 f!!= @&! 㿘!> b`H&@㿘>&@"("(&`"(>&`b> >!p D!L" "&`&` &`@ &`&` d` I  `TI Z `I Z `D`@  ipsecversionusermemtimerrootdevrootdevposixphysmempagesizeosrevosreleaseostypencpumsgbufmodelmachineloadavghzdomainnamehostnamecopyrightbyteorderboottime...%ld %ld %d %d %d %d %ld %u 㿐 5x [ "#    0! /M 0"s> _ Y 0K kr 0@>a R0l>a0R0f d&>   a@"b   @ @Z " U @ 6"@ "" 8  ` &D >!>   @ > #>΀ "2 HԔ ** >ɄaȐ( aȚ(>a8R0">H>aHR# 0@t  @"& 㿘 / _ J?` "!>Π"H> "#J?` "!> @H>"!, 㿐     %@? q   >L . >ӽ%@`_ #>  b ` `@  ``ɔ`@ >  ` G>`?5  ` և -  %@+ 2# !PH    "` " ` " t%@` 㿘 `0 2!m``    㾈  ` @sv$$ H" d  $$ @m<$$*`" *  * $,$0@" $$:   44$ 'c! 2< <  @ - 㾐 `t   -`@ 'C! /  㾘 `t  # -`  @   @8/ "   2  .@㾈  t` L  8F    @ƒ  7>b ,` 1 >c@, G2  ?" u쀢 " `  'G/ / /7    `㰀@& <`<㿘   ;$ t 㿘  U &  `>4(`  ` "`  `    (((tag VT_KERNFS, kernfs vnode 㿘>PU#X  㿘   2 㿘   ( kernfs: bad op㿘>N#㿘>ْ ` /r >"c null_node_find: vget failed. 㿘>#`>ّ6` >ّ* b` #>`2@`  H2 @ h  O`8`2` null_node_alloc: no alias for device㿘>"   >!   0`t  $ t  ֐ $ x`x` " $ $` $` " t&  t? > x~ >  $ t$ LU ә+>ِ? 6`;%> x> b: ?*   x " x x   t t@2 4 ِ  怦  x" x" x"`&>M! 0$ 0 0hѲ& 0`c *   $@ " " $` null_node_create: aliasnull_node_create: lower has 0 usecount.㿐"  'Q р`4 4 >w#>M# &㿈<@@a -C  [ T&(&&$&&,ʡ PS& t  D    H$@  5 0*0 "0$` `H< "$< $<$΍ YC3 Z`@$@ C( Y `@$@  㿘!6`  4 ` ѣ 2 Җ!m &! 㿘!>  bO`x&@㿘! @P@j!!   "P& DT&@X@ &`\&``&` d&`h&`l&`&` d` D  `TD Z `D Z `D`@ϔ   㿘!   - -null_bypass: %s >!P`@>`N+#`  *`1>͠x  @ $@ "$ @ L!@" $ @$ @` "@ <  ` 2x@@L*` € ` @?3`>ߐ ؐ@@   x@"@'@`" `!2  2  "@  `H <  ` ؐ㿘   `H  d"`㿘  t` H <` f㿘   7 㿘  "`"`" J & ǐ tag VT_NULLFS, vp=%p, lowervp=%p nullfs lowervp㿘 > "` Mb >ҧ# 㿘  \``$ \$ \㿘  \``$ \$ \㿘  ` @*@&  㿘 @* "  㿘  `   H`<@?  ?   H`< @   㿀<@@_ -A  Y $ R (` `J ,>!| 耢 A  ސ  " ؐ  "`t0 "0` Z" "@"`# # `" <$g$< YA `@$@ A Y`@$@  㿘!6` 4 ` ~ 2͐q!   (! !> $!㿘!> b!`J&@㿘"   D&`&` &`@ &`&`&`&` d` B  `TB Z `B Z `D`@”  portal_closefd: error = %d 㿈' >L-#㿐   '%? I   >L .|%͐ < | `H6 2/ "`t     "` L +>`J@ "$    $`BI$@b $` %b% #㿘`"! =VV@@"` ) 1 2` =   沔  &`portalconportal_open: %d extra fds ``'t0 'l  \  H a ऒt ltbP 2l` (t lH /` * ! t` `$ '>` `>!X *t  "0t` `$ "`H 0t`$ 2`Zt2 ~tx X @ @3 Xt| @2|` ``'x`'|`'` A7 P'''    ?؞P''t ''''' X jl 'plh耢 ' &` @'ht'p  Pp "l  'p O@l  " 6l ْ`8l`@?2  2` . = `>?"(JΒ $  @?` ,@ `R     =H 0l% \ l "tt Ӓ t㿐  ` @ʄ$ $  H  d""< $ $ @{ $ $ *`" *  * $ ,$ 0< H$ ($ <$ @$ D 0  !$ 4 $ 4  !4 4 $  $   02  @ -  㿘    㿘    "   &     " `>x(`  ` "`  `    0XXll@LlXtag VT_PORTAL, portal vnode 㿘>J   㿘  E  㿘  ;  portal: bad op㿘>Hk!0(%s)X Ȱ ->b(   `1? (`,>Pa J  (H 0`  Ā`4`x    &`2` @$n` =`Ą "``  Ț   '?''''''@%'䰒 2k``    '?'''''''@% 2W` (   K* :I`  ' ( "@`   '?''''''@%[ / "?`@ 2L "        # '" 2 `  *'`` @8&` waitrunstepdetachattachusr2usr1infowinchprofvtalrmxfszxcpuiottouttinchldconttstpstopurgtermalrmpipesyssegvbuskillfpeemtiotabrttrapillquitinthupprocfsxprocfsprocfs_control㿘#`4 4@2`, ( @j `,6a4`H(@&`,`4&`Xܐ#  N`1  `H`,(0)6a4>0z{4>0u`,({ 7`H&`,`4`X " `, `,*@&`,/&`X]N`1`  &``,  @#! @` H&`0M`,(0 N`1  `H 5>! -Ж N`1  `,( `H *N`1 2& `H2" `,( N`1 !>! !- N`1 0 F!N`1  0V 㿀 6 - '@䰒 ,>@;#h  -`">@-# N`1 2``H2 ``,(`06a4 `# 㾐@u 9! $@@  `  &``, `@"p` @ &! 2` 2 `N`1  @ݐ` ? &`> ,2   㿘 ( @* #`,2 `  Ā`4`   &`2` @"%`  Ĕ" @#_` `` @6&` 㿘 `  2`,!" `4!6  `4  > !  H    @'@H  -H͒ 9 P $@@  `  &``, `@!Ȑ` @ %y 2` 2 `N`1  @ ` ? &`> ,2    %d %d %d %d %d,%d %sctty,%ssldrnoflags %ld,%ld -1,-1 %ld,%ld %ld,%ld %snochan %d,%d 㾈  -`H `4 4a      4a < . @@>aF`,`  > o na>a??F >뀢` !> aF>aa `2 J> aF>aJ ,>F~aа`,  >`> ܒa FrFma >aF_`l>b`>"FQ`!>@"`FH`FCV`  %>`, @ F7V`   >b(F. &"@  ` $|>N  procfs_allocvp㿘>"'>NȀ>N 2 H2  0 &@g 2>N"Т` "А`$bА ,Y >`"|$bВ Ֆ Bb@   $ "" ""*  "">#d. €!m2  $ 0$ t!$2 $ t!m2 $ t! !$2 $ t>C!@" " "" bДbА `$bА $b, 㿘 `""`>N"""   &  㿘     `V>ږ h24K  2  > !`$ ` 2 = ?`8>!\*` € - & D  I u   -4㿘  @"!   (#Q "  > .@@k J?` 2&?.@& 㿘 @ʔ   2 procfs: invalid directory entry sizeprocfs㿐 <@@2 -@& <>&!  Z8 Z`@g"  @c Z>":Ք  㿘@  >#`   V  㿘 r  h@81>>!l>b(c&`Ԗ Dؔ b(#@ &`&`&`&` &`&` d` :  `T: Z `: Z `D`@  cmdlinenotepgnotestatusctlfpregsregsmemfile...㿘     '>ڒ h`2 "  2   (2     "   ($  ` >Ї(`"` ȁ  "       㿘  ` ">  h LJ  㿘A `>(`  ` "`  `    tag VT_PROCFS, type %d, pid %d, mode %x, flags %lx 㿘 >`#8` ` `CQ`㿘   0 㿘   &  %ldprocfs_getattr㿀  ` `  ` ">F h   > t $` 4 `$ $ @( $ < H@< $ 4*`" *  * $ $$ ($ 8$ ,$ 0` ` >"ȓ*` €,!? " @4  4 @ $ `$ ` ` H*`>" € " < 4 $ $ =< H>" 4 $ $ 4>cB: < -< H 4  " $ `< $ < H - >ܔ ( *   :  P !  < H< >A  (Xdppppp\\\\44444 8  E    curproc㿘 >"  %?    M .2% `  . 0}@y 2>#@@W  2H ` @<#\ >D h RHJ @"`HI ">+ h 9>!> @ 2`  @   `" @ ሢ`@  2HÓ`༐%  `   㿘z@ 㾐   `    @  7 H 2  "> h`>  ؓ,@>a  `" @ "  `` *  '  7/ /  b   \a& W> !  N  J5>3>/>!@0 '/7 , !/  '/c@7  /  #`@ 4`*``' 4AP //     `  €<= 㿈  `2 >"`4>A'c  # Є #* ((Ї8 #2     㿐`xH``  `<  t`> *` €>>! ~ ` ?1>9` ,> a   >9, !|@*` $ h  >9@=? E  `4  Q@  L >9, a|*  $@  0 $0```H0.>9!x * > !`` ?`  >8, ""@*`   ƞ , ">8b* @``    \     spec_read modespec_read procspec_read typex `  `>> @` 2 `>" "`>> P 2t  > ❐x>9 a|* * `@  `˔0` 6x (` ' `>9!x *">8*" b* ` @`   `h@   `  ` " ``"8' ( 2@r`>䀢 K H`@  > @ &@ 8 @?'#\#`2 ?%@@"@8 HT䀦 "`0= `L 㿘    spec_write modespec_write procspec_write type㿈    >=# 2 t>" "t>=#  > ǐx>9 a|* * ` @  ` 2 6x >9 ( ax*">8*" b* ` @`   `h@   `  ` " ``"7 ( 2@>=` H`"F@  @ǒ %@ 8   Y '?1`@%@@8``H@@R`쀦`"= #t spec_ioctl㿘  x t `` 0>*>9 a|* `@       *>8*"@ *`  @ *>8" b* ` @  @ <ǐ"㿘 `t 2 `x >9* a|* `@   spec_fsync: not dirtyspec_fsync: dirty㿘 `t PH /d4`d* %`d  > 0   0 <@ 0 $ 0H p@0ڠ` `h`hd$`0$ `h 2`0`d  H 0> X0H 0 㿘  x   F> #`">8@>8, "@" *` €  "    "     2" spec_close: not special㿘` x t`- `S>m ` ! ` Đ`!` "X 4 0!)4 >9* @|*` -``D`  `  1` 1 4 0!4 >8* "@*` ;"p``tag VT_NON, dev %d, %d 㿘 >`x  = `>؇(`  ` "`  `    ԐԸԸԠԬԸ㿐  x    #\   spec_badop called㿘>;f!@㿘>Ւ @  >"c  6?@  *@2 ?*  6?` ` 2 ?*@㿘>"@>ّ6` >ّ* b@` `2@`  H2 @  2@0`2` umap_node_alloc: no alias for device㿐>>"ax  "`t  "tg `t?    ] "`x`xx` " "`$ $  &  `t? `x   "t> `" Lu0\@)>`t6`? @'>`x >Б: ?b*  @`  x x    t t@2` 4 א `  `x"@`x"`x" $@>:p"`0"`0 0h+& 0&@# @*   $ " " $  㿐(  'R  &㿘/!` b``ܒ`?2&`#&``Ҕ?2&`?#&``@ ?# @?"&@&@ @ x ` w <@@r -0  k T&(&&$&&, `&`t  BT  ^"`H $+ $ /$  C"/* <ܐrܔݒ } 0*0 "0$  `H< "$< $<$Րؒ Y/{آ Z`@$@ /p Yذ `@$@  㿘!6`  4 `  2 7ې! &! 㿘!>  b`ٽ&@㿘! @P@!!   "P& DT&@X@ &`\&``&` d&`h&`l&`&` d` 1  `T1 Z `0 Z `D`@   㿘!  㿘!  㿘  H $umap_bypass: %s umap_bypass: user was %d, group %d umap_bypass: user now %d, group %d umap_bypass: component credit user was %d, group %d umap_bypass: component credit user now %d, group %d umap_bypass: returning-user was %d umap_bypass: returning-user now %d umap_bypass: returning-component-user was %d umap_bypass: returning-component-user now %d >  `     't> 9#   . x 3> $x"  "$ @ Lax@" $ @`$ @` "@<`  ۀ ?"$ ?O&฀  `>9#8`H฀ "  ``>`9#` ?&'t ?!x("` ฀`  `>9#`HҒ฀  x`>9|#x@L*` €  @?   x@`"@@<`  2 ?"  a2 `2  b2   `Hx ?"! ?฀  `>9.# &฀  "  ``>9  ?"? ฀  `>9 H mt@฀` "   `> 8 xumap_getattr: mapped uid = %d, mapped gid = %d umap_getattr: original uid = %d umap_getattr: original gid = %d 㿘ː " G> H `d "  ` `> 8  H`b` `   ` " >!(8 #"`   ` " >!P8  ?#"`  㿘   * 㿘  ` @*@& m 㿘 @* a" 㿘  "`"`" % &  㿘  \` $ \ܚ $ \㿘  \` $ \ܠ $ \ tag VT_UMAPFS, vp=%p, lowervp=%p 㿘 >`#8. umap_rename: rename component credit user was %d, group %d umap_rename: rename component credit user now %d, group %d 㿘 `   > ` $`  `> 7 0H@   `> 7 pܐ E$` 8> @L 26  @, @ף؀`' ! G' b`   > &(@  '&@  㿘>N"ؒ |"? 6">N#X@ >!X>"`d 㿘>N#X.    " " "  㿘>N#X.  `"  "㿘 @ 2` 2   ` ` ː Ɛ @ @2 (@ (  ?& (`"  "` "@@"   "?t  "  &   "?g& ??& > 8  "?Z??& > 0@>N"ؓ,  & " @ " &  (`& (|㿘 㿘 }㿘 t 3 ???`0 2 `4   :`02`8`8`< :`8 @R union: unidentifiable allocationunion: . not lockedunion: allocvp not lock owner㿐a\ ` ` `>5 "0 " `t t@" @'     "' '􀥠@T 2  "` #>N #>N"? `";7`"74  #>N, b`$` 2@`  2@``H2@      `2```o@2`(`( 2>>4"X" "&`  4`@  ?$` >4u"p`(` >2``(`$`( "` $`( 4?$`@` @` `"` ` "``(  ?$`(`ɒ    $`    $` ,  `_*@ $` "`` % @2   2>   ` ͐ g hĐd  } H`"`0 "0`t t"`t??$`$` <`8<`0$`$``  $`(`$`,$`$ $`(>" "? 4 $`@   $`   E $` +  `*@ $`$` $`$`>N"ؓ, $@ " @ " $``(`$`(a㿘  (  ?$ (`"  "` "@  " D " >  " 8  " 2  "    &  p   ?''v% !ӭ h   Ӡ@  жت )@'''''' Է ?% '''''' ˖耢`  P 㿐@ P`(` `$`(`T  2`(  `( $`(  @.`,`( `$`(`$  ѐ Ӹ`$`@ $`$㿘\ `' -   *'  ' `*  '' '  `2  '  ' '  ' _ 2 G0Ē ' p#\˜ "" ѐ  |'70 R o  &` c@j#\ `Ғ0̀   0`   ېؐ `$8% !@-`'`  ` ')Ք' 't'p'x'|` '`''lp` ;`l `՜`l@l.l 0"1'` Ӓ4``r lҲ.  l  8`" 8l% l㿘` 8?& 8ҭ㿘>"@ (  ?& (`"  "` "@ (` & ( ՛ 8     Ҽ  ؀   union: dircache table too small㿘>  L `"@" &@`&>1F!h &    ۔㿀`'ь  ,`'ǒ  '* ' `"`,"'' @'  Y`(@@  H #\#`Ԙ  " ,`" , 㿘 ,    , & ,:::union_mount: bad um_op㿈<@@    -&Ŕ   Ӑ P&(&&$&&,  V&t       ``$ ``    } $  $$ $4 $$ < 2     g  $ @ 2@ $ 8 !`$    H <@ "  H`< "< $<H<< ` $<i$ Y & Z`@"   ">  >0 >0 > ##>#0 @:'  Z"@%? $@e@0 =  `` 㿐!6``@6 1    X `@"  9 2 `4 $`!   "@|@y `! $!㿐>!"  2 - " `      #\#`  j `?    5@ ( "(P!@Ȓ!    H  2[\`&` d&`h&`l&`&`H  T TDPX&@&`&`` )@mT&` `)@gT&``)@iT&` D@\` `dhl`&` ` ` `@ &`&`&`&` d` &  `T& Z `& Z `D`@  㿘 `T (`& (㿐@@ 0 "' H' :&@2 0 2 Hh 3"# @2`  . ` €D " & t 2& x`& union_lookup returning. (%x) not same as startdir (%x) > H   !  b $ ` ``'''P'`( 2 l %`(`$`( xg @` @`( $`(`Τ  `"@  ?$  ? @2   s   ؀    >`2= `r$ 2 $ `$ $    .` @ 'I '`"@  ?$  @ ` `    ' `'`2  ?$  "f % t`# `( ?$`(̔-``( ` $`( EA'  Ѯ H #`#\l   " $:@ `  @2 ц    J`. @> -W㿈   `' ( Mu ( $ ( H  #`#\  0 㿘 >  b  - ( 2   ҳ 㿈``  )  ( , ( $ (`V H` `͒ ` ` ` #`#\ɖ >0;  㿘    ` ,  `t 2 $4 ` ` ( ͷ" $ $ $`ͨÒ 0 ( ͖㿘  ` 2& `$`?"`$& >!L*` €㿘   `  `( 2  x  ͗ &` !`  ͈    Ha` ` z h `8      (  2 :  z 26`? ? 2 t     _ `? ? @ "  @ 2 ` 2  `H  d"`㿘`  ``  t`2 ``` ` Ւ@ % !  ( 2 א `` 0` ``?2``? `? ` L?㿘   ">ِ`? b`  ( 2     ϫ )    ` 04  4   ??0 84   <   ??union: missing upper layer in write㿘 >  `b>+M!x ( 2 N       0   4  ?˜?㿘   " & >"L*` €㿘   " & >"L*` €㿘   " & >"L*` €㿘   " & >#@L*` €㿘  `  ` " ``?`1  `( 2  В   ے 㿘   " & >#L*` €union remove: null upper vnode㿘` ` `  ` >* X 0 (  ( $ (`( ( $(`     &  ː0 2 b  H  ` ``union_link called without LOCKPARENT set! 㿐   `ऀ `>+!E  LL@?  2:  `ʂ` @2   8     ` @2 `    Ű   0*    0   ` '  "`(G 0 `( $`(:  ̂㿘 > L         T L@2L` F`   "` ِL@` /ͦ ( $ ( ``L 2 ` ` ( $ (   O 2 `" ސ 502 0.ʐ` Ő 㿈   `.  ( Y ( & ( g   = "  0 H #`  #\  0  union rmdir: null upper vnode㿘` ` `  ` >)"` 0 ( 6 ( $ (a`( )( $(T` v    &  I0 2   H ` 0`.`㿐   `  ( Đ ( $ (     "@   㿘 >  b ( 2&  & >  L*` €㿘   ">ِ`? b`ה & ( 2&  v& >! L*` €~ 㿘   " `?( ``Ȧ &  2&  F& >!< L*` €L 㿘  K  A  (`  y  㿘  union: dangling klockunion: dangling upper lock (%lx)union: locking against myself㿘   @. ` ` (  `4   C " (3 $ ( ( "  (>">"'ђ >" "  ( 4 @@2 ($ (>'"`$ (Ւ `" "? 4$ @ (  $ (union: unlock unlocked nodeunion: unlocking other process's union node㿘   (` > ' P>" " ( 4 @@ ?$ (> '} p ( ?`$ ( ˒  ( `$ ( $ ( &$ @ 㿘 >  b`?`DZ & ( 2&  P& >" L*` €X  tag VT_UNION, vp=%p, uppervp=%p, lowervp=%p uppervplowervpdircache:㿘 >   " (  ` `> ֐"P  `> ϐ"X  ,   !> "`  2  (2  㿘   ">ِ`? b`> & ( 2&  ݒ& >"p L*` € 㿘   "       㿘   " & >"L*` €union_strategy: nil vpunion_strategy: writing to lowervp㿘  \  " & \> &  0@    > &v 9& \㿘>!d> *`" * "㔢 @K%>"㔒 @4` <@@ <* .@@ * >2 Ta@> ,'"  !n!m:"`>">"@  @" `@:*  '4p8D* @4p> 6p&% * ,  , @Hb.p6@dos2unixtime(): month value out of range (%ld) 㿘 6` &k& g2`**`" " `*  , **   d@> a'> =)>?"2a2     !`"!n!m`@ ` >">"6  ?> "'+  ?  ?*@  ?, @*`" *" * b $ !d *"@ *`@  &@* d* "*"@ *`@*`@*`&  >> `>  (   >>ȆȘ  ` `+``    "*@ .*@ ``  >>ȆȘ  ` `+``  *@㿐  ` *? 6*.`  .2 2.@а@ .  . .`@ .@  `   " ."       .`"2  < *`#"@ &  ?>"Ȅ .@ `2 @ .@   $ &   ?? "? ."?   >"Ȕ .@  `2 @  .@   $ * 2@ _.@@ ` .@7 5  @  0?,@   @ ?@ "&  " @ "  ~  .@    @? "."(("@   ( ** *  * 2 ? (@((` ? @((` ? @((`   @*((  @* @ 2?V? ?(("@ `K@ >Ș  * @   7` 3 >Ș   @   #`  >Ș     ?@   `  ?<璂  @ ?ca @ (( ` *` ` 2?R` @?(( @  (  /">( ` 5?< `  (  /%0 ` (*`8( ?< `  (  /" ( `   *`( ??<    ( @0`㿘`? " .`` ?` "`."` ` @4 㿘>ap> 2   ;:  >"c( 㿘>"6@+> )>#@c#( * @ "  @2 2 2 ( `  c> > c0((   2 2  2 ("   2 @ 2" """@   2   " "denodedeget(): pcbmap returned %d 㿈>"`tc 2``"`<`z  &>"x@   & =ǐ @ >0   氐 4"` $ $ $ $ 0`$ $ @p$ `‡t "$ , "`0` $ ` $ (`t#@&`<@## 0 "0, ``tc 2$ l`<$ l`@T`$ p !4 j4 b, a4 d4 fS4 h@ n찒 p T  c, ` , a  * @4 b  * @4 d  * @4 f  * @4 h  * @4 j  * @$ l  *`  * * $ p ,`t    *` * $ l `  " t l?c @˜  >`T*  $ p!8"  "`t  &㿐> !! *`" *  * ''  detrunc(): can't truncate root directory, clust %ld, offset %ld 㿈` 0 ````,  t#@>``"!x  ` @> `p@` ` T@ 2@  @V "  `0o`l?''$`l `@  T@S2@  X@/ ? \ T" *@ D  @  T \6@ "@* ` ` ]0C@>``H `@M"@~$`p` $$``  ` " Y 􀢿 @?  T2@$`$`|쀢`  t2@ ??@deextend: file too large㿘 `0   ,t#@" `4  ` " p. @ 8`>  P@T@?2@ 2 " P@   @    p     & p $&  㿘 ` ܐmsdosfs_reclaim(): pushing active㿘 >c    4 >!ؐ "& u =$  msdosfs_inactive(): pushing active㿘> c   ``4 >"@ْ T   ( `H <`   ?  , T   T`Q 㿘 h@& lH 4"@8@  4<  8@@ &2&  h@j'㿀>բ`\ `, "`\'?2`l `l 1' `` ) T`p.@ ϰ  \ @"2@& \ <".@@&2&   T`p.@ `"@ 8 ' 2&   `''@&@'>a "a>!* `" Z# t2?x  @ g쀢 "  ?O谒 W t H   *`  * *  ' H  *` ' t/2 t 2 ' t ' t2 ?8'  ' t2@ ?? p  T \"@  D?*  && $`t$`xY0& "N$`?$`|  t    "(  " " t?  :" 㿐 x X P ) | 4 *`   *   L :4 @?24      4 4 * " 4 *`@ k8?& |  x$? & x!  H S* P2 * P* P* * |2 * |* |* @  V @"%   6   4 `< o ' H`<`H @ 4  & 4 @Ő0%㿐 P 2* $ P  * *@# @0   @" P$ P& fatentry(): function code doesn't specify get or set fatentry(): get function with no place to put result 㿈`2`> #  >#8J  `L`$@`Ϙ`?  0)`t#@  H  *  *` *   H ` * o2 23  3 8 &`b?`t#"' R#&K耎 H  * /  < / 3 `H* 7 `H*`H '* < H  *  *`  * ( 3 `H3 3  * `H * `H * x &`d'耢  㿈`@ L?  |0k@D  ? #v` t?#1 a4\蒎` H   *` <  o +` 3  H*`H * `8'5`3``H*`H*)  @ H<  *  * @@ *@ ( 3  H3 3 @*` H@ *` H@ *` '@ 􀦠2q  $ d 㿘6` *@` L?*2`O `"  "    * @" ?7 8㿘   2`* `(  "  P & P `?   2'`2'@ 㿐`   q@တ :`  qbmi  L`9 @ @$ 4` ,  `  * ?@, ֐8 ?t: L` " @ 4` @!4` ,  `  * ?@, 8 ?O(` "     X㿈'?@ 耢`֐ ? "0{ P6`  $ P* ` * *#  t?#@")o" R@ #@,J t` `H   *` 3   <@`H3 *@ H@ /*` H  ** @  H !*  H@  @ (  *`+@  H+   * H6` @*` H@ *` t@ 6@ ?8@ `( L@(p 耢`Q 㿈L  2  '?," L 2 *L \$PA@@yh 쀢 2t쀢 ">ݘ ? "t-08#@  H@ @  *  *` *   H ` * o 22  2LP4 $P*  * *# L( extendfile(): attempt to extend root directory extendfile: pcbmap㿐l  , ` >  >  |`" l ?>"""c   `0( 0 2' '? p&@& l 2  $l E |    ?$|J$F' `  `T?`\ `D" `*@ '``@* !`\`T "@. `` `\`T T P"@ :  ! ?$ T T?2 H>! H@B <$ @& Ӑ?`'`2l P  '`'` '  ''@?'  ''' ,"@ ` 2` ? `ђ @ 8А ] . D/   a "̀` `֔ Ǹ      D ̀`   k` ڦ"0` `J .2   J .  #  'ܐ  "    "` `'` '  '  2' 2 'Ԫ  Y?ذ i؀J H ``2?'` '3C A &    $``'?' @ @K "% ?'% T% $ؤ `  `ј  + 'Ġ Đ"* @'  2"` "` ( ` `  % $% `̐(`$` ?`@ Д}   *  ct    * @*`< " ܀ "` '# t#@ "<`2 -#8`` E  l ܀` ?а "԰ Ԁ `"@   5Ȁ`0 -#2` { `  t l2܀`m ܐl԰ eԀ` "`([$` V # ؐܐN԰ ` 0À`0 -` &`00 l ܀`Đ"@%԰ 00  Ԕ  "`@ 㿈` `p@ `,?``"@`T 2 '     p ? 0`T`p*@ &`p` `T2   r  ` `X ` ?5찒 T`  `X`H @   ` , , a, c, b2 ,  e, d2 ,  g, f2 ,  i, h2 ,  k, j2 ,  o, l2 ,  `` s,  ` 2 p2 ,  `  q,  `  p, , tc 2`$l,  l, `$ < `$? 1&`$` `X@!^谒 L` &` `T2@   @?`찒 6` `XH &` ?U Ψ 4谒 "`  ` l'`t#@`<"'  #. .. 㿈 ,    =`??] .H# %>#> `" 2쀢`0@Ԕ a@@Δ  H@    0  doscheckpath: source and target on different filesystemsdoscheckpath(): .. not a directory? 㿐`` ' 1' ` "i `llb a`,,@"`t>"V #@>`<N9 `` H` `  >a@@h " `<  `c`t*   ` `*` * lԀ ( `<#`' ?  `` Ֆ?`\`l`T?" *@`D`@ ``    2>"  㿘 X` ` T  \2 "@  @* * `2  T T \6"  <*@@  \ D"@*    ?]   &  X H  '㿘  , 㿈`( ?, &`(  *`?  `X "*찒 1` 2- `X( ' `T?4  @ ?`  i0`XH  `"Ơ  "  Z  㿈 , ``ﴖ  C A    `4 2? ' H H@   @F   `ͤ   㿈 ,  Ř 2/ ?  0"H@ @   @  "` `  ` @ * @Ԑ Ӡ А  ̐  x  s |  <@@"Mx`  ` @    <@2 - ` 'x<@"x ``` @F! 3 0 /` *@$`x x`| @&(&&$&&,  t " x >9 `x&  `"<< !!`5  ,0m <@@2 `@j  w "r0Q$` $`4`` @ $` $``"$` p`t#@2$`@t @}0't``   $`tp Y Pp Z`@~Ғ$@ x Y Ep `$@ @~ǐL : |RRaArrAaU㿈x     > > d 5 `@    M  `<   ?!  x ' `h ? 2x`( "y``  ܰ O  "? 2x  0 ; # 0!sH@~S!$@   *  @4`  * @4` ,`  * @4`   * @4`"  * @$`4  * @4`(  * @4`* ,`$x`2`"+  + (*2  $*2  ?8 O`"2   *`   * * $`,  *`   * * $`0 * @$`,$`0`?@Ɠ2``0 @8_ ` 2,``" 2W `4 2S   * @2M #  $`t$`$`  *`   * * $`4  *`  $`` $`x A`t#@ # 2 O`@@2 O`0  @{z @ 8 O`@{o`0 4`$`0`, $`,` 4``" {4`"`4 w$`4 s``tc $`8 " !*  #@ $*@ *@ $`<`4 ] ``8@$`D & %* @$`x`4 Q `` `*`8 $`<@#$`D$`@`0 `D @" `4$`H` 8$`L$`px /`  `?`*?* 2  ?/  `t ///  ?#  $`t$`$``t/2@`*` $`h``h@$`l ?$`\ ?$`X$`` ~? *@ $`Th O'`x`9$? 2[x> Ha@}  2%$`x>a!@}   2$`x>!!@}  2$`x#@|  2 $`x ! !*` ! !* * $`|'`L < 2  Α* $`$`$`J 2x`< ` $` ` $` $`d` &a&`d  &`hx" x" 쀢   -?` ` "U <R ;&a 㿘6` r  a` x"`` `  ?`/ <, ;`<*@$`<$a㿐! t  `&@㿘! D`@ &``&`H&` P&`P&` &`&` `T Z ` Z!La | `D`@{  msdosfs_sync: rofs mod㿘!d    6 >  H  2` H2  t  X%   <` d `@`\    2 -`2 H` <@ 2 ` 2l 㿐!`` 2& `&  2@ "`"`㿘!`  `0`4&& msdosfs_create: no name  l`   p@h `$2p> "x@{i İ 2X``  ! > !/''! h *`' " '|*  , *  <''l'ڔؖ l'hА /`  ֔ \  ԔT 'dR 2``@2`  d "` 㿘   2  @ y ϰ   㿐 `4 7`  2> !! *`" *  * ''  $  &  j h  ` . ` , `   f     d bߖ a  ?&  㿘 !m `` `,!  ! 㿐>   *``," *    * ''` %2  $``j`h詖 `` ,```, `` `f 蚖 ` `d`b蒖`a` ?$``$ ``` \`l T?"  D*  M `l`  \` T?"  D*  >  < 8`2 $ `` !m!4`,  4 `` @4 4`, ` ,$ `, $D$`p <`j`h`, `  `f 跖$`d4`b `a $@,0$4$8$$$($@ `` 2$<@$@$<`,``$ `,`pX* #0 䀊 " p =_  " W  Q "p@ B 2 p@齒 = p 2  (  D ,':`p '  B  2+``@ ((``:```@ E@`TB B?@uŔ?4"@  F 䀧 պ  Ӏ | '|̀ `T?2 ?';  'ܐ@u`\% @u`X  @ P @E @u@u @u@u4``2p@ 8 ``p 42````@- | 'H@w<T"@P`\T`T"@ ;  솘 ?"`T`T?2 { "b 0a``?zB  `X`` "  p <  B 4  &p  @)Ԕ @)H`z`` {=z  &  `T @t܀ J@ H   䀈?ꈘ " @ b %= p y?@ 2   `H    㿘   `?א   0`? 㿈  H <`2 > aa`*" *   * ''  $  $   j h ` , ` , `   f      d b a  ?$    ? ``$  ( t 耢 2n T*   ` * *  a*`  c* b2 *` e* d2 *` g* f2 *` i* h2 *` k* j2 *` o* l2 *` `  s*` `  p2  *` `耊  q*` `耊  p*` , tc 2   l*` l*   y 0y㿘   t `   .  +㿘  - ! msdosfs_rename: no namemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirrename: lost dir entrymsdosfs_rename: updating .. in root directory?X >   ' ''Ha` d "$2H>& w  H@  " H@԰ ,Ԁ %Ԁ 0f   ` ܒ ```" J`.  ` ` @ @ДA  $` 'Բ   ` `  ' ':/ðВ ( `ll2 Đ $`" `VԒ 2``@2>&   2`Բ   `!`` h ذ B`հ }dΰ  ɀ`  ̔ ` ? $>&  H` sЀ 2 >&  pT ` L  ' @>& | p= ` N 3`TؐG C Ö$$Đ$   3 ``(`$`($  `ĐT 3 `u  `? U;` X @$`̐` D'`&`l`2\>&  T?" D*@@ `w "xu  H o` *`l2 *`w̰Д `SQ` ?$`Ёmsdosfs_mkdir: no name `l `,` `p@ d   ?쫚 2p @t+> ! <! h*`" *  * 'h'l'ڔؖ C'А /`  ֔ 3    Ԕ* ?'d  \ T" D*@  `@ x  H@s ` H>"\ @  H+`d2 +`+`ԑ2 +`+`ґ2 +`+` +`֑2 +`+`ڑ2 +`+`ؑ2 +` t@ `l <" 2+`;+`:+`0Ԗ2 +`1+`.ґ2 +`/+`-+`2֑2 +`3+`8ڑ2 +`9+`6ؑ2 +`7 t@  d+`d+``l+`4 `l+`5vÐ /d$2>'#X2İ "d /''`'` '|` d@2C ^ `  "Ҕ 5 Q㿘    B' s " B` @ B  {i,  w  {] 㿘  -v  ...p`?` '   `  , ' @r!  ` "$ `"  'ܑ2  . `"@`" l 2 t#@i<2f @  @'2]؀@ YvȐ +`v'`ء5`:  I'>)#`P t2 '\<T?D" *  '  /   >) H/ 7>) P  /7/  ? 7@   2`` E `" &@ݲ`  $t:` 'В@ T@oeؚ X%@ ` "@ 8  p"  8 䴒 ?t䴒  @" H@@  @ k 2 ` ?'Ԁ   |Ԑ'u'?q'Ԁ , ` `ct*   ` `*` *   \<T?" D* \TD" *   '/\?TD" * ؐ <Ғ  H$@ :` '/MԐ  ߒ/*@?  ? '7@  O `` &@`અ` `H` E @ o u  2``"@""@ $< p@ Вe @  b 4`2``8 `` "@u{0" 㿘    4㿘 औ  4 `㿘 `q 4㿘   `,` "  2  2" \T "@  ;    msdosfs_strategy: spec㿘  \`t? `>*# T P@2 T`,\ TT"@  ;@ ߘ ?$ T T? H@q <$ @ T?>`  x` $ D`$ L*` € 0wtag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %d, %d, %s (LOCKED)㿘 >+`  l  >+!    >+>+!8!Hʐ 4 㿐 `  p #\   0 ~``,>+( `  " ` $`    `    p@dp㿘`>,!|.` €  ..  . . .  h> #t o ! 6`H /f * ' >8 2H p@ `  &`6`&@&`&` N< `$@b 7&```A&`H /f!>͐* '!>!H   Mx !H&` > !>"  2` > * 8 ?" ` @$!HH 0`  (` &`6`&`(&`$&`,&`0` 2&`  7&` &` `"@&` &`s  `l  O<00000 000" `"`"` bpf: ifpromisc failedbpf_detachd: descriptor not in list㿘 4  . 4 @  " >,)!   >,`@!2"  2&   "@& >∐∀  h"h ?㿘 .  * ">ؑ* b    @oN X># $ <$  㿘 . * ">ؑ* b H /f4 * '   H 0@  bpf㿘 . * ">ؑ* b  2`  @ H /f4 * ' ?   $ 20$ $>"(,$ $*$ $ >- $>b(? >-ꑒ! # ? #H 00I     )$    6 "   " $  $  $ $ $ H 0 N H /f   H 0 * '  $ $ $ H 0㿀 . * ">ؒb*   `2`0  `+ `  "`<  Mް (0H /` * !  `| H 0 "" 0" " " 0" " " ,㿘 . * ">o* b @  2q@ "i@ "`"h@ f@lj@"` "@Is@"`<  w@n@>  ~@" "p@ " "r"k@"`ݰ @Ӑ}@"հ  bm@>   v@bg@9 0 "l@w0"f@"` H /f * ' ` ``@H 0&` 2    8$` &$`@H /f * ' CH 00v qH /f4 `4* ' `4   @Ւ   ,`4H 00W "U R "P  @ 0K@G!XN>!\@k, ;$`  7 5$` !X` @p&` @ot>4\(&`,&`0#&!,`666 ?$` $` $`8$`@ `$`D @  $`H`@ ($`< &㿘`  (@ 2L H /f * ' & (H 0-@b1,`  ` #@ H /f * ' & (H 0С  Н  㿘N@ .` ` А ( `>ٔ  0@   8.@ $@ >#\`"@ ` 7 @lh 23@ 4 2 1 2  @M 'H /f4 * ' @  ːH 0 @`2` 㿘 Ɣ 㿘`2=  * @*`"@>ؓ*`@ H /f4 * '     6 "   "  H 0 ?  $ >"(& $ PH 0 㿘  !>( ,& , (@ @G"d 2 ,bpf_mcopy㿘#>0 2 `Ѐ S@㿘`   ` @` #>0 ,& , (@ @` 2 ,㿘    @ 4   ?@ $" 6 `2  0 b& 0& & & & &  8   <` @ D% H{ P& P " ʐ 8   <` @ D He P& P @o$@ $ $ 4  $ %&  >b(  ` & & & & $& &  8   <` @ D H1 P& P㿘  M &   F & & &     7㿘  " (   "   " (  ( "& &bpfattach㿘    2>>1 #\ "@"#\""" "&""㿘>#\ <#\>,#+>>)>9 0"@a @ 6 !| >, #!|`@ `(@ 2` >ؤ" ``  X    Ά 2 & (x`" $ 4`2 $ 2  & $a 6 4? & $ 4 > 6 4   4  a7ذ D"@ @6   @ " @ * ( (,  ,   % "  " @  @ * ( (  * ( (  * ( (  "  "@ @6   " *  2" "   * H  (?? `!>3!*` €    B2  t`   K2  ֖  [2 `   #  6    @ 2ڰ  <@ @ *` *  *     @ 2  l@ @ *`   2 `   #  6 yJ w@   2 `   #  6  @ @ ^* \ Z  * U@ * P@ * K"@ * F"@-  () '  *# !  2   "  (  *    2  "  * "  0  *2  "     @kɰ     * 2  ޖ  DX|lȤ    ,       ̈ˤȬ     4  ȴ   ̔t     <  ,   ̬ˌ      H  ɐ   ˼     d  H          \   0         l              t   ɀɈ                                             ʨ 3 2   )  $ 944    Ҕ*` `?㿘> #` !>N>#` ""```2`!>N#>7@`@ܐ㿘>#>`"# `6 0%> '> 㠨 5>66 c 5>6@  * @6* "㠒 *  Ɛ@g㘀 " 㠒4 z %㘡*   ɲ@g 4 g $c*`@gD"  9(   , ( ɏ @go`(,`( , `0ޔc,  0*` 84 , " $`$`  `$``"``& & $`$@$`,  *㿘>#`> ""  & &  &  "` "`"& U㿘>#`> c"c"  & & & c` & `""`=㿘 @     0@Ԛ   @  *   @  *  㿘H /f4 ,* ' ,  @m֐ ( > > !P #>5,  `` (  , @@; `"  "`> "#  "@@= #>  (`"`& " `   <`@"`@$ @<"@ q  2H 0㿘> # , "%  `  2  @ @f  4 "   "   " @f    2  2  㿘> # " 4 "  "  `  2   `"   @@fm    2  2 4 㿘      ># > >#. : > #`5` "-` 2$    @   @`* " @v "   2``2` > `` " `    2``2`  㿘  C ` "? `26 ` 2 @e "/``"'  @e֐ 2! #  ``   @   @`  @  2㿘 ,`D ( `$`   `D` ?@~P &`D"` &`D    $ >6"㿘 4 ?  6 4B   2@4 @> !P #>5,   `( , 㿘 4`@6 4@6R> !P #>5,   `( , 㿘Dx  & && 㿘H /f4> * '> #  T 2   2*` 4 2 `" @  2T 2H 0>!XC㿘> # "  @d 2    㿘0a@ a$@@FBܐ 0; a@C 4!aH a2@ a1@a@Ba@"`  !F@" a@"` !F@aG@a@" a@" @` a5@"` a~@ 0 !6@" ` 6& <& 8 Dа6Ψ  4  H /f * ' H 0 " 4 4 2 4H /f * ' H 0 4?bR!   4 4 46Z x$ @6P <    <@f@Ic 46: u  R  g -! "$ ! "8!! "` 0a"a"a "a!` a a" a% ` 2`  .a#` ` @0a a "   4aa2 46 4 `H /` * ! @4H 0x@  > # 0   !  `  2 &@[ > #=`:` 0!  戮  7 `   ` " ה  2 В`  @ 2  ̀  ؐ q  @b  "@"&@ %s: can't handle af%d 㿈 4 A A d 2> !!& t 7& x`4  @{   `8?$`8`4 "`4`x " `0`4  @{f`0@z $`x 2`45 A "`\`@! @( A& @ " >9!- >9!@ " `! ( 4(沔 B (s7@Ƙ !"f7`0`逤 ` 値 ` ဤ ` @  4(> ;沔 B~  "4` 2  "   "   $$  A   $    `7w  7   /@ C` 2  `"   " `  &` &` A    $2V 7 9 5  1  ,  @j F H /f * '   @&  `  & H p@% 7 & `$ 2" &  &  & b" 4 h & h 4$ @H 0 @㿘 4  > !!& t  \& x  & \@` >#@a  !"6 # " , d & d ,  # 2`  4! @ag  " ` 0ː@k `  h") 4 h 0] 5@:!"݀@= 0T>h `"h5 > >  *`  > ># >h "h  > >  *`  >͐ >!L 4 z@0>h@ "h  > >  *` Ւ > >a \*2 X @ S  ` O*@"@J "C ?&& & "   "   ?`&&  @S    &:@2`2`2`2`2` 2 ` ?2 ?ؐ0&H /f * '  @`?"0 & 2" "" "H 0>N> :  0 *@ `  *@`*@`>N*#㿘      . . . . {. .  >9 !%. : . 9& <& |. 8  "& "   2 * 9 *` 9j & 㿘 `""`"@  7 2㿈H o4 *@ g ` ``0_- 0\ 7  1Y   2  >#Ȓ$ >*#А     ^//////  2  2   2   2 >#ؒ >#  3   //////  H 0[ / 耊 2 `H 0L  @_  2  @_y  2      & H p@.  7N   H 0  7뚔  떔  & & ` & ` "`&``& ``&`H 0 4㿈H o4 *@ g ` ``0_- 0\ a  [Y   2  >#ȒN >*#А     ^//////  2  2   2   2 >#ؒ% >#  3   //////   `H 0@ /` @^  2  @^  2  2  H 0$ ?  & H 0  `"  "`  "@5 7`?&`H p@ 4! #l $X $ % %< & -D . 1( 2 3 3 4$lcp! 6, 6H 6 7 7L 8 %s: invalid input protocol %s: Cisco packet in PPP mode %s: invalid input packet %s: protocol queue overflow 㿘 4   \`  & \`>>` b  L l`& l=& L0`?  "  |0   Ԁ  >> `   8  L 0!@"3>= #`!H  !@"<   耢@*#@".  耢  0& ``! +  3  @  >> `     p & p#h@~0@ 䀢 =@Ò09 7@03 1>=#@i0+ 쀢 2P 4>h `"h; > >  +*`0. Ԁ 2 k>> /a0h  5@ p & p@(h `"h > >  *`  >Ő >#=>> ap    5 L 4 0`"/ LH /f * ' `` @&&`` $`H p@ >>a n   L` 2" $@`$``$`H 0 %s: no memory for transmit header 㿘 H /f * '  4`@@ ;H 0 22`@6 4H 0>=#x@H /f * '  : `  * ` ;H 0  1   @6 `  2 >` '( ` #* @ "  `# * @ 2` ` 2  `"   " `  &`&`  ;̔ ` ` `` &`2  4 >?b@   T & TH p@_ 7 ` **  **  Ԁ (2 !2 쀢` 2 2`;1 T & TH p@5 /`` @ `;&  T & TH p@"  70&`` 2" $@`$` $` 4d2 ` @ ``  & `H p@ 㿘!>O h 2 >=>!X*` >V"D*ຒ >= h#h &  $ h >? 2bd. 8& |& &!&!& & 6 6 & & @& @ @@o㿘>O h %>U   "h Ѐ 2  "@h >>V"D๒ ># , @ఠ  , ઒㿘@y @w @u H4 (     `?H 㿘H /f4 * '     & & $  Đ?& Ā (@  2  Ԁ     & & $  ?&     & & $  ?& H 0H4`(` `䀠"``Ԁ` "`H㿘H / * '  2@ 1@t@q @#j @"  4d  !@_ 9@W@"IU 0:@M~@"H <K ( 4@?Ȑ*@6 4 4`   @ @`? 4@  `?`2 Ԁ ` Ԁ >=#|@` 4 ?6 4` 4 Ԑ @`6 4>=#x@0$ !(( & < "@"H 0%s: cisco invalid packet length: %d bytes %s: cisco input: %d bytes <0x%lx 0x%lx 0x%lx 0x%x 0x%x-0x%x> %s: cisco unknown packet type: 0x%lx %s: loopback %s: up 㿀` 4  \>B`  0V ``>B@``#\` #``#d` #hu @A 3 ;>B! 066 ` ܀@&  ڀ  >B 戀!@ 4`6 E@  ڐ 6 &  4@  6 Z>B!P 0  @M􀢠@ %s: cisco output: <0x%lx 0x%lx 0x%lx 0x%x 0x%x-0x%x> 㿈> >!>P"@ *`"  4*  * #t e  ! 4 H /f * ' >8 2H p@   $ 4 $$ $  72  K   $ $ $ `52 *<c"*4`3 3 3 # # ?2 #\ >B#` b#d    Ȁ@   `& 8c&   4$  2" &  &  &  4$2 ` @ `   & `%s: %s output <%s id=0x%x len=%d> 㿐/  42  X ` X>#t ِ ! 4`H /f * ' >8 2H p@ `  $`4`$@$`$` 6 `Y/ 2  `$`$` $` , ,,4 , 4 .`@2 @u  >C#\a@ 2  ">C@#>Cq!h  Ȁ@   `& 7&  T  & T$` 2" &  &  &  4$2 ` @ ``  & `%s: %s invalid packet length: %d bytes %s: %s input(%s): <%s id=0x%x len=%d%s: %s invalid conf-req length %d %s: %s tlu %s: %s id mismatch 0x%x != 0x%x %s: %s send terminate-ack %s: %s: ignoring RXJ (%s) for proto 0x%x, danger will robinson %s: lcp echo req but lcp closed %s: invalid lcp echo request packet length: %d bytes %s: got lcp echo req, sending echo rep %s: lcp invalid echo reply packet length: %d bytes %s: lcp got echo rep %s: %s send code-rej for 0x%x 㿐`4`  >C c`p 0  `*`@ @ #\>C c#` X``*`2`@H>C얐!h@4 ?` Ī>F"*` €`4  >C #z``L`* @   4    * `>F"*` €  @ ,@S 8  @0 `a<* "  @ 86@ >D `  ` ( ` `    e>D  0```L`*@`X>F"*` €a<+``" @Q 0H@L  ,@ 8@C  8a<+``" @9 >D `  디` ( `   >D  0͒``L ` 2   $  `*@` >F"d*` €a<`+`"  8@  ,@ 8@ G 8 `*@`ܚ >F"D*` €@ܔ >D `X 7`    0đ+``"@@Ŕ  ,@瀤 `* `>F"$*` €  @ 4@0@  ,@N 8 !>D` x@3 `  `* `~>F"*` €@ 0v0 !@]0o0 !V `* `  ^>D `Z`L`4V>D0 a  >B`!@>=c|€0F$>D!`+  3  060 !@ a0@2*`L` '>D!@`Ք0!>D!xϒ`a @26`0>D ! ```ܐ&`  `L &`L           T d                  P  ,               h  0 d d h    D ( (%s: %s up(%s) 㿘`4 ` *` !>F "@`  `* @  "a<0@ 0 `"@ @  8@%s: %s down(%s) 㿘`4 ` *` !>F #@N`  `* ` >G *` €@q 0@l  0@0 @d 0@_  ,@ L ` L     %s: %s open(%s) 㿘`4 ` *` !>G  @`靐  `* @` >G!Г*` €@)   0a< * `"@@  8@0@  l         %s: %s close(%s) 㿘`4 ` *` !>G !@`U  `* @` A>G#|*` €@   4@۔ 00@֔ 0+@є  `a8* "`ܐ &`ܔ    ,@0 a8* `"@`ܐ  &`ܔ   @  t  t  t  ( ( ( ̝㿘 `* @a<" $  'a4w%s: %s TO(%s) rst_counter = %d 㿘`4 H o *@ g `` !>G*` # @0` *` Đ  *` ?  $  *  "  0;: @G * 4@B % 4@> ! 4 * `#>H!*` €`ܐ &`ܔ   0@  8@0z 8@H 0 !` !` ! ! !%s: %s %s->%s 㿘`4  `* @!>H `@"@L  `* "@   >H"̓. €: " " " " " " " " " ">X%ܔ   "!@"!"!$"!4"!8"! " "! "!,"!("!<%s: Up event(incoming call) 㿘 4%ܠ ``@  @&!&!$6 &! &!,&!(6 4#>= >Hc@   耢  " >H7#P Ԓch & `€ch>H*#hch%s: Down event (carrier loss) 㿘 4 >I`8 ̔ >=#hђ 4 @"  @ Ԑ 4 & 6 4㿘! !  ?&! >= & Ԑ#h㿘>=#h8㿘>=#h%s: lcp parse opts: %s [invalid] [invalid chap len] [not configured] [rej] send conf-rej %s: lcp parse opt values: 0x%lx [glitch] [empty] [non-empty] %lu [mine %s != his %s] [chap not MD5] send conf-nak max_failure (%d) exceeded, closing send conf-ack 㿘 4    >IaX , s ` p!>I%>I" @@ @ap @ "   0F C  ` H0 ` A0  ` 90 4 `"+ `4!x' `0 `* @#@ 2 !L ` >I"! `!L 2  Ԁ >I! `  & >I! `r `@ `% @ ` >I!-0`!3 ͔  >I>H#h>IaА 暔 ` 9>I;>I" @@q @А!p @ "3 `  "L ` `S 2{ ` ` `*  `*` * ` !   q>I!殒 m `>I樐! !  6 ږ8 222,`,`,`T,`  `  `  ` J>I成"G `>I悐",`,`,`6,` `*  7&!(>It"(3 ` ` `* @!L@" !L@!@_b0!L2 ,`!M,`0"#@2 ` ` " >IK"H ,` `ݭ `@ `% @ ` d,! !@  &! >I+"X-0`!3  K 0(>I"h ڀ >B!@ >=#|@6 &!  >I"&! 6 .0`!3 ' ɒ  %s: lcp rej opts: [don't insist on auth for callout][access denied] 㿘 4    U >K` 剔 D`` @>=#h%>I "@@ a@p@ "   " !#`2!`!&! ?&! ?&!  !  >K堐!! ? &!>K嘐!0@`&@` ǀ >H凐#hS %s: lcp nak opts: magic glitch %d 㿘 4  |  }`>KbȐ  l`` i`'>I"@@ @Vp@ "J`  -M`2K`! FE` 2C&``*`* `@*`@ ! @ 8@ `>K-"T*&! (&! >I$"($`"` 2 &```*  >K":$"$8%!&!$  &!">=>K!0>=#|@`&@` ``>H#h %s: phase %s 㿘 4@   >ꮐ>B!Pߒ >#  , @ `"  @  , !   Ԁ   &  @ !>L! o># , @ `"  @  ,  䀢 ># , @ `"  @  , >#  !, ,  `2  @  ,` 䀢 @㿘 !>L & @ Р!$   )>!,#,@ ` 2 ` @@@,㿘 !>L & @ ! !܀`@㿘!>L !& @   !`@㿈! !  G&!  / , !  2 2 2 , , , !#, !  ,   , !$ 2 , !' ,  !  !,  *0 2`"#@   , *2 ,  0, b#2    ,   ܙ+ 0 & . `!3  >!,   *`  ``* 㿘 䀢   >=#|@"!"!D"!H" 㿘>=#2㿘>=#^%s: ipcp_open(): no IP interface 㿐 4 `@ T    >Mbh 5 0  >=!H!D `&!H&!D>=#y㿘>=#!H @ ] 㿘>=#.%s: ipcp parse opts: %s: ipcp parse opt values: %s %s [ack] [addr requested] %s [not agreed] still need hisaddr send conf-nak send conf-ack 㿐 4   -   >Mch ˔ `4  1 />I" @ p `   >I!x >I! P  $@`  ր >IՐ!- ` `!3   >HƐ#h  @ >Mc q [  X ;>M9>M7>M" @ ⦐c 29   * *`  *   ` "!H@ t⇐#!H  &!H >M|#@ bu, , 2 ,  ,  А  $@`    !H    2 2  2 -@-`-`-`-`-` >MB#耥 >N; -  ``!3  \>N, . ``!3 M  `?%s: ipcp rej opts: 㿘 4    / >O`` ὔ ``  %>I"@@ @p@ 2`!D ?&!D`&@` 뀤 >H#h %s: ipcp nak opts: [wantaddr %s] [agree] 㿘 4  Ԕ  R`>Oa` u A`` >`)>I'>O"@@ @᭐!p@ (`% 2#&```* `*`!D `*  &!D@ |Ꮠx!H  @`>Oᄐ!`&@` ɀ``>Hv#hB !,"!,㿘!, &!,㿀!D  @!  /  ,@  ,@  ,@  2 ,@  ,@     & . `!a %s: chap invalid packet length: %d bytes %s: chap corrupted challenge <%s id=0x%x len=%d%s: chap input <%s id=0x%x len=%d name= value-size=%d value=%s: chap success: %s: chap failure%s: chap failure %s: chap corrupted response <%s id=0x%x len=%d%s: chap dropping response for old ID (got %d, expected %d) %s: chap response, his name != expected %s: chap input(%s) <%s id=0x%x len=%d name=%s: chap bad hash value length: %d bytes, should be %d Failed...Welcome!%s: chap unknown input(%s) <0x%x id=0x%xh len=%d 4` `>Oc L 0``4@ `  `0{\ `0v ?$? `!>P0  ( `!>P0  X @"#`` -`@ &2`>PZ @ >CT!h@Cؐ @C`!p @ B@Cې@Cא@D !P/ @ 0`>>#d #\`4#`#h#l  @ޚ07`>P` ٔ $ >H>P *``@ޓ2`>H#hH /f * '  0!L ?b# & !  !,  H 0 0H 0 @w0>P` ߚ  >Pݐ *``@2`>HՐ#h0>P`Д ߇ 0 ?$?`!>P0   @"#``q *``@a2`>C߯!h0`  `>Pa [ 0!@ @ >P@J >P aXH -`2`@T>P߉!x @* @J2`>H#h`"@ @0@"#``>P#\ a# -`@/2`>Pc @>C]!h `h>Pa    0`@BՐ @B`! @?@Bؐ! @BԐ@B@J[  !>>` 4>Pa#\ @ޘ  ,   `>>>P 4b#\ @̘  #!>> 4c  (@0@! `@>P`b#\ ޴ *``@2`>C!h " "!㿘!L0"#@!  !>> 4 8@!<&!, 㿘` >> 4! %s: chap TO(%s) rst_counter = %d 㿘 4 H o *@ g   !>R @Ǡ!! ^ !? &! !>> 4 ,@ 0   !<&!!>> 4 8@ؔ H 0%s: chap %s, reconfirmedtlunext re-challenge in %d seconds re-challenging supressed 㿘 4 !<! &!~?c >>`L2 >X!,4΄>R "` >R">R#  ! >R>R#.0+#0H /f * ' !, Ԑ ` &!,H 0 0 H 0  䀢 @%s: chap tld 㿘 4 ">>>S` ݯ >>`Ln!,>= ?&!,c|€p!@ߐ &!$`$`$`  ܐ /!P . & @Ɛ  #d>>#\#`#h 4#l  @t%s: pap invalid packet length: %d bytes %s: pap corrupted input <%s id=0x%x len=%d%s: pap input(%s) <%s id=0x%x len=%d name= passwd=%s: pap success%s: pap failure%s: pap failure %s: pap corrupted input <0x%x id=0x%x len=%d㿀 4`  &>Saؔ % 0``4@ ">U   0ـ 0` @   `$ !>S0 " @ #`` *``@2`>C1!h0!` @G @0@i #``>S#\ b8Ր ,`2`@>S"h@ے>C!h`  4/@H+!   @H$!  /`>Pa !>=##\#`#d  @" ,    /`>P >=#\#`##d  @ !>=#   (@0z!? >Sbx u  N@`" >H>Pܴ ,``@x2`>Hܭ#hH /f * '  0!L ?`# & !  !,  H 0 0>H 0 @05>U! >Sb /  N@`>Po ,``@32`>Hh#h0>Sb  0>S`b`   *``@2`>CN!h " "!㿘!0 #@2 !L! >=!<&!# !L0 #@ >> (@>Ua4g!㿘` >=#s %s: pap TO(%s) rst_counter = %d 㿘 4 H o *@ g   !>U @ `! ۰ !? &! !>=# ,@< 0  >=#3 H 0%s: pap peer TO 㿘 4 >Uax  >> (@㿘 4!<  &!>=#>D`  l H /f * ' !, Ԑ ` &!,H 0 0 H 0 @"%s: pap tld 㿘 4 ">>>Ub ; >>`>U!!,>= ?&!,c|€p ܢ!p . & ܒ @b!P/ @]  >=#\#d#h#l#`#p#/#t  @㿀`4>t 'T'X Q  ! 7 H /f * ' >8 2H p@   ' 7 '' '  $  g  '  **  * 2 ,`T  X X?j@2 ' '  4` @@4` >C `a@#\ ڠ` , `@2`>Cߐ!h``Ȁ@ ```&`%9&``T &`T' ` 2" &`%,0`&` &``4$2```@``   &``㿘%  & && %s: down 㿐H /f4>O* '>O h M >=#h Ԁ`"D  4 @?`2  䀢 (:  ؀ 2 >V ~"8 Ԁ`"  ؟@ ؀  4  Ԁ   ܒ` $     䀢 0 !  ' $ ,!0`!  u Ѐ 2 ԑH 0>!X*` >V"D*v         2    "   `"   22"`2"@  2 "  2"㽨ϖ! t @!쀢@!쀢@ i 0!:@2d  <!|@D’ @D @D @D s!N!9@2J  䀢 XD   0#@#@29 ` 0#@#@2. \!L@D D6!L!P | |!p `!@Dy D  6!6!! !   㿘 !>L !@&   ># , @ `"  @  , >#  !, ,  `"  @  ,`conf-reqconf-ackconf-nakconf-rejterm-reqterm-ackcode-rejproto-rejecho-reqecho-replydiscard-req0x%x㿘 ` (>X!X*` €1>W&#1>W##1>W #1>X 1>X 1>X 1>X 01>X @1>X P1>X  `1>X p1>O >X` ` ` ` ` ` ` ` a a a a,challengeresponsesuccessfailurereqacknak㿘. 06 `# b#4`"1>X `   ` 1>X'!%!1>X"!1>X!` 1>X1>O 1>X 1>O !1>X !!1>O >X`ٯmruasync-mapauth-protoqual-protomagicproto-compaddr-comp㿘 ?`>X#*` €1>X"1>X"1>X"1>X#1>X#1>X # 1>X #01>O (>X` n cl cx c c c c c caddressescompressionaddress㿘 "1>Y  1>Y 1>O"1>Y1>O     ( 8>X` <initialstartingclosedstoppedclosingstoppingreq-sentack-rcvdack-sentopenedillegal %>Y؇* >Y >Y >Y >Y >Y >Y >Y  >Y !>Y!>Y! >Y!( eP e\ eh et e e e e e edeadestablishterminateauthenticatenetwork >Y* >Y">Y ">Y ">Y"(>Y"8>Y!( f` fl fx f f㿘. 06 `!"1>= `#  !1>=1>O b#" 1>> 1>O##1>>  0  p H*>X`2؋ %02x-%02x㿘>Y#pM .`  !>Y#xD *`  \x%x%c㿘?.`#`@#>Y!>Y ^ (c `##*  @%d.%d.%d.%d㿘!>O X6 6 >Z 6 `` =    2lo%d㿘> b   ̠` ->Z+>[)>Z`Ф`!В`X  $ |$ , 8, :$$ <4 4ڋ, 9 ˖ XX?Xlooutput: no header mbuf%s: can't handle af%d ` 2> >ZC!!!& t  (& x 4   t't'' 'xտx&`4! @" P 4o l 3j A P & P` `@& `  > >#     >Z x! ؐL /H /f * '   @ ` # H 00 7&`  2" # >h  , @ # # "h dZ > > *` 6  H  H & H` \ & \H p@ ` "`T  @   42 4>[<" 2@1@ "  /  /  "  " " " "" " ifmedia_add: can't malloc entry㿘    2"`>[h!"` "`"@ "`"& 㿘 `` ``ifmedia_set: no match for 0x%x/0x%x ifmedia_set㿘@ 2 & >[!֮8 >[3!㿘 { `xv0!50 !6"$m `@v 2c ` @2&2&X &&@ P&M& ` `&`&`&`&`€`   *  i ` .$@` &2 02   ` *`$ "`  &`  ifmedia_match: multiple match for 0x%x/0x%x 㿘 8  @%>\  2  8  2 㿘 #< 2 @2 $ & "@  ꀦ>  @2` @ sl%d㿘> 0 b )>\'>a%>]!$   !(pؘ 2 , 8$ <$ $ |$ $ $x4 4/ Ԛ ``/sl%d: can't allocate buffer 㿘 Ȁ 2; ȑH /f1>͐* '1>!H   ֒ !H`> !>a #@ 2 > + 8 ?" @&!HH 0` h >\a"X 4  4 4$  Ȑ x$ @b$ ̰ 㿘>"`a6 _`h > Y " `H O "M 7&`& `& DH /e * & `p$ &`pH p@Ӓ H /e4`L* &`L"Q & `` @ & #xݔ  H 00& & H 0 / 㿘H /f * '  Ѐ`4. hz$`& БH /f * ' > !>`Ȓh" ! 2 ?* `* >!H>`Ȕ8"` 8`#!H" H 0 $`$`$``쀢  H`v`H 0X@ ?ਐ "%s: af%d not supported 㿐 >]x"ؐp / &p ͐ 2p 2 4 @24r A`@  2 e 4  2H /f * ' 䀢`"! H 2 > ta"'a`x"'Вb@ ? $ `@6&  @ `w& H 0T 7  &T&`  2" & &  & > aa&t&xH &@  H 0 ` д  H   ğ@ H 4% # L H" "QH /f4 * ' "  % % $ ?% "  h % h  % % $ ?% H 0 -> /  Hд ` `@` 2/ 4@   @a  @*/   /ؔ /S% t% x H`  ` `% `>"83> 1  ` `? $  `% ` i    ݐ ^   ` % `H /f  T0* ' T* ?5 H p@  "2T$`@*TH /f * ' > !> ! "@ 2` ?*  * >H "  `"H% H 0 Tcp*  2v  "  `G  X`% X P `% `% P㿘>#t  ! 4 H /f * ' >8 2H p@   $ 4 $$ $    `_T (K ̑H /f#>͐* '#>aH   ǒ aH$ > !>"  2` > * 8 ?"  @$aHH 0  (  $ 4 $ ($ $$ ,$ 0  2 N  ̐(& $  ̐ 8$ Ȝ $ $ $ 㿈>b`А `"b?2 ``p 2 `\` @2`\`А $`Д `4 `&$`\2 $``܀ > `ᰐ @6$``ᰐ @`ܐ  $`$``܀  0> $`؀ ܀"`` 2``Ԁ 2 ``Ԁ 2 `$`Ԁ  ?$```̰" $`o  $ ` @ @*p 2`4 O*@`4!@ `̒@`` $`Lo@~p2}`L 'y`̔ p@`` $s`L`44`4o  `̒ *og ̐ [> `H $`Haa$`t`$`xH /f * ' ># @  `"`L`l`$`L$`l0 #  2" ">h`"" "h ^[ > >  *` 6 0 H 0```Ȁ@`*@$` $``А $``L $`L`$`Ԑ8$`$`́H( @  @"  2@1@ 0 2 / 43 4"  /  / H ppp%d㿘>  `x +>a)>d'>d 2ah$   %ܔ !L, 8$ <, :$ $ |$4 4$ $!$!Ӆ$ !@ ϧ ``!ā㿘>ϔ  x ܀``!Ġx Ȁ   ``! Ȁ 2`` 0&$$ ܐ%4 ؐ!( $ @:u$ Ԑ.   $!p@]!D$!L$!T!  "? 6"$!$$! > !$!X$!\㿘  4& Ȑ ?6 4&     & & " ?& 耢   􀢠  & & " ?& ! !  &!&! "!?&!!  &! ! 2! {&!@V!d&!L &!Tڒ &!d&!`!l "!pҒ &!l&!h!p ʒ &!p%s: comp_alloc failed %s: decomp_alloc failed %s: no compressor for [%x %x %x], %x x Q@! S@ "`8  Z N@"@.?0怦@ "0` V@(?0 J@y?0 `G@ `F@R@PY@?0  M@" `K0 L@&?0`&`&& !6  @H /`4`Đ* !`Ā @ @@H /f4`Đ* '`<?c $`ēH p@  !6 x> $@(q4`p m& !6 gap bH /` * ! @\ H 0M  !6v F 4B$`ܒ!6m = 8  ý 1ـ > `  2z  < H /`4aL* !aL  aH@$aH€  $aL`@@>b ߒ` 7H /f4`Đ* '`* $`đH 00H /`4aT* !aT  aP @$aP€  $aT`@@>b!Υ` 7H /f4`Đ* '`* $`đH 00 `@@|>bؐ!(ڒ`   ! 0 L@2 aD&!6 aD@  H /` * !  * #`@`̟@H 0b H /` * ! > aaX"&a\" &H 0G "*   +   00Ր   ג &    G@aha`H /f * ' ""H 0    㿘H /f * '  2@ 1@1@") @"!n @" 4h 0!z@ "P!{@"[ @V  @S ?Q6 4  `  `I$ <"F / B@ /@7 8!(&!,&`!0&`!4&` !8&`!<&`!p - &`!p` &`!p`&` !p`&`$!p`&`(!p`&`,!p` &`0!p`$&`4@7U 8!L "!T!H`€!T !P`4€,H 0%s: af%d not supported %s output: 㿘 Ȁ " 2 4 @. 2` 2 2`?Ȗ*@6`>d`  !D` !6` *   # / 2" ` 2  `?"  `?" 4 `   2&`  7?&``<`* * ** `  `&` `` @` @>d#Ғ @ @2!!@` *@!d  ̤ 2!lj !l ̘ "`> !$!X`*!@ H /`* ! !$`"&`.$!$`@ ! @&&` "&` "H p@ T 7!<` $!<"$ T 2" "" " ̟@> a& t Pa ``& `& x& PH 0 㿘! @!   *`@ `! !D  ".- #$"@  ! @& " " T!<` & T&!< 2" "" " v$2&!$㿘H /f * '  > h*@ & # h Y > >  *`  0ü H 0㿐a    $a$a & a?$a  `    $`$`& `?$` 2a8  $a8   *  !   -01 !`Ā,0ap(    0  ` 02 @Y  p " ,  / -,, , , @Ԕ 0 !3  "0`aL +`Ā@' '   `aH aL`<   `@``Ā    `Ā 2`Ā 2`Ā 0 !" `   & & `Ā  2  , ,    & & 㿘>Ϡ xH /` * !  ' Ā  ! "`H /f * ' $ ēH p@  ̟@`!@H /f * '  ` ` $ $ "` ?$ H 0 `߀`H 0if_ppp/ccp: not enough data in mbuf (%p+%x > %p+%x) 㿐` 8`@`` ` `` Ş ` `*  @@ @ Ā@>g" ʆ0 @?`>h!*` € Ā H /f * ' ?# & ēH p@ 0 Đ ` @ ` 2(!T!L~@!H @    rH /f * '   & ēH p@ 0[ Y@!P @#\$   ؔ KH /f * '  @ 0*@& ēH p@ 02 Ā`/2!T!L)@&!H@ 0 @!P(@ H /f * '  * & đH 0  X ̝㿘!L "!T!H@&!L!T !P @&!T㿘H /f* ' ` 6`&` 䀢 2" &  >h @ & & "h V > >  *` y 0R H 0%s: got %d bytes %s: decompress failed %d %s: VJ uncompress failed on type comp %s: VJ uncompress failed on type uncomp %s: input queue full 㿀!, Đ &!,@ ' `   >h#3@` ` `*``@ ` @?А*6`H /f * '  Đ(& ēH p@ D!TB8 Đ  <!P `, 2 Z ` ` `* : @@>h#( H /f * '  Ā (&  @& đH 0  Ā  Ā@ !P`0€  2 Đ  Ħ `  h-!p  @W H /f * '  Đ 7& ēH p@ -;/ Ā /!p +` #\` @W  > @@>h<#H#p  u ! 4 H /f * ' >8 2H p@   $ 4 $$ $  B  $ $  `(W H /f#>͐* '#>aH   ~ aH$ > !>"  2` > * 8 ?"  @$aHH 0  (  $ 4 $ ($ $$ ,$ 0 `   (    "      ?$ : I0 !,@,`,`,``@ !  $ ` ` "@&`&`   "     @  ( " ( `k$  ?$b `@ `  `  $ H /f * ' V`>8* ?2 H p@ ` "4@`$`@,@H /f * ' > !>`  "@ 2` ?*  + >!H>` 8" ` `#!H" H 0 @p$V`*% $"! ` Ā !p ` #\` p@Vb 6  ! @@>h#p5 0,``< ` 7>#t 2 ! 4 H /f * ' >8 2H p@   $ 4 $$ $       [&`  &`&`` *!d ʖ "!l  "`> !&!\`*!@ !!-  4 !D "`%0q>``  h?&`&` `&`# h SȒ > >  *`  >{ >#  H /f * '  @&&` "H p@  @@>h#  l #& l 2" ""`"H 0  H>  \`& H& \ & t& x П@0  L!0` &!0& L%s p +  | >   2  @*   @ *  ** ޔ  >*>k*#㿘>" !6W ^H /e4`h* &`h  `Ѐ  Ȁ H 0@ > 4 2  ԑH 03 `">p@>pa, !t 6!@/&!?>n>p>lؘ"&!t&!& & & & Ȑ&!@&! 4`@6 4` & Dn&`БH 0 㿘H /e * & V  Ѐ  . h&  Ȁ@ (H 0 㿘H /e4!* &!  &!! " &! Ā$  Đ ;& đH 0㿘 Ѐ  z H /e :%>ܑH 0k H 0c* & "%>܀    @  H 0C # !  Ȁ h "  H 0+ " p, ( 􀤠  $ $ $ ?$ H 0 ` q "C㿀 p     @2 h  h  " Ȁ <` @` ` ( 700>"8>#t   4 H /f * '  4H p@  $ $$ 4   G  $@$ `#(: H /f#>͐* '#>aH    Œ aH$ > !>" a 2  *  $  $aHH 0  (  $ 4 $ ($ $$ ,$ 0      ( @  "@  ?$`@8  y$ ` {/` `" ` #` |㿘 Ж  Ȁs? P@_  U@0X@ Y  W@ "  T@M  O@F!6* KH$!t!tE& !6 >;$!!8& !6 1H /e * & !t !|!*  $!$!|$!xH 00!t 0    R@@>(*  @2 (2 `* 2 㿐`ȶ H!Ua2  "L H 2 a4 ~`&a4H? ͐#6a> aa&`t`&`x U@at@ @ 2`*  `* at `@ @ @2 *`  *"`@ Ha4$@&a4%+@&H /e * & H }G < @A ,H 0a4` &a4@`? s o aat8 ;`*`   * `  }//bH p@݀H 0Հ/a 8 :` `;`*  `*  },@`` ,@,@` ~,@`H /e* & H גH     ?0 * H 0 $a4 &a4 $`$ H /f * ' T>8* ?2 H p@  2>$`@+TH /f * ' > !> ! "@ 2` ?*  * >!H8 "  `#!H" H 0 T>ݑ* p "&aa 6a&aH /e * & @0  `Ā$`n `Đ$&`đH 0㿘H /e * &  Ȑ " (#H 0㿘 Ā` П@ H c` p    @  Ȁ 㿘 ȓH o *@ f  Ē {& В H p@㿘H /e * &  آ `y!>"8 2g >#t   4 H /f * '  4H p@   $ 4 $$ $   j  G&H /f1>͐* '1>!H    !H$ > !>" a 2  *  $  &!HH 0  (  $ 4 $ ($ $$ ,$ 0    ($@"`H 0%s: bad char %x %s: bad fcs %x %s: too short (%d) %s: no input mbufs! %s: garbage received: 0x%x (need 0xFF) %s: missing UI (0x3), got 0x%x %s: bad protocol %x %s: packet too big %s: too few input mbufs! 㿘`Ѐ`O `Ȁ@K>@a( "`  $a(`@@>q h`"( `2` "``p,>9`n* a|* `&`p@€ 0  `p`Đ >`&`p@0H /e * &  ``@ $`>> * c(@  * `` $`đH 0`@@ ~2`aa 4a@ڒ?`0@  1<a @- H /e * & 0 $`@>qa <``La0` $a0$`L0*$`đH 00 4(a @>q `H /e * & `La0`Ē` $`$`L$a0H 00s` ?  "` aa@ 2@$aa! " aa$a"`< `ĀH /e * & `* $`đH 0!0<@  5@901  a*@*H /e * &    }  $`đH 00*$`İ H 0a @ a 2aa 2 a`@@>q &` a`  ` `` &`$a`<c4a $a`Ā`@@>q  *$a *a`$a4a`  &` a 2a  @`Ā@>q `F`a 2a "aa*a a`$a4a  " a  2`@@l>qaJ!*`c`Ĕ`ؑ*2 `  4a`@@V>q)! a`  `` `( `  "$ @+` `  ?&@ 4$` @ 2@F@ 2 @`@@.>q!8`)`$a` &` ` `` &`$a` > &` a(*@a`*2 $a* 2@ 4aH 00-@$H /e * & `La0`Đ @ $`L$a0$`đH 0`@@H 0 %s input: 㿘`!!*@ &!! `  >s v"!@!&!%s p ">s  >/pq>2cH @ + @  +  +   * >+ + C 0 ! " ," 0" * " (" $" " 4㿘  , )#  $ (  22 " " & & $  #   & , $`*@*ѐ  ( 8& (Ȑ  㿘 @&@ <&` H&` D&`  8&` 4&` &`  $* &`2``@*`&`㿘6 & 0㿘`$L  2H   2D  6  2?  `!>t"*` €#  #)  "] " Ϥ ,  *@ P    @' P .`   & L`  & L&& . & .  D㿘 L "G D 㿘 㿘 㿘`@ 29 ` 25 `6` 20  ` 2+ "! L "  !  L*2@  *#@2`T2`V. \&  &  . K 㿐#\#` 㿐\ #\#`㿀`'H`*  ` '`? ` 'T' H"T4'T>ݐ#p    4 H /f * ' >8 2H p@  $ $$ 4   H V"$ `T@ l(< H /f#>͐* '#>aH    aH$ > !>"  2` > * 8 ?"  @$aHH 0  (  $ 4 $ ($ $$ ,$ 0 `  $   (   "  @?$@  ` @,@``,@`,@`,@``2 ,@ ``,@``` 5` % ''쀦 '@? `* @,P@ * @`@  `  :$ , P@@ @ `-> `"8 '耤`'7 ,@`@ > $@$ cp   "$ 2`H /f * '   5 H p@ ""` " 2  $ NT" l9$ H /f%>͐* '%>H    H$ > !>" a 2  *  %  $HH 0  (  $ 4 $ ($ $$ ,$ 0     (   "  @?$@ s/ `@ * ?@ `'-` .` X@*`@ `T22#2`T26&`%`% 4 @2 ->"8 耤`'7 ,@`@ > $@$ cp T  "$ 2`H /f * '  4H p@ ""`"2`  $ NT" l9$ H /f#>͐* '#>aH   ] aH$ > !>" a 2  *  $  $aHH 0  (  $ 4 $ ($ $$ ,$ 0     (   "  @?$@ s/ 耥`$@%`$`  %` `%`$ !% *>b8耤` '7 ,@`@ > $@$ cp   "$ 2`H /f * '  4H p@ ""`"2` : $ NT" l9$ H /f#>͐* '#>aH    aH$ > !>" a 2  *  $  $aHH 0  (  $ 4 $ ($ $$ ,$ 0     (   "  @?$@ s/  耤` ' * 2 ,@`@ z> $@$ cp   $$ 2`H /f * ' >8 2H p@ ""`"2`  $ DT" l;$ H /f#>͐* '#>aH     aH$ > !>"  2` > * 8 ?"  @$aHH 0  (  $ 4 $ ($ $$ ,$ 0     $$@$  * ?@ `@ `  -`  `@ `<%`@T`%`<H@ H"`4`8` %`8 %`4`H `D `%`H%`D㿘` ``*       4   `& 46 ` `?V`S` `X#@ @ *@*P  * @`      :" * P @:   #` @ *?* `.  *  T@"2 T1 3 #  L& + ,  2   @2@, @`2` 5  $@ & & $ 4  8* <  @`& 4& 8& < & @   . bsd_decomp%d: bad sequence # %d, expected %d bsd_decomp%d: bad CLEAR bsd_decomp%d: bad code 0x%x oldcode=0x%x max_ent=0x%x explen=%d seqno=%d bsd_decomp%d: ran out of mru bsd_decomp%d: peer should have cleared dictionary 㿀  'L&`"'  '  '` ?`4 ` `$@ *  " ` 8>y ![ >4#p  \ ! 4`H /f * ' >8 2H p@ `  $`4`$@$`$` ) `2' $` "H /f * ' >aH >͐ f >!H$` > !>"  2` > * 8 ?" ` @#!HH 0`  (` $`4`$`($`$$`,$`0`` $` ` `(`   "  ?8 0` $@ }***!'Y `U * '' I2 *@'!'@`0@`2`   E>y @!Y ,'`  +>y ~">y"0x5   L,    ' >y "XZ @ <`>ݐ&$` cp V   6 H /f * ' >8 2H p@  & && 6    O& &$@H /f>͐* '>H   e >!H& > !>"  2` > * 8 ?"  @#!HH 0  (  & 6 & (& $& ,& 0     (   @" "    ?&" `` ,  V*``P * , `*. "H@C,  , @+  P@.-``    :# +  P@* X`*` `T23`#2`T3`2"L$ *@+2  "', @`2` `& $` $ @ $$/$ " H >y U"xH `D@<@ $@$D$H$<L"㿘# D 㿘 㿐`29   23   2/   ` 2*   & 2` "  d   >{>{#ؒc& 8& <#\&  ?   @ &  H@ 0Ò  㿘@+  㿘$# @  2 ` 2 ` ` 2 2`   2 ` "&  & &  @& 㿘 @&z_compress: deflate returned %d (%s) 㿘 # *`@ @``&@4>ݮ#p    4 H /f * ' >8 2H p@  $ $$ 4  1  m&@$   l(< H /f#>͐* '#>aH    aH$ > !>"  2` > * 8 ?"  @$aHH 0  (  $ 4 $ ($ $$ ,$ 0      (   "  ?$ `6   $  $@   - - - -  : - -  $($$А"@$($$  ` $$  "$    2(" ($ $" (  p$   ِ `$$ 2`H /f * ' >8 2H p@ ""`"2` a $ R' l;$ H /f#>͐* '#>aH    aH$ > !>"  2` > * 8 ?"  @$aHH 0  (  $ 4 $ ($ $$ ,$ 0 $$ `"    (   @"   ?$$( А"@$($$@Đ  >|0!>|"<  `"P( K  ($@$ 6@ 2P " @PT`$P$T@ "Xw&@X\@ $X$\HL@ $L$H㿘 H&@ L#&` P&` T&`  X&` \&`&`*&`2`@  &`㿘`24   2.   2*   ` 2%   ! 2`   d Д  >{>{#ؒc& 8& <& $ @  &  H@ 0{  㿘@ΐ r 㿘$% @  2 ` 2 ` ` 2 2`   2 ` \  & & & &  @& 㿘 @&z_decompress%d: bad seq # %d, expected %d z_decompress%d: inflate returned %d (%s) 㿐'@` ` `" ` `$@ * ``*   >  "~ >~ 7#x &#p  7 ! 4 H /f * ' >8 2H p@   $ 4 $$ $    "G $ %@H /f * ' >aH   C H$ > !>"  2` > * 8 ?"  @%HH 0  (  $ 4 $ ($ $$ ,$ 0      (   "  ?$ `6   $  $@  -- - & & @`    & $& (     2 (`"  (`& ` & ` @`  ( 2"$ & (   -  $ ( & $& (#p  ~v `$$ 2`H /f * ' >8 2H p@ ""`"2`  $ }H /f4H* 'H    H$ > !>"  2` > * 8 ?"  @%HH 0  (  $ 4 $ ($ $$ ,$ 0 & $ `"    (   @"   ?$& (@    >~ 0 #8>|"ߐ ? "D  ( ?$@$  H L P T@ & T& H& L& P'@ " z_incomp%d: inflateIncomp returned %d (%s) 㿘` # *`@ <:8 &` ?& & ?& &  & ` & ` @0 "@  > 0 !>|"} 0`2` X \ H L@ & L& X& \& H㿐#\   @ 㿘  &  ?   2m? 4h?`` $ a?' (   W? ,@,@ & ?$,$L$$(  $$$H$D@$$P  ( $0   (┟$$8  D ( $<,@ $   (0  $8  >< 2 > |@0& ?␑*`  $ $ $ ,\$|$ @$㿘 "(?  "$? " ? $  ?. ,& & &  $   $ $    * q $ $ @@L  2` ( " (" 㿘  `8  ``  & ` $`   @"& & `" $``$` 㿘 ` 2@? 2 `` > t?$`` 9>  *& ( |?* :``( *` @| $ q&   "  ` "   |2   q`& `2u  `" `> ?i$`` ` l ```2 |"&  | @Β @ 2L ` "H `.`- "(`` @ ;0@ 0 @֖ `  D <*  2? D <@ٓ*`B` ` |&  `2   2  % ?c ( ?& `?㿘   2 0.?`" 8 $ $* ( 8`" < $ $* ( <`"  D $* ( `" $* ( $ (&  㿘`` 2` "$` `2@ @@& @۔@`@$`$@㿘 $ D*` <*  & 42? D <@M*`> |`*` `& x@  & @ `& @ & X& t& @& d& T& l& `㿘`$`d~`0`t`p!  `0`d`p``8`, 1 ^  Y T  N  &~ 6'@ /'@ ('@ !'@ '@ '@  '@ "ɴ'@!  ` `h@ ( ?2㿘 $ 4 l d"@ @ ??9?2 $4?~  / 0 h d" T# D" <+`@& h& d& T@ "2@2@ 8+`@@ "2@2@2 #  0 d l@ ܒ@  l@`& l 0 d @ & @ ` P L*  & @ l! `2 4㿘 & p `  d 0 ` @ P L*   <& @ ,* @  8+ 2  @ <*` f2 " X d $"@>@8 X ڒ& X X l 8& X XF d h@̒"  X l x" (& l %& X d 0`& d@  @ P L*   <& @ ,*  @  8*`2  @ <* f2  X? & X d  X d& X@ 0& d @ & @ ` P L*  & @ 0  d@  l d & l& d`" l T  0   d" @  d & T `"&  l!_ l!`"  T T  0   d" @ d& T  `?㿘آ `( X d 0 ` @ P L*   <& @ ,* @  8+ 2  @ <*` f2  X  h& p& \`+& X x@:( p d $"@>@8! p  & X X l 8& X X`8 p  `2  p d h" ( p& X p(V ` X Q d l \ `# @ l p " & l& p d @& d 0 @@  P `*  L  <  ,& @*  @  8*`2  @ <* f2@  p? & p d  & X& dJ& ` T  0   d" @  d<& T )` ` ) 0 d  @ " d T  0   d" @Ɩ  d& T d l & d& l 2  l9  d  l & `& d& l l!( l!`"%   `   0 d  @O & ` T  0   d" @ d& T  `?x> X>P>Q h   ؞   +  # ch(+@ ?` >h ̒* >Q ܘ   >P * +  $@  h**@ ?  *"; > >Q ܢ *>P + "?,@  ` ?h(!*@?  $`2? 62>O r  ,   2 7耤 !>O r ,  3  7ꀤ!!>O r ,  3! 7怤!>O>O r ,  3! 7>O p@=!>P   4`@T 4@  `㿘>P `Fbbbb b& >>>& Ḙ!̄ )*t&+&+&+&+$&+(&+06&&@!0t060 H060" 2"" " 㿘.T7H.46.P*` /  ) (`@/`@*  / / / T@.@@  ..  .'@ ..T 㿈`+4@ '`  +R ' 2@ L +T'*` * @2  `<;",@, @* @ `@$22 4!,`   5 $* @@@ې @ & ђ@ @& <쀥C- ?,``,``",` `?2 *   2  2 " ",@  * @ `" ?@ $@@&6`? 2`ߑ,`xؚ    * 2 ` ` ` *` *6 @2 6 㿘 LH"= & ?@& P+T " 2  & * # +@`@`H +T '+4`P b b  *  & % % , 4 + ?&   "@ &  急 H&2`@ :`` `4 H L P*+X &&+X ,`+X?&* $ +`?&* $  ,   4  @` -+`,`2  2`&+Xe  Ϡ `L +X& *% 5㿘?  `   .<c:0jt "-.@7@ .@7@j 6j 4jj6j6j `       ͞㿘 ?      c* @R 1 +`b tbv "@.6 (&6 .@ "&>6@(6&  `v@,v+`b #@t.6 ( &0.@ #&>& 6@(&6궺b #@$.6 ( &0.@ #&>&6@(&6b .@6 .`6` ( &0. '@( 4J꺺b #@$.6 ( &0.@ #&>&6@(&6b  .@6 .`6` ( &0. '@H(Lb #@$.6 ( &0.@ #&>&6@(&6b  .@6 .`6` ( &0. '@&>@& 6(&6      @    * 㿘+; + 7)+(>!  *v $  * `"?  * `@$ 㿘  ~+  6  `+  3  *   & 2`*  " ;6 & &  ~* @6 &  *  6  `*   3 *@   & 2 *  " ;6 & &  +  6 &   +  6  `+  3  *   & 2`*  " ;6 & &  * @6 &  1)"">! *v`  * @+ @6   * ` & 2* `$ & ; 6`* @*@  6&㿘  .  6  `. 3  *   & 2`*  " ;6 & &  .  6 &"` * @ &@̖ 㿘" "   *  ` & 2*  `?& & 6 & @b   ?& 㿘   +@  6  `  *   & 2`*  " ;@6 & &   * @6 &>O pd⸢ #d +@  6  `  *   & 2`* #?;@ 6 & & d * @6 &!" ` @& "" " [ "  +@ 6  `  *   & 2`*  " ;@6 & & "  *@6 &`pd #d +@  6  `  *   & 2`* #?;@ 6 & & d * @6 & ` @& " &㿘!" `?  `&@Vz+w+""    2 2 (     &@{&  `0p 4  +@  6  `  *   & 2`*  " ;@6 & &  * @6 &>O>P`p@Ɛb 8b  +@  6  `  *   & 2`*  " ;@6 & &  * @6 &++ ` @)b b   &  @ b  & "6 㿘" "*`2 "` *@ & . @  +2@ " >P & ch @ *  2 `>P!h *`>`!!h @*)` !h >`!!h *`@ 2  | '"2# d> T`̦" *)  @@ؒ`?`" "2@ 64  bb  `?㿘☺@ >P>@ hX@@+ @ ) / @@ #@$@@@.7@ ``(@ `'`0.@@ #'@@@('@7@>Ph⸅(`  @"@@$@.7@ ``(@ `'`0.@@ "@'@>'`7@@@('@7@(`+>Qh"@ "@'@/7@ / `6`(@ `'`0.@@ "'@>'`7@@/@'@7@3  (`@"@ "@$@@@.7@ ``(@ `'`0.@@ "'@>'`7@@@('@7@>+>Q܂"@ "@#@+7@ +`6`(@ `'`0.@@ "'@>'`7@@+@'@7@@ 1"d @"@@"d@.7@@ ``(@ `'`0.@@ "@>7@'@ '`d"@(@7@'@d'@     *```` ` *```` 3  *``` `?*  0`* 2 b b ( "2 (" "2 b (   " 02 " ( "2 ( " (""2㿘ڐ" & 6 8*@  & *@  & *@   & 3 *@  &   @ `*@ & 㿐 "? 2& ?& &  ` " @ٰ 㿐 ? ` $ 2`0 @ $  (  $ 㿘 2 1?  (  )& "  `"   "`  ( ː?"  `  >"d *@  "` ?㿘ǒ unknown compression methodinvalid window sizeinvalid reserved bitincorrect header checkincorrect data check㿘 "? ? `>#<*` € ܔ  & &  @   `" &  ">b 2    >"" &  " "   & &  @ ` &  ">c   * @2  $>c $ `@k`      @``  " "~  @۔ `  "@ "@  b? `& &    * "` &"  `O  & &     *` " &" `:  & &     *` " &" `%   & &   " &@   ">c0 &  "" " ? ?`2   " ?" ? @4 @ Ax A B Bl B B㿘` ?@<㿘 F?`2@0@  "@"` 25?     `0 `  ?( "@$$$ "` $$ "@?㿘 8 " <&? 8  `$*`(  2  ( @ @ @ (& 8& 0& & $& 4   & <㿘   ( @    (  & (& ,& 8& <0 ( $ @ invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeatp 0 4@` $ "? ,"` =>#*` €?  *`` 4  `&  `/`2  `4 $@&إ4@@耢 & & $& @&``$  &`&@& 4? && &  &4>&"&`4& $& @&``$  &`&@& 4??  *`` ?c82   >&"&`& $& @&``$  &`&@& 4Ŕ? ` &&  q `& $& @&``$  &`&@& 42D  , ` 0 ( @ "?"`22 & 4@ 0 4 "@ ,? ," ` 0 ( @ "?"`2 & $& @&``$  &`&@& 4h 8 " %%@&     &?  *``  ?, `& 4   ! >&"8&`& $& @&``$  &`&@& 4$?@ ( ` `(  & & $& @&``$  &`&@& 4 ? & &4&   2  @> "$¨?  *``   *@ *`"  & 2  4    >"$* *`"  &  &   @ ?2& $ && $& @&``$  &`&@& 4 &&  4   ! @  >! @,  r?  *`@ ,   *`    $@ * "  & R4    @  V?  *`@ + 4$@  4 @ ! @$@ 4   >&"`&`& $& @&``$  &`&@& 4>?  ( ? + "@ &  4   ! @    @  4 #\&  `   !`''#`@"ܠ ?"&& $& @&``$  &`&@& 4@ؠ 2 @͒@ʒ& $& @&``$  &`&@& 4ߔ?`(*`$ & & & && $& @&``$  &`&@& 4@ђ @  @ @ 0 4@` $ "? ,"  `V&  && 4@ 4 0 0 4@& $& @&``$  &`&@& 4 && $& @&``$  &`&@& 4q & $& @&``$  &`&@& 4c?& $& @&``$  &`&@& 4U& $& @&``$  &`&@& 4G& $& @&``$  &`&@& 49& $& @&``$  &`&@& 4+& $& @&``$  &`&@& 4& $& @&``$  &`&@& 4& $& @&``$  &`&@& 4?@P F Hd H J K M0 P Q| Q R(㿘# (  ,`(`$" `(`$ @㿘 0 4@":? "`5?  ,@" $"  8 <& <[`@&` ,$@& 0 ("& 0〤& $& @&``$@&@&`& 4 2?" 8'H\'L'P'T''''''''''''''''*`  " H  !":  `   , `" @*   ,``"@8 " *,  @   /`,` @?"  '' "@`  ,  *`#`" H`@*  '?'p ͮ / '@"¸ ._H . @``'(`(`  "? " `@*8 (''' @  p@`? ! p"" //'*` $4@, ""4H*`'  / /L    `/'LT" *  `P/L" P* '4@ *  ?, * ""   *@ @" @4 @2@ *@? @  %*.? @ E 8/ ` `2?oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths tree㿐#\#`    ??>#( & @>cP&?oversubscribed literal/length treeincomplete literal/length tree㿐`\>>#\p"#`!L ??>#/$ -@@>`$ %?,`>>#\h##` - ??># $ 2 @@>`$ ?@@0 >`>Q (!T"`>X   "X)>%>U->U'>U +>UX"X`"X \ U`X>>!Lapx?h'pH "? 6"  *```"a a *``a"a4  *``a" $#\>>! !p"#` "? 6" $#\>> #`h# a % \`X?$`X%&@&a& 㿘  ? *`$`( ? 㿘 (    * * " " "invalid literal/length codeinvalid distance code㿘 0 4 @` $ "? ,"` > ܓ*` €)` '& $& @&``$@&@&`& 4   @o  0 4@ ` $ "@? ,": $   $ $ $ @ >耥`  *`@ >a+`@   * @  @$@ 4  $ $  @ $  $ $_   $>$#&`& $& @&``$  &`&@& 4? @ >耥`Y  *`@ >!+`      $ $@ $ $ $4  @ >耥`H  *`@ >a+`@   * @  @$@  4 $  $ A$ @ $ :$ >$#&`& $& @&``$  &`&@& 4H? @ >耥`  *`@ >!+`    $ $@ $4  (    ," "@  "$27  ,  0 ( @ "?"2% & 4@ 0 4 "@ ,? ,"  0 ( @ "?""& $  ( ,   ( ? $ $2D  ,  0 ( @ "?"22 & 4@Ԑ 0 4 "@ ,? ,"  0 ( @ "?"2 & $& @&``$  &`&@& 4 (m$& 4@ 4 0 0 4@& $& @&``$  &`&@& 4r $& $& @&``$  &`&@& 4b & $& @&``$  &`&@& 4T?& $& @&``$  &`&@& 4F& $& @&``$  &`&@& 48& $& @&``$  &`&@& 4*& $& @&``$  &`&@& 4& @&``$  &`&@& 4& $& @&``$  &`&@& 4?@ `p a0 bD b c d et f g gL㿘`(`$ 㿘 4 0@`  ,"` " `"&`&` 8 <& <- ,@@ 2)&`  4  (& 4 4`"   " `"&`&` 8 <& <@&` & 0㿘04@$  "$" ##@""""4 , >. .`(  ( ( @`x@>ؐ! `!d7`(`!   7 (   (> @@! `!97 `( & (  (`@!'@@ 7'@/@ `/@ `,& &/@ `(/@ `6`@2 1 (`@ ("`@` (` (`  !/@7`[1 " "$" ##@""""4?` e 1  "$" ##@""""4 0.95Pbuffer errorinsufficient memorydata errorstream errorfile errorstream end㿘?6  ` f a !E&@`@`@@`@ `@@`@`@@`@ `@@ @`@ @`@@ @` @@ `@@@`@ @ `@@@` @@`@ @`@@\#@X#񀦠,`tun%d㿘>ɐ" 1>/>->+> , 4? (Gc+`$  5 $ <$ $ |4 4, 8$ , :$$ X$ L$ T$ H$ P$ \$ `  ` ȤȦȀ`ؠ ȁ㿘@j76   .  * >ɱ* b 2  6  㿘 . j @*`@>ɓ*`@ ?#@ 2@ H /f4 * '     $ $ &  ?$ H 0   4 0$2-$H /f * ' , 4 @  `2  2 @   2H 0$M  4?A242 `8@2/`" 4"424" `" 4"4 24" `" `"` 2``2@ 㿘 H /f * '  a@ a @a@  a@a@" 0& F @!!$ t $ x` 2  `?"   ?"  `` ?`&`&`  ~ `" `` "`` &``" ( ŒH /f * '   @ `$ H 0 X 7 1$ X&` 2" $  $  P` $  `$ P``@$ `H 0`@?# @6{     n E   *  (>Ʌ(H( }@"@w@"h@@0b\@"@0\ v@"M~@"0Q [@M"@ *<28L"H" <282HD""=2? "32?.2H4(""H 0" "  " "H   H  tunread㿘   . * >ɱ* b  `ٰ @?# 6 H /f !)>H 0ưH 0 #H 0* ' )>@ !>!!y  @     $$$ ?$  @! @4@!!x  "@H 0>"8>5>Ͱ`S#pqŔH /f * ' T * ?6 H p@   "1T  $`@)T H /f * ' > !>  "@ 2` ?*  + H "`  `&H$` H 0 T * ` `    @8`2  8L $L㿐   . * >ɑ* `b   (>ݰ#p  ^ ! 4 H /f * ' >8 2H p@   $ 4 $$ $  ڈ   `԰ 7L 7'`I` D>"8 8 $  p$``,#p  ^p  4 H /f * '   5 H p@  $ $$ 4     l`` ’`  "L۔L {$L" "`( =`"` ?" `?"`0 >#  >  i /0SH /f * ' `` @` #`H p@X 7`I$X03" ``#@"``>h `, #`#`"h > > *`  H H $H`\ $\H p@㿘 . : * >ɑ* b  H /f`* '` `0  >ّH 0 bQ 0 H 0  H 0 bridge%d㿘 5>3>1>/>->+>)>  d $ $  b<$ ̐ ##$%ܒ8` 5 $ <$ $ |$ , 8$ , : ( 1 ٤ԁx>٤" H /0 * '0 >@ -0E@"w`@@"h` !@" 4 A@"Z` 0!C@F@"o`ܰ <@.=@ 00 !D@ "`8!OB@ʐ?@ 0H@ 0@ "!G@ 00 M@ON@ 0`ea6  "  ,  " 8  6 7 4 +ؒ @,/ 4'  4 47  |  w @/ 4 ?4 47  0Ӓ  a   2] > @"W   \~     8    0F&`&`&``&` &``&``̀`&@`" $`̐`&`4$ ,`da6 -`̀`&` @ޔ  2@` " ,`@``"``@"@@b`@ ] ``2`` @)? "  ,@2 `̀`" `2@`" `& `dLa6 ! "ڰ  ,@2ְ `̀`"Ұ `2@`"˰  &`@Uİ`d*a6  @da6  "  , 2  !"@  " 0`da6 @"&ca6 @$`0ca6 `$`~H x>!X|`}0po$ " 4@ 4 f@ϐ0b`cɒa6 \ "W  , H2Q `̀`"M `2@`"F  ? 8@  ! ` :`@ 3 ! /@{ *`ca6 #e "  ,  `̀``2@`  @@p H 0㿘 ,̀  2`"  "` "@ @6@Z\˒ & , 2 p`̐    ``2`, ) `',`Ш  ` @\/  `@V/ `'@x $ ,`` $?ܦ$` &``,`* &`hא` `  `, 2 ̀ 22  `  ` ` ``,`C `(AȪ   @/ؒ`@ / /  ./ / / / / / / / / / / /`$ @/ Y,`` `.?Ҩ .` &` Ȓ H,`* "` * @(A,`Ȩ @/ؒ`@ / /  ./ / / / / / / / / / / /`$ @/ ,`` .?Ҩ .` &` Ȓ,`* "* &` 㿘 4 @5H/` / Ѐ`2 4 Y   & БH 00  Б*"@ 4 @6 4H p@  >!X  |㿘 4 @ |\  @W 4 6 4㿘` S  ` ,H /f4 4* ' 4 @X @  " @ "O 4 ̀ >  4 @"6 6 T 沔 ל  2  P T  $ T  P $ P` `@$ `" ` 2" "` "  ` "` 4$2@  2 `֢H 00: 4 @2  ֕H 00- @  T`ֆ$ TH 00 P $ P ``@$ `&` 2" &  &  4 d&  @H 0 㿘 %>* *  *  *  @)H /* f '    $ $ " ?$ H 0 ߐё*㿈 4 @ ( `Ӓ> ! H!& t `& x& H \` ̐ & \  2 `  ؞    2`?#@     "` @g ` #   @ @2`0z`"&  4 q      ^b"  [  W  ^S  @ J  @< @@ t` # 2 d`2`4 d & dH /f * ' @H 00Q @ ̀ "  2   @ W09H /f * ' ``@  T`B& TH 00 P & P ``@& `&`` 2" $``$``4 d$``@H 0bridge_input(): no HDR㿘 "# ,]"`24>*! @Q c w沔 ֝  "  2   "   "   $ $  6  &     $  ̔ H /f * ' @& $ ԸH 0° 2" $$`$H 0>h "h L > >  *` '  ̀`"'` `8 2@`@:  `  @ `}&`@'  p@`2` 2  "   "   &&  ԡ S   &J 6 H /f * ' @& &"H 0,  2" $$`$H 0>h "h  > >   *`     e  㿘 ̀`j ``00 "a@` 24 # "X@4 @"T@ 6 T` " @@l "E@@ 沔 Ԋ  2 ` T 4& T `  @  " PӪ&@ P & P  `@& ` 2$ `h &`h$ `` 2" "``" `` "``4$2@@ @`2`|㿘H/` / Ѐ` 2  V  & Т  Б,``c"@@ Б,`@ '   @w  U  q G  , $ , ,  Е,`@ $  "` "  В@ S$ `@!   "`,` $``",` D`   @<  U  6   , $ , , `$$ `"!$`2Ϣ  @  U    , $ , , @ $@" $@$   &  H 0㿘H/` / Ѐ`@% Б* @  @   H 0  H 0  '  *`@*(  *  7o"@ 2 "@("@@"2` "  2 "@("@@"2`"  2  "@( "@@"2`"  #㿘H/` / Ѐ`>  @(8 БH 0@FHo o  % Т ,`@"`  "$ "@   V&   @瀢c$  Ѐ`    4  V| & БH 0㿘H/` / Ѐ`  H 00<*@$  2 `? * * "*  $ "  & V; ݖ$ БH 0 >!XD v 㿘H/` / Ѐ`/  Б*@`2 2 $ "  & U $    4  U & БH 0 㿘H/` / Ѐ`6А Б* @ . @$  2%`"  "` " & U    4  U & БH 0  ֐H 0 㿘H/` / Ѐ`,  Б*@2 $ "  & Ux $    4  Uh & БH 0p  H/` /`Ѐ`:- ` 6-  `Б,@ "+Т ,``* @ %`}Ӕ   }Δ  }ʔ  - /`@ *`/ | ( 2 -  ۨ$`Б- * &`H p@㿐` (?  (":  h 5@/!"݀@+%8, ` '  (?c*   #2  2 (   5(!"݀   㿘 "'      `@  2  ` 2  @  2  2  㿘  Rٔ  `"  }+ `( }' `!` ,  ,  ` , $ " &  ` , $ "&  㿘  "   & & Ti  2     & & T[  2 㿐>#`'P   ("%`    x?c* "P # (ܠ PҺ  Pҵ P` P`    'PP<  P2 <P    'P   P@O* `6  @P &P c 2"@ "  "s c`  @P 2 P`  ҳ {'PP` p `@O 56 P` 2P  `?"  P ?"  PP`?"`P  "  ϒ 'PP` P` P` "`P :  |%P` 2P  `?"  P ?"  PP`?"`P  "  _ 'PP` P` P` "`P   { PP   R` ` ` "``R`6`   R` `  "`  "``R`6`  @  @    ` "J2#  ` @ *J@@ `J@`  "  J   `?㿘   ` @Q  2  @>       2 `  @ `>U  8@ @ @   @ ` @  㿘@V``  ` `  "``V` 6` ` `     JJ@   ` p` 20j: "  :  ,@8 `V`4 `Q K``"` 쀊 `@ :@ `" ` T4. `2+ 0 @8  "       "   2  "  2  I    2 @2`  ` 8:`( 0 " ? 2"( * 㿘@`     JJ@ *J 5&&"  *`:  ` ` @ ``V`8`     $ $ &` &   @ 2& & &  rn_addmask: mask impossibly already in tree㿐>զ!D @ " @>"| , )>U>Ub! z`!@z$!->ՠ@ '>逤 !L? "?!$@4 6$|n , 6!"@@!$*@| !` !@ 2 T`RD  0O  I D@\`0 0!yΔ|7` >a` Q$ 0-   "  $L  :  `> *`J:`@ 2 +  + @8`6   .  @ 2  :  @ ` *  Mask for route not entered 㿘>ct  "ct  O  >`  @ݒ  6 .  " & & & $Non-unique normal route, mask not entered㿐  `    2` ` 8`=  ,:  @뀦``"T I  y   2 2$  , $ `2$`$` $ $? . & 6` $ `4  ` ` ,  @@8 T` 6 @`2*: ` "`T`&`@ 2 `I &``2`` *V: @ "$V &$&`P-`T:   0J  & E$ `T@@21,V: @&!4* "  ` >aX Ӑ ː 2<`V@&$ڐ&rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Mask㿘. 4  @@Ô" 2 `ǒ        2  `"T O > $`ah+  >ah# 8  ? 2" `T V 8 4,  V 2 > & 2>"@t""t2 > a   ` C 2 & 2& &   `  ```" >`2``"> "`a  r & & & &  & & `2"`"`" ["`   `2"`"`&3 V  @ 2$"@ >#t & ? " " `2##t>>ab "  &`& `& ` & `& `& " " ``2"`"`  # ` , , #㿘V  6   `2  "   V ` V  6    @   2  "  㿘  t9  LZ  "3 @8 t&>Ua`, `\ * " " @8*` 2`$`\`!>U# `># ` ># `># `>"># # ᄄ a`($@$` $`$`$` $`( rn_init: radix functions require max_keylen be set rn_initrn_init 2㿘> P !>Ֆ(D@4$!D2(!D`*`>`x~ 0)  K #>U $a>~j !D*@˒@ !D>Ua>U  " " *  **>Ր"|r >~M 㿘  > 7>  "$   `4 4 >cc $c" "c$  㿘  Ҧ"``"  "` "@MZ 㿘  `> 㿀>#'T'X'P'H'L H  @@2@ `" `@28  "  @ 2.  @u 2$沔 w  8p Ȟ  ܂    2 8S ȁ0 f  0t raw_usrreq㿘 `  k -    \ -J`U.`>"| €  M (I "F 9DC "> 9O0 ڐ8 1 8$ + 9 `€"  $ 1Ő    2   2   9u & >}(   @ \ x ͈ P  $ >㿘> P  "  $* €  2 㿘f> !P㿘` `@  `4  @ &``  2   h > !P*` '̑H / * &  `3 `€ .> +`T`"' 4!" 8ʒ     @њ̢ ' 8 $ 8  4"  ` 8 $ 8>ɒ`T`  "` ` А@ޒ $'Ԑ@ > H 0́㿘`  `@  `4  @ &h > !P*` '̑H / * !  `. `€ ")  2% `' 4!    @c̢ ' 8 $ 8 $ 4"  ` 8 $ 8  >ɒ`T`  "` `   А@i $'Ԑ@ɔ H 0́rtfreertfree 2rtfree: %p not freed (neg refs) 㿘 2 8>{ߐ#(?-& 8 4 )  >>{ϐ#0b쀢? "b>#@}>0@  @ D`" ` ?"`  J J ifafree㿘 2 >{ H ?J 0& pӐ  U 37 @  0@ 2   D Y 2 A`. "  " 4 (  4 `` >ɶ @ >ɢ `X>$ 4\  @  A  ``'@Y`>`T "`T $А@摒 $''''@  -㿘` `   C     8 2  8? & 8 4 "  D `  2 D  D " `   w "rtrequest delete㿘H /` * ! `> !P*`   / 2 "  P0=`0Ԑ 2` ̰   " `x>z# &`x  8 ?$ 8&`x`4`D ?` &`4`  >b쀧` "b'@`8  &`80" @ 2 H  4 D >  0  :   3  GД  z 7@嬒  $ 4$ @{ I~ j 7 @” T@r T 2   P 2 `  <$ T  2`  x " . IR IO ;   $` $ D` $ @@P$ PT$ TX$ X\$ \`$ `d$ dh$ hl$ lp$ pt$ t@$ |`` @`"`'@ 8 $ 8`  4@@ H 0㿘@ ?    ?    0 "  ?  @8  `(   G!  2 & (  & x & 0qkqeHɒ  x `8 ?"`8& x 4   & x 㿘@.@ @`.@ `     .@`@ *@ @丒"rtinit: wrong ifa (%p) was (%p) 㿐 ' `20      2 7 ђ "  8 D?@$ 8Úo 3m Ai T$ D   @􀤠Ä````   @ 8 ` $ 8 `2C`2@ "< 8?$ 8 ` 2  D T 2 D  <$ T D#>zE! D`  . ..groupۀ master.passwdqpasswd protocolspwd.db services spwd.dbdisktab.shadow disktab fstabۀ resolv.conf hostsۀ . ..chownqfsck_ffsBfsckqreboothaltqifconfigBinitqmknodqmountq mount_cd9660 mount_ffsB mount_nfsB mount_kernfsnewfsq mount_mfsBpingqrouteqshutdownBslattachBumount disklabelBdmesgqXdhclientB . .. chroot  installboot  sysctlwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: games:*:13: staff:*:20:root guest:*:31:root utmp:*:45: www:*:67: network:*:69: named:*:70: dialer:*:117: nogroup:*:32766: nobody:*:32767: root::0:0:daemon:0:0:Charlie &:/root:/bin/csh daemon:*:1:1::0:0:The devil himself:/root:/sbin/nologin operator:*:2:5::0:0:System &:/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source,,,:/:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico www:*:67:67::0:0:HTTP server:/var/www:/sbin/nologin named:*:70:70::0:0:BIND Name Service Daemon:/var/named:/sbin/nologin nobody:*:32767:32767::0:0:Unprivileged user:/nonexistent:/sbin/nologin root:*:0:0:Charlie &:/root:/bin/csh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source,,,:/:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico www:*:67:67:HTTP server:/var/www:/sbin/nologin named:*:70:70:BIND Name Service Daemon:/var/named:/sbin/nologin nobody:*:32767:32767:Unprivileged user:/nonexistent:/sbin/nologin # # Internet (IP) protocols # # $OpenBSD: protocols,v 1.11 2000/09/28 17:56:00 mickey Exp $ # # Updated based on RFC 1340, Assigned Numbers (July 1992). # See also http://www.iana.org/in-notes/iana/assignments/protocol-numbers # ip 0 IP # internet protocol, pseudo protocol number icmp 1 ICMP # internet control message protocol igmp 2 IGMP # Internet Group Management ggp 3 GGP # gateway-gateway protocol ipencap 4 IP-ENCAP # IP encapsulated in IP (officially ``IP'') st 5 ST # ST datagram mode tcp 6 TCP # transmission control protocol ucl 7 UCL # UCL egp 8 EGP # exterior gateway protocol igp 9 IGP # any private interior gateway bbn-rcc-mon 10 BBN-RCC-MON # BBN RCC Monitoring nvp-ii 11 NVP-II # Network Voice Protocol pup 12 PUP # PARC universal packet protocol argus 13 ARGUS # ARGUS emcon 14 EMCON # EMCON xnet 15 XNET # Cross Net Debugger chaos 16 CHAOS # Chaos udp 17 UDP # user datagram protocol mux 18 MUX # Multiplexing dcn-meas 19 DCN-MEAS # DCN Measurement Subsystems hmp 20 HMP # host monitoring protocol prm 21 PRM # Packet Radio Measurement xns-idp 22 XNS-IDP # Xerox NS IDP trunk-1 23 TRUNK-1 # Trunk-1 trunk-2 24 TRUNK-2 # Trunk-2 leaf-1 25 LEAF-1 # Leaf-1 leaf-2 26 LEAF-2 # Leaf-2 rdp 27 RDP # "reliable datagram" protocol irtp 28 IRTP # Internet Reliable Transaction iso-tp4 29 ISO-TP4 # ISO Transport Protocol class 4 netblt 30 NETBLT # Bulk Data Transfer Protocol mfe-nsp 31 MFE-NSP # MFE Network Services Protocol merit-inp 32 MERIT-INP # MERIT Internodal Protocol sep 33 SEP # Sequential Exchange Protocol 3pc 34 3PC # Third Party Connect Protocol idpr 35 IDPR # Inter-Domain Policy Routing Protocol xtp 36 XTP # Xpress Tranfer Protocol ddp 37 DDP # Datagram Delivery Protocol idpr-cmtp 38 IDPR-CMTP # IDPR Control Message Transport Proto idpr-cmtp 39 IDPR-CMTP # IDPR Control Message Transport il 40 IL # IL Transport Protocol ipv6 41 IPv6 # Internet Protocol version 6 sdrp 42 SDRP # Source Demand Routing Protocol sip-sr 43 SIP-SR # SIP Source Route sip-frag 44 SIP-FRAG # SIP Fragment idrp 45 IDRP # Inter-Domain Routing Protocol rsvp 46 RSVP # Reservation Protocol gre 47 GRE # General Routing Encapsulation mhrp 48 MHRP # Mobile Host Routing Protocol bna 49 BNA # BNA esp 50 IPSEC-ESP # Encap Security Payload ah 51 IPSEC-AH # Authentication Header i-nlsp 52 I-NLSP # Integrated Net Layer Security TUBA swipe 53 SWIPE # IP with Encryption nhrp 54 NHRP # NBMA Next Hop Resolution Protocol mobileip 55 MOBILEIP # MobileIP encapsulation skip 57 SKIP # SKIP ipv6-icmp 58 IPv6-ICMP # ICMP for IPv6 ipv6-nonxt 59 IPv6-NoNxt # No Next Header for IPv6 ipv6-opts 60 IPv6-Opts # Destination Options for IPv6 any 61 any # host internal protocol cftp 62 CFTP # CFTP any 63 any # local network sat-expak 64 SAT-EXPAK # SATNET and Backroom EXPAK kryptolan 65 KRYPTOLAN # Kryptolan rvd 66 RVD # MIT Remote Virtual Disk Protocol ippc 67 IPPC # Internet Pluribus Packet Core any 68 any # distributed file system sat-mon 69 SAT-MON # SATNET Monitoring visa 70 VISA # VISA Protocol ipcv 71 IPCV # Internet Packet Core Utility cpnx 72 CPNX # Computer Protocol Network Executive cphb 73 CPHB # Computer Protocol Heart Beat wsn 74 WSN # Wang Span Network pvp 75 PVP # Packet Video Protocol br-sat-mon 76 BR-SAT-MON # Backroom SATNET Monitoring sun-nd 77 SUN-ND # SUN ND PROTOCOL-Temporary wb-mon 78 WB-MON # WIDEBAND Monitoring wb-expak 79 WB-EXPAK # WIDEBAND EXPAK iso-ip 80 ISO-IP # ISO Internet Protocol vmtp 81 VMTP # Versatile Message Transport secure-vmtp 82 SECURE-VMTP # SECURE-VMTP vines 83 VINES # VINES ttp 84 TTP # TTP nsfnet-igp 85 NSFNET-IGP # NSFNET-IGP dgp 86 DGP # Dissimilar Gateway Protocol tcf 87 TCF # TCF igrp 88 IGRP # IGRP ospf 89 OSPFIGP # Open Shortest Path First IGP sprite-rpc 90 Sprite-RPC # Sprite RPC Protocol larp 91 LARP # Locus Address Resolution Protocol mtp 92 MTP # Multicast Transport Protocol ax.25 93 AX.25 # AX.25 Frames ipip 94 IPIP # Yet Another IP encapsulation micp 95 MICP # Mobile Internetworking Control Pro. scc-sp 96 SCC-SP # Semaphore Communications Sec. Pro. etherip 97 ETHERIP # Ethernet-within-IP Encapsulation encap 98 ENCAP # Yet Another IP encapsulation any 99 any # private encryption scheme gmtp 100 GMTP # GMTP pim 103 PIM # Protocol Independent Multicast ipcomp 108 IPComp # IP Payload Compression Protocol vrrp 112 VRRP # Virtual Router Redundancy Protocol reserved 255 Reserved # # $OpenBSD: services,v 1.23 2000/04/27 15:28:10 millert Exp $ # # Network services, Internet style # # Note that it is presently the policy of IANA to assign a single well-known # port number for both TCP and UDP; hence, most entries here have two entries # even if the protocol doesn't support UDP operations. # Updated from RFC 1340, ``Assigned Numbers'' (July 1992). Not all ports # are included, only the more common ones. # # from: @(#)services 5.8 (Berkeley) 5/9/91 # tcpmux 1/tcp # TCP port service multiplexer echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users daytime 13/tcp daytime 13/udp netstat 15/tcp qotd 17/tcp quote msp 18/tcp # message send protocol msp 18/udp # message send protocol chargen 19/tcp ttytst source chargen 19/udp ttytst source ftp-data 20/tcp # default ftp data port ftp 21/tcp ssh 22/tcp ssh 22/udp telnet 23/tcp # 24 - private smtp 25/tcp mail # 26 - unassigned time 37/tcp timserver time 37/udp timserver rlp 39/udp resource # resource location nameserver 42/tcp name # IEN 116 whois 43/tcp nicname domain 53/tcp nameserver # name-domain server domain 53/udp nameserver mtp 57/tcp # deprecated bootps 67/tcp # BOOTP server bootps 67/udp bootpc 68/tcp # BOOTP client bootpc 68/udp tftp 69/udp gopher 70/tcp # Internet Gopher gopher 70/udp rje 77/tcp netrjs finger 79/tcp www 80/tcp http # WorldWideWeb HTTP www 80/udp # HyperText Transfer Protocol link 87/tcp ttylink #kerberos 88/tcp krb5 # Kerberos v5 #kerberos 88/udp supdup 95/tcp # 100 - reserved hostnames 101/tcp hostname # usually from sri-nic iso-tsap 102/tcp tsap # part of ISODE. x400 103/tcp # ISO E-mail x400-snd 104/tcp csnet-ns 105/tcp cso-ns # also used by CSO name server csnet-ns 105/udp cso-ns rtelnet 107/tcp # Remote Telnet rtelnet 107/udp pop2 109/tcp postoffice # POP version 2 pop2 109/udp pop3 110/tcp # POP version 3 pop3 110/udp sunrpc 111/tcp portmap rpcbind sunrpc 111/udp portmap rpcbind auth 113/tcp authentication tap ident sftp 115/tcp uucp-path 117/tcp nntp 119/tcp readnews untp # USENET News Transfer Protocol ntp 123/tcp ntp 123/udp # Network Time Protocol loc-srv 135/tcp # NCS local location broker loc-srv 135/udp netbios-ns 137/tcp # NETBIOS Name Service netbios-ns 137/udp netbios-dgm 138/tcp # NETBIOS Datagram Service netbios-dgm 138/udp netbios-ssn 139/tcp # NETBIOS session service netbios-ssn 139/udp imap 143/tcp imap2 # Internet Message Access Proto imap 143/udp imap2 # Internet Message Access Proto bftp 152/tcp # Background File Transfer Proto snmp 161/udp # Simple Net Mgmt Proto snmp-trap 162/udp snmptrap # Traps for SNMP cmip-man 163/tcp # ISO mgmt over IP (CMOT) cmip-man 163/udp cmip-agent 164/tcp cmip-agent 164/udp xdmcp 177/tcp # X Display Mgr. Control Proto xdmcp 177/udp nextstep 178/tcp NeXTStep NextStep # NeXTStep window nextstep 178/udp NeXTStep NextStep # server bgp 179/tcp # Border Gateway Proto. bgp 179/udp prospero 191/tcp # Cliff Neuman's Prospero prospero 191/udp irc 194/tcp # Internet Relay Chat irc 194/udp smux 199/tcp # SNMP Unix Multiplexer smux 199/udp at-rtmp 201/tcp # AppleTalk routing at-rtmp 201/udp at-nbp 202/tcp # AppleTalk name binding at-nbp 202/udp at-echo 204/tcp # AppleTalk echo at-echo 204/udp at-zis 206/tcp # AppleTalk zone information at-zis 206/udp z3950 210/tcp wais # NISO Z39.50 database z3950 210/udp wais ipx 213/tcp # IPX ipx 213/udp imap3 220/tcp # Interactive Mail Access imap3 220/udp # Protocol v3 ulistserv 372/tcp # UNIX Listserv ulistserv 372/udp nnsp 433/tcp usenet # Network News Transfer https 443/tcp # secure http (SSL) photuris 468/tcp # Photuris Key Management photuris 468/udp isakmp 500/udp # ISAKMP key management submission 587/tcp msa # mail message submission submission 587/udp msa # mail message submission # # UNIX specific services # exec 512/tcp biff 512/udp comsat login 513/tcp who 513/udp whod shell 514/tcp cmd # no passwords used syslog 514/udp printer 515/tcp spooler # line printer spooler talk 517/udp ntalk 518/udp route 520/udp router routed # RIP efs 521/tcp # extended file name server timed 525/udp timeserver tempo 526/tcp newdate courier 530/tcp rpc conference 531/tcp chat netnews 532/tcp readnews netwall 533/udp # -for emergency broadcasts uucp 540/tcp uucpd # uucp daemon remotefs 556/tcp rfs_server rfs # Brunhoff remote filesystem # # From ``Assigned Numbers'': # #> The Registered Ports are not controlled by the IANA and on most systems #> can be used by ordinary user processes or programs executed by ordinary #> users. # #> Ports are used in the TCP [45,106] to name the ends of logical #> connections which carry long term conversations. For the purpose of #> providing services to unknown callers, a service contact port is #> defined. This list specifies the port used by the server process as its #> contact port. While the IANA can not control uses of these ports it #> does register or list uses of these ports as a convienence to the #> community. # ingreslock 1524/tcp ingreslock 1524/udp prospero-np 1525/tcp # Prospero non-privileged prospero-np 1525/udp nfsd 2049/udp nfs # NFS server nfsd 2049/tcp nfs # NFS server rfe 5002/tcp # Radio Free Ethernet rfe 5002/udp # Actually uses UDP only # # # Kerberos (Project Athena/MIT) services # Note that these are for Kerberos v4, and are unofficial. Sites running # v5 should comment these out and uncomment the v5 entries above. # kerberos-sec 88/udp # Kerberos secondary port UDP kerberos-sec 88/tcp # Kerberos secondary port TCP klogin 543/tcp # Kerberos authenticated rlogin kshell 544/tcp krcmd # and remote shell ekshell 545/tcp # Kerberos encrypted remote shell -kfall ekshell2 2106/tcp # What U of Colorado @ Boulder uses? kerberos-adm 749/tcp # Kerberos `kadmin' (v5) kerberos-iv 750/udp kdc kerberos # Kerberos authentication--udp kerberos-iv 750/tcp kdc kerberos # Kerberos authentication--tdp kerberos_master 751/udp kerberos-master # Kerberos authentication kerberos_master 751/tcp kerberos-master # Kerberos authentication krb_prop 754/tcp # Kerberos slave propagation krbupdate 760/tcp kreg # BSD Kerberos registration kpasswd 761/tcp kpwd # BSD Kerberos `passwd' kpop 1109/tcp # Pop with Kerberos eklogin 2105/tcp # Kerberos encrypted rlogin rkinit 2108/tcp # Kerberos remote kinit kx 2111/tcp # X over kerberos kip 2112/tcp # IP over kerberos kauth 2120/tcp # Remote kauth # # AFS Services # afs3-fileserver 7000/udp # AFS fileserver afs3-callback 7001/udp # AFS callback server afs3-prserver 7002/udp # AFS protection server afs3-vlserver 7003/udp # AFS volumelocation server afs3-kaserver 7004/udp # AFS kerberos authenication server afs3-volser 7005/udp # AFS volume server afs3-errors 7006/udp # AFS error server ? afs3-bos 7007/udp # AFS basic over-see server ? afs3-update 7008/udp # ? afs3-rmtsys 7009/udp # ? # # Unofficial services # supfilesrv 871/tcp # SUP server rsync 873/tcp # rsync server cddb 888/tcp # Audio CD Database supfiledbg 1127/tcp # SUP debugging radius 1645/udp # radius authentication radacct 1646/udp # radius accounting webster 2627/tcp # Network dictionary webster 2627/udp canna 5680/tcp # Kana->Kanji server icb 7326/tcp # Internet Citizen's Band hunt 26740/udp # hunt(6) # # Appletalk # rtmp 1/ddp # Routing Table Maintenance Protocol nbp 2/ddp # Name Binding Protocol echo 4/ddp # AppleTalk Echo Protocol zip 6/ddp # Zone Information Protocol  @ :    @@: LI@@P^<@`bT U: 7 ``(0A: v: 9/: 9/ MBA: u*: 8C: 8C 5A: G: 9: 9 z : 7n: 7n: 7n../../instbinH3: !`: ": " S: % : % : % c: (: (: ( q[mV: +: ,: ,  kP: /q: 3%: 3% h p x PEiT: 6: 7n: 7n EX: :i: :  PA : 6=: 6=: 6=../../instbin : 9: 9: 9../../instbinZa: /q: /q: 5 R N!: 0G: 0G: 5 R* zHa: 2: 2: 5 R !s(!: 4s: 4s: 5 R*!yZ5a: 6: 6: 5 R "ģA#!: 8C: 8C: 5 R*"Aa: ;3: ;3: 5 R #@!: : : 5 R*#)a: : : 5 R $4!: Ĵ: Ĵ: 5 R*$}a: ': ': 5 R %^i!: X;: X;: 5 R*%3Qta:  S+:  S+: 5 R &'q!:  X:  X: 5 R*&¡a: 沀: 沀: 5 R 'm!: ߀: ߀: 5 R*'a: : : 5 R (Zs7!: C: C: 5 R*(YBFIa: W: W: 5 R ){!: p: p: 5*)y)a: t: t: 5 R *M,ӛ!: : : 5**=]a: : : 5 R +!:  /:  /: 5*+݈Z a: ": ": 5 R ,A!: $[܀: $[܀: 5*,9a: &6: &6: 5 R -~!: 'c: 'c: 5*-a: *Q: *Q: 5 R .H!: ,: ,: 5*.Pra: .}: .}: 5 R / U !: /: /: 5*/?a: : :  0sZhr!: À: À: *02a: ,: ,:  1!: ]J: ]J: *1ca: X;: X;:  2g_!:  h:  h: *2˗a:  :  :  3E!:  :  : *3Gy{a: v: v:  4!: : : *4 ia: C: C:  5ϖ!:  :  : *5msa: p: p:  69۶>!: G: G: *6Ja: 8: 8:  7Q:!: e: e: *7Qva:  /:  /:  8 !: !: !: *8)a: $[܀: $[܀:  9 >!: &%: &%: *9Ԑģa: ) : ) :  :ij!: *Q: *Q: *:dra: ,: ,:  ;;'!: .}: .}: *;~@ a: 05: 05:  <:'!: 2b: 2b: *<~a: 4s: 4s:  =de!: 6=: 6=: *=}a: 8ـ: 8ـ:  >,!: 9: 9: *>DIa: 1-: 1-:  ?ESl!: bZ: bZ: *?a: N: N: ܓOm!: I: I: ܓ ka: z9: z9: ܓӞ!: f: f: ܓ Ea:  :  : ܓ1O!: ׄ: ׄ: ܓ ._a: 9: 9: ܓj!: k : k : ܓ ka: e: e: ܓSy!: (: (: ܓ r\ia: !: !: ܓk!: #F: #F: ܓ 3q!a: &%: &%: ܓz!: 'V: 'V: ܓ 5a: *Q: *Q: ܓhF!: +: +: ܓ 8a: -D: -D: ܓJ!: /: /: ܓ N)a: 2b: 2b: ܓ Ɋ`!: 3B: 3B: ܓ Qna: 5: 5: ܓ =!: 7n: 7n: ܓ Da: 9: 9: ܓ ?C!: ;3: ;3: ܓ  a: bZ: bZ: ܓ Z^!: : : ܓ Ya: : : ܓ !3!: : : ܓ a:  !:  !: ܓz!:  S+:  S+: ܓ .va: N: N: ܓ!: I: I: ܓ 7a: k : k : $[܀ڛYL!: 8: 8: $[܀ | a: (: (: $[܀*o-!:  U:  U: $[܀ mca: #F: #F: $[܀3Ln:!: &6: &6: $[܀ Pa: ) : ) : $[܀N!: *Q: *Q: $[܀ la: ,: ,: $[܀IE!: .}: .}: $[܀ 2Oa: 05: 05: $[܀I!: 2b: 2b: $[܀ ?a: 5 R: 5 R: $[܀!: 6=: 6=: $[܀ Цa: 8ـ: 8ـ: $[܀ra!: :i: :i: $[܀ (eba: 1-: 1-: $[܀*,!: bZ: bZ: $[܀ -ga: ]J: ]J: $[܀Sd!: ': ': $[܀  Ta:  h:  h: $[܀؜<!:  :  : $[܀ 7a:  :  : $[܀n!: 沀: 沀: $[܀ aʣa: I : I : $[܀N!: : : $[܀ a: u*: u*: $[܀kc!: W: W: $[܀ I^a: G: G: $[܀vqW!: t: t: $[܀ 0Za: 4΀: 4΀: $[܀!: : : $[܀ /a: *T: *T: 1xˀ IK!: ,: ,: 1xˀ ufa: /q: /q: 1xˀ!S!: 0G: 0G: 1xˀ !-a: 2: 2: 1xˀ"P<!: 4s: 4s: 1xˀ "~a: 6: 6: 1xˀ#mg!: 8C: 8C: 1xˀ #N7a: ;3: ;3: 1xˀ$lO!: : : 1xˀ $(Va: : : 1xˀ%%!: Ĵ: Ĵ: 1xˀ %< Pa: ': ': 1xˀ&?Qx!: X;: X;: 1xˀ &߷a:  S+:  S+: 1xˀ';V!:  X:  X: 1xˀ '<ja: 沀: 沀: 1xˀ(d!: v: v: 1xˀ (O\$a: : : 1xˀ)Ū!: C: C: 1xˀ )!1a: W: W: 1xˀ*.!: p: p: 1xˀ *_ca: t: t: 1xˀ+T"!: : : 1xˀ +W?a: : : 1xˀ,F]!:  /:  /: 1xˀ , a: ": ": 1xˀ-!: $[܀: $[܀: 1xˀ -!)ta: &6: &6: 1xˀ.hq!: 'c: 'c: 1xˀ .a: *T: *T: 1xˀ/G|!: ,: ,: 1xˀ //57a: 8C: 8C: Ĵ0!: 9: 9: Ĵ 05؅a: : : Ĵ1ӧ!: À: À: Ĵ 1a: Ĵ: Ĵ: Ĵ2K:yX!: : : Ĵ 2o~a: X;: X;: Ĵ3\!: !: !: Ĵ 3K9‰a: X: X: Ĵ4b!: : : Ĵ 4a.a: v: v: Ĵ5dm3!: : : Ĵ 5Lʉa: C: C: Ĵ6M*%w!:  :  : Ĵ 6[ia: p: p: Ĵ7h|!: G: G: Ĵ 7Ia: 8: 8: Ĵ8'!: e: e: Ĵ 8{U"a: /: /: Ĵ9o !: ": ": ]J 9ka: $s: $s: Ĵ: B!: &6: &6: ]J :wfa: ) : ) : Ĵ;^!: *T: *T: ]J ;\a: -L: -L: Ĵ<f!: .}: .}: ]J <-a: 1xˀ: 1xˀ: Ĵ= !: 2: 2: ]J =Ha: 5: 5: Ĵ>Z!: 6: 6: ]J >CY{a: 98p: 98p: Ĵ? 4~J!: ;3: ;3: ]J ?Jfa: I : I : % !: z9: z9: % :,q<a: ܓ: ܓ: %  !: W: W: % :Nꝃa: : : % !H!: t: t: % :&a: e: e: % !: /: /: % :KOza: #*: #*: % V!: $s: $s: % :6$a: 'c: 'c: %  !: )': )': % :ha: ,: ,: % #!: /q: /q: % :=oa: 2b: 2b: % ﶣ!: 3%: 3%: % :Dxga: 6: 6: % <_[!: 8ـ: 8ـ: % : ]a: : : %  d!: bZ: bZ: % : Elua: ]J: ]J: %  'RH!: ': ': % : a: !: !: %  `!: ;3: ;3: р!: : : р!: : : рA3a: ߀: ߀: (  a: : : ( a:  :  : ( [Na: : : ( #i!: : : (dh!: : : (/7!: !: !: ( !: $s: $s: (Ea: 0G: 0G: bZRa: 3%: 3%: bZ5 !: 7n: 7n: bZja  n}www*CCHTTP server/var/www/sbin/nologin2\Wnamed*FFBIND Name Service Daemon/var/named/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin3FaSanobody*Unprivileged user/nonexistent/sbin/nologin2bin*Binaries Commands and Source,,,//sbin/nologin1binrroot*daemonCharlie &/root/bin/csh2root*daemonCharlie &/root/bin/csh3e` daemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody ul+&~==operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonroot*daemonCharlie &/root/bin/csh1root \Vto$$bin*Binaries Commands and Source,,,//sbin/nologin2www*CCHTTP server/var/www/sbin/nologin3Cbin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2a  n}www*CCHTTP server/var/www/sbin/nologin2\Wnamed*FFBIND Name Service Daemon/var/named/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin3FaSanobody*Unprivileged user/nonexistent/sbin/nologin2bin*Binaries Commands and Source,,,//sbin/nologin1bintrootdaemonCharlie &/root/bin/csh2rootdaemonCharlie &/root/bin/csh3e` daemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody vm,'> >operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/csh1root \Vto$$bin*Binaries Commands and Source,,,//sbin/nologin2www*CCHTTP server/var/www/sbin/nologin3Cbin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2#!/bin/sh # $OpenBSD: install.sub,v 1.158 2000/10/09 22:47:22 naddy Exp $ # $NetBSD: install.sub,v 1.5.2.8 1996/09/02 23:25:02 pk Exp $ # # Copyright (c) 1997,1998 Todd Miller, Theo de Raadt # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Todd Miller and # Theo de Raadt # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation/upgrade script - common subroutines. ROOTDISK= # filled in below VERSION=28 VERSION_MAJOR=$(( $VERSION / 10 )) VERSION_MINOR=$(( $VERSION % 10 )) export VERSION VERSION_MAJOR VERSION_MINOR # extra "site" set can be provided by person doing install ALLSETS="base etc misc comp man game xbase xshare xfont xserv site" # install UPGRSETS="base misc comp man game xbase xshare xfont xserv site" # upgrade SNAPSETS="bin dev etc games man misc sbin \ usr.bin usr.binutils usr.games usr.include \ usr.lib usr.libexec usr.misc usr.sbin usr.share var" THESETS= # one of the above # Path searched for sets by install_sets on the local filesystems local_sets_dir= # decide upon an editor if [ "X$EDITOR" = X ]; then if [ -x /usr/bin/vi ]; then EDITOR=vi else EDITOR=ed fi export EDITOR fi # Please don't use the 1 of n form below, good idea, wrong implementation! # get a reponse with default[s] getresp() { local _shell_aware=0 local _no_shell=0 # -s option means exit after a shell (caller is shell-aware) if [ "$1" = "-s" ]; then _shell_aware=1 shift fi # -n option means don't try to run shell commands if [ "$1" = "-n" ]; then _no_shell=1 shift fi set -o noglob valid="false" while [ "X$valid" = "Xfalse" ]; do read resp if [ ${_no_shell} -eq 1 ]; then test -z "$resp" && resp=$1 else case "$resp" in "") resp=$1 ;; !) echo "Type 'exit' to return to install." sh test $_shell_aware -eq 0 && continue ;; !*) eval ${resp#?} test $_shell_aware -eq 0 && continue ;; esac fi if [ $# -gt 1 ]; then for i in $@; do if [ "X$resp" = "X$i" ]; then valid="true" fi done else valid="true" fi if [ "X$valid" = "Xfalse" ]; then echo "Try again: Enter one of [$@]" fi done set +o noglob } isin() { # test the first argument against the remaining ones, return succes on a match local _a=$1 shift while [ $# != 0 ]; do if [ "$_a" = "$1" ]; then return 0; fi shift done return 1 } addel() { # add first argument to list formed by the remaining arguments # adds to the tail if the element does not already exist local _a=$1 _seen= shift while [ $# != 0 ]; do echo "$1" if [ "$_a" = "$1" ]; then _seen="yes" fi shift done if [ "X$_seen" = "X" ]; then echo "$_a" fi } rmel() { # remove first argument from list formed by the remaining arguments local _a=$1 shift while [ $# != 0 ]; do if [ "$_a" != "$1" ]; then echo "$1" fi shift done } cutword () { # read lines on stdin, return Nth element of each line, like cut(1) local _a _n _oifs="$IFS" # optional field separator case "$1" in -t?*) IFS=${1#-t}; shift;; esac _n=$1 while read _a; do set -- $_a test "$1" = "" && break eval echo \$$_n done IFS="$_oifs" } cutlast () { # read a line of data, return last element. Equiv. of awk '{print $NF}'. local _a _oifs="$IFS" # optional field separator case "$1" in -t?*) IFS=${1#-t}; shift;; esac read _a; set -- $_a IFS="$_oifs" if [ "$1" = "" ]; then return; fi while [ "$#" -gt 10 ]; do shift 10; done eval echo \$$# } firstchar () { # return first character of argument local _a=$1 while [ ${#_a} != 1 ]; do _a=${_a%?} done echo $_a } basename () { local _oifs if [ "$1" = "" ]; then return; fi _oifs="$IFS" IFS="/" set -- $1 IFS="$_oifs" while [ "$#" -gt 10 ]; do shift 10; done eval echo \$$# } isnumeric() { local _a=$1 while [ ${#_a} != 0 ]; do case $_a in [0-9]*) ;; *) echo 0; return;; esac _a=${_a#?} done echo 1; return } get_ifdevs() { # return available network devices /sbin/ifconfig -a | egrep -v '^([[:space:]]|(lo|enc|gre|ppp|sl|tun|bridge)[[:digit:]])' | cutword -t: 1 } bsort() { local _l _a=$1 if [ $# == 0 ]; then return fi if [ $# == 1 ]; then echo $1; return fi shift while [ $# != 0 ]; do local _b=$1 if [[ "$_a" != "$_b" ]] ; then if [[ "$_a" > "$_b" ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi shift done echo -n "$_a "; bsort $_l } dir_has_sets() { # return true when the directory $1 contains a set for $2...$n local _dir=$1 _file shift for _file in $* do if [ -f $_dir/${_file}${VERSION}.tar.gz ]; then return 0 fi # Try for stupid msdos convention if [ -f $_dir/${_file}${VERSION}.tgz ]; then return 0 fi # Special check for kernel if [ $_file = "kernel" -a -f $_dir/bsd ]; then return 0 fi done return 1 } list_has_sets() { # return true when the list $1 contains a set, given dir $2 for $3...$n local _list=$1 _file shift for _file in $* do if isin ${_file}${VERSION}.tar.gz $_list; then return 0 fi # Try for stupid msdos convention if isin ${_file}${VERSION}.tgz $_list; then return 0 fi # Special check for kernel if test $_file = "kernel" && isin bsd $_list; then return 0 fi done return 1 } ftp_list_files() { # log in via ftp to host $1 as user $2 with password $3 # and return a list of all files in the directory $4 on stdout local _host=$1 _user=$2 _pass=$3 _dir=$4 shift; shift; shift; shift ftp ${_ftp_active} -V -n $_host << __ptf user $_user $_pass cd $_dir ls quit __ptf } get_localdir() { # $1 is relative mountpoint local _mp=$1 _dir= while : ; do echo -n "Enter the pathname where the sets are stored [$_dir] " getresp "$_dir" _dir=$resp # Allow break-out with empty response if [ -z "$_dir" ]; then echo -n "Are you sure you don't want to set the pathname? [n] " getresp "n" case "$resp" in y*|Y*) break ;; *) continue ;; esac fi if dir_has_sets "$_mp/$_dir" $THESETS then local_sets_dir="$_mp/$_dir" break else cat << __EOT The directory \"$local_sets_dir\" does not exist, or does not hold any of the upgrade sets. __EOT echo -n "Re-enter pathname? [y] " getresp "y" case "$resp" in y*|Y*) ;; *) local_sets_dir= break ;; esac fi done } getanotherdisk() { cat << __EOT Now you can select another disk to initialize. (Do not re-select a disk you have already entered information for). Available disks are: __EOT _DKDEVS=`md_get_diskdevs` echo "$_DKDEVS" echo echo -n "Which one? [done] " getresp "" if [ "X${resp}" = "X" ]; then DISK=done elif [ "X${resp}" = "Xdone" ]; then DISK=done elif isin $resp $_DKDEVS ; then DISK="$resp" else echo echo "The disk $resp does not exist." DISK= fi } getrootdisk() { cat << __EOT The installation program needs to know which disk to consider the root disk. Note the unit number may be different than the unit number you used in the boot program (especially on a PC with multiple disk controllers). Available disks are: __EOT local _defdsk; _DKDEVS=`md_get_diskdevs` _defdsk=`echo $_DKDEVS | cutlast` if [ "${_defdsk}" != "${_DKDEVS}" ]; then _defdsk= fi echo "$_DKDEVS" echo echo -n "Which disk is the root disk? [${_defdsk}] " getresp "${_defdsk}" if isin $resp $_DKDEVS ; then ROOTDISK="$resp" else echo echo "The disk $resp does not exist." ROOTDISK= fi } addhostent() { # $1 - IP address # $2 - symbolic name # Create an entry in the hosts table. If no host table # exists, create one. If the symbolic name already exists, # replace its entry. if [ ! -f /tmp/hosts ]; then echo "127.0.0.1 localhost" > /tmp/hosts fi sed "/ $2.$FQDN $2\$/d" < /tmp/hosts > /tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$1 $2.$FQDN $2" >> /tmp/hosts } addifconfig() { # $1 - interface name # $2 - interface symbolic name # $3 - interface IP address # $4 - interface netmask # $5 - (optional) interface media directives # Create a hostname.* file for the interface. if [ "$3" = "dhcp" ]; then echo "dhcp NONE NONE NONE $5" > /tmp/hostname.$1 addhostent 127.0.0.1 $2 else echo "inet $3 $4 NONE $5" > /tmp/hostname.$1 addhostent $3 $2 fi } configurenetwork() { local _ifsdone= _ifs _ouranswer= _reprompt=1 _IFS=`get_ifdevs` resp= # force at least one iteration while [ "X${resp}" != X"done" ]; do if [ $_reprompt = 1 ]; then cat << __EOT You may configure the following network interfaces (the interfaces marked with [X] have been succesfully configured): __EOT for _ifs in $_IFS; do if [ "X${_ouranswer}" = "X" ]; then _ouranswer=$_ifs fi if isin $_ifs $_ifsdone ; then echo -n " [X] " else echo -n " [ ] " fi echo $_ifs done echo fi echo -n "Configure which interface? (or, enter 'done') [$_ouranswer] " getresp "$_ouranswer" case "$resp" in "done") ;; "") _reprompt=0 ;; *) _ifs=$resp _ouranswer="done" if isin $_ifs $_IFS ; then if configure_ifs $_ifs ; then _ifsdone="$_ifs $_ifsdone" else _ouranswer= fi else echo "Invalid response: \"$resp\" is not in list" fi _reprompt=1 ;; esac done } configure_ifs() { local _up _if_name=$1 _if_ip _if_mask local _if_symname _if_extra _hostname local _dhcp_prompt set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` _up=$1 _if_ip=$2 _if_mask=$3 if [ $_up = "UP" ]; then ifconfig $_if_name delete down fi if [ ! -x /sbin/dhclient ]; then echo "DHCP install not supported" echo else _dhcp_prompt=" (or 'dhcp')" fi # Get IP address resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "IP address${_dhcp_prompt} ? [$_if_ip] " getresp "$_if_ip" if [ ! -x /sbin/dhclient -a "X$resp" == "Xdhcp" ]; then resp= fi _if_ip=$resp done # Get symbolic name _hostname=`hostname` resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Symbolic (host) name? [$_hostname] " getresp "$_hostname" _if_symname=$resp done # Get netmask if [ "$_if_ip" != "dhcp" ]; then resp= if [ "X${_if_mask}" = X"" ]; then _if_mask=255.255.255.0 fi while [ "X${resp}" = X"" ]; do echo -n "Netmask ? [$_if_mask] " getresp "$_if_mask" _if_mask=$resp done fi if [ -n "`ifconfig -m ${_if_name} | sed -n '/media/p'`" ]; then echo "Your use of the network interface may require non-default" echo "media directives. The default media is:" ifconfig -m ${_if_name} | sed -n ' /supported/D /media:/p' echo "This is a list of supported media:" ifconfig -m ${_if_name} | sed -n ' /media:/D s/^ // /media/p' echo "If the default is not satisfactory, and you wish to use another" echo "media, copy that line from above (e.g. \"media 100baseTX\")" echo -n "Media directives? [$_if_extra] " getresp "$_if_extra" if [ "X${resp}" != X"" ]; then _if_extra=$resp fi fi # Configure the interface. If it # succeeds, add it to the permanent # network configuration info. if [ "$_if_ip" = "dhcp" ]; then ifconfig ${_if_name} down ${_if_extra} cat > /etc/dhclient.conf << __EOT initial-interval 1; send host-name "$_hostname"; request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT dhclient -1 ${_if_name} set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` if [ $1 = "UP" -a $2 = "0.0.0.0" ]; then echo "hostname-associated DHCP attempt for $_if_name failed..." ifconfig $_if_name delete down cat > /etc/dhclient.conf << __EOT initial-interval 1; request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT dhclient -1 ${_if_name} set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` if [ $1 = "UP" -a $2 = "0.0.0.0" ]; then echo "free-roaming DHCP attempt for $_if_name failed." ifconfig $_if_name delete down return 1 else echo "DHCP attempt for $_if_name successful." addifconfig ${_if_name} ${_if_symname} ${_if_ip} return 0 fi else echo "DHCP configuration of $_if_name successful." addifconfig ${_if_name} ${_if_symname} ${_if_ip} return 0 fi else ifconfig ${_if_name} down if ifconfig ${_if_name} inet \ ${_if_ip} \ netmask ${_if_mask} ${_if_extra} up ; then addifconfig ${_if_name} ${_if_symname} ${_if_ip} ${_if_mask} "${_if_extra}" return 0 fi fi return 1 } # Much of this is gratuitously stolen from /etc/netstart. enable_network() { # Set up the hostname. if [ ! -f /mnt/etc/myname ]; then echo "ERROR: no /etc/myname!" return 1 fi hostname=`cat /mnt/etc/myname` hostname $hostname # configure all the interfaces which we know about. ( tmp="$IFS" IFS="$IFS." set -- `echo /mnt/etc/hostname*` IFS=$tmp unset tmp while [ $# -ge 2 ] ; do shift # get rid of "hostname" ( read af name mask bcaddr extras read dt dtaddr if [ ! -n "$name" ]; then echo "/etc/hostname.$1: invalid network configuration file" exit fi cmd="ifconfig $1 $af $name " if [ "${dt}" = "dest" ]; then cmd="$cmd $dtaddr"; fi if [ -n "$mask" ]; then cmd="$cmd netmask $mask"; fi if [ -n "$bcaddr" -a "X$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr"; fi cmd="$cmd $extras" $cmd ) < /mnt/etc/hostname.$1 shift done ) # set the address for the loopback interface ifconfig lo0 inet localhost # use loopback, not the wire route add $hostname localhost # /etc/mygate, if it exists, contains the name of my gateway host # that name must be in /etc/hosts. if [ -f /mnt/etc/mygate ]; then route delete default > /dev/null 2>&1 route add default `cat /mnt/etc/mygate` fi # enable the resolver, if appropriate. if [ -f /mnt/etc/resolv.conf ]; then _resolver_enabled="TRUE" cp /mnt/etc/resolv.conf /tmp/resolv.conf.shadow fi # Display results... echo "Network interface configuration:" ifconfig -am echo if [ "X${_resolver_enabled}" = X"TRUE" ]; then route show echo echo "Resolver enabled." else route -n show echo echo "Resolver not enabled." fi return 0 } # Print the selector and get a response # The list of sets is passed in as $1, sets $resp get_selection() { local _next= _f _sets=$1 for _f in $_sets ; do if isin $_f $_setsdone ; then echo -n " [X] " _next= else echo -n " [ ] " if [ -z "$_next" ]; then _next=$_f fi fi echo $_f done # Get the name of the file. echo -n "File name? [$_next] " getresp "$_next" } # Do globbing on the selection and parse +/-, sets _get_files and _setsdone # (which must exist in the local namespace) as side effects. glob_selection() { local _selection="$1" _parent_dir="$2" _sets="$3" local _action _matched _tfile _f if [ "X${_selection}" = X"" ]; then return fi # Change +/- into add/remove _action=add case "$_selection" in +*) _selection="${_selection#?}" ;; -*) _selection="${_selection#?}" _action=remove ;; esac # Major hack to allow the user to select globbing patterns set -o noglob if [ X"$_selection" = X"all" ]; then _selection=* fi _tfile=/tmp/install_case.$$ # safe in single user mode cat >$_tfile << OOF case \$_f in $_selection) # Add/remove file to extraction list if [ "\$_action" = "add" ]; then _get_files=\`addel \${_f} \${_get_files}\` _setsdone=\`addel \${_f} \${_setsdone}\` elif [ "\$_action" = "remove" ]; then _get_files=\`rmel \${_f} \${_get_files}\` _setsdone=\`rmel \${_f} \${_setsdone}\` else echo "Unknown action: \$_action" fi _matched=\$(( \$_matched + 1 )) ;; esac OOF set +o noglob # Eww. _matched=0 for _f in $_sets; do . $_tfile done rm -f $_tfile if [ $_matched -eq 0 ]; then echo "File $_parent_dir/$_selection does not exist. Check to make" echo "sure you entered the information properly or enter 'list' for a file list." fi } install_url() { # Get several parameters from the user, and xfer # files from the server. # Note: _ftp_server_ip, _ftp_server_dir, _ftp_server_login, # _ftp_server_password, and _ftp_active must be global. local _sets _kernel _f _file_list _get_files _failed_files _osetsdone local _url_type _url_base _reuse _minpat # Parse arguments, shell style while test $# != 0; do case "$1" in -ftp) _url_type=ftp ;; -html) _url_type=html ;; -reuse) _reuse=1 ;; -minpat) shift; _minpat="$1" ;; esac shift done if [ X"${_minpat}" = X ]; then _minpat='base*.tar.gz|base*.tgz|man*.tar.gz|man*.tgz|etc*.tar.gz|etc*.tgz|bsd' fi echo echo "This is an automated ${_url_type}-based installation process. You will be asked" echo "questions and then the files will be retrieved iteratively via ftp(1)." echo # Reuse old values w/o prompting for anything? if [ X"$_reuse" = X"1" ]; then _reuse= if eval test X"\$_installed_via_${_url_type}" = X"1"; then echo -n "Use values from previous ${_url_type} install? [y] " getresp y case "$resp" in y*|Y*) _reuse=1;; esac fi fi if [ X"$_reuse" = X ]; then # Proxy the connections? if [ "X${_proxy_host}" = X"" ]; then _proxy_host=none fi echo -n "HTTP/FTP proxy URL? (e.g. \"http://proxy:8080\", or \"none\") [${_proxy_host}] " getresp "${_proxy_host}" if [ "X${resp}" = X"none" ]; then unset _proxy_host ftp_proxy http_proxy else _proxy_host=$resp export ftp_proxy=${_proxy_host} export http_proxy=${_proxy_host} fi if [ "${_url_type}" = "ftp" -a "X$ftp_proxy" = "X" ]; then # Use active mode ftp? (irrelevant if using a proxy) case "${_ftp_active}" in -A) resp=y ;; *) resp=n ;; esac echo "By default, ftp will attempt a passive connection and fall back to a normal" echo "(active) connection if that doesn't work. However, there are some very" echo "old ftp servers that claim to support passive mode, but really do not." echo "In this case, you should explicitly request an active session." echo -n "Do you want to use active ftp? [${resp}] " getresp "${resp}" case "$resp" in y*|Y*) _ftp_active=-A ;; *) unset _ftp_active ;; esac fi # Provide a list of possible servers test -z "$_ftp_getlist" && _ftp_getlist=y echo -n "Do you want a list of potential ${_url_type} servers? [${_ftp_getlist}] " getresp $_ftp_getlist case "$resp" in n*|N*) _ftp_getlist=n ;; *) _ftp_getlist=y ftphost=129.128.5.191 if [ "X${_resolver_enabled}" = X"TRUE" ]; then ftphost=ftp.openbsd.org fi ftp ${_ftp_active} -V -a -o /tmp/ftplist ftp://${ftphost}/pub/OpenBSD/${VERSION_MAJOR}.${VERSION_MINOR}/ftplist > /dev/null cat /tmp/ftplist | grep "^${_url_type}:" | cat -n | less -XE ;; esac # Get server IP address resp= # force one iteration while [ "X${resp}" = X"" ]; do if [ -f /tmp/ftplist ]; then eval echo -n "Server IP address, hostname, or list#? [\$_${_url_type}_server_ip]\ " else eval echo -n "Server IP address, or hostname? [\$_${_url_type}_server_ip]\ " fi eval getresp "\$_${_url_type}_server_ip" if [ "X$resp" = "X?" -a -f /tmp/ftplist ]; then cat /tmp/ftplist | grep "^${_url_type}:" | cat -n | less -XE resp= elif [ -n "$resp" -a `isnumeric $resp` -eq 1 -a ${resp:-0} -ge 1 \ -a -f /tmp/ftplist ]; then maxlines=`grep "^${_url_type}:" /tmp/ftplist | cat -n | sed -n -e '$p' | cutword 1` if [ $maxlines -lt $resp ]; then echo "There is no ${resp}th line in the list." resp= continue fi tline=`grep "^${_url_type}:" /tmp/ftplist | sed -n -e "${resp}p"` url=`echo $tline | sed -e "s/^${_url_type}:\/\///" | cutword -t' ' 1 | cutword -t' ' 1` host=`echo $url | cutword -t/ 1` path=`echo $url | sed -e "s/^${host}\///"` path="${path}/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH}" eval _${_url_type}_server_ip=$host eval _${_url_type}_server_dir=$path resp= # do it again, just to double check echo "Using $tline" else eval _${_url_type}_server_ip="$resp" fi done # Get server directory if [ "${_url_type}" = "ftp" -a "X${_ftp_server_dir}" = X"" ]; then # Default ftp dir _ftp_server_dir="pub/OpenBSD/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH}" fi resp= # force one iteration while [ "X${resp}" = X"" ]; do eval echo -n "Server directory? [\$_${_url_type}_server_dir]\ " eval getresp "\$_${_url_type}_server_dir" eval _${_url_type}_server_dir=$resp done if [ "${_url_type}" = "ftp" ]; then # Need default values even if we proxy ftp... if [ "X${_ftp_server_login}" = X"" ]; then _ftp_server_login=anonymous fi if [ "X${_ftp_server_password}" = X"" ]; then _ftp_server_password=root@`hostname`.${FQDN} fi # Get login name resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Login? [${_ftp_server_login}] " getresp "${_ftp_server_login}" _ftp_server_login=$resp done # Get password unless anonymous if [ ${_ftp_server_login} != "anonymous" ]; then resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Password (will not echo): " stty -echo getresp -n "${_ftp_server_password}" stty echo echo _ftp_server_password=$resp done else # only used by ftp_list_files() _ftp_server_password=root@`hostname`.${FQDN} fi fi fi # Build up the base url since it is so nasty... if [ "${_url_type}" = "ftp" -a "${_ftp_server_login}" != "anonymous" ]; then _url_base=ftp://${_ftp_server_login}:${_ftp_server_password}@${_ftp_server_ip}/${_ftp_server_dir} else eval _url_base=${_url_type}://\$_${_url_type}_server_ip/\$_${_url_type}_server_dir fi # Get list of files from the server. # XXX - check for nil $_file_list and deal if [ "${_url_type}" = "ftp" -a "X${ftp_proxy}" = X"" ]; then _file_list=`ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_ftp_server_password" "$_ftp_server_dir"` else # Assumes index file is "index.txt" for http (or proxy) # We can't use index.html since the format is server-dependent _file_list=`ftp -o - -V ${_url_base}/index.txt | sed 's/ //'` fi _sets= if list_has_sets "$_file_list" $THESETS; then for _f in $THESETS ; do if [ "X${_f}" = "Xkernel" ]; then if isin bsd $_file_list; then _kernel=bsd fi elif isin ${_f}${VERSION}.tar.gz $_file_list; then _sets="$_sets ${_f}${VERSION}.tar.gz" elif isin ${_f}${VERSION}.tgz $_file_list; then _sets="$_sets ${_f}${VERSION}.tgz" fi done else eval echo "There are no OpenBSD install sets available in \"\$_${_url_type}_server_dir\"." echo -n "Search for *.tar.gz and *.tgz files? [y] " getresp "y" case "$resp" in n*|N*) return ;; *) ;; esac # *.tar.gz and *.tgz are possible sets _sets= _kernel= for _f in ${_file_list} ; do case "$_f" in *.tar.gz|*.tgz) _sets="$_sets ${_f}" esac done if [ "X${_sets}" = X"" ]; then echo "There are no *.tar.gz or *.tgz files in that dir." echo -n "See a directory listing? [y] " getresp "y" case "$resp" in n*|N*) return ;; *) ;; esac echo echo "${_file_list}" echo return else echo "Adding *.tar.gz and *.tgz files to selector." fi fi # Yes, all those blackslashes really are necesary... eval echo "\\\\n"\ "You will now be asked for files to extract. In addition to the files listed,\\\\n"\ "you may select any file located at\\\\n"\ " \$_${_url_type}_server_ip:\$_${_url_type}_server_dir\\\\n"\ "You can also enter \'all\' to install all the standard sets, or \'list\' to list\\\\n"\ "the files available. When you are done selecting files, enter \'done\'. Some of\\\\n"\ "these sets are required for your ${MODE} and some are optional -- you will want\\\\n"\ "at least the base and bsd sets. Consult the installation notes if you are not\\\\n"\ "sure which sets are required!" _osetsdone="$_setsdone" # Set the minimal default for _f in $_sets $_kernel; do eval "case $_f in \ ${_minpat}) \ if ! isin \${_f} \${_setsdone}; then \ _get_files=\`addel \${_f} \${_get_files}\` ; \ _setsdone=\`addel \${_f} \${_setsdone}\` ; \ fi ;; \ esac" done # Allow the user to select/de-select additional sets while : ; do echo echo "The following sets are available for extraction." echo "Enter filename, \`list', \`all', or \`done'." echo "You may de-select a set by prepending a '-' to its name." echo get_selection "$_sets $_kernel" if [ "X${resp}" = X"done" ]; then break elif [ "X${resp}" = X"list" ]; then echo eval echo "\$_${_url_type}_server_dir:" echo "${_file_list}" continue fi eval glob_selection \"$resp\" \$_${_url_type}_server_dir \"$_sets $_kernel\" done # User may have said "done" without selecting any files if [ "X${_get_files}" = X"" ]; then return fi # Stash the fact that we configured and downloaded via this url method eval _installed_via_${_url_type}=1 echo echo "Fetching files via ${_url_type} may take a long time, especially over a slow network" echo -n "connection. Ready to download files? [y] " getresp "y" case "$resp" in y*|Y*) ;; *) _setsdone="$_osetsdone" return ;; esac # Download the files one at a time and keep track of which ones failed while test -n "${_get_files}" ; do _failed_files= echo for _f in $_get_files ; do echo "Getting ${_f} ..." if [ "X${_f}" = "X${_kernel}" ]; then ( cd /mnt ; ftp ${_ftp_active} -V -m ${_url_base}/${_f} ) else ( cd /mnt ; ftp ${_ftp_active} -o - -V -m ${_url_base}/${_f} | tar zxpf - ) fi if [ $? -ne 0 ]; then # Mark xfer as having failed,. _setsdone=`rmel $_f $_setsdone` _failed_files="${_failed_files} ${_f}" fi done # Give them the option of refetching failed files. _get_files= while test -n "${_failed_files}" ; do echo echo "The following files failed to transfer and extract correctly:" echo "Choose which one(s) to refetch or 'done' to exit selector." echo "You may de-select a file by prepending a '-' to its name." echo get_selection "$_failed_files" if [ "X${resp}" = X"done" ]; then break elif [ "X${resp}" = X"list" ]; then echo eval echo "\$_${_url_type}_server_dir:" echo "${_file_list}" echo continue fi eval glob_selection \"$resp\" \$_${_url_type}_server_dir \"$_failed_files\" done done } install_from_mounted_fs() { # $1 - directory containing installation sets local _sets= _kernel _f _get_files _failed_files _osetsdone if [ ! -d $1 ]; then echo "No such directory: $1" return fi if dir_has_sets $1 $THESETS; then for _f in $THESETS ; do if [ "X${_f}" = "Xkernel" ]; then if [ -f $1/bsd ]; then _kernel=bsd fi elif [ -f $1/${_f}${VERSION}.tar.gz ]; then _sets="$_sets ${_f}${VERSION}.tar.gz" elif [ -f $1/${_f}${VERSION}.tgz ]; then _sets="$_sets ${_f}${VERSION}.tgz" fi done else echo "There are no OpenBSD install sets available in \"$1\"." echo -n "Search for *.tar.gz and *.tgz files? [y] " getresp "y" case "$resp" in n*|N*) return ;; *) ;; esac # *.tar.gz and *.tgz are possible sets _sets= _kernel= _sets=`cd $1 ; echo *.tar.gz *.tgz` if [ "X${_sets}" = X'*.tar.gz *.tgz' ]; then echo "There are no *.tar.gz or *.tgz files in that dir." echo -n "See a directory listing? [y] " getresp "y" case "$resp" in n*|N*) return ;; *) ;; esac echo ( cd $1 && ls ) echo return else echo "Adding *.tar.gz and *.tgz files to selector." fi fi echo "\n"\ "You will now be asked for files to extract. In addition to the\n"\ "files listed in the selector you may enter any file located in\n"\ "$1. You can also enter 'all' to install all the standard\n"\ "sets, or 'list' to list the files avilable in $1.\n"\ "When you are done selecting files, enter 'done'.\n"\ "Some of these sets are required for your ${MODE} and some are optional --\n"\ "You will want at least the base and bsd sets.\n"\ "Consult the installation notes if you are not sure which sets are required!" _osetsdone="$_setsdone" # Set a minimal default for _f in $_sets $_kernel; do case "$_f" in base*.tar.gz|base*.tgz|man*.tar.gz|man*.tgz|etc*.tar.gz|etc*.tgz|bsd) if ! isin ${_f} ${_setsdone}; then _get_files=`addel ${_f} ${_get_files}` _setsdone=`addel ${_f} ${_setsdone}` fi ;; esac done # Allow the user to select/de-select additional sets while : ; do echo echo "The following sets are available for extraction." echo "Enter filename, \`list', \`all', or \`done'." echo "You may de-select a set by prepending a '-' to its name." echo get_selection "$_sets $_kernel" if [ "X${resp}" = X"done" ]; then break elif [ "X${resp}" = X"list" ]; then echo echo "${1}:" ( cd $1 && ls ) continue fi glob_selection "$resp" "$1" "$_sets $_kernel" done # User may have said "done" without selecting any files if [ "X${_get_files}" = X"" ]; then return fi echo echo -n "Ready to extract selected file sets? [y] " getresp "y" case "$resp" in y*|Y*) ;; *) _setsdone="$_osetsdone" return ;; esac # Extract the files one at a time and keep track of which ones failed while test -n "${_get_files}" ; do _failed_files= echo for _f in $_get_files ; do echo "$1/${_f}:" if [ "X${_f}" = "X${_kernel}" ]; then ftp -V -m -o /mnt/$_f file:$1/$_f else ftp -V -m -o - file:$1/$_f | (cd /mnt; tar -zxpf -) fi if [ $? -ne 0 ]; then # Mark xfer as having failed,. _setsdone=`rmel $_f $_setsdone` _failed_files="${_failed_files} ${_f}" fi done # Give them the option of retrying failed files. _get_files= while test -n "${_failed_files}" ; do echo echo "The following files failed to extract correctly:" echo "Choose which one(s) to retry or 'done' to exit selector." echo "You may de-select a file by prepending a '-' to its name." echo get_selection "$_failed_files" if [ "X${resp}" = X"done" ]; then break elif [ "X${resp}" = X"list" ]; then echo echo "${1}:" ( cd $1 && ls ) echo continue fi glob_selection "$resp" "$1" "$_failed_files" done done } install_cdrom() { local _drive _range _part _fstype _directory _n # Get the cdrom device info _CDDEVS=`md_get_cddevs` if [ "X${_CDDEVS}" = X"" ]; then echo "No CD-ROM devices were found. Aborting." return fi cat << __EOT The following CD-ROM devices are installed on your system. Please make sure the CD is in the CD-ROM drive and select the device containing the CD with the installation sets: $_CDDEVS __EOT _drive=`echo $_CDDEVS | cutword 1` echo -n "Which CD-ROM contains the installation media? [$_drive] " getresp "$_drive" case "$resp" in abort) echo "Aborting." return ;; *) if isin $resp $_CDDEVS ; then _drive=$resp else echo echo "The CD-ROM $resp does not exist." echo "Aborting." return fi ;; esac # If it is an ISO9660 CD-ROM, we don't need to ask any other questions _n=0 until disklabel $_drive >/tmp/label.$_drive 2>&1; do # Try up to 6 times to access the CD if egrep -q '(Input/output error)|(sector size 0)' /tmp/label.$_drive; then _n=$(( $_n + 1 )) if [ _n -le 5 ]; then echo "I/O error accessing $_drive; retrying" sleep 10 else echo "Cannot access $_drive. Aborting." return fi else break fi done echo if grep -q '^ *c: .*ISO9660' /tmp/label.$_drive; then _fstype=cd9660 _part=c else # Get partition from user _range=`md_get_partition_range` resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n 'CD-ROM partition to mount (normally "c")? [c] ' getresp c case "$resp" in $_range) _part=$resp ;; *) echo "Invalid response: $resp" resp= # force loop to repeat ;; esac done # Ask for filesystem type cat << __EOT There are two CD-ROM filesystem types currently supported by this program: cd9660 ISO-9660 ffs Berkeley Fast Filesystem __EOT resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which filesystem type? [cd9660] " getresp "cd9660" case "$resp" in cd9660|ffs) _fstype=$resp ;; *) echo "Invalid response: $resp" resp= # force loop to repeat ;; esac done fi rm -f /tmp/label.$_drive # Mount the CD-ROM if ! mount -t ${_fstype} -o ro \ /dev/${_drive}${_part} /mnt2 ; then echo "Cannot mount CD-ROM drive. Aborting." return fi # Get the directory where the file lives if [ "X${_directory}" = X"" ]; then _directory="/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH}" fi resp= # force one iteration while [ "X${resp}" = X"" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file. [${_directory}] " getresp "${_directory}" done _directory=$resp install_from_mounted_fs /mnt2/${_directory} umount -f /mnt2 > /dev/null 2>&1 } mount_a_disk() { # Mount a disk on /mnt2. The set of disk devices to choose from # is $_DKDEVS. # returns 0 on failure. local _drive _def_partition _partition_range _partition _fstype local _fsopts _directory _md_fstype _md_fsopts getresp "abort" case "$resp" in abort) echo "Aborting." return 0 ;; *) if isin $resp $_DKDEVS ; then _drive=$resp else echo echo "The disk $resp does not exist." echo "Aborting." return 0 fi ;; esac # Get partition cat << __EOT The following partitions have been found on $_drive: __EOT disklabel $_drive 2>/dev/null | grep '^ .:' echo _likely_partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/swap/s/.*//' -e '/unused/s/.*//' \ -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _def_partition=`echo $_likely_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then _def_partition=`echo $_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then echo "There are no usable partitions on that disk" return 0 fi fi resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Partition? [$_def_partition] " getresp "$_def_partition" case "$resp" in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" resp= # force loop to repeat ;; esac done # Ask for filesystem type cat << __EOT The following filesystem types are supported: default (deduced from the disklabel) ffs __EOT _md_fstype=`md_native_fstype` _md_fsopts=`md_native_fsopts` if [ ! -z "$_md_fstype" ]; then echo " $_md_fstype" else _md_fstype="_undefined_" fi resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which filesystem type? [default] " getresp "default" case "$resp" in default) _fstype= _fsopts="ro" ;; ffs) _fstype="-t $resp" _fsopts="async,ro" ;; $_md_fstype) _fstype="-t $resp" _fsopts=$_md_fsopts ;; *) echo "Invalid response: $resp" resp= # force loop to repeat ;; esac done # Mount the disk if ! mount $_fstype -o $_fsopts /dev/${_drive}${_partition} /mnt2; then echo "Cannot mount disk. Aborting." return 0 fi return 1 } install_disk() { local _directory cat << __EOT The following disk devices are installed on your system; please select the disk device containing the partition with the installation sets: __EOT _DKDEVS=`md_get_diskdevs` echo "$_DKDEVS" echo echo -n "Which is the disk with the installation sets? [abort] " if mount_a_disk ; then return fi # Get the directory where the file lives resp= # force one iteration while [ "X${resp}" = X"" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file. [${_directory}] " getresp "${_directory}" done _directory=$resp install_from_mounted_fs /mnt2/${_directory} umount -f /mnt2 > /dev/null 2>&1 } install_nfs() { # Get the IP address of the server resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Server IP address or hostname? [${_nfs_server_ip}] " getresp "${_nfs_server_ip}" done _nfs_server_ip=$resp # Get server path to mount resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Filesystem on server to mount? [${_nfs_server_path}] " getresp "${_nfs_server_path}" done _nfs_server_path=$resp # Determine use of TCP echo -n "Use TCP transport (only works with capable NFS server)? [n] " getresp "n" case "$resp" in y*|Y*) _nfs_tcp="-T" ;; *) _nfs_tcp= ;; esac # Mount the server mkdir /mnt2 > /dev/null 2>&1 if ! mount_nfs $_nfs_tcp ${_nfs_server_ip}:${_nfs_server_path} \ /mnt2 ; then echo "Cannot mount NFS server. Aborting." return fi # Get the directory where the file lives resp= # force one iteration while [ "X${resp}" = X"" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file. [${_nfs_directory}] " getresp "${_nfs_directory}" done _nfs_directory=$resp install_from_mounted_fs /mnt2/${_nfs_directory} umount -f /mnt2 > /dev/null 2>&1 } install_tape() { local _xcmd # Get the name of the tape from the user. cat << __EOT The installation program needs to know which tape device to use. Make sure you use a "no rewind on close" device. __EOT _tape=`basename $TAPE` resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Name of tape device? [${_tape}]" getresp "${_tape}" done _tape=`basename $resp` TAPE="/dev/${_tape}" if [ ! -c $TAPE ]; then echo "$TAPE does not exist or is not a character special file." echo "Aborting." return fi export TAPE # Rewind the tape device echo -n "Rewinding tape..." if ! mt rewind ; then echo "$TAPE may not be attached to the system or may not be" echo "a tape device. Aborting." return fi echo "done." # Get the file number resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "File number? " getresp "" case "$resp" in [1-9]*) _nskip=$(( $resp - 1 )) ;; *) echo "Invalid file number ${resp}." resp= # force loop to repeat ;; esac done # Skip to correct file. echo -n "Skipping to source file..." if [ "X${_nskip}" != X"0" ]; then if ! mt fsf $_nskip ; then echo "Could not skip $_nskip files. Aborting." return fi fi echo "done." cat << __EOT There are 2 different ways the file can be stored on tape: 1) an image of a gzipped tar file 2) a standard tar image __EOT resp= # force one iteration while [ "X${resp}" = X"" ]; do echo -n "Which way is it? [1] " getresp "1" case "$resp" in 1) _xcmd="tar -zxvpf -" ;; 2) _xcmd="tar -xvpf -" ;; *) echo "Invalid response: $resp." resp= # force loop to repeat ;; esac ( cd /mnt; dd if=$TAPE | $_xcmd ) done echo "Extraction complete." } get_timezone() { local _a _zonepath # # If the zoneinfo is not on the installation medium or on the # installed filesystem, set TZ to GMT and return immediatly. # if [ ! -e /usr/share/zoneinfo -a ! -e /mnt/usr/share/zoneinfo ]; then TZ=GMT return fi if [ ! -d /usr/share/zoneinfo ]; then _zonepath=/mnt else _zonepath= fi cat << __EOT Select a time zone for your location. Timezones are represented on the system by a directory structure rooted in "/usr/share/timezone". Most timezones can be selected by entering a token like "MET" or "GMT-6". Other zones are grouped by continent or country, with detailed zone information separated by a slash ("/"), e.g. "US/Pacific" or "Canada/Mountain". To get a listing of what's available in /usr/share/zoneinfo, enter "?" at the prompts below. __EOT if [ X$TZ = X ]; then TZ=`ls -l /mnt/etc/localtime 2>/dev/null | cutlast` TZ=${TZ#/usr/share/zoneinfo/} fi while : ; do echo -n "What timezone are you in? [\`?' for list] [$TZ] " getresp "$TZ" case "$resp" in "") echo "Timezone defaults to GMT" TZ="GMT" break; ;; "?") ls -F ${_zonepath}/usr/share/zoneinfo ;; *) _a=$resp while [ -d ${_zonepath}/usr/share/zoneinfo/$_a ]; do echo -n "There are several timezones available" echo " within zone '$_a'" echo -n "Select a sub-timezone [\`?' for list]: " getresp "" case "$resp" in "?") ls -F ${_zonepath}/usr/share/zoneinfo/$_a ;; *) _a=${_a}/${resp} if [ -f ${_zonepath}/usr/share/zoneinfo/$_a ]; then break; fi ;; esac done if [ -f ${_zonepath}/usr/share/zoneinfo/$_a ]; then TZ="$_a" echo "You have selected timezone \"$_a\"". return fi echo "'/usr/share/zoneinfo/$_a' is not a valid timezone on this system." ;; esac done } sane_install() { if [ ! -s /mnt/bsd ]; then cat << __EOT Warning, no kernel (/mnt/bsd) installed! You did not unpack a file set containing a kernel--this is needed to boot. Please note that the install kernel is *not* suitable for general use. __EOT elif [ ! -f /mnt/bin/cat ]; then cat << __EOT You still do not have a /bin/cat in your filesystem (i.e. a sample random file which you probably want). This seems to indicate that you are still missing important distribution files. __EOT elif [ ! -d /mnt/etc -o ! -d /mnt/usr/share/zoneinfo -o ! -d /mnt/dev ]; then cat << __EOT Something needed to complete the installation seems to be missing, did you forget to extract a required set? __EOT else return 0; fi cat << __EOT You will now be given the chance to install the missing set(s). You can enter '!' at the prompt to escape to a shell and fix things by hand if you wish. __EOT return 1 } install_sets() { local _yup="FALSE" _have_nfs # Can we do an NFS install? test -f /sbin/mount_nfs && _have_nfs=true # Ask the user which media to load the distribution from. cat << __EOT It is now time to extract the installation sets onto the hard disk. Make sure the sets are either on a local device (i.e. tape, CD-ROM) or on a network server. You will have the chance to repeat this step or to extract sets from several places, so you don't have to try to load all the sets in one try and can recover from some errors. __EOT if [ "X$local_sets_dir" != "X" ]; then install_from_mounted_fs ${local_sets_dir} if [ X"$_setsdone" != X ]; then _yup="TRUE" fi fi # Go on prodding for alternate locations resp= # force at least one iteration while [ X"${resp}" = X ]; do # If _yup is not FALSE, it means that we extracted sets above. # If that's the case, bypass the menu the first time. if [ X"$_yup" = X"FALSE" ]; then echo -n "Install from (f)tp, (h)ttp, (t)ape, (C)D-ROM" test -n "$_have_nfs" && echo -n ", (N)FS" echo -n " or local (d)isk? " getresp "" case "$resp" in d*|D*) install_disk resp=d ;; f*|F*) test -n "$_didnet" || donetconfig install_url -ftp resp=f ;; h*|H*) test -n "$_didnet" || donetconfig install_url -http resp=h ;; t*|T*) install_tape resp=t ;; c*|C*) install_cdrom resp=c ;; n*|N*) test -n "$_didnet" || donetconfig if [ -n "$_have_nfs" ]; then install_nfs resp=n else echo "Invalid response: $resp" resp= fi ;; *) echo "Invalid response: $resp" resp= ;; esac else _yup="FALSE" # So we'll ask next time fi # Perform sanity checks... if sane_install; then # Give the user the opportunity to extract more sets. They # don't necessarily have to come from the same media. echo echo -n "Extract more sets? [n] " getresp "n" case "$resp" in y*|Y*) # Force loop to repeat resp= ;; *) ;; esac else # Not sane, don't exit loop. resp= fi done } munge_fstab() { local _fstab _fstab_shadow _dev _mp _fstype _rest # Now that the 'real' fstab is configured, we munge it into a 'shadow' # fstab which we'll use for mounting and unmounting all of the target # filesystems relative to /mnt. Mount all filesystems. _fstab=$1 _fstab_shadow=$2 ( while read _dev _mp _fstype _rest; do # Skip comment lines case "$_dev" in \#*) continue;; *) ;; esac # and some filesystem types (like there are swap,kernfs,...) case "$_fstype" in ffs|ufs|nfs) ;; *) continue;; esac if [ "$_mp" = "/" ]; then echo $_dev /mnt $_fstype $_rest else echo $_dev /mnt$_mp $_fstype $_rest fi done ) < $_fstab > $_fstab_shadow } mount_fs() { # Must mount filesystems manually, one at a time, so we can make # sure the mount points exist. # $1 is a file in fstab format local _fstab=$1 local _async=$2 ( while read line; do set -- $line _dev=$1 _mp=$2 _fstype=$3 _opt=$4 # If not the root filesystem, make sure the mount # point is present. if [ "X{$_mp}" != X"/mnt" ]; then mkdir -p $_mp fi # Mount the filesystem. If the mount fails, exit # with an error condition to tell the outer # later to bail. if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then # error message displayed by mount exit 1 fi done ) < $_fstab if [ "X${?}" != X"0" ]; then cat << __EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the installation process. __EOT exit fi } unmount_fs() { # Unmount all filesystems and check their integrity. # Usage: [-check] local _check _fstab _pid if [ "$1" = "-check" ]; then _check=1 _fstab=$2 else _check=0 _fstab=$1 fi if [ ! \( -f $_fstab -a -s $_fstab \) ]; then echo "fstab empty" > /dev/tty return fi ( _devs= _mps= # maintain reverse order while read line; do set -- $line _devs="$1 ${_devs}" _mps="$2 ${_mps}" done echo -n "Unmounting filesystems... " for _mp in ${_mps}; do echo -n "${_mp} " umount ${_mp} done echo "... Done." if [ $_check = 1 ]; then echo "Checking filesystem integrity..." for _dev in ${_devs}; do echo "${_dev}" fsck -f ${_dev} done fi echo "Done." ) < $_fstab } remount_fs() { ( while read line; do set -- $line _dev=$1 _mp=$2 _fstype=$3 _opt=$4 if ! mount -u -o $_opt $_dev $_mp ; then # error message displayed by mount exit 1 fi done ) < $1 } check_fs() { # Check filesystem integrity. # $1 is a file in fstab format local _fstab=$1 ( _devs= _mps= while read line; do set -- $line _devs="$1 ${_devs}" _mps="$2 ${_mps}" done echo "Checking filesystem integrity..." for _dev in ${_devs}; do echo "${_dev}" fsck -f ${_dev} done echo "Done." ) < $_fstab } donetconfig() { _didnet=1 resp= # force at least one iteration _nam= if [ -f /tmp/myname ]; then _nam=`cat /tmp/myname` fi while [ "X${resp}" = X"" ]; do echo -n "Enter system hostname (short form, e.g. \"foo\"): [$_nam] " getresp "$_nam" done hostname $resp echo $resp > /tmp/myname resp= # force at least one iteration if [ -f /tmp/resolv.conf ]; then FQDN=`grep '^domain ' /tmp/resolv.conf | \ sed -e 's/^domain //'` fi while [ "X${resp}" = X"" ]; do echo -n "Enter DNS domain name (e.g. \"bar.com\"): [$FQDN] " getresp "$FQDN" done FQDN=$resp echo echo "If you have any devices being configured by a DHCP server" echo "it is recommended that you do not enter a default route or" echo "any name servers." echo configurenetwork resp=`route -n show | grep '^default' | sed -e 's/^default //' -e 's/ .*//'` if [ "X${resp}" = "X" ]; then resp=none if [ -f /tmp/mygate ]; then resp=`cat /etc/mygate` if [ "X${resp}" = "X" ]; then resp="none"; fi fi fi echo -n "Enter IP address of default route: [$resp] " getresp "$resp" if [ "X${resp}" != X"none" ]; then route delete default > /dev/null 2>&1 if route add default $resp > /dev/null ; then echo $resp > /tmp/mygate fi fi resp="none" if [ -f /etc/resolv.conf ]; then resp= for n in `grep '^nameserver ' /etc/resolv.conf | \ sed -e 's/^nameserver //'`; do if [ "X${resp}" = "X" ]; then resp="$n" else resp="$resp $n" fi done elif [ -f /tmp/resolv.conf ]; then resp= for n in `grep '^nameserver ' /tmp/resolv.conf | \ sed -e 's/^nameserver //'`; do if [ "X${resp}" = "X" ]; then resp="$n" else resp="$resp $n" fi done fi echo -n "Enter IP address of primary nameserver: [$resp] " getresp "$resp" if [ "X${resp}" != X"none" ]; then echo "search $FQDN" > /tmp/resolv.conf for n in `echo ${resp}`; do echo "nameserver $n" >> /tmp/resolv.conf done echo "lookup file bind" >> /tmp/resolv.conf echo -n "Would you like to use the nameserver now? [y] " getresp "y" case "$resp" in y*|Y*) cp /tmp/resolv.conf \ /tmp/resolv.conf.shadow ;; *) ;; esac fi if [ ! -f /tmp/resolv.conf.shadow ]; then echo echo "The host table is as follows:" echo cat /tmp/hosts cat << __hosts_table_1 You may want to edit the host table in the event that you are doing an NFS installation or an FTP installation without a name server and want to refer to the server by name rather than by its numeric ip address. __hosts_table_1 echo -n "Would you like to edit the host table with ${EDITOR}? [n] " getresp "n" case "$resp" in y*|Y*) ${EDITOR} /tmp/hosts ;; *) ;; esac fi cat << \__network_config_2 You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. __network_config_2 echo -n "Escape to shell? [n] " getresp "n" case "$resp" in y*|Y*) echo "Type 'exit' to return to install." sh ;; *) ;; esac } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi }   D` ?"` $ D $ @ `<$ T   &   @../../../../net/route.crt_init_done == 0㿘#>` " >>>> ``hxr#"!\!>U">`ThR>!XhZ $`㿘> `  E  2& &  & >\\`&  "`"\& "㿘* `"  "`   "@` "`&  `"@ "  €      k Gs   2  ` "`  "㿘 `"  "`  "@`""`"`"@ GK  2㿘H /i * * >bH 0  "$ 2`"  "`  "@`""`"`"@ G  2  EG  2" 7""" " "`  & " """@& 㿘H /i * * >bH 0H /`4>* !>!\`7 (``"  "`   "@` "`$` "@ "  €       F ` " `  @ & ` `2`H 0>!Xg"㿘`    D & @❒ `* (   > ` ?"` >  " >  "> ` ?"` `?"`H /``* !`  >"`   _`>  ;  F& H 004  > `  "` >  `" >  `"> `  "` > $ `:"  @6 H 0route_output`Р'P'T'X'L'H'@ $        ij  2  7  2 >v~ `K('  'm  C  'e 7  >'Y +"4L &'В@Ԁ "K  "   "A 7 @ 2: 7 '  `Ka6 "+ ?`%>#ܓ*` €؀ Ԑ ܚU ĀP @U$`8?"`8"HԐ ؚ<  8 )' 8>  aP* @2  / ܴ "  "߰  8 ' 8 "    \0ŀ0 ' 0' ' H' 0" @`"'` ' D'`4 "' D '`06' @   C*  " 7m}D @  4& P&$ T&( X&, \&0 `&4 d&8 h&< l&@ p&D t&Hy& ؀   m E "z "` `耢` ؀   "z -&D耢 z/ 2 ` ؀ `4( " ` `" D " D ؐ D` Ր?"` &D`  '` &@ $@dPD "  ؐ  2&HP * &P $ &P - "& @& "`` @ >  `4 `D/ Đ0   @gD" 26Ԁ >  2 >> ȔȖ਀ 6 `  `" `" @`" `" ` "  `" `"` " 㿘@  :  *" ?  @ *㿘 J  @*@  &@T`  3`l8 l" $@@` @4@@ 2@T`@  l l" $@@$ ` "` @l&ݲ    && rt_msg1㿘   L  T L$ >t"@.  D`C H /f!>͐* '!>!H   ˒ !H& > !>"  2` > * 8 ?"  @$!HH 0  (  & 6 & (& $& ,& 0   R "0  & & & @+`  ,`-@@ &@ ?   4``,`  ,4,z 㿘 &@    L  T L2 `,` @*@&@ ?    kJ``,`)%`$  &   "B  @̔  &&  & ,,4㿘>  `` @ "`"`@> Ȁ "`  22>> `Ȕਁp>  `А@p $ݐ   D` 0 84 V 4 j$ > $ >> 3 p>   ` `c  ->+>@F $  `  `    @' `'`'' ;  0 2 `$"`"" ` >逤`% '0''{ "`  024" "" > 22`Ȑ```p@    4`@V А@ڒ $ @  0' ' H''  D''4`'  ` "1` ,  4#  t#  P# $ T# ( X# , \# 0 `# 4 d# 8 h# < l# @ p# D t# H @`0# 3 # # # hP` "`&`&`pШ@݃ $> #"d ``" 0@2X @ ' n``C'` ?804 T4 D$ iҐ А$ `h 2;+`@ `2(`'` '`' C```` `02 `"`$""`g` "`&```Ӏ '''2` x  f `a  @  '   ''''H /`4ؐ* !؀ %   0> !P %>``.`  `@2` ( `0LH 0 @ 䀦@ '"  &  *` * " @ڎ &route㿘.@ܧ ( &&* "?&$,   6 &. . 㿘 ( @܋. @܆'@'h@܃'@`.`"* * ?@* "?"* * $,   6 &. . 㿈@?`    ',@   B @ &` `@2``@2  ` *  @@ "/ @ &` `@@ ``@ @ ` *  @  @ 2&`& 2 ,2@&#$@" 3 @` @ ,``@``@ < @  ܐ` *`@` Ґ 2   ?* @ Ɛ "  * 2`?* 2  2`, , , ,  @ " * 2   2 , , , , ` @?#,2  4, ,,  , `  ?#x+ 2  3 , ,,  , ``!> l-` €`` ^@\`2`` "2 ` ` "2` `` "@ ?* 2  3 , ,,  , ` 2` `g$ `@  `."@ `@.@ `@ ," @.@  4 "@& & , , g     & `g ` p.` `.  $ $ $ $ $ $ $  $ $ @  $ $ @㿈  #\@  @` & g&@   gG$㿘\p"3   ? # @/ 7 *" *  `*`* 'h `( ` 2 * @`l․@g6   ' '@$ ' `@   "  $? ' $ ? c 7 /  `*`" *  * 'h ` *`*` 3     + `   `0  "@    # W#   @"@ P#   +     * @3  3   + ```2    *  @ 3   ` 3  ```2    *   @#    # `` `2    *   @#    # ` " `2    *  @ 6    ` 6   6 &@ " 6 6` @@`?# @3`@ @3` 8 6'@ $ ? ` ' 7 enc%d㿘!> #0@ٮ ( 1>/>->+>)> !o#& 7 㨔Db$`<,`8$`,`:$`$`|$`rp$@ n @̠ ̀`́㿐 Ā 3  Ȁ 2/ ) ") đH /f4 * '    &  & & " ?& H 0 Đ 0 Ē @ ˤ 2' đH /f4 * '    &  & & " ?& H 0  0܀ 'H /f4 * '    &  & & " ?& H 0 ep 0ܑH /f4 * '   & & " ?& H 0 B 2 PI 0 & P `@& `" 4  '  @ʘ    @ ` " ' ` & !0 2 ` `@8i*`4 @ 0encoutput(): no HDR㿘` 2> >m&"0!& t! & x&`4! @ 47 4 32 AH /f * '   @ T`& TH 0 &` 2" &  &  & H p@ @ `&"`T㿘>>`"  % - J@ " L !@ "48!! @"4 @ "  *l  !@0 !I@"  4 " ? @4444& ː.dq 0!6BR  &Ȁ H /` * ! Ē @k 2&a(H 0@Β $$đH /` * ! @N 2 &a(H 0 H 00!6B   H /` * ! @" 2 a(H 0}  " &a(H 0r H 00j!6A eȀ _ H /`4* ! @ 2 H 0B  Ē@ ˲ 2&a(@> $$đH 00+   `H 0 `  H 0 c$$&a(H 0gre%d㿘>  b )>'>%>ƒ  pm]    %@ /, 9, 8, :$ <$ |$ , ̐$4 4$ X$ L$ T$ H$ P$ o$  ( kߖ ``۠ Ё㿈>a8     "a8 `8$ $8^  ( " j ̀ 7 />!4`"  2 ` k  " `` * @^  " `@֒  * 7'& @    7 '& 7@<7`` " V>#x 8 ! 6 H /f * ' >8  2 H p@   & 6 && &  W   > `$ $8ڰ 7a  * @ @& & `@&  ` +  &`` `*`" &` b &` &``@&` &`  b*`bW62N >!0`2  `p$ $8 2 `   "@ `( `X$ $8~ /` 2 "   " `  &`&`   `` ``  &``*$ $8P `2   7 $ G$8 / ` @գ -`2 * 2 . .  . ̀`7 2 . 2 2 . . . @* @ 2 2 2 &. . . . . . `* 2 2 . .  P`$ P` `  $ `  @%< "$8 T $ T$8㿈>" H / * '  f@e@@"L   @'@"%Ʀ 2@1@ 0Y0g@" i@X 0h@j@"o  ֐ $  ` `$ X $  ``8 ?"`8$ @ "z$ { 4 " 4 2 4 ?6 4    70p /,  4?+@,  4?&@"d / `^ /`?-a6 W`/, ̀`7  4 ? 4 ?ؒ* F6 4?ؐ*@B6 4*@?6 4=6i $$ `?a6 2@$ @2 $  % ! ``8 ސ?"`8$ @ 2 4$ $    6 4 '` 0 H 0㿘 @k    $ , ,  4# `   $ 싐 ``@2  4`8 ?"`8 $ $ $ 2`  ` ? ( ? 228 * 2 㿘H /` * ! >!X>c@X>  `!> ` \@!8@r `2`H 0arp_rtrequest: bad gateway value arp_rtrequest: malloc failed 㿘>h`0 `L>  `"h "!>U" >Ȑ`X,>!XX4`4 "` 0"+ 02 `4` &`4`4a>` xv`@>  `8`0,`@ 04v&`\@" ` ``@ @l  > 8`@`` `8,`@`0Y4  5  &`L>Ȓah4 0L>>"T`#"T"@a $``4$&`4> `` $@`" "`$`` `D`H- &`\`@ ,`  _ >!d`> "&`@>a?"a@``"``@"&`L`4 ;&`4` "6 㿈 ϒ  5  `D%  % @% >#_ (4  4`D(  4 4 , , _q `L_m `R_i `\_e  | // arpresolve: can't allocate llinfo arpresolve: unresolved and rt_expire == 0 㿘!>#= "  ^// /   / / q/ `"`L @Q 2  `2 `\>ɒagg Y `0> ! ( 4  2  4   ^ 0B 4 2?  "$ $ `\ 2 `\>h!0> a&`\`\"* `4 ?&`4 `> ᰀ" >&`\ ` @  $ `D 4`  >!H`4`\` &`\&`4$  arpintr㿘>aL N H /f * ' !L !L $!L"`"`?"`H 0 > 2 >f#     *   h@@S !Lg !L arp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s x``^ ܐ ^>  ( ` "   ,`"<,@2< `H܀  2<`"`HH @ѣ  >c@ќ   !>' @f# 0!>'@!qf u'ܔ @ @`? n j0f C `@e <4@!>'!P@lpe 0I@#>'a@Y@ pԐe͐ 03!>'@F!ТpÐ e $\  `, ]c \ > >D $\4 ?$4 `% | % F0C  ]? ]; @e   ]/ 0   ](]" ] ( 55] ] (4  //| arptfree㿘 `2`8>e"` $``0" `  2`*& `4 ?"`4 `   = arplookup: unable to enter address for %s 㿐>U 8*8 @ , $ 4 蔒 28 4? dd"80 `"L`   !>'"@}d   -㿘`H   `>Ȓa(!&`&`㿘      *   h@@0v㿘   /  >0) 'L0%!p` >!t  #>al >U @  >UbL \M >U bH\H  $al>UM"H?㿈 x  4  D%  % @Ϸ% >#\)   54`  4D(    4 4 , , \ L\ V\  | // revarp㿘>!l` - >> "at"!p'>U%>#>Р??alaXH2 : K` #"?al %!p>U"L[Ք >U"H[Д   3㿐ǒ[NULL][%d,] 㿘 2>eA#`0>e=#h >%>#>e5p? e0cx 4>e*# ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d 㿘 >e  >e  >e ( > $ 8 d  la_rt=%p la_hold=%p, la_asked=0x%lx 㿘 >   d rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p (%s)(NULL) ifa=%p genmask= gwroute=%p llinfo=%p 㿘>͒d!  t> \!0 4d 8>d!`] >d!hX >d!pS 0 @>d!x @`">>͐!d` Dd! D>d! Dr >d!7 H x> Ldx! LRoute tree for AF_INET (not initialized) 㿘> !X>db"؀ >͐aޔ 0>dW" >>U  P㿘>U"P  2  &    2 8 0O   "P""" $"P&  㿘>U"P  2 8 01 "P """ $"P 㿘>U"P"P  2   "1ג 8㿈>'L'P'T'X'H" ` "" "``V$`0  ` :  2 ` $` "& & @- `4"0t  "@& & ```0b 0_  $ 4`Y `2Hz " " 8 @2D >  ('' ` ``t`<`'`'`7 `2` 2@8 ? " &`@Ϧ 2 &`>"  `` ``t`<`'`'`2`0< 8 2 `$ 0 " >  ('' ` ``t`<`'`'``2)@8 "@@ 2`?`>ϐ#*` €`( ~&`@K &`>"  &` `` ``t`<`'`'`2`0 "4`<` 8 2^2Z ?@> (`" (` 2`<`"(`0& (` ` 2`<```t``@@  ``"u@ 2``n&`` "`` "` d b `&` `"[ Y  "4`S<` 8 2" `"0D?@> (`" (` 2`<`"(`0& (` ` 2`<```t`#`@@  ``@ 2``&` `" `` >ϐ#l*` € &`@# ?T ?T ?\ ?\ ?T < <( <( " & H 0㿘    8 ?   4`   `@ 㿐>` O H /` * ! >  ($`'' `2 `t`< ')  ? $   2  `@K  @G  $  $` ` `t`< ' ' 2 H 0H(>UP 2    2H@>#x - ! 4`H /f * ' >8  2 H p@ `  $`4`$@$`$` ] `7>!ܒ `$`  $`$` 2 * * 2 "  " `` $` $`*, 4 @*$ 4 ` `  $` $` /' /  @ >b`  "` >> (`" `,`( " `<`2`, > (`"  `4`0 " `<`2`4 <  8  ?     * H"*  @"   *  @   :@2㿘@ʦ   . ``:` `*`?&@ #: . in_control㿈 !@  !@ 00!@0  " L@ >  (   2 < a@"'a@"< a a@ua@2 a0a#@ a!@n !@  aa%@d a      2 < H@2 < !@2  " 1  B >^"Pe  x ,/  7@  x$ <> `(` <$ @`""`$  $ "& D T d $$ $ , d4   , T, U$ $ t4 5 >c /"c   P  "    H ``<` ` 2`<`H 2`<` ` "  ) 1 a@a@"H4a @0 a@ta@00a"@" 4  !@~a!@ 0a#@a%@0 D& H& L& P&4    T& X& \& `& d& h& l& p& ְ  T' X' \' `'$ T$ X$ \$ `  $ T$ X$ \$ `   $  䋐 T$  䅔  4 2 $ T$ X$ \$ `@ $ 4$ h E    2  D & H& L& P& H@" 0 @V0 $ d4$ h8$ l<$ 4$ p4 "! 2@A  $ T$$ X($ \,$ ` 24`"4@A 4 ;! 7 $ T$$ X($ \,.$ `@ ` "`&  "@ <`" @ @"`@> " , @ <"@ ?$  - တ invalid argument to in_lifaddr_ioctl2 >]"h!@ "!@"ɰ -0!@2İ - @" 2  2  `  2  @  "  8  !@ 4t!@"  -0!@(t - @2 @, @T T "T  //m aj@   @0]t @@ 2[   !@ L    `2 t  2  09 1!@x D DTK4  T TTD0@ɒ! h&&  @ @T3  D DT/4  TT' T dT# d a㿘`  4    `  ` ?&`㿀H /f * ' `D &`D'`H`L&`H''&`L `P&`P' a  &`D&`H&`L&`PH 00]H 0  &@`D&@ @ ?0 @ ??&`,`4``,&`h&`4 &`,`,`d`4 @ @ &`(V&`0@&`$4  `4`0`,2`(&`X2 &`8 @  &``U   ]  2T4` &`T4 @8 '@\?J H``4K`2`>    "A  "9`2.4"!84"0X"* 0"& 824"8X" 8" 0" (2  ̀` 2  xH /` * ! >  (` ` 2`<` `t  $@      $ 2   $  Z&  6(  2 @H 0R  && & ( 2<2 & ** 6H 08 t & t "`t"t&  ` @// ' a1؀  ` "`  ") 6H 0  אH 0xH /` * !  ? &  `"  "`  "@ / '  a2) 6H 0㿘&&   ;) & 6 >(0 *`0 *  * 2`~0>Є( 2`~>І0(@ ` *   㿘  '  [ 7@ś > !>> $  !, , , $ 8H /e * & $ `@$ &`"` &@ 4  6 `  `* @ $@ "  4  6 `  ` * " 4  6 `  ` * @$ H 0  & ?$ `2$ !$ `$  㿐8>    '@"@|ے >  (` 16  0    ` ` '`V`` ` `< 8 `6`'@ ْ  -`ְ 1 2"-`2  0#6/F İ #> `bP 5 @s  "  8 @  0bP5 @c " ` 8R  2` 0`&0`266`  >>!a 6/  # "X   >>!a- , 2 2`@9 , @Ē&@$, 2`" 4)> ܰ 10[?* 2`@46 : 4   "P @0 ܐ866, @ƍ$@, 2`$@ 49>  10$ * 2`@ 46 ( 4  j "P @Ė0 ܐ66@" IPv6 pcb passed into in_pcbconnect㿈 8  ``@}g `!"` >X  " [  " V / I>  (" 0  ? H2  0  4`" 0X&  0 2 0 8R` @h @ 2  0쀢 . 1'* `'`'  @D 6 " 0 0 2  6 2 `r 12`  1$ 0 $   @4 4㿘 8 `>a##` & `& `& & & @6 4 8 `@㿘 8 "` " @ @ " `' `!@* 0@ H /`4 * !    ` "`"0  "@H 0 H /e  "@* & ` "` "  @ "`"`   @ "`H 0 & 㿘`  @&`  , , 64  0$ 㿘 8  @2`@}0   @&`  , , 44  $ 㿘` /\``+'./ 2 2` `!2  2  8 "  42  62   0 ` @2 `㿘` `` `!2  2  8   뀤p @`А& @@ $ D'`0'` '`4 `4  ``  L`00-㿘 @ $& @㿘 @ .2  6/ 2 @2 `v  `!"  $ 2 ( 2  , 2 0   $   $  $  $@e  2{   2  2   2  "    2@  2 @  2@ @  `   `  ` = @.  2D  42@ 3` 2/`` 2+`` 2'`` !  `!2,    2$  42   0" 0  0 2 `````"  @6 ` 2U 6㿘 @ 7 @@  8 `#2,             . .  &  &  &  ٴ&    . .  ٨& 㿘@ ` @28 8 9?"8&@2@@   @ 2@  .`.` ~&`` @H @` `@ 4`"`D 2  Z4  2 4 [  4 >  ( 2  1ސ &@< 8 2 D" D>  (  2 <  D 1'  DH(  `!"14 46    @("   @(  46  (" 46   ()" 6   @("   @( 4 6  ("4 6  ("H in_pcbhashlookup: faddr=%08x fport=%d laddr=%08x lport=%d 㿘@.6/  7 @  *  1 `!2( 2$ 42  62 0 2@ `"  "` "@ &@" #@&  2 `  >!` (+ >ې"X2VC3 in6_pcblookup_connect: faddr= fport=%d laddr= lport=%d 㿘` @. 6/  7   *  6 `!- @6  2( 42$ 62  $@'  2 `"  "` " &" $&  2 ` >!`>U#ؓ,`>ۓ2`Uې#,>ܐ U֓2`interneticmp_erroricmp len ` * > c  "c ?؀@ 2% `!  @*            > c ` t"`  # o @ i &  d 8 ` `" ? $ `$>S!> #  .` ``" * $`` $`,`  ` `  ",` >4``,` K''x `x `*`'4 ` `@*`4  쀤: >S!$ $$  $K 4 @* $ , , @q㿐'L'P'T'X'H   $> c `\ 5"`\@8 @ :   2 > wc  "@& & @ > c `` "``  "@& & > # * p `" `>ސ!̓*` € h>ސ!,  €    Yc    Tc   Oc   #c  *``< 8 "<c  )2 >ꀧ C06c `d "`d `*``0;@ 2 c `\ "`\ * >` # `>ɐ x >*` *  *  `0c `X "`X> `2K.  # c D.> `   # c `l n"`l R @.&.& > `a $Gc >> " `"   XQԔ K .h& 2   4 2X "X& c 6h `"h* `@U# 0. c #( `d `*` `8 c `d "`d> " >`"`!> $   Κ  @;08 u u u u u u u u u u u u u u u u yp yp yp u v x yp yp wX yp yp u u w yp yp yp w ypx   ` *`' 2   ?  " >  % `( > H@ `4   H@   4`" < X@2 <Ԁ " W  2& Hؐ@X ܐ * /"Ճ؀`2 `t> `@`T y"`T   H`D "`t`8 ?"`8 H % ``- @ Q    ߒ   $ "@8`  D 2  I  $ $ $    (  `@ހ   4     *@   $  "5 @* @%  "`&  "&  IL  |6 @ 㿘   , "@& & 4`@"@4`  "@& &    @ | 㿐@T@(a* &. . @v#㿘`  >   *0 *0 >  > !(5 㿐>  Դ  v 4 )> 0   4 " P0b"P T"T X"X \"\ `"` d"d h"h l"l p"p t"t>!x>`א `0?% P T @ ``  * $@`>ꢒ` @ <>!  P !*@@( a' @ <@  $ P T  $ T ԯicmp_mtudisc_timeout: bad route to timeout㿈 2 4>P  2# P   ' ''  'դ 0> `~>* *  ᰑ*    0 "& T㿘> !(>>Ր"?``? 㿘.`  .2 .   ,,`6 J2 @6 , 4 J@6` ,`6 㿘)>U"h0 "h'?+a@ >U#c2bX4  >U2"Z >U 2b\  "h !>U4"` @a >U2b^ 5>U7>3>U1> ->4"`"` @*  `"h "h#@|c4 %"h` >!خ ,,`2   , @j4*  2` , 2  @` ,2`s " @ !` ? 6b&bd5"6 㿘>! a/  > >Uad!>Uu!>U"h "h ߢ "ha 2 @/@ $"hb ->U>U>U"^b``)"XIՐ@_!?4"X`>Ua >U"\Xb@ 5a >UbZ>" . 6 %d.%d.%d.%d㿐>'1>U"paPip_initaeshmac-sha1㿀"K"""""#g77777777777    >>O#!#@ *"@ *`" *  *  * " * ">ɒ`x: > > `*@@ 6*@>   @/>!+ +`" " **"@ " *` * @  *`*  @ *`* " "@ *`* " #@ >ɔx@``2 `4S```:* `4@ #>c>!"` ( (" >ah >Ial>"ax>Р#@! @   +``2`*` (  #  +``2  >ф 0 +``2`*` +` +   >>a @ T>> a@z ipintr no HDR㿘>" `#>)%>H /f * ' #` #` $c""`?"H 0 ` `  NJ  @ 0Ձx'L'P'T'X'H 7o"" ` s q  @ `@ 6`> `( U >  @`" @   @;  2 `  &`  <  `@`X 5"`X2 <8 ` ,"`  2 `@`  "`@* `6 `@` "`@6 `@`  "` `@` "` > 2"@ & & >#` '  @耢 g > "!@Q \ '@ "  4`2v< 8 1  (`" `    ``<`" ` 2`<` `t    22H`@(`>"( <:>!X`h`@H /e * &   @d= #\ @s@ H p@䀢 `@(` "(0l m & @+ 0b?@"   C 2 `@`  "` H /f * ' >`   H 0  >  $H 0 > #耦`` 2@ `@2 @`@2@ ` @"@`2`  "2 6*` `"`@`` "``H /f4$* '$H 0 耧  * 6*  j``@;>>a`ሐ  &@d &dH /f4$* '$H 0   E   ad &dH /f4$* '$H 0  "` 'a*`  @ 2@H /f4$* '$H 0   0`&@ * @H /f4$* '$H 0  "6 ΐ : ` = ); 9 8`@H /e * &   @b #\ @q H p@䀢  `@`(  "`(. Ð0% & & `@4>ɐ "4 `x @ >* *  ᰑ*    0   > (=H"8  4 40 ", >p`"!<`2<4"<X`8 `0`(2 <`  `2`2H 㿘 ` @   * "@$/$  W > `> cc耢 &@c" "c&` <.`  ` .`  `6` &`    &`  r&`3  2  ?h `            (    ``  " `  @>  ? `2` "2 3     * '> @ "@ @"Ӑ ?` "` "1 Eጠ?  $    4 2 ` &` " &` `  &  &" %& `     ` ` @  m  ?c * @  > @h`@_"h[ ?N$ݒ E>a? "a  Β E!?%!526 `& `& @``"`@`" `*` $  `*`" $  @$`@`-" E>a ?"a㿘 "%>  ?` "` "w E? $`"  "` "@?㿘H /` * ! H /f * ' >`   H 0  >  $H 0 > #耢>  @ ? *`  `$` 2 H /f4$* '$H 0 H 0㿘H /f * ' >`   H 0    $H 0   "> c耢  >  @ `#`Q$`#耢 2`H /f4$* '$H 0 㿘 2#> @ `0"c耢>!*` > : @?> attempted source route from %s to %s h   * ?   `>!7>ꀤ`  ? ` @4 $`Dw ``Q`̬%`2Ȭ%>!``"    $M />ꀤ`%ߴ ?  '@!%@ `2 N  N8@'Ԕ H% @ɔ  < , 8 @ ~@ ?  ? t  @M  H`@'Ԕ H@   ],@ꀢ$逢` 2   *` ? z'D% А?@}   "   'g c   ]" N+  "H@_   M@U MW  /.'̒ ̒@E  /% ``  >!X`@Z 6 4 'Ԥ@x !>'Ԡ!pHj   ?  ?  $   *"@ 5  ט > `@`P  "`P㿘>"?` #>` #>`8 ?"`8>""  , $ ,˗bb   D >save_rte: olen %d 㿘>!t `@>#0I[`+ !>U"?2 >"a$?㿈   //'7s 2`87 ސ`4 ?$`8`4 $$* `0 `%> # ! " `0  @2     `@4 "    2  2  ip_srcroute: nhops %d mlen %d hops %x %x %x 㿘!>!  ^ !H >!t+ `& > Ȓ H۔ !>Ub* !t  "@ >Hʐ ?  *`*` `?$   @   %>!t "@H@$@ >U!t"`$>!H 㿘  @` * >"   "`&  "& @* @@ $@forward: src %x dst %x ttl %x redirect (%d) to %x 㿈>!t `   >` "`He ` ! > `b' 2 `> @(`"(0`  , >>",` ->`@    8 ?$ 8>""  ,,`I$     Y 0` D4 C  " @ @ `*` @ @2> 4 0.>  (>!\`$`#> > D!p4` 0 > 4 "` 0 t   >" Gٔ>!p`  !#\  @ >  @(`"(> `@$  "$(0$, ",A >"* €      @`@`L "`L  ̖ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ L @ @ @ @ @ @ @ @ @ @ @ @ @ @ x @ @ @ @ @ @ @ @ @ @㿘`ڰ ?`>#$*` €>Ř!X>!\>!d > !` >!`>!p!>)!h!h` !>!x h>al$!xh !>!x * $!x!>)q!l>ax!l 0z>p!>j!>d!>^!>X!>R!(>L!,>F!0>@!4>:!8>4!<>.!@>(!H>"!D>!L>!P> T>ѐ )D  >!T( -   , ` 8 P h   ( @ X p x ip_output: IPv6 pcb is passedip_output no HDR'|'H'P 'L'T'X''   `!" >D#  `>D#@d'|< * @ '7 : `* *` > 7 '@8 "8 * 'H /e * &   ` `ŀ `Ȁ ' H 0f|v %$H 0`Y| @ 4 "8  @" 8 ݐ?"8$  |  - - % | "I8 2 I\ >   /  2Ǭ`2`t>  @ T A "`t4`D `@0 < 8 |H' |hd`H /e* & ` ` 2 #\` @u   #\  @iК ` H 0 ?- "'r`;`'x `?2   Ā@<H 0  ǹ &$ < 8 |`2V 2@ 4 "8  @" 8 ܐ?"8$  |  - - % | "Hz 2 H C>   /  2`2`t>  @ T4 A "`t4`D `@0 2 H'  < 8 `" 6 /  2T`4 / T`4 @2  2  >  @ T 3`" T'  > (`" (` 2`<`H' (` ` 2`<``t    2   @  `4 #02 'C "`4 | 1~'` 2  x'`<@8 (! >6|  "  P    7  DH /e4>* &>#` a('>  @   A'H 0$x@Yp 2 A'* |6 @u; 'H 0>#` ' @  A`<  @ x7 7 `|' @ >  @ L (`" L'" ?' ('>  @ < 7`" <'=  @ >#x  ! 6H /f * ' >b8`  2` H p@   &6&&& ` >%!ܬ&& $  $  $  $   #@6@  < `**` &&  '@?Ȑ*:`@4   @ 4  @ "@'  4 @4 H  v& &&@ 4 > 4 `@`H "`H @ @x> [$ &    7 7 @ 7 7  &  `|'C  > `@`D "`D| ` `8 -?"`8#㿘 ?` c`? i`@ 2$`  >  " F>#x  ! 2H /f * ' >8  2 H p@   "2""" w .> "   & & "    & & 8Ɣ    @& &  & 9!   ``8&`4`malformed IPv4 option passed to ip_optcopy㿘  * ?쀤'`  $)> ,@` 8 @#  @#8}@$ 〦 " ,@  `㿘>ـ" `  %   2`>"*` €`@K "  2  `>"*` €.`e.`l`` &`` ?&```` &`` ?&```` {&`` ?x&```@zr "p  2k  "``"``_ " ``[  ?X&`` ?ߐ T&`` ? P&`` "N  2I  B >`0-`0*>!| 6%.`6 2 .`! 6.`6 2 .`>! 6 .`6 ".` ` @eI` *  @&` * g@c`]>!*` €  '` "P$  $ ``7 I  ' `:$ >!*` €2`e0`l``- ``2 ``2 &`@$ e ' $ ``  2    $ " ` "` ` " * İ ĸ , ń p p p p p , ń ń ń ń ń 8 8 8 < P P P P P      , ´ ´ ´㿘 ``&`  `U Q L``   F `&`  7E`@c `$4`  "0`   `- )'``2$@` ?&` ,`6 7`$@` ֐ ` ,& B 㿀@  X 5 6 2&@ 7 ,$,4?`> *` €"  2 > $ (`  `H2`<`2`  T4@"װ 1$"Ұ  2ΰ  ,"ǰ  2ð  8 ,"  2 <8 @@ 2   /' *" " 1_ @>  (`  `H 2`<`2` p T4@l @` @`@  ,` @2`@2`@ `f 0b ;Ӑ,` "@ Y 7 U4"R  2N <8 @@ "D   >  (`  `H 2`<`2` "0 1 @ ,` @2` 2`@ ,` 1 `@ ,` `$?@  ?4 -  @@@@  5&@ x , d 㿘 ~   &0  # -0+ ``"` @`>  (`""` 2`<`""`H"" `` "` ` ``"` `*  -㿘     , @ ⬠  ,   5㿘沐   ` 4 `@e*`4 f 㿘> #ⷒ 㿘>  >#Ĭ  b#"`D `!2< m`"0 @240`"  @2, ` @2$沔   8b Ð 8  8Ā2`8bw 0   0     i > >  @ 0 4" 4" 0㿈 'P'T'X 'H'L ` ` >`  ?`#@=  2   ?"   ?"    ?`& &    "    "   &   .`6` m.`  6` 0.`&` /&` ?#$ 1- (@@  "`  `@ 2 <@6`  > 6`> `@`\ "`\  a @㿘`  C  ?쀢" 5k3d1 0' `" ` 8`  ` `  ?$ ` t\ ِ ' "  `  "@  - ` Srip_attachrip_detachrip_usrreq㿘``  ܝ ``2 `.`>"l € "`>;# > >"{ x> c\ q`n, m` "i 9] >;#o_ > #`"U 1? 8O 1 "K$ 0@R "F 1C$ 0 = > #`2 6 1? (/ /$ +̐'`   8 2 9    -ヒ ㎒>;+# 0 Լ  L  Ԥ հ  Դ D    0 㿘>>* @*`"@*`"@ *`@ d""$@4 4 $  t2̔  t@S   42 <!4 p 4@E <4 p $ $ $  $ $ $ $ $$ ( $ ,$$ 0@* (4 p㿘 ` 8  E:  2 > `"ٰ  +>  ``"     `" $)a``` " `$!`@` #`` ; BR;`  E0H"&`@&`a`#``Ȓ ; B;`8 `"  "` "@  E " ` " $6 " "2  $ 6` $ $" $ & $" $$V  $M  "I   T  j  8 `& T  ` `  $`  "@ `"  ``!"  `@  @   "    , E`` T  ͔    㿘H /e  >@ 0>* & >!`!` .`2   '<` @"  R` 2 6@ "a`2<a`a`<`@" R`  2 a`| "`| 2     ``0``0`'`( >:!Pf 0 `  ߐ y>  ` `" R    " '@j֒5 @-* `@5$> 9 "'`2  2 ?#@B 2  2  ?#@4     $ @z  ( > ` "` @ 2 * Ԁ"> !` "`A' @ : i  `> !` "`!ْ 0`"     '` '$ J 2 `@B @2  2   ' ' '' ` ``>!`㨖 >'!`'9آ`2&`<> !a`  "a``>!`  >!`  / 2`<> a L"aJ`V {`'̓*@''`8  t &` 7`2! > !/ <  >c "c "" " """" " $"$  K˒ 2 ’ 6 ` / ` ' ` ? $ ``  a`` !$`` k,`kd$`d`4`6`<$`$$`( $`,$$`0*@ $`/$`0$``< 6 <@gH /e * &  @N #\@] H p@ Ѐ Ѧ V 6>"J6 @ @ L "@V  #\@@ 2 V&`Ԓ@&dV 2 8`7 2 8̀Ѐ@, 8T2 8`" 8<@2 8(@2 8 ؐ"  >"&&Ԁo$"@ $ 8"@ 4 8<@* 8V 2 8> !̒` "!>"Đ"@ @ U`V" "  @ G> $!" `` <`B ;`#` `  \``!" `@  @  \Ԑ&L&$$@2V6 2 |6 |  u \À $@2X 8 T 8 <"@ D @" 4 4I 8@  > l > @> !  T &T ;`B 8  `"  ``!"  `@  @b    6;@ 8    0 <" D @"@@ @ `& T"@@ & V &P    ``S``@2 ` `2 @   @p  # k``    < 8 [   V`G`g  $ **<" " ""2`d* "`$'`('`,'`0'`$ `( `, `0  $`$$`( $`,$$`0@Z0 /$`$$`($`,9$`0``!  $ ** " @ 2`0`$`0 $`0@ &@V 7' Ē #\@@  " &@#>&8>"Ȣ&83b}@ >$b8 &\`6 > &L&66 &,&&(&$&T!` y"`` > a `"a$" Z`" U`̔` `8"@ J`"@ E`v@ =rn" 6( &$&(6@ &`&\&T6"` &@`) $8" "> !`u"  ` `6..͒  V`"@2 & 6 &P@"@ > `ؒP < `ДB;`ؘ '#`к`?&0&X̀ #`2"TЀ`Ȁ <T>"Ԓ"@@ 4&>  :`` aB #a#`;`T" =  &`6ߠ?Ԁ> 6> Ԛ`` < B #` ;``` < B ;`#`@&Ԑ"'"66  V  " @)> !`[" TP@ " A> ! Ԑ  -# В : ؖ B`; V 2PT"  }(@@'P $`T@`>  a6`" ؒ < B; ؐʒ Ժ"'̀ Ѐ@ `ؐ" `>"&&Ѐ` `؀@/?* : `>! *` € = 65 $> 6 `" `@ 6ٴ` Ȁ`V >  `!`%"  ` `6..͒  ϖ&0$" 4q@Ԁ \` 2X6<@2`> ` $`V`Z> * :`@ F6< ( 2 @L@6( - &@ &L66```B <``@rV-@&66&(&``B@_<``V-(@$ ~&|&(@ @L&t`6 >V" '@$  ' &V" @ 2V&@ :6@&6V@&6" > !` "`$" >   ̑<`B`;  # >"Đ"@ @`V" "  @ @2V6 ' 26 ,@ԒV  ?# * 8 &" \ `"  \``!"  \`@  @m  \@   \<" &< \z  u<"&<  |  #( &$&(V "`  `0, %`0'`%`   >  6  6 6@ x6 `` `@  x?6 `4` 0@ @4 , Ԁ &` <!` Ԁ 4@2 &<<@> a "a&<&0Ā&4&Ę '` ":T"6TV 42T 8>` (6-X@ " $&XT 8"  ? % 4  @5 BȐ ?.ր@ !Ԑ@X"@ 4&XԀ 2V`bV ^T@F B?   6> T! &T ;`  B 8 `  ` ``! `@  @d E 8*   @3`6@  `@c`|$`"1 V ,  T `6&TV "       x 6 6 6@ x6  6   " `?  >* ԓ:`ᰐ   >ٓ*ԓ:`    v@0r`A{`@60g`6  # 1`` `  < 8 !`   @ ~ `Ԑ 'Ԕ   @ n  501 "  8`  >* ԓ:`ᰐ } 0 >ٓ*ԓ:`  r {Y @ @ @㿐\V7`P>#$*` € 2I@ D`(4 @@ 2=@ 8   @6 `@8/. π 2-@ '`( `(  > !6 @& &  @ 2@ 2@ " @ "6 @@&$ @`` $  ` $  @`@! t  H    " X l  #?pt ''`` T" 4p"t"p`t"" l  l"  & l@ϐ ` T   d& l& p 6 T "p"t l T d n  l `'$'  `t `p" 4 l" " "`t $ < "`t"`p  l `''?+ l  pt ''`"?"`"?  $& lĔ  "p"t l耢 4 l & l l?  + ?p?t"x"| & p& ttcp_sack_option㿐 @ 2  " D  & D  >/"0&  &"  $" ဦ`"   " Ӏ H "  p  & H`$ $ $ $ & D& h  @">b 8 $ $ # '>  ,   $  0" "  "  $  & H DS?  $ $ @  $   $  $  " @ :$ 43 " .    )  $`$@ $` $` @*$`  $   $  $  @"  :$ $  D & D "  h@&  ǔ   h$@$` @r">b 8 $` $`@$`$` $ D & h& D 㿘 @ )V  % $`&@   H`"& H`" 4 @ `E  D?& D<& H` &@&` & H p" l   ` L< 2 2  $`     "  tcp_pulloutofband㿘` > 8  &@>-# < Ȑ `** " % ?& >  * `(:` * 2 2(& (8"@(  2 2((22*822*`R(88822  22ʝ㿐>"0    M` @`G` (   T 21"`;>!h`2)`<`4 2%`<`      ? #@ %  @g}    n' `<"?쀦 ``<"?0 * `44ಀ 8 @*b  ` 4ర?2$ 6 4@ 'C$4 㿘  ֋ 8 ~V 2>dl ":dP @a @* 2``6  ` 6 =`$@6 p "*`z@`H6 2 :  : 6  V * :  :   6 6  6 d "`:?+`@&ޒ>` 8 u\` "<?@&ʒ>` 8 a8``"h<@#h ,` * & 㿘``L@ 4`4```($`(``$`" `@ @n$``(& `$`$`(` `$`"@ `"@ " $``@ `H >  &    < `$  2   H` ( h``  ` " (``<" (tcp_output: options too longtcphdr too bigtcp_outputtcp_output: template len != hdrlen - optlenP` '`$`  8`? '  'T`T`@&`@`$``@  `(`@<`$`(`$`<` "@ > T``@" @ 2L`>"T`@ &L`j "L`   `$" ` "@  `L `" $`L`  ' 24``\* ? 4`` `\  "6 ` `$4`$`(`   '`$`(`\   ?`<`8 "@`D`@" 4   d` :[`L` 2W``đ2` `2P``@ K`2J`? `͐#* 4`, `T" " 69`* 65```21` 2.``," 4)` `#@""``" T`  T` ` 4` T` T` @4` `      .0 .0 ( < 6``8`1$`(  //ѐb 7Ɛƒ"   ܐ`@ 2 ` @A`"@A 'Ԫ `   @" ` `@c "Ъ`` ` 2`@ 2`@  a"`@>`@B` " " "` `@ ?!>T` <`(` ""7`(`l2 $"Б2 @   ` 6*pt ''̀`" `l#̘ # `l`@&p*@Aa  `((`>*5#H" ' ?>aܐ(>*$#h"`L`  2 `(> `l "`l`(`@ > `X`P <B ;`X #`P`H`D <B ;`H#`D#p  y ! 6 H /f * ' >8  2 H p@   & 6 && &  sF  >H /f!>͐* '!>!H   r !H& > !>"  2` > * 8 ?"  @$!HH 0  (  & 6 & (& $& ,& 0   ti >a ("@"@ & & `pu"  &s 7'`pv & `\ " &  > !`h "`h > `x "`x`,`$" > !`p "`p`t "`t#p  Ð ! 6 H /f * ' >8  2 H p@   & 6 && &  r  CH /f!>͐* '!>!H   qӒ !H& > !>"  2` > * 8 ?"  @$!HH 0  (  & 6 & (& $& ,& 0   s > 7V' &  & & ``2` >(Ő#x&"`>(#  `      ?`  `(`@$`(2 `( 2`(T` "``(` $ 2' $ ' `T`$В f `2`<**` $ , `<2 ?`& ? `͖#* 4``T"@ & 2 = 4`,`("@` @ 8 4 , `$$`,` "    @2` `     L` L`@b 4ؖ &  @iq (4L`  T` 2V`( `( $`(" `@`(` `$`(4``@  `(`"` 2`@`@" $`(T`  $` > 4`$`` "``@ T`` 2&``(`@" T``T``4`4`4`T` 2``(`$@"``T`` 4`4`4``@"@ 4$``  T`  찚& ` "   5 1  > 2` `l*` `e*` h`@` ` ` Θ '   ?, 4 ` @kB , ` ` @  @ ' > `7` @e - A2(T`  !4``@  "`@`T`@"@ 4$``?c`T $`4`  ' tcp_output REXMT㿘 V * : V  : > '5! &V >"T* ! * :`` 6  `x x6 V   `6 tcp_init㿘 >@>>Ր!`̖"> b ; <"b>aܐ < `> &"㿘 `f  pڒ  2  "   > !>!  ($` >!` `( `_C$` H /f'>͐* ''>H   o H$` > !>"  2` > * 8 ?" ` @$HH 0`  (` $`4`$`($`$$`,$`0` 2 qL   "`26` @  , 4 0$  $ `" <$$ ( $ , $ 0$  $ $ $  $ $d* $, @j4 , ` (6 4* <*@4 $ 4 4 $ $ , 4 4 㿈   `8 @ < 8 D" " 4    `? `@@< `? p9  >!܀ & < (+ p&& <& ``(`'` '`$'`'&`` &``&``&` &`$&` &` &` (& ``` &` &` 44  <`( 4`  (`& && * <*@ $ $ $  ,  ͧ<?#44 #4  $@,`   @ij 4`,`4 ` @f ( 4      @ 0@ 4` @Ð4 >4` !g>,`h `  $  ๘ 㿘    > @ْ &>>"<>2 8`?6 & @6   >"4 *`: *`6 6 & 6 6 6 6 $ ` 6  `& a&   &  `!> #, k> !g, l$ <㿘 V   `86 _> a`  "` > a` "``<V ʀ 2@4 $㿘   8 @ "` ` 2 ` 2 ` 2 ` " `   "`   @ ` 8*  @@ <b ^"]  P @ V *"@ *`" *  l * ` 2 $ l$ l P  V *"@ *`" *  p * ` 2 $ p$ p P 2  d `" d h 2  d2 @:   * 2 2 @@ے`(   `<`( h  2 $ h$ h  +#> `"  "` "@oT  E 2 H #> `"  "` "@o=  E 2 H "     2   "n $<*a` "` ?  * Δ ΄ * ΅* * ΁㿘  `"T@   > " ?  > P `0y> "̀  `'`'`@'` '`'`'Ѐ 'ɐ      07ʀE>''' ''''' '$  '   07 2   2   07 `@    q  > !`#\@I 0 >#\!`( @H 㿈`> `P"T M>!.   > /"? >("  >!h`> `*`  !` =  > ,>  "̀  > #T 0 > `*`'  !`#\˓0!`Ô  < ਁ㿘 <̿ `" $`4 2 `T̰  `T ? $$ (㿘 <̝    4 Β|?㿘H /` * ! >!` !` ?> #a  <"    2`  `$`  2 "L>a`*> a`` " H 00N@ 3>:1> `< 1`T  ".   T *` 4  8 @; @2` 2` 2   T   `4 4 @2`<b}@ޠ "`&b&"H 0  2?㿘``` H " & H d  2 & H`"|> ``" 0`V   >  V @ >"N6 ư`*`:  6  > 6 a`$ "`$V ʀ  < > a`( "`( V * :   :   V >"T* *1:  * :`@ 6 6 ` 6  V ` 6 ʑ   * : @6 6  $6 & (  <& L 8  2 @ ( & & 6 ѐ0ea`, &`, V * :   :   V  >"PV 6 `0>*: `0`=&`09 . 9. > a 4 # 4V '   8`>>bH> V  @a 8`# 8    $ T ?>"N6 >"J 6 a<`"< <㿘@tcp_usrreq㿐 `    @@S6   k  0H /`4* !  ` H 0` ` k   ! € h 8@I d " T 2 x4V < `!@CϒNߒJ 6   `!@C ϒ  9 64 C   2  2  "   "  2 6 2 6?#@2 6 `< @8 '   6  @Cv @Dː*) < 8 'Ŀ 2ݰ 'ķ հ  6  a ̀DŽ ŀ9 $ 7 <4}> >"#>bȒ`" 4 $84b}@ 8$b$L$,$$(%$$ -@ `!|0~ ~p@ 0  }y\p 5k`&@H 0t 4 2 @"Y !2U  Ȁ  O  K #&  E*@ Ȑ A,\`"@hd" 4 \j{1 7~\ $, $,Ő$, `!@EÒ֒ `!@EӒڒ K.@ >p"@    T H 0 ? B ? @ @p B B C C@ Cd C E0 C C D@ D D B E0 E㿘 H /`4`* !`  H 0 6 i\ <`  @` ` / @ؘ ޅH 00ySo!C **? *"<  (8 `"   /4 ?# @*4 "(  (# `$  @4 4 "  8T   4   $" `"$ @$ @#i5 0 h ' " "  *"   * "@ "@ @"@H 0㿘`` >`<  >>>"}U !>Ւa`6 ` 2 2`` ? M4`` 7 4` `!  "` 㿘 V ` 8;   T    {+ 8@  h㿘V `>"*` €6   6  V    {`8V  >  6  JL JL JL J` J` Jhh 2 2 2 @"  " 2y  2s  @a  В @a  _ Z H /` * !   `!>!` !>'`!`'`ȜȔ> aa   "a`!` !``` Ƙ  8  ?'8`'?''H 0"&@"㿘`V ?` P>"*` €>;"8>5"<>/"0>)">#"H>"L] !>А#ߚ @>">"!  * MP M M M M M N N8 N\ Mh M㿘>">š#`㿘@@!udp_input: received unknown IP version %d 'L'P'T'X'H 7o"' >!p`"!p 2    >   /    / "G2`c`ՠ   `@k !p` "`"    `2 !p` ;"` " !p 8$` -"`jl ''' ''+  2  2 ?#@      ?#@ @]* `"7 !p` "`/` @   6 @瀐* `7 !p`g#"t!p`  "` 0/@  //7  @'// 7'@  //7 @`6 @|// 7 @`*  < 8  >ڀӐ'j  ̀>#`#`  `!26`!26 @2"0$ $(  $, $0 $@`  `@2f"      @A  ` ` @2G4@2B`8沔 g8  0 '`@@ÖiW`8{" fP !pfJ!p`   "` z+`  '8` " `#`j`!p` "` '`@@i`8z Ȓy`]  Y !>#` m  '#`' 2E !p`$  "`$#`  #`    2- !p "  c` "  @k & & & &  &ƈ7 u 0q7o"" H /e * &  @1 #\@@ H p@  7  '`@@Ֆ ` 7  @. 'h\8 8z' !p8y< 88   0!p`  "` 髒 e@ e:㿘 dB    . `& $ $$  㿘 82 $ 8y 8 8    8x \x`,` (&`'`'`@'` '`'`''`    " 07@؁㿈> /!>!. ?򀢠 >" ``0 `` > `*` ' #`#\R0#`  'X'T'H'L'P``   !` 'h  `8 2@  p'h$`"B````a `$`('`,'`0''`0``!"` `  8`  8`   8`  8`  8D'hH /` * ! Ȓ  'hH 00+!` `  ``  `` ` 9`2  9'h  2   ?"?" /0  ?А?&   0 &   &   0dd  ̐ 7    0 &   7?#@  ('hy<`d*  @'l `(&@`.`@p'p`'t`'x` '|`'`'`'p@V ` ` `/q` /p'x'|''`@\l  'hl@\`.``@``$`@[h 2 h  1'h`$`@&` &`   &` 6`&``6 (7`47 `7 @Y7 * `7 <c7 `8`` `@ ='h  @ , 4 `0>$ ` $ `64 `4 4 4  4 @㮐* `4 4 4 ``!> !g, ,  `l,  `e, >p(`"(`8`@ ` 0`Ӗ#\'ha $``$`$$`($`,$`0$`0H 0c2$`ch㿘@udp_usrrequdp control data unexpectedly retained 㿘 `   `! @J0 60 ``2 `.`># €  H /` * ! >ڒc`H 0` >>"v    `!> #. k> !g. lH /`4 `* ! `! @:ΒݒH 0ŀ  `!")    8        H /` * ! @;H 0`  8H /` * ! H 0` t{  `!"         d 9H /` * !  `! >a##` $ $`$ 0`$ ($ ,$ 0H 0  ?>6 u;  `!@2>F7tߐ@K$  `!@=? R  `!@=O V   - ->"8 >_"Haa c f c g, d@ g, eh fX g4 fh f g< g$ g4 g, f f g, g, g, g, g,㿘H o*@ a H 0㿘`!  >   *0  *0> " 0: @ >">"㿘 @* H/H "H\ @@"\ 0 * @@ ``@2d @2`@2`  * @h!"݀@>O >#h@ >"hА Ւ > >  *`      1    ""@& & & H /f * '  @``&0 &  2" && &H 0 㿐>!0'L'P'T'X`'H`Ґ0 n / `Ȑ㿐>'H !4'L'P'T`@'X@ 7 :H "H \@"\`  ``*`*`@ * ` 222.` .` .`.` ``*`*`@ * ` 22`2.`.`.`.`.` `В*  "@`{0F. **@  *`@ "* "  n@ "& `"@6` "& @6` `@ఓ*`>c6` H /f * '  @``F"0 &  2" "" "H 0 > `  2   ̀  4 А 㿘`    *>#!0㿘`    *>!4IP Filter: already initialized passblockno-match -> block㿘H /e%>* &%>4   1>#>$#@ >b"H p@3 @)@ ?",?@?"'?@&?> ?"x@1 p#>U ""&#$4H 0!>Ϡ >5` >!X 2`@ :`IP Filter: not initialized 㿘>ǐ H /e!>* &!>#4  >U">"c @ א @&$#4@@@h@(H 00 > @H p@ 㾈#>c  F>\> L\> '> L' s' ''/ ,,' ' ' ' '' %! @ 㾀> !` 2    D .D@#C@; "H@ "  "E@ " ""B "> bP@ *bQ@%=@$<@ !t 0bW@bV@F@ G@bA@"c 0 0."K@0C"J@W H /e * &  >#4`@  H 08  .>#4`@ H 0#b=@6b<@~"T@b?@r>"@S> bB@bE@x  b>@"WC"@@x bH@9bI@߀ 0"A@"bF@"D bD@ԐbC@ р0AbG@= 00bM@ bL@0 "N@ 00."K@#0C"J@ ! & 䀢 B>z`lw l> p > p " @ڔ>͐"x@~ p>p &p" y"p>#  >`L`L >''\ >\>'!> s''/Ц#,#>#,%>' c7'/)>'' ' '`'`>'` `x''` ` t'' /'@}АӐ ! 03"2 ^0.(  @ '  0" @)&@  0  @%   @  H 0㿘>>p*` \  ` >?`""`@`2`p \*`  ` p?`""`@`2`p`L* @` ?`""`@`2`p`L*`  ` ?`""`@`2`@@ $ 0."K@  $` `  `X@  0. 0."K@"`X`  `X@ " `X 2  > ̀> \ ^> L.@* `   @̘ "  >͐"x@}` pL`e " L`u`e $`?$`L`u " `X`u $`?$``XL`* $`Xw` $`?$``X $`XL` " g` $`?$`  ` @}Y 20."K@    $ $    .!@ b=` ? $` " `? $` 2`  .b=@bD@, 2 a   ]   ` ` ?"` 2  `X@q@?$ࡒ I= 8   @$+0 IΔ  (   `"`  "`    $ $ !@$ $@    $ @       㿘 @&㿘`,  ?? [  2 7 7 2 >!ܤ ( ( $ $$@|Q$  $  <$ 4`  4 `   *  $` $`,`  , 4  (@4` 4  , 4 @㿘<* @ *@@ &> ag . @&㿐  ' 2!2  " !   "!H ! Z  >? 7!ܠ 8$ @  $ 8$@{$ .   <6.6  6.  @@??&  `&,@ ,`<4`  * 5` $@Ԑ4`IP Filter failed to attach 㿘A > !    p`'ؤ@{  / `('@'  `  " 2Y? '    '  /؀2"؀   X@ؒ?('`"`@2 `4:'ܒ 3 ' A 2`0`"``t "`t` )&@ .`>`p> \*  `&`("@$>c`x "`x &`( X!2 @@%4 < 8 ؒ@ɐ4 ؐ@|'@Đ (" ?`4'В ('Ԑ 7'Ԩ  t >#x  ! 4H /f * ' >b8`  2` H p@   $4$$$ XȒ >!ܔ @$$  @= `**` $@$ %?Ȑ*:`@4  @ 4  & "@ 4 @4 Z–  $$$4 @@4 '@\ܒ$  444 @*4  ` $ؒ|'YƐ Ԁ` >>c,  "c, ( #,` "`@ 8 ?"8 7'Ԁ`( `!@.`!&@'ܒ .`!&@Yԁ㿘<7 $7 "/ ' (/ 7 7 `3>7 2c+</ !@ 0(.' ` * 7 `@ 7 0' ,` 2 `  " `  "   &@  >.2``,  .޶:&? .  :&߱.  *@ Ɔ  *` *" + 02 " 2 K`O  H(`P` 2? ( "7 ( :0 ( () ( 8" ( * (  (`V(  ( `V   M K`NH(`R` 2? ( "7 ( :0 ( () ( 8" ( * (  (`T(  ( `T   ``" `H `H `I `?`` `I 2 㿐(6"&(6$` * ?* '  0 `?'` >#̸;"ئ " ```"`@2@``"`4@2@`4`4` ` @@  @ @@`X @ @ @  @  @@  @   @ @ @ @2@ 4 `L?#@2@`H?@2@4   ͒ "{@`X`J2 `L   2m@`2j@0 (f@`L  2`@@ ``  &(@ ϖ 2 * @*`  %  * @*`  ' `\2`  2`$ $``` $` `d.!6"`6$``&((`6"`&(6$ 2 @`#  X   A   ; ?@  "    " $ "   @ @4 @Y  '>.@*`L ? " >.@*`H  " ǔ`>2 `t $@ ,` $`4>.@*`   " @@ `>`p> \* `$`("$>c`( "`(``@8 @ `2G.&>͓*`"x@@vÔ ! > ,>.@*`@ `( )" X $$`p>* L`$`( t@ "ה ," >.@*`  " `( @ ' > ̀`$`(  >a "a>̒a` "` ("$`(`2  @3?>.@*`,.@*`0>.@*`4  " @1 >.@*`8.@*`<  " X @2 ?` @ >`p> \*  `$`("$>c`x "`x$`(@ Ӓ>$`(> `l@ V@ " .>㬒*`   " /    l@>.㬒*` *l@'>.㬒*`   "  @Ŗ @*   ` "   沔 U   .>* `5" 2>.#@*``  %" ! !!  ' `$`&`$ `2    `t &`t 2 6   ? o `' `dࠀ  Td `  ` `? ?008* 2 㿘@` , "@` *`` 2`` ``  6   "& & @|?c 4 *@  2"& & @ *66 >*d>* ` > *? @    2  2#㿐`XӘ   Iև   `6& & & "㿐 ` I-"㿘 ' & `   "@$   ?$   XՖ4  2$ I` 2&㿐 '2 >͐"x@t p>@  p "`>T.   >d  `>L.   >\  㿘  @t 2`    2    0\ 2\      ("    ( 2?  "  2" "?  "@㿘 ?  "   e & &   " 2 㿘> #  %>@ Q@  @ I?p!>*` \ #>p *` ˢ`Lp*`@ p`*`@ 㿘1>!  IP* >!耢+"!! @s)*`! I* A  $ !@s*`1>!  I5* >뀢"" ! @s*`1>"  I&* >뀢""?" @r*` 㿘 <> 8 2 @u(>b*   `@2  "㿘 4> 0 2 @u >b *   `@2  "`?( 0082`?((  2 28 2> ! `   I˰  I pԦ a@ `  pH /e4* &!@  `*`H 3` 4`*`0 `4 $`0`8`< $`8>! `* *@r F 2 P@ "5"B@"'"@n>p "R@*>i 0"V@ "M"WQ@ꀎ\ @J0"S@1pS "Q @ 'lIl=  E A  p ? L  $ ?$ L \ " $L l@ \ $ ) $$ H &#>; <  > * @" 8> <#>ɖ @2 @t>b* ` ` $ $ H &  4  > * @" 0> 4 @2 @s>b * ` ` $ $ H $  <8 *`" *  *   48 *`" *  < 8" 8$  `  * `$  X>!`2>>"""b$ `2 *  "@ I>ɒa`?G"`$ C4 *!>!>!>a>ɐ!>>!>" " $" (" 0#" 4" <" ," 8l @0%g @ _ 0" @'hh  @'hh!G H 0 ԣ I㿘 P#>@ H 2 H H"@ T@ L 2 L L"@ `" @` ?"`  @    $ `$  *   "@[h Ia`?"`@ $@T a"Y I㿘>! !>ɢ!$ `2 *  "@3@ I`?$`$ 4 * 2㿘>!!耢 >! @pI*` >! @pA*`>!! " > D w$ 2 D>ɐ!" 㿘>" !>!􀢠 >! @p!*`>">" @p*`! >ɢ!$ `2 *  "@ I`?$`$ 4 *  >>"""bp*'T    7 '`,'  ` I   ` @o֐T`4&   '$7  '` `'@'@ " <`$<'8 2'#>a & D2 "@pX!>!* @& P@!& H"@ $a2 @pJ * @& T@>& L"@`(T & \` & @. >@&& X& 0& ,&   # T` `  2͒ I 2 >ɒa` ` "`"`  $㿐` ;  ?@2V  @ /`,  /+  ` ` 2B  * 0@ &: `4@`0  ? 80    "  8@6    ' * ' +`@ @   ' '@  @㿘    &`,`   " `\ 2   ?# @` 2`  $ ?# @`$2` $ ?# @3` 2` @@ 3   2`3   @ @ 8"@ `\6    `  '>6   6 e  _ `  '>6   6 _ L `\ * `$`6@ >  ?#2` @ @ 3   2`3  @  @ 8"@  6  4# #`8@   ?#2` @ @ 3   2`3  @  @ 8"@  6  0 $@㿘>!7`7 @n>a* ` 2/`2 `  X@2% L (2! L $2 L2 > `@` >2 L` 4b"  L 8  a L ր` 㿘>!7`6 @n>a* ` 2/`2 `  X@2% H 2! H (2 H2 > `@` >2 H` 6a"  H 4  b H ր` 㿘>!6 @n_>a*   @`* @2 H "  X2  H 2 H ( H 2 @ 㿐   +`@  '  '  $$  84 㿈>!  `    :'`( X@2 @ ?@ ? ` ?   " ?`,?  @4 " ' -  , 2 '' /`2`+ "%?` w`64`64 `4@24`4`8 "4`8` <$``` H@$ H  >2 @m > * @ : 22   ".  * "(  4 0  2"  H 2L \ $6@2 L \ @T "  H  6I 2   2 `>"  - *@" `w쀢 `@`  @1>"?`$& $@ `0`, `$`0$`,  2E ` 2A `8 " 56`  `<@  >"@ $@>#@@@  >#8  2   >"$@ " `\ `      > n  @a@>ɒa`  "` 㿈>!'@`    7  ?@2 `   ' '쀊  `,    좒  ?@ @ "   ,'' @ @ "?`cu'`4b"`8 4`4`85 @쀊!24`8` <$``' H@$ H  >2 @li >* @ : 22  *`쀊 "+  < 8  2%  D @  2  H "  ,`5 @2 L l` @2     2   2 `>"  -`*@" `}`@` &`(`  @   n @#쀢 >"$@ ?`0`, `` $`0$`,& ` &`  @ F>` Ca`6`쀊 " 56`  `<@ >"@ $@>#@@@  >#8  2   >"$@ >`\ `Ŕ >ɐ >a  "a 㿘3!> !!耢 "`5 I$!` !>. I$`!>" "!>& I$" !>"  I$"㿘H /e * & >! !>ɤ!)?? $  D D$@@#[ $@ 2H 0㿐H /e4>* &>!`D "``X2:`D` 26`D`@`"2`D`! ? 2  L $ $  2 H 0` @? 7 $' (' 0' ,' 4' 67 87 >'7/>!` @2@ '䀢` @@2@' $'''Đ  @ >>> >!Є" " " x>"a^ ! ( 2    , "//7'@jq',   #>̐ @he a   IC  2 `(a`  ,"`  ($aЀ & `(`  "` ,  & " & &   {& >"?6 a`0* 2 6  ⠒` # $⠁㿘>   ?㿘> " & ?x` ` +`` 2  ` `  , /"/7''@i!,  4>̦#aА @g 2',  "`0  "@ "` & "`& & `0`2   @ @26  6   $ Ԑ 㿘>   ` ` & "`㿘>    > !*` " 2`*`㿘 `"  ` ? "`   I `""@` "` I㿘>  $! $@@2?> !, ?$@ @ ""@2 , 㿘H /e * & >  !$>̦!%>*`  2 $ $$ 2?> !,`#>̤!#>*` 2 $b$b "" c$ 2ّ,`H 0@?_@~>!X2`>ϒ@  :`㿘1>#P  IȤ* >뀢"#(?#P @f|*` >,>(>ې h" $" 4㿘 H /e * & >cP? G->(*@ ;@>ۢ h'>뀥  (   \?   "$ (`2``  $`  $`(`?`0?$`0c@@, ?$, ̀`(H 0㿈"B@! "@,>. "U@0"A@2% l  8 ' @Ȑ ' gR 80!M ?@% ` !>>#L,@   >ے`h`>  "`"Tx@e  '|//. (  & @& $  4@   "`, "j`, @ " @  " . D  " @ `6 @`* 2 *@2`@ 6 B @ . D>ۖ h>cH R"`, 2ư  6 B6 @ @@  "& P  `2  "@ *  "@@@ `& H& D& P *` 6 L 6 L!>۔ h  \ "   @ `?@16 B6 @@@ >ۖ h>cD "&    I:   h`  l"` >#P@gC`(`& `  "`  `X> l & & ?& `<& 0& 4#`6 86 :` 6 <6 >`   & ,`@*  ``@du` `$ , *>#(,` &"  2` h`0 "`0` "@& @& & & @"c,  ?& c,`%c,@@  $ `@ `.` 㿘    `?  D P) *  @ `2` "  D*` " @@ @ 2  3`#`#@ 2    " 0 @ @ "@ @ `"@ 6@" @ 1?"0-@!Ѐ)& ` *3`@" 4#@ @   >h \ "h &   & @&  㿘  $@@  . ,    `2  "     V  $- ) "%  @  B@0 $  "  B  @@ # 2 , :  2T  4 0 2M  : 8 @@ 2F  > < @@ =  26 @6 @  & D D & H 26 B6 B  & P P & T , <& ,`2   "   "&  "& (` ``@c  X @ 2  /ݖ`    Ӱ `,   `*` $ʰ `0?ř*`–@`4`  `  f  @  @   ` `  >#P@eS @` `*`4`4``>@`?('/ܑ. '` #>`( @2(@?ј "@`D  `@@2 `h 2 @`h $`h` `&` ```2`(Q   0Kh` "h` `&` ` @&` @ `*`` @ `>@ P @d @` `*`4`4``>@`?('/ܑ. '` `(2@''f >@`2`( 㿐?@ ` " 0ޠ  ` P@   0 0  2>@@ >#P@d>c(*  ) ( @2 ? " D    @@>뀢 2>#H$  2 ( p  j 0    `  ;>>#P@dEc(* @  (@''ט P " ;,2 . @2`3@ ִ   ;>>#P @dc(* @1>  (2'' #D$   .2 / @2`@ ״  2 >ے`h`  "`>  $ h`"h   $ &`(`  @ 㿘 ` ` ? "`  h Ie I㿘>#P '>(*@@  #>$c,?$c, 26((>ے`h"`0>",@ I$(㿘H /e * & >#P :1>->(*@ .@>ۢ h'>  "? $ $ (`2``  $`  $`(`?`0?$`0c@,?$, 2 `(H 0#T  &#T,  ` 0 ` "@ ("@` `l>뀢`j4>@"h) ><" a>;(`` ) >0"`` L) J H) ` ) >0>"< `!) `>뀢+>>뀈` +>0("` ` >뀢` 4>8 >4"` ` ) ` >뀢>8">4 ")   x ` ` x x ( 4h (7 /  ' ' $' /'/連   @  B7 7 ] \//27 D77ؒ '''̐  ԖИ@  㿘>#P $>#(* ? 2  j ` $ $  2 ` p $ $  2 >㿘!>U"@`   $ X$  `k Є   Є _  Є Y  (8-T N `8k?`** ` 8Y?`** ` 8G?`** ` 85?`** (8*  $?"!     뀢2 斂  (28 㿘 I    &@"@&8 ?@ J@ @ (J@ @( `Є ,  @J@ @ (J@ @( `Є  +` @USER PASS PORT %s %u,%u,%u,%u,%u,%u PORT`, `@_" @2 4 ` * { `` `A&`?0@_ //8 3 8   0><c@^  2  ><c@^  2 $ 2 >#`2 ><c@^  2 ` ']ԑ* `2 Vԑ* `2 ,` @ @2 IԀ`J@ ) `'J@ 2Ԑ'J@ 2g J` 2c `'Ԩ ` *` 2 ` `Ԥ8#\><><4`$cȔ#`#dŐ@^D@@~ ,`6`,#(4  +`@ `'>'܀ # 8͒@^S  ` "5&` @557' 7R >""h"&` 㿘 331530230227 227 Entering Passive Mode` , @2 4 ` *@^ `r"` `` `@`K0@] //8 8  !>=cА@]  >= cؐ@]  "$ >=c@]   $Ē   >=c@]r   `&>= c@]g  O `' Д'J  А 5ԑ* `2 .ԑ* `ޙ2 ,`(@ @2{ !Ԁ`ҔJ@ ) `'J@ 2Ԑ'J@ 2c J` 2_ `'Ԯ ` *` 2 ` `Ԥ8#\><#4`$c;`@]@?ǒ}q " `6`   `+`''>˘؀ ( 8鮒@]4 ` `-&` 5`5@&` 75`@!' 7/ >""E!&`&` 㿘㿘!>U#p@]   $ X$  㿘 , &@ I   &8" 6 6?   *`0 (:(?З*`Є ((2 8 4 ,@ `2  * ("@\ 8 >Ж8 =/.2  5  +`@ `'>'( & 8 @\  ` "4&` @447'7쐘  >">U"cp'Ȓ"&`  㿘㿘!>V (@\d   $ X$  㿘 D Iu   &8@\S D8 D&@ "  ?PNA㽐8    ,@ 2`@ *`@\5" 4"`yb">>  >?#p8  e &2  2 "V *  && K"F 2   *` &6& 2    *  & 2"  2    ? & *`  6 2  & *` 6"&& " & (8   ,@`  42`@*`"ؐ@[  = @``>?#p 禖 #&$ @   `@$@  "8 <  & <(  $ < +@  ( < <#@f b  1 2*  $  3 4* @4 $`  .`  ` &` ( `&`糔 8@[9 >V (''5    2!  $`  "*55 2 @`77!*  >"@?" >  " 5 @577 >""'"&`.` &`  n" 2 2 ``   `   㿘 /   +` @& L I   @Z L $& 8` && <& @?> I >c& 4& H"c㿘   @Ĕ& "E?  <@2@?`2``4`,巔* `2   >`* @*`D ? &" ` `,`( ` @W`4勔4`  ,  0@  $ 0$ ,㿘>#2 0@Y  2 0  $   2   " 㿘 #>`@2`H H "`H`@2`H H"` 8`  @   I I㿘 ,@ 0 `(&K  *V@ `?/`(` 2@ (`P` (`@ # @? @ &@(`  6  (R@ `?.(`@L 2@H R  `?/`(`  2  (`P` (`@ # @? @ &@(`  6  (R@ `?.(`@ 2@ (`P (`@'# + 㿘>#     0㿘># `   0  2 㿘> >`  X)>>ʤ!H , * @2D  > 2?   @YI ! 27 @ > >!@ * ༒`?%!%@ -# >ʘ!H>>` @ @?2   `D   @>" %%ༀ " , !`  "`㿘> > ` 4 >̀  >̀` >̒a`  )"` >  `` " # #`#`>>ʕ, H *# #@   "  8>Вb@, >"@  İ fr_authnextP .bF@& b<@ =b=@bD@7bC@ 4 030 "N@G>bG@ 0(0bL@DbM@i > Ȧ  2  ."=@2 2   $@ I$&0 I_  䳔 > >$ $ $&@$ $@"  Ȕ (>̐!" $䜒0>>  >А"@* *@ >ʓ*`!H@䅔 8 Đ  $ $ İ >C ĔP!(Ӫ >0p D` ,  >ʒ@*`!H  >`> > "@,  `#?"" H /e* & `(      >̒a` C"`a` >"`:> @`7!"! 7  2" ">"h` ""h z > >  *` 園  t  >̒a` "`a` "`  70> >* aH#  ?"  ">  @? >  `D  2@ `@>" #`#༑H 00 㿘>ʐ!H>Цb@ +> ?  "D6$$D `Ȁ  ` $ I 2 >" ́㿘H /e * & >ʤ!H>̬a />+>? $>Т"@,@ "6o ?` $@%% %` DDȀ>̢!?  " $ I`  $` 2>"`̑H 0㿘> !> > c!0>>a!P    $$%%@V 8Ȣ?``?@,`  0 ($@"` 0 (@`@   4 0 & 00 $( @`$0 8`@ؒ@V   "  `"`8 ""/$7(7쀢 / ^<c7@  ''''''̒' ȖИ@ 㿘`"> !0. .  %>$*`P@@Vl !  $ ` d"`$P*`@⟔ !  . "@>*`!P@@V ! @ .``@  I-  >@ . !   ޒ I3 T" M $@$`$`$`@````   ] 2 7 > c@> !0"" "@ ipl sleep㿘  `` #耢@ H /e * & >ɮ*!   H 0 > #>Fh!(= rH /e * & `> !@ܬ&`@ D `@?>ɪ! @  "%@ % H 0  H /e * & $ @%@%@% IH /e * &   `@(@   > > # "a0"@"H 0 㿘> !. @  .   $@ I@ 2 . >ɛ. " > c@ "@ > >*0!P " @T !IPsec ESPIPsec AHIPv4 Simple Encapsulation㿐@ ` j (!` d^  'y| @W&@'? (NH /` * !  @G H p@ 26  KƐ!@@T!@&    !> !>! ; > h. & &!@z. >!,`$!  `: & > X@^   '@ 㿘>!\`y >!l` )>+>v $!l!p !lv %!p!lG@  @,  ?$ 2 @!p2 @  @&@!p# @ ah⣐ ah8  @ \@QUah  8  @  @  @ \,`@  2@ @T, 2 2㿘>!`` >!l`` )>1>vB $!l!p !lv9 %!p!lŐ @   @,  ?$ 2 @!pⰐ @  @& @!p⡐ @ !h! !h8  @ `@PӔ!h  8  @  @  @ `,`@ `" ! "  ! !!"    2  2  @ @S 2  ܒ! ـ`㿘>!d` >!l`` )>1>u $!l!p !lu %!p!l( @   @,  ?$ 2 @!p @  @& @!p @ !hᄐ !h8  @ d@P6!h  8  @  @  @ d,`@ `" ! "  ! !!"    2  2  @ @R 2  ܒ! ـ`no tdb hash table tdb cnt bucket cnt %d%c %d +X!>!\ >I蝐!06@R @>!h @!\,`   `` 2`*` ` @ " >I!z )>I'>I%>I  !`k`` 㿘>!\`  >!h  !\*@  " hĀ  2h!\㿘> q ᰕ:  X 8 ` ` \ ` x` ` x ᰖ ; B8`2 x` x |@@ @ ?`dᰕ:  ` 8d2 x d d x |@@   $ @ƒ !`"` x ᰖ ; B8`2 x8` x |@@’   {$ @ `쀤 > !! p:` 8 2  t ( > >!!X! ;` p8@ !>Ic @N0#   tdb_expiration: expclusterlist first link out of order (%p, %p)tdb_expiration: expclusterlist prev link out of order (%p, %p)tdb_expiration: expclusterlist next link out of order (%p, %p)tdb_expiration: expclusterlist last link out of order (%p, %p)tdb_expiration: explist first link out of order (%p, %p)tdb_expiration: explist prev link out of order (%p, %p)tdb_expiration: explist next link out of order (%p, %p)tdb_expiration: explist last link out of order (%p, %p)㿘  H /` * !   x |@ x  B 8 @  B  x |@ x  B 8 @  B "  X X8  X \@ X"  ` `8  `2 p d@( p ` p > t@ >H 00  , "  p8   t    "   pp@2  tt@ `>I >I# `%`2>   " p> a>!X`a >I::#p  b@  d@L ի  p t / (`" $p2  $t2  $$($$ ($"& ( $`" ( ("`("  ( $"@& ( ,`" 0 0"`0>"  0 ,"@ > pH 00k` `` ` `> ,"($ @` p8``t `0쀢8ꀣ``t䀣``䀢`0`䀢 & $ $"`( $"`$& (쀢 & ," 0"` 9& 0 ( @ ` $ " & , 0& 0$& ,$ 0"@$" 0 & 0 "" p8 $2 (t@( ($`& $ $"`( $"`$"$& ( ( l䀢" pp@8>J tt@>J"(  pp@8>J tt@>J"h 2  $䀦 " $>J"(p p@8>Jt t@>J"   ` "`>J"ڒ `"p p@8>Jt t@>J"Ĕ 쀢" 0p p@ >J2  0t t@>J#(㰔  0 @p p@ >J t t@>J#h㚔 2  ,쀦 " ,>J#(㏒ pp@ >J  tt@>J#|   ` "`>J#o ` pp@ >J  tt@>J#ؒY H 0㿐!>!h K* '$!h Ǒ* !h K  * !h   K* !h`*`@N!h`@N*`!h`@N*` a>!\*@o'1>/>>!l`  p>쀢 "al!p  p &!p>!l X@ @  @-   ?$ 2 @!pD @  @& @!p5 @ hܵ h8  @ ,`@Kgah  8  @  @  @ ,` $& >>a`o>1>/>>!l`  pf>쀢 "al!p  p\ &!p>!l  @  @-   ?$ 2 @!pҐ @  @& @!pÐ @ hC h8  @ ,`@Jah  8  @  @  @ ,` $& >>ado1>/>>!l`  o>쀢 "al!p  o &!p>!l t @  @-   ?$ 2 @!p` @  @& @!pQ @ hѐ h8  @ ,`@Jah  8  @  @  @ ,`@ $&@ >􀢀 >>a\ K>a`>"a\ K>ad>"a` K>"!d㿐H /`4'* !'>!\1>쀢`(;>!h K  * !h&\`*` K !h'a``*`   K>!h"d`\@L*`!h`a`@L*`!h>`d@Lړ*`>!l```` +>9>Z`o2 %lap  o) %apl۵@    ,  ?$ 2 ap۠ @  & apۑ @ !h !h8  @ @IÔ!h  8  @  @  @ \+ @ p\ k!0!h* * ` d\ l` `n %lap  n %aplB@    ,  ?$ 2 ap- @  & ap @ !hڞ !h8  @ @IP!h  8  @  @  @ \+   &@" l `n[ %lap  nR %aplސ    ,  ?$ 2 apɐ @  & apں @ !h: !h8  @ a`@H!h  8  @  @  @ a`,`  &`" l `m %lap  m %apl{  ,  ?$ 2 apf @  &apW @ !hא !h8  @ >@H!h  8  @  @  @ >!d,`@ &`#@ > >!0; '!0:ؕH 􁊀㿘>!\`ź>!l   ` +>3> 9>Zmr %lap  mi %apl@    ,  ?$ 2 ap @  & apѐ @ ahQ ah8  @ @Hah  8  @  @  @ H4\(\*   ` l@2@"@l  &l %lap  l %aplx    ,  ?$ 2 apc @  & apT @ ahԐ ah8  @ >@Gah  8  @  @  @ >!`,`@ 2  "@ ` l`2` "`l  l %lap  l{ %apl  ,  ?$ 2 ap @  &ap @ ahc ah8  @ >@Gah  8  @  @  @ >!d,`@ 2  "@ `"  `2` "`  &  @ & `"`&!0"@"!,2 !4`"`&!8"@"!42 p t@ ;]& d "!Z L& ! " S L&! `" ` ""`  ``""`? K!0?'!0H p@㿘> >; > h&!&!,!,&!0&!4!4&!8>>!X .`2  X  * Hashmask: %d, policy entries: %d SPI = %08x, Destination = %s, Sproto = %u Established %d seconds ago Source = %s, Proxy = %s Flags (%08x) = <none> , uniqueinvalidhalfivpfstunnelingnoreplayrandom padding> Crypto ID: %qu xform = <%s> Encryption = <%s> Authentication = <%s> Next SA: SPI = %08x, Destination = %s, Sproto = %u Previous SA: SPI = %08x, Destination = %s, Sproto = %u Associated interface = <%s> %u flows have used this SA %qu bytes processed by this SA Expirations: Hard expiration(1) in %qu seconds Soft expiration(1) in %qu seconds Hard expiration after %qu bytes Soft expiration after %qu bytes Hard expiration after %u flows Soft expiration after %u flows Hard expiration(2) in %qu seconds Hard expiration in %qu seconds after first use Soft expiration(2) in %qu seconds Soft expiration in %qu seconds after first use (none) x`0>V @H &@>`>ah >#`>R АHc>a\  >!h ;>SH /` * ! \, @`>V -> +>S1>S> a@&a``'`'`'`%>S'`'`'`@N'` `h:` >Sb `@`İ'`Ȑ'`̠'`'`'`'`@+'``ဢ``'`'`!>S'`9>S'`'`'`@'Ȓ p!>S’ >S` `ݺ` xQ>Sp`` >Sݫ` `  ݡ` >Sݚ`` @ ݑ` >S݊`` ( ݁` >Sz`Ȱ` @ p` >Si`а` @ _` >SX`` @ ">SM`>SH`>SaB>S`a<```>S3a ` " ` >S)a0` " ` >SaH`ਠ''''''@M'` `ah` ਢ'!>S'''''@/'`  `!a(>Sa۔`<>SbՐ`P>Sb ϐ>SbHʐ` ` >SbX`X: @ ܼc `  >Sb``: @ ܭc ` >S`@ܤb` !>S`Hܛbа` >S`4ܒb` ">S`8܉c ` $`x`|@>S>S`xcH`@C: @ c `cpm` $"` `x`|@>S>S`xc`@C: @ c `cQ` '>TI`E H 00@`>H 0h      @?    >|  >  >@   ` `` "0`` "`"`0`"`0 "0%d.%d.%d.%d㿐#>at`'"@ (  !>Z * >Va$atat*` . (unknown address family)㿐 ``  1>V '@  " > Т\` t&    ?i&@EN 4@EJ @EF ` ,  0`,``6 /R& 4 ,   'J`   'E`  '@` //// ' '   24  @ * '(` '#`0?>4  4 ,   '`   '`  '`, /// ' ' ' ' ' ' ' $' (  24 , @  &`. &`004 *\@20&]y א A`"8`  8 ?"8ʐ A]h  `?"82 A`>Y *` €& A}  " %a  |        || a a  " h$d  `  l  p  t  `     `"`"8"@& 2 "- ?2)@DY| 2}8&  "  2+& 2 2  2 2&``@D0 "`""`"a8"@&> @ # 2>   > !!:`> &&!8&!8""a8&  > "`   &  &` @  ? @  &`" `ŀ `@Cǐ "`""`"a8"@& "_  X &  ` @  A&} A` @ "r& m A> @ " 2>   > !!:`> &&!8&!8""a8  >G A` @{ >&;?:& >5& @ " 2>   > !!:`>︐ &&!8&!8""a8  >&` @C && &  ^, ^, ^, ^ ^$ ^,x`}      j "`f ` ``  `` `` ` `ؐ`|/ `@B   A  //ِ  //ِ  $` 2,  Ē@Bǐ Ā "%  ŀ "     0"  `? 2  Ѐ 2   Ԁ 2   ؀    㿘   0 \6    ` "`"8  "@ `"  "`>"   "@ " !  "  K>`А?"`Ёh Ȓ KK  > @B' ȠȐ@B# 0 0  //7ʔ'̐ ([  K# >А`"В} 0 0y 0 |u . . >  `&  "`Đ ""& ā㿘> `5!> %>Z!!: ` >2`(`$ >`(`"`,`,"`,`" `,`("@  K`!X! ; ` !@ 8@>Ic    0`㿘>  @@Aڒ "=  ( 2@ 0 K  0   >T> a  :< $ (`` ($ ,`""``>a!Xa ;  8@ !>Zc @>   ƺ @㿘7o"" >!x`2 , 2>c `  "`  (  !0@@*!㿐 7o"'H'L'P'T'X >!x`H  , >c `  "`    0@㿐># 7o `"#      # 2   0  ( #   ` "`Ȓ 02 `  /` @2 /#J " 2   0h  ( #    ` "`2   "    @'  @ 2`/@@* %@* @%@  ">  4 2< > #`"7 ` .># ` ` 2" ` @`$ $$"  ` 2 ``@@  2  ? Ԑ0d ؀ ``2`   " :  B ; ># `> д H /f * '  @`%    `" H 0&&  2" %>h  ,@ %%"hc5 > > *`  0 H 0㿈  " `2 `/`"`09`ŀ  >`Ȁ  ` 2  > ,`K",&_  2   "   "   & &    <     & < @* @ *@@ $@ >4` g4` ,``$` `$`4`  !  ,` !`` 4`  ! )2 /,` 4` /@̒,` 2`` 2 `` 2`` >`ŀ >`̀ 2 `Ѐ 2 `Ԁ 2 `؀ 2  > ,`",&ʰ 7??  ? ? 22 ? ? ? ? 2 2  2   " '  (" ' ؐ (& &  (ٔ        (& 2  >c ` 7 "`&>$@ @  `,@ 4` g,``$``$``$` `$`$`$``$` `$``$`   ) ,`=&Q / (  ٖ )2 /,` @/@* @ $@$>&c `( 7 3"`(># ``#`&`  `` `P?쒂B>`P `?쒂B;`` 2 `` `P?ؒB>`P #  ?ؒB;   "   ipe4_input(): should never be called 㿘>]q" ΐ㿘`    *>٘!x㿀>"Р>!'L`'P'T'X" 'H  , 2   `" 0f  " , 2  "`"0W "В`$"0N :  ΐ 2  " `v"0>"  "& & &  @ 8C  8     <6 耊` >#@>   !6   #  `d "`d A  `,  H* 8㿘`ŀ   >`  >`Œ `@ >`` (  `"  * 2  ??" 6  `  4  " @ & & 4 K     4   &   >>b` 7 O"`b`4  #` # `( ; B;`(`  "  9& <* @ *@@ $ >4  !g a, , , 4 .4 4 `$ `$ >"  `* 2 g*`"`"`" `"$`"`" `"`"& 㿘`    *>!p 2>>ْa`, "`,b`( "`(  2>>a "ab "b 3>!` 32 >!`2 K 22>>ab`L "`Lΰ -"  29 2>>a "ab "b ʖؒ` ĖԐآ@< /ـ  0 /ؐ  0/ؐ  0 22>>ab` "` .H /` * ! Ԓ 2 H 0ߐ 22>>ab` "`b  "H 0Ȑ 2>>ْa`4 M"`4b`0 H"`0 2ੑH 0 22>>ab` "`2  2 x( 2& > & x|@2 > !!:`>x `  H 0  H 0 ` ``22>>ab`  "`   2 `2>>a "ab "b 7   `*`4 @4 4 `"'$  `*` ٖ`ဢ  `䀢`쀢 `ဢ   $#`22>>a$ )22`  `*` (`ဢ `耢 `쀢  ` ` `@;  `ဢ  " ``22>>a`ŀ  `Ȁ`     ֐`22>>a2  ( 2 `2>>a "ab "b 4  V$$ " ) M`ဢ  `䀢`쀢 `ဢ   $`22^>>\a$ )20`Ő (+`ဢ `耢 `쀢  ` ` `@;0  `ဢ  " `f`22->>+a`ŀ 2``̀  `Ѐ   `Ԁ  `؀  `@;  `ŀ  " >`22>>ab`L "`Lz  `7o"@   $ ̔  & `2>>a "ab "bZ  ` ``2 *  ` "@` "` $6 ` "a( (6 a( > (  `','( ( ,'@'0'D'8(Θ8`20`2`30@@M`3 0 @ @  .㿘`    *>Ř!㿘`    *>!㿐'L'P'T'X'H   3㿘> @&&  " `7o"@ ؒ m>b` 7 !"` 2" ">"h` ""h ]  > >  *`   Ǽ  㿐'L'P'T'X'H  Ę 2㿘> @&&  " `7o"@   >ْa` 7 !"` 2" ">"h` ""h \ > >  *` Ǘ  o  ah6_input: l went zero or negative㿐@`'0 `('  (%>b  3 *  *  4@@ & >b! "b $@E !㿐'D 'HRA >!>>٠`ܴ!># D 44>H 6  ``B >` ,> 0c'> #> `*@D0`B :0* @*`@*` DH> `B :D `7o"@ Ò DW esp6_input: l went zero or negative㿐@`'0 `('  (%>c ݖ 3 *  *  4@R@ & >a! "a  $@ !㿘[㿐`23>!` 32`>!`` 2` ΰ A `  {`x`|@ > !!:`>`xK 2``" " (  " 7 ` 0` @+``% `` @2[`` ``  `` `` "K``@8V  "E`ݒ      `4 *`@4 4 ̒ ( 2 R 7?ؐ#@( pH  ?4`  ` "    2V.''``@&"`@`  "  (   *  @ 㿘`  " 0  2``' ?ؐ#@  ?2` # `` ` ```    ( M      @Eq  H `-`E>e!8*` €>!> !<> !>!`>!>!` *u ` 8q & ` @6 *`2 6   ">  >[ >W !" "( @"& K   & &! `&! L6 * /2 &!Ä @7  $  '''* ''   L 6 * 2 &!d @6 $ @ * ''''   @G  0 < H $㿘! " !@6 ! L&!! @6 ! L&!@G   > 㿐` ` `` ` `  ` `" 2>ـ4 `>ٔ`" ` *` @2'   `a @3a  >  "  `">ٔ(`"(װ 0 ##`P# ; B>`P >ِ""" : ! 8@ B ; 8` "` `@`P@8` `D`T@ @0   ` !``H`P@8` `L`T@ @` ~&` ` `2 @H  0) L'  `.$#@ "@ #`  L"#`@ #`a#```4*#` $ , Lɐ^@HR`P 7 R"`P "@ $$ , >f"T $$$($` <$ `$ $`$, $ (`9 `-$@ " $``" $`` @` `ǖ` '  8* `` '`  $` @$`a$``* $`@Gsx   ( $ ,H /` * !   T L2 >ْa` "` @" <  # >ّH 0@G8a` "`  `>ْa`P  "`P`  " T` @5l " ` >ْa`$  "`$  L@G @  Mܠ  >!`"!H 0j2  w  25"0$@ *! ( f"@  " "@$$ X"   2$ " "@$ $"  M "$ "@$ "@ >ِ! `" H 0 @2>ِ! `" H , ` T H p@H 0``V L@F``@4l ` `''$'`('a( 't'p`'h >  ( "` xh` @`   " @2`@2$ `  >٠a 0  $ 0` @ 2`a 2 `` " `   c$   @?@#@ ~`H ( M"`Hv` . E"` `P# ; B>`P `@# ; B;`@` !`@`P@8` `D`T@ @В 赒 H ` !> `H`P@>  `L`T@ @` ~&` > >!䠖 a   " ,    "(  " ,   " 2 J`$ 沔    `%Ѱ 7"$ǖ  2 ` 7 "`` ` @ a d'd`&a  ؒ`@G 2`  7@   c,@  &Wc*S  2/cST ` 2 @E C4@`$'  " ' ' `%@' ` @ 4a$`S0` ` 6   @ 8* ` &   ' ' a' `* ' `$ 0 L   2 `\@EP`P 7 )"`P $ ,`$, `N  >i! $`$`$`($` $```<@$ "@$ "$@$a$`* $@D㿘  H /` * ! ` `5@~ L 2 >ْa` @"`   @" <   # >ّH 0@Db6a` "`" >ْa`P  "`P@Dڐ @  " }!$H 0H 0Ð@D 2+   " : (# "   >ن 22>ل (# (  (㿘`V     "  *  9   >    3>#t   2H /f * ' >8 2H p@ """2  2&? 0  &  &   $   p ?`>j"*` €> !> " >"(>"D>"`  ` #  &! & & &!  L6 * 2 &! А@1 $   *''@B('ܰ 㿘! @1i !D L&!@Bi   > p``o 09 &>b 7 ."b ,, 4 `4 4 84 4 @  @  6!@ "6` @'  @! " @ 4  @ @  ֲ@@ @ ?q  >  "i@@>& @ΰ А  (Ԁ  >`O" ('/א ؐ ``/ِ " 7ڀ` ِ  `7耢``  `   7 P̔ ((  ؐ L   >` "z 7 ( آ (  ր_`+K@`<`0JI@  * 6;!> @2*  *  "`$"6; L?   `> "ʔ "`$"$ L(  * & @ *  L>`"    (PB L 㿐` !`'D   &` ", ` 2( D  `a a  >  "   7D`_"0>  7D`V" 0*`? >$ D`G"$0D>` `P""B>`P`" 8""@ B ; 8` !`@`P@8` `D`T@ @{ 䊒 D 0` !`H`P@ `L`T@ @{` ~&` @B4  D 7*"`$#@ #`#` 0#`a L#`` *#` 2 D 70 L  $ ,D۰ 7 LA@A̐"`P ;"`P  Dn D>  OpD` 'D `>m$`$`D $`$`(``<@$` ` $ (`, $ $$ @A  , L L@Ax   ( $ ,H /` * !  ڝ L`2 >b` "` ```@" =`  # >H 0@@ʐb` "` `2 ` >b`P  "`P@    @. >b`  s"` ,Nג  L@Aܠ >"`""H e  2      ;4   *# ("    `" "@$`$ "   2$ `" "@$`$" @ @ې   "@$  `"@$`[H p@H 0`  L@@` @.1'Da( 't`h` D''''h'p >  ( ">Dh>" ,`$ ,a 2` `  ` @ D x   W$ ` @  `  2DD? c   \ ("`H :"`H U ."` 3"` `P# D; B>`P`"`@# ; B;`@` !`@`P@8` `D`T@ @y ┒ D & 0` !D`H`P@>  `L`T@ @y` ~&` D> >!䀤 a     " ,   " 2 J`$ 沔    `" 7`D %"0"'D$@ ߐ D   2  D Ӱ 7"` "`Dl  ?2 , 4 `> $ D Me` @a $  &a @?ߐ  DD  7$" 0$#`#@`#` L#`a #``*?#`   L9  $`, LD  7@?|"`P d"`PD  `  D& 3`,f q f @7fD M D`,f _ f @7fD L D 3e/eL `,D*@`s  2`,D `>o$$D!$$(``<$ ``$`(`,` $`$$@, @>  L L@?㿘   ( ,H /` * !  %n L`2 >b` <"` ``@" <`  # >H 0@>R7b` "` L > L@>ɐH p@>b`P  "`PH 0    L@>㿘>> !    *`*@ *   >!*`  -" *``  > >Ӡ!` > > (`   #@  - 2 *3  + 2 * 2`@  `c ((ဥ>>!Ha>>۲` x> >Ӻl!`   > `( $ 4,4,%@,4 (#@ ">!H "  @*C @@    @*5 *` >` 4%@4,4,, 4,4@,%@4 ,"  "@">"!>"`x "@  @*  `   @)*` `  @)*` `   @) *` 4,4, d"4,h"@ '@&@q` >"!㿘>!`? !`& 2 &@& `$ `$ ` $  "<` 0À n0>!H>!  3+ * 2  # 2  2 @ * @ .` @ @ @      `` ݆>$ `aH>! $  3+ * 2  # 2  2  * @ @.` @ @ @       $ ( ,``׆U`>$ `H$ `$ `>! $  3+ * 2  # 2  2 @ * @ .` @ @ @    $ ( 3 , # *3 3 c@ *    @ 0  4 8 <``† I $@ $` $` $` *  @; #` ` 2`*`" * " * 2`*`" * " +  2`*`" *  " ( 2 2*  *3+ @   &*  @ ʹx`  @')>`'`''!1 (4`#7 @((7 1 4 #(@@7 '`@.`@4 4`@#(@4 'ܵ.#@4`1 `( '@` @۲@7`@(@7 #6`((''7 ߰#@(6`3.(6`c@(3` 7`'(.`37`7 ` c/ @'` '8!((@. 6(.`@2#@66@(@'ر. 6@6@2 `@ (@@ @'ܸ(62 2` #*@ @ @'` @@@'۱7`(#@7 6`(@߷7 `(6`@@ 6`3'(@.3 `c@7` '(@.``37`7  c/ @@'` '`!((@. 6(.`4 #@67`@('ر. 6@7`3` ('ܶ(7`34 `c , @ @'` @@@'۱7 (#@6߅6`(.6#`@ 6`2 @( @'. 6`c@2 7 `@(@@ '(2 7 6` ##.@ @'` @@7`@(#@66`(`'@'ر6#@(6`. 36`(c @3`7` ('܇(3` @ 7`6c.'` (67 c6 @(6'@(c@6 `@2 @(@@'`'6 #@2 (2  #7 ((`7 @6#.'` (636 c(@`6'(c@6 2`@(@'س.`6 #@2`3`@(@@'ܶ`'2`( c@ 3 6.۰` (67`6 c(@`6'(@c@@6 2 @@(@6 '.`#@2 7``('(2 7`6` #c.@@'` @@@'3(#7 @7 6`(.#`@6`2`@(6`'ر. c@2`@3`@(@@'ܶ(2`37 ` c / @ @'` @۲@7`@(#@66`(`'@'6߰#@(6`. 2 6`(c @2 `7` ('(2 ` #@ 7`6c.'` (67 c6 @(6'(c@6 `3@( 'غ@`@@@'6 #@(37 (7 `(# 36 .@>aH'.`@7`` d6h@6 l('(@`6@c 6 2 (@ '.@6 #2 @7``(  @'`@@@'2 (@ #7`c6@.` %` %@%`%`'x! -` (l@@`'L'`'d`'h'>ۘ55`$((#5`@c7 7 .7 ,(*`@@ 4+#@ c@4@4* 5. @5@5`@ (@@  @@'ظ    ۶7 (c6#@6(@?''''6ߕ6*`  67` #@7 (c7`@6 .*7 @/ @ 7`@/`@     '''?>ۚ. @d.`(.h7`2@ #@( c4 47`*   c*7`l/` 2@ *@4 @ ,  4@@, @@  @ @''܆ ''6`0#ߔ (۩6,@7  + @-` #@ #@07 66` c7  # /   0@66` ..`(@?@ @@    @ @  @''''?>۠$((. 3 . c(3 3.3 c3,5 *` *+@ 5`@ # + 5  - @ 5`@@-` @ @@ @ @@ @''ܶ ''ۇ6(7`7`*` 6`6`#(6`c@*߱7 7 * ? 7  #6.  6@7` (/` @@  @ '  @  @3@(#66`(@?''''2 (63##6`6.2 6`c@(*`@*  @2  # @3 +@ @@   ۅ6'܇(62߰##+7`66((@c@?    ''''7`(2#66/ .7`c@@ 2*@@ @@ @ @@@2`'22`#c2 (6`@(6`/ @. 22   +` #2`  (@?  ' ''ܰ'6`(c2  #2*@  ۳0'ߓ3c( c6 /`6  #0 *3 #66  - 6 .06 @ c. (@  ?@3@+@ @@@   @ @  '@@ '''6(7`7`*` 6`6`#(6`c@*7 7 * ? 7  #6.  6@7` (/` @@  @ '؞  @  ۲@3@(#66`(@?@@'ܒ@''@'߇2 (63##6`6.2 6`c@(*@*  @2  # @3 +@ @@   6'(62`##+7`66((@c@?    '''ؐ'7`(2`#66.`. 7`@c2`*`  @  ۞> x6 '(߇(32 @ c$@ /  c 2 ,(@6 32/ @c2 , @ 3(@?@@@ @  @'@@ ''@'6 (#2  #2@*@  L  'H;j&. 0㉒`v"" " " " " \" " 8`(   ''@4ܠ@ 5`-` `8, 4 4, 'Ġ`@5Ć5 - '1 ) `5-'Ԯ`4@@4 , 0`(`'@4`,` '5`-` 1@` @41 , ) `$4, 4@'ؤ5- 4`,` `5 - 5-'̨4̆0`(` 4 , 4, `,5@'5`-`4, `1 5 ) - '`@4'@54`-,``44 , '5- `1@@0`(` 41 ,) `4@5`-` '` @4`,` 4, `<5 - '5- 4`$4 4, , 5- ` 50` (` 5 - `(1 ) `@4'5`-`@4, 4 , `,4``(,`@'Ȣ1Ȯ@5-4,5- 1 ) `0` 4@ 4`,` @0`(`5`-` `05 - 'Ђ`4@44,4, 4 , 5- - `8t$5- 5 - 1 ) 0`(` ,`< @@5`4`-`,` 44 , , ,)` @ @! 54-,1 ) ,@ 5- -` Ԇ@0`5 (`- 4`,` , 5`-` -@`4@44 ,, 4, - 5- -` 51 - ) 5 - , 0`(` (@`( ܆@@5`4`-` ,` 4 , ) @4, , @Ȇ54- , 1 ) ,@ 5- -`< Ć@0`5 (`- 4`,` , 5`-` -@` @44 ,, 4, - 5- -`0  51 -) 0`5 (` - (@@ , Є@@5`4`-` ,`4 , ) @4, ,`$ @54-,1 ) ,@ 5- - ؆@0`5 (` - 4`,` , 5`-` -@@44 , , 54- , - -`8 ̄51 -) 0`(` (@ 5 - `,1;\b@@5`-` 4`,` 4, 8 @4 , 4@܆` 4,5- 1 ) 5- 4` z㡨@5 - 0`(` 4`,` 55`-`  `(0@4 , 4, 4, 5- 4Դ`841 ) 5-5 - 0`(` 1Ĵ@`54`,`@5`-`4 , 4, 4@5@`$4,5-1 ) 5- 4ش`<55 - @0`(` 4`,` 5`-` 50@` 4 , 4, 4, 45-  `41 ) 5-5 - 0`(` 1д@54`,`@5`-`4 , 4, 4@̴`5@4,5-1 ) 5- 4ȴ@55 - @0`(` 4`,` 5`-` 50@4 , 4,4, `5- '4`441 ) 5-5 - 0`(` 15`,@@@4`,`5`4 -` , 4, , @]"5@ 4,1 ) 5-5- ) `055 @- 4`,` 5`-` 0`(`,@ -@`;#`ܠ4 , 4, 5- 4, `,  `$(@ 5 - 1 ) 0`(` - 5- @ `,, @4`,`4 , 5`-`4, , @`(- @4,1 ) 5-5- ) @-@ @4`,` 5 - 5`-` 0`(`,@ @-@'` 4 , 4, 5- 4,`,  `0(@ 1 ) 5 - 0`(` 5- `0- @`, @4`,` 4 , 4, 5`-`, @`-`4 @ 1 ) 4, 5- 5- ) -@ ` @4`,` 5`-` 5 - `$0`(`',@ `-@4 , 4, 4,5- , `(@ '`<1 ) 5 - `(5-0`(` '- @`8, @4 , 4`,`4, `85`-`, @'- @@@4,5-5- -@ 1 ) @@@5 - 0`(`4`,` 5`-` -@@4 , @5- @4, 4, @@0@*TN@0`(` 51 - ) @5 - @4@@@4, 5`4`-`,` @@4 , 5܆@@5@-@ 5- 45@؅, @1 ) @0`5`(` -` @5Բ@ @5 - 4`,` 45,- @@ 0@е4 , @50`4-(` , @4̄@@1 ) 4, 5`-` 5 - @@5Ȇ@@@5- 54`- ,`@4 , @5@@Ć@ @5`-` 0`4(`, @@51 ) @@@5- 45 , - 0@4`,`  0`(` @5@- @44 @,  4, 4, 5`-`@@5@1 ) @5- 5- 5 - @5@@ @@4`,` 0`5`(`-` @@4 , @5@@4,45, - @@0`1 0@(` )  @ @& 55 --   4`,` @@@&& & & X @   &  @& @ @ \@ ? ` c \K& \ @" ` X  <  *  *` *  #  ?&6 @:!*`*``  ` *  *` *  #` @ *`@?& \X`\` *@ `\ ?@" @ `<  *  *` *  #  `\ 7( `@t @``2 * * ''ސ  @ .@ 2 . @ . @ .  >Za8Ĕ @ >Z   !8/`7`!@  @@  >Z7 / a8` 1 @)    >Z87`/`@ @6. @1 )   @ @ >Z 8 5-  6.@  %>Z87  / @ @5- @ @ 7`/`  7 / @  1 @ ) @ @7`/` @  @6 .  1 ) @  ' 5 -@ @6. @  $7  /   5-@  @(7` /`@ @7 /  @ ' ,1 @)   7`/`@  @06 .@ @@  41 )  '||5-   6.@  87  / @ @5- 'x@ '>Z@ |8<7` /`@@ 7 /     5 x't1 @) -  @ @ 7`/`  @4t6 .,  @ @1 ) @ @@  4`5-,`@ @ @ 6.  07  / (  @ @@5-@  47`/` , |z#@ @ @@@ @7 /   3`@1 x) +`@  @ @ @7`/`  06.(  @ @@t1 )  3 + 5- @ @@@ 6.  4 7 / ,   @ @@@@5-@  5`7`/`-`@  @ @@7 /   5@1 ) -  @ @@|7`/`  6`.`@ @'6.@ x  @@@ @1 )   6`5-.`@  @ @@6. t | 67 /  . @ @@5- x@ 0`7`/`(`@  @ @ @7 / ' @t  0`@(`@ 1 ) @' @  @7`/`  5 -  @'ؒ@ 6.  @1 )   5 5--   @ @@@6.  47 / ,  ؒ@  @@@ @5-@  0`7`/`(`@  @ @@7 /   0@1 ) (  @'А @ @7`/`   3`6.+`  @ @@ @1 )   05-'̒ ( В@ @ @6.  7 / @@ @@ 4`̐أ,`@  5-  @47` @/`,#`ܤ @  @7 /  @  @0@1  ) ( @ @ @ 7`/`  3 6 @.+ @   @1 )  @ 4 5-,  @6. Д  @   5` -`@ 7 /  '̔ 5-@   @5`7`/`-`@ 7 /  @ؒ@  @@ @@ 'Đ   ȗ5`1 ) -`   7`/`@@  @6`6..`@  Ē @1 )  @ @ؖ @@  5`5' --`  @ @ 6.  67 / .  5-'p @В@ @  @@4@  , 7`/` '@  7 /  ̬@   @5@1  @) - @   Ȓ@7`/` @ А @ @  5`6ē.-`@ @ ̒@ @ 1 )   5 5--   @ @ 6.  @@ 07 / (@  @  5- @@ 0 ( @p @7`/`@   @7 /  @@0 @ ( 1 )  '@  @ 7`/` ' @ @ @@@ 0`6ȑ.(`@ @   @1 )  @ 05 -(  @ @  Ą6.  07 / (  @  @ @@@@ @5-@  3`7`/`+`'2֚@  @Ē@ @7 /   3 @1 ) +   @@ @p7`/`   4 ,  6.@' @ @@1 )   35-+  @@ @6. ' p7 /  3+ @@'@@ @6`5-.`@ @  7`/` @@@7 /   6@1 ) .  @@@7`/`  36.+  @@ @ @'l1 )   55--  @ @@@@6.  5`7 / -`@  l@@ @5-@  7`/` 5  -  @@@47 / ,   @1 )  @@ @@@@7`/`  4`6.,`@ ' @@@1 )   4 5-,   @@@ 6.  37 l/ +  @@@@ 5-@  07`/`(  @@@ 07 /   ( @1 )  @@@@ @ 7`/`  3`6.+`@  @@ @1 )   3 5-+   @@ @6. >Zp a8>Za8"@"`"`l "` "`"`"`"`"` "`$"`(27 */   >Za8 `,5- `< `0 `4 `8 @  @   @& && & & H;j&. 0㉒`v"" " " " " " 㿘 . &  6  & 2 ?`? @"  i  ? @ ? @   &U@㿐`      #* 2@, >a  ` !! #>a( ` !!     @# *`2 .  㿘&0@@33#3. $(``@7`7`#7`.`$(`33#3. $(` @7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(` 33#3. $(`$@7`7`#7`.`$(`(33#3. $(`,@7`7`#7`.`$(`033#3. $(`4@7`7`#7`.`$(`833#3. $(`<@7`7`7`.`#((`D`@@&@&`㿘&0`D@33#3. $(`@`@7`7`#7`.`$(`<33#3. $(`8@7`7`#7`.`$(`433#3. $(`0@7`7`#7`.`$(`,33#3. $(`(@7`7`#7`.`$(`$33#3. $(` @7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(` 33#3. $(`@7`7`7`.`#((@`@&@&`1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىyP?##`H>a95*`2`  *0 : *0@`( ` 2㿈.7 6ݐ, 2 @ + @2$@  7'' , 2`*`$@ `**`2 $@   , 2   Ւ.`2  `* *`+`&@2&  , 2  , 㿈/ 7 7 , 2 @ + @2$@  .67'' v'o', 2`*`& `**`2 &  6 ,  2  O'H'e, 2   * *`+`&@2&  / 2  נ㿘.;6㿘.6  : *`2 `  㿘.6   *`2 `  㿐 .``(`*`@*`*`@ `+ `+` @ @ ? 000000.@.`.`.`.`.`.`.` ֲ`㿐 .``(`*`@*`*`@ `+ `+` @ @ ?+ 000000.@.`.`.`.`.`.`.` ֲ`㿐 :   @  . ( *(*`*@ + +` @ @ ?0.00000....... ʴ㿐:  * ( *` * @ +  +` @ @ ?000000? ,, , , , , , ,   ,( ʠ  * ( *` * @ +  +` @ @ ?~ 000000,, , , , , , ,  @ ,( 0@ԟ k/?%z!?/M`@ϟIԯ'@Жuncaf"(h;oY#yw_PC@/V|ҽ-4lHam"T/*2Tk"V:Af@ȧ9/M/-ޗ?JRvD7,QYoZ z{hА."TY5Km/PdfI-3";K4]E@1?.Ueձʭ-Էm P"@ nO8O[rVL/ŜSITFiXcE]WSj9=7*T:x}_bvzB j)r'^Pg8Ƶˌ*ZJ'ѓk*҆Vґ׉C`B\u &ql-sJ5&{M 0n٘&fVH%^V c|cp EP(r#Hp -;MyBA &G LGMj| ^\#Y8r۫Sn/#qFVEn9 q+A|ʉiHCyB}B{ZIݏ\e  [i~9?Caz zUrQyNr5Zc60_ }/{Y6 DDY̳A; *{B [%AzzƩX0ދw?Nyi${[P5%a_b1T UKc]h!fY=cs4~\g+!a9b60W;`/d:͜F5-' zyl0%7^oo; jEt'N:4Oi>M5YdE8Cfr%c3N?( 'ᛥզRTUfpdw M&g!CX`T0orSGUb]hVk-n;ۦк=\w 3L9{^+_Soa Cd^xc"g&рI"{^U-%Rr7yҕ LHϢ 0qc/ S!ET(5c)1BƎI# 0(_qȾ`a輨M/".pN40';yaٸHi?(;CZᗘv/܆7ӱÓnƼ>Q7Bh(Re-jw5'K \n.ے^)XXOTi{&g̅`HK8` #l8~ I` 5sܱGLV>#d8^FB kzOdEA^\#>];Cוr~m|llq`9spvE#@%]=G`6KDʐPQHX_0.r| ],*IPڈ'WyoIR}rY}@EE]t>OuVi#A.`' v䶔etyvwvNHam❄/}4 ȖH0b \8D=`nm`T:IW'H+8 $hE%;` E}(/P4b +md+10ZRXAB휤1\2>F63S57 ާ{sJO{dWQC~(zc _5y Cddc$J(_OC@ " 07O-${MQgqL-_d_ !S>^'Ҹ_Bar%΄q=Ko&;~ԄT~DmLl&I߮63P?~w a8rPP.wWOgF3Ti 1M5=\f][̩o꟒oF"/9F}mCOC!N ? (X&Hn>׊ptw|- %y 껁(;#iޭ8t߇b!@7{ @YVOv/@U{ MV3i5W#'ȰVÑke^anu2Uw?[-;%m;$ cf8( 2T2bZg,uzT1w&16o FjHVZyjLRC~/v t,߷t*M . k|AT嶠5!=B,|&aeR1%i &c1\!^ rIyٍ 1p>d >Ӷ È0lrqn/ބkD؋V9ñ/ʴ1x(o}2X~$ŗ{sa0-!!))*\e0,Ъ?\Ԟ, T ͆_wޠ:xV^V!\uㇳQ#wE)/i߯zpIJ[̘v9F څ8/sgD)k)I/•fgni~/%p^QS$jlD!>Yye)CA9y+WMN҂z) Gl ыiWw@~˳PM xQ VA$ VWUnaX $K'{UahwdlkDMfdi~կI/07O,5jsI@v;M(BDHsnL )_}Oao.w+᪐r<}F+YEEYTNmHo |cD_sVjprn] `yE`۩11\"NB\rr,%@N2N/@g#\xnu"xMkXnD O?H{wv#uV_F*+ (=8 6RJf;tQZרխly ueXJh&pSF\l(vk07h)҅6*$gk %huUD,eI40ʸ"W ubIb~U^vSEFmG,lLHg3|hC\2US `ߡWc톹^9283Ia7b^~N#tq܇&3@~C/ ^A (lؑ0~foo䬘s`*4-K6%░#% =HI6oJ8@CzT¼pOWAZ:TUY5|ūZǵޯ:G:S%e=~jT&IQwP[]Dlvȸ!`Xi[)Y;LJ]5UkLD5$bI/T81q(TH9)[u/@3+gf-V*o` ('Md)P,2\K6ޠ_AP! NhÁ\yCMIP8CA<?f϶&`ued$zHܩóf(` ߨ5mw 5k*HiMuN{:_Cg7I3BfΌAT:lG()G%7j+z \D7bB ntgr9X7EXVn0!$Eˆ)^18FXJNFFPx)C_$;,NmdTJOëoxnn<UV6;]޻a<tb3<L(m tyl{nwe\R0+@`>x7T0}ȧm2羾-yy"SuwXkxoZc\]3򎿰€vzҰyBq3j'`CP=Ăm+NvH%6f(NAa =IϺ߶_撮d:枨 +}?pP+ObZjyb.H@@Z,Қ"-E4S֙)nIloIrB~>VofblqTL+*)9ܰX򮞢RVLf.v9Si.Ӡߦi>҅tFL+OuvV]93x2#O=2]K&ǟ/<~~^O?v)f=oEӵ4+4NrgU="Ҩ`g8k0=8}cQXӐTyGawY-WSVXNcF.xe~yU@0ј5?P=@!IXLQ6p΃yǔqoKK0 ڽ5dw$,ϰ/ t*Bv-:7ޚޱ ,p) @$:7ϴNy ]H 1hZfB1?ru3 BQ\}mc@!d SWz13]oCqF8"ΔԸGi[bUfg N[GLoŽĸWrndzx]D`Փl 9_] c~2p PI) *m~SHX~;t.R/G~'ͤ![<z8BOv5`9'5ɯ{6 g{qp-^3TIZd,= p4wB&Ob$ҿF%dN>7`xͥE{_ v"1.{$%r_m LPm=O%#so(%Iy4azn|n6lTAV'JA<șgmB`{u $ž9g;?q0T;2dB̰E}JBp} W[z?Z MΤ(y043w;S7x倳Nhȳ~ 9|*OC/}"6ʢ7ߓ+$W4xgaoHR^^A$e.{@鎠XӐ[HV8Wrs޼[d1~OPa`{ I8,v%ѷ%$K vGX YѤf 0nN&Qd# Ph㿘` `(`(`.  @#0(3>>.3>@ #@3`>` / c. `+.   D@ # 0(33c(3 @#.  H@ # 0(33c(3 @#.  L@ # 0(33c(3 @#.  P@ #0(33c(3 @#.  T@ # 0(33c(3 @#.  X@ #0(33c(3 @#.  \@ # 0(33c(3 @#.  `@ # 0(33c(3 @#.  d@ $# 0(33c(3 @#.  h@ (#0(33c(3 @#.  l@ ,# 0(33. 3@ (c  ^@ p 0#0(33c(3 @#.  t@ 4# 0(33c(3 @#.  x@ 8# 0(33c(3 @#.  |@ <# 0(33. 3@c ( @0`0`0`2`2`2`/ // / / / / / 㿘@`.`/```(. (`/ `` >>!>c#>| <'0(6". 6bc@6"@b. x@8' 0(666c@(#@. t4'0(666c@(#@. p@0'(066(c6@#@( l ,' 0(6".`66b"@b. @ h@('0(666c@(#.@ d$'0(666c@(#.@ `@ ' 0(666c@(#.@ \'0(666c@(#.@ X@'0(666c@(#.@ T' 0(666c@(#.@ P@'0(666c@(#.@ L '0(666c@(#.@ H@' 0(666c@(#.@ D'0(666c@(#.@ @@'(066(c@6#(@ 1 *1 1 0`0`0`*******X   & 'Ȇ ''`   'Ā& (& @?(&? (& &ĸ  `'>>>'Ąd„ >ׅ(". >г7`7`ȳ.`@2 (7 ('؅7 7 ۴. 2 @@'߇6(66@(2 @@ #@@@7`'7`̷.ӱ7` . .`@'''_'%>ߤ܅(. س7`7`.`@2 (7 ('ȅ7 7 ˴. 2 @@'χ6(66@(2 @@ #@@@7`'Є7`ӆ.۱7` . .`@'''''Ą V    0M  3>000(b@>6  #6 /`+6 #>+`" + 2`2 #2`,` 2**`, *@@ @ @@ @  @ @H `%>0(. 0* *`67` 7` >c7 " 6++ ,`67 .  7 @+`#,  @@ @@ @  @ @ ` ` `    G 'A>ޱ. .`(($%>ձ. ˳.`χ((7>. ڶ޳.`( (>ϱ. г.`Շ(("@@``@`  @ ` ` ` Ā@` ```  @ ` ` ` Ă`8'Ĵ  '   Ą'ā㿘>!  !]L L,``&@  * $ ` $㿀  @ '@  ' @` @' @     ' $@'  @   @ @@@ @@  @ @ @` @  @ @    @  @@  @@ @ @` @@  @@@  ` @@   @   @`      @ @    @  @   @     @ @ @ `       @@`  @       @@ @ @`   @@@  ` @  @@` @` @ @     @ @      ' @ @@`@@`  @  @ @    @@        ` @  @   @ @ @    `   ` @ ` @  @ @ @ @ @@ ` @ `  @ ` .@@.`.`.`.`.`.`.`x    ' '    @  @ ' @@   @$ '   ' @ @  @@@@    @ @  @ @  @ @ @   @ @ @ @ @ @ @  @      @ @  ` @@ ` @ @     @ @   `@  @   @@@@  `  @@  ` @  ` @   @ @@ @` @      @@`  @ @ @@`  @` @ @ @     @ `@ @@ `   @     @ `'  @` @`@ '܄  @ @ ` @ @     `@   @@  @ @    @  `    @@ @@@  @ ܄ `      @@  `   @`.@@.`.`.`.`.`.`.`                              A@@A@@A@@@@A@@@@A@@@@@A@AA@@@@@@@@@@@@A@@@A@A@@@@AA@@A@@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                             libdes v 3.21 - 95/11/21 - eay㿐 *   * +    *`  *  * ''@000000.`.`.`.`.`.`.`.@''㿘0`(@@7`?(@@0` ̆3(@@7`?(@@0`UUU(@0`@(`7`/``@>!#%'"$& @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7`` / 7  ?7 (`@7  7 @`?. 7`7` 7`@`0`>!#%'"$&`x @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7``/ 7  ?7 (`@7  7 @`?. 7`7` 7`@`0`(`1 ) 0`UUU(@1 ?(@0` ̆3(@1 ?(@0`Æ(@$$㿘0`(`7`/``@>!#%'"$&  @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7`` / 7   ?7 (`@7  7 @`?. 7`7` 7`@ `3>!#%'"$&`x  @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7``?/ 7 ? ?7 (`@7  7 @`?. 7`7` 7`@`?30`+(`$$        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$   $ $$$   $ $            $$   $ $$$   $ $                0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((           """"    " " " "((((((((    """"( ( ( ( ("("("("> * ``( > ` `(  㿘># @ޔ     ` 㿘>#`" א ? " ? *`   +  *  @  *`* @ *@ 1 c @. (` 33 ) 6 @@ @ 6 @ 1 UUU . @ 0`? . @ 1  . ? # # *`@ @><!X@ 3 @ 2>  $@ @  - `(`) 0`1 (`) 0`1  @ @0` 0`  `00`0``? `< ,`1 1   <  +1 1 ,  00`0`   0` `8( 1 @ ?,+  *@ @@  @?.   3` &@3`+`` &@  ` 㿘4㿐 + *`   +  *  *  *`  * 0c *  0)?# *  0' ̐3 *  0%? *  0#UUaU *  ?`?0 *  0 *  0 *  0 *  0 *  000000.`.`.`.`.`.`.@.`㿐> h`4> l :*l`    "   2 `@ @`  l `2  l `   ߄ lh ,  '€  3`+   +` @ <h "㿘#>`h  ( . 6` >l *   ?#`h €`h@   @  @ϒ 㿘>`l   $`l  Pݒ L>퀢" h8$`l`l @*``l `l> h` 2   ` 2 @ "  ` `l2?. .  LP  >`h`l{*`l*`@ `l* $`l?>l  ` ` 4 >`h*    ( `h  2 " " "  㿘> l `` 44 > h` . @  `2*%  h   `   @ " 2  h @-` h `*  h" 㿘H/` />  > ," "k_ 0>  ,"@" H 0 㿐 "f  ( 2 $` #>`h2 & @S + 3` >l 4  4 "04`24 $ `  #> #& @/ *  ` Ē `h ` $4  4 "04`24 $ W`  #> #& @ @ 㿘 6Ho o $#>퀢%>!>`x |4& $ Q[ L $ t"4$ t$`x $`x`x|  QI L0>`p& ,"`p$`xH 0㿘Ho o>p > 0 LOi  H 09  x ,"p" x@9 0''>%>t  8 LOH  H 0 x 4?$t$x@ 8 $$ 4& $H 0crypto_wait㿘Ho o%>'>``  $p h` ,$H 0 Ho o`㿘 (@``   @V 2  P  `y9 2 `y0  4  'Ā!`  `  . '`'Ā  "@   . '`  € @р  `x"= " ` x`x @" &* ` € 'Ā &`  `  . ''Ā&  "@   . '6`   x`x   ;Ā  x # 8 İ   @U Sؐ    6 `  * & ` €#xJ xE €`    * & 2Ȓx-Đ ϔĐ@ݔ "b  @ "' "'Ā@  E  &  @. &  `€(Āw w `€&   @. & 2Ȓw̔Ĵ' @ L4 0I `w  ` =``w   ` " @C`  @ +  (`` `€`w`` ``€`2` ``€ ` wc  `   㿘 c`a>!`#>a  :` " a   ,`2`a 20`a  $a  * $a a  L* L͔  a a 2 $a $a  @=/ 7@ꝓ*`  a 2w *Np L$,@`&  LL  $@ꂒ @?` >"̓*` €> !> !<>!`>!>!` `  :  LLy "``  "`  >!>" >"(  LL_ "` `   LLT "` ` #>'> @  6*@ ` & : &`  €```  *  2 ` ` :  @"* 2  @  j*@ ` & : &`  €```  *  2 ` Ȑ :  @"* 2  @  \*@ ` & : &` F>"D>"`  LK۔ "` ` ` &  L: K̔ "``  ` & : "` ``   v: €```  *  2  €"  @  @"` ` ưƼXdptɀ㿘>! @  >!`.`@N `K   a"` 9> p*` €   ` @   "*0   @3` M L  "@*` M L   @` L L  "@  L LL La 2  |||||ˬˬˬ㿐 2 $p  J   E>!     >!*   :&      `* @   ```! @ 2`` @        y  &  4 &     $ 4   4 $ 0 4`2 4 $ A` > Software crypto device cannot initialize!㿘!>퀢 G$!>>>  !    !    !   ߘ !   ٘ !   Ә !   ͘ !   ǘ !    !    !    0>|ʐ"pmbuf2pages: pa == 0㿐'H'T'X 5 >̺"( 9> `(-> ` $3>/>`'P€ |#%% T`@ ) (@ "@$($@   2 X `   2  " X"H"DES3DESBlowfishCAST-128SkipjackRijndael-128/AESHMAC-MD5-96HMAC-SHA1-96HMAC-RIPEMD-160-96Keyed MD5Keyed SHA1㿘 㿘 㿘  LI  @&㿘@烒 K^ L&㿘 㿘!  㿘  LI!&@`!```a㿘@O!K* L&㿘ݍ 㿘ݹ 㿘!  LIR H H@1&.G6㿘@%`HK L&㿘| 㿘 㿘!  LI( H H@&鰔㿘@ Jؒ L&㿘ג㿘㿘  LI ( (@&말㿘 ,` " `@ђ! LJ`` @ǒ (J L&㿘 㿘"ؔ 㿘  LHː$&@檒$.c "] 㿘@昒$Js L&㿘.͉2 㿘.@)2 㿘.t2 㿐a"@  o6-    ' "  "`"@"`"`  o6   @8 `     ' 7  ź6bind failed krpc_call: sosend: %d RPC timeout for server 0x%x rpc denied, error=%d rpc denied, status=%d h  ° /'А Ԕ Ύ    Ĕ ' "  " "!?ְ# `  | l' " "@Ԓ#֛ | ̐ '` "` >ݒ ,, $ #p ( G  2H /f * ' >80 20H p@ """2   "  "Ԓ X  9cp  G !'̐ 2`H /f * ' >8, 2,H p@ ̒ " 2 ""  K '̔  "  ,, 4 $ 6̰̀ cp>{y# ( G}  2H /f * ' >80 20H p@ """2    " "Ԓ   Ā ò    $ q ֐  <$$ @ <#>}b $b  & && & & & & & 8& 4  '̒` @`@'$$ 沖 2 e'Ԓ  ? ^'> z#Ѐ "I'̀ 3@B'''ȒД̘ؖ fȰ # %M&@` ` b@ > z# ` >z#耦   R   ' 7>#z`    ? ̀`'''@ېЀ ͝ԁ㿘` ? hP  Ԓ `lCH /f!>͐* '!>!H    !H& > !>"  2` > * 8 ?"  @$!HH 0  (  & 6 & (& $& ,& 0  2 *   & p|"㿘   "    ?      V.@&U 㿘 \   "  " " " " "㿘  ƅ  2    "  &@.@ .` .` .` nfs_read modenfs: bioread, not dir NQNFSNONCACHE: type %x unexpected nfsbioread nfsbioread: type %x unexpected 0H ! `    >x!` 2`ǰ 6@° " @b`@@!K`t E` >w"@j @  %`% %%` `@"@t @D @z   0r"0o0l%`@!O> !` $9tH!`` 62t @Ζ! P` `@t`$`@ `  '& @ @5  /` =` `  @ @!  ` t0  2t"t >t >t@)@ϔx"t '  >t >t> a` "``@= `  @ :` qt >!` `K'` G 1 q^:`  2"`@ "  0" 0@$ 0@ " ` 0 $ 0J`F`  q/`: @ ǖ` Œ  `0@  @@ @A "k `0"  `0@ $`0@9 '`% 8 `` "@@&  / $.$@`p`t $&$@ @ "8 `0`d $`0`0 >vo"@C # Ґ$@`t "@&ݠ ܀ > 0`"0 $@ݖ " `0"2`@`0@ $`0@Ք `@$`" @ 8    `!"> a`8 "`8` + cC + 3` @`  # $@ "Ѱ `0"C>`0@ $`0@ 8>q #/ @ @  $@~ " `0"2 `0@ $`0@v " H  "ր >!``C$` ?$``   * : @ 2$ (0`@` +$ 峒 $$$@7 $ 0" 0@ $ 0@ " $ 0 $ 0$$`@"`" @ 8   v"P   2`H'Uvt >"P> `  `0 $`0"Pv͒  伐 `  4@nfs_write modenfs_write proc0  H ` !>u.! 2 t>"@ "t>u"!  `  ?`4`" @b @ "`  $` @    $`@ }`= 6u q`"`@ `B 2`Q ^ <0Z 0h$ 05L@ba6> !` $ `H!`` ` @2'` @ߖ! 2` `@ `$`@`   @Q  ` <`` >  a '@^`@}H0a`$ "`$@F=   @%8 n:` @ "  l?2`@ 6@$ l`= 4` B` 2 d`( d B<``   @  d  ` 6 $ ,  !:> !` $ `H!`` ` @2+ H @4! +` `@ `$`@` " HW @  n` <` HSݔ   d` `8 $ ` $ d$ `$ d t   ` & d p d@   d$ p $ t8  @ $ p $ t 0 ?$ 0``  @t$ , '`  @P  "0!  0`$ 0$ ,@ھ {   㿘 H! @!㑘 2#>А @g  aX+ 〖 "   t nfsvinval㿘 H! @  >!X!*`   '> 4   Z6   @g 27  `4   @g  ? 4 ?4 [   G 䀧  ? 4 ?4 [  㿘>!``A>>!`    .` 0@ h?2& "& @ 6@& h 0@ l & 02 & "& @ 6@& l&  & "@"#[` ' ``Θ  0D @  0 & 0H /d * %  \yH 0䬐 Process killed due to text file modification nfs_doio: type %x unexpected h \H !' 0'؀@ % % -%  T : <2` H* @ % *`  0?Ѐ@= > a`  "` % @&Ƥ> a`,'̐ "`,% @ 0@" T < H% ''% t ~>   >t g>t T> a: `* 2 * #`= @  & p T <* #@`@ "  @8 H @Q@& t <& tk0 g!> !` H!``  ` `@>`$`@ >I`T` C>r N~  :&> ! 4 `" 4 = @8,<"< P ; 2`* @ *` = @@@ʔ c @*@$@@ @Or!( 0& 4(& 0y> ( `:  d2 H* #($% * @ 'ԑ< 0C @=   @'Ѐ`% '̐ ' 0@ & 0@%Ȥ ̀  0  0 ?& 0 0@*@& 0* 0 & 0 & 0 0`H /d * % H 0 0$& 0" & d 0(& 0%`& 4` 5`& d& ` `& @@zyHnfs_boot: no suitable interfacenfs_boot: using network interface '%s' nfs_boot: socreate, error=%dnfs_boot: GIFFLAGS, error=%dnfs_boot: SIFFLAGS, error=%drevarp failed, error=%dnfs_boot: client_addr=%s nfs_boot: set if addr, error=%dnfs_boot: bootparam whoami, error=%dnfs_boot: server_addr=%s hostname=%s X> 'Dw01>ؤ5>Ħ7>ɮ;>9>> #؀ 1>5>Ħ7>ɮ;>9>   4  2   >pj#8 hCqܐ#X  : ">pY#0aw ">pN#1 `7!v ">p@# Q ">p8# 'Ēq@۔  / ,! $vӖ >p @~ ?'//ɐ!&@v ">p  8 'Ē @qz``Dgڔ  nfs_boot: bootparam get %s: %dnfs_boot: mountd %s, error=%dnfs_boot: portmap NFS/v2, error=%d㻘@ "j>#oҒ@ a>#0oȒ b ">#Po @iO :.` K.  * .nfs_boot: bootparam_whoami: bad reply 㿐  '` "` #a b$$ $  "@ b$  o4'  >`    %'   ?> >4`@$" '> ">Βb䀢 ' '>p h H " nfs_boot: bootparam_getfile: bad reply 㿈>!>4 @  '@K, "@4 ab  V ) Y'n '쒒 '#' `耢  '@[   &..>pd"ð 㿐#ab ̖  0@ '& b   `  H` #    $ '  f 0 H㿘>ap>  O_ >"b   㿐>"->+> c *  >  H 2T 2 @ 2   L 2O& 2 >    &A˒  ;Ր!@ٵ!$$ `"`H H@ 2@T`2 @`@Ք @`2` $" $@$  ; $  $  e4 & nfs_inactive: pushing active㿘 >>#  b 4 >"’   t` `$`    @IC =+ ` 4`   nfs_reclaim: pushing active㿘 >`H#` a`4 ># `"  2"  "@!"`t ` @ &  "`  @  & "``t 2T  " T <ے  T @ <ђ (`<̒ $` Nqnfs server, too many leases nqsrvnumlnfs_nqlease.c: Phoney lpp`t\ d  `G >"@@8&@ :`:H /` * ! `|> aaD "aD4 `H d'x h'| $€  >ΑH 00 ">  * @@ x @2| $@2@ت ( 2' 8%`|   d   @b  Y"G   2C O@R  I       @A 7  2   ` @ `  0 :B T&@! T @@ `@ 7 @N@@ 2 @@   %% $7 H 0m H 0d > !>a< b>Ð m%> #>Ò aSz <"@4  / 9 <@Ē < $7 @M ' 8x' | (' $d( 2>lF! '" %' %`|H /` * ! @@SH 0 %<@`@"<"@ x   #\ #`#d'?  㿘>!$6 @  > A6& 6 #$@ 2 沒  & `6& h6`D &`D> > 7 >̄8 " "  8" 8"` "8 4 82 8" " 8"   "8"8" " 2 " 㿐? !+@ > >#$ 2  @@t  "@t `0 2`  `  2'' @txbuild > MLENmbuf siz=%d Bad nfs svc reply0` `'D'L'P'T `' >"8>ݸ#pLP @"6@@ c 2`@6  8  4H /f * ' , 6,H p@ $$$4 G  * $  *`>"`2``>#$````0 ; ``  `U@` 4   @g) @H @D H d' h%  $``"`` `(` ` @" ( 5 `  ?$@ 8.  8?  2H /f * '  6H p@ """2 В $@  $ '   $  '"@ be`   !@( #h>Ő!hk >jp!x#l#pT #d#\#`#  @gҚ / 2  ?" 4  ?"    ?`""  z "   " ? "@@ ` 0` @@ @@ $ @U' "@@^@ @QH /f * ' T* ?7 H p@  "2T$`@*TH /f * ' > !>  "@ 2` ?*  + >H "  `"H& H 0 T*9 2 `"'   @ dLnqexp㿘!> ! @*      ! >@ #    6 X P 0倣 2 `"   @  #㿘>#8#8@> `! `  `?#ߐ 4`R`Ɛ8  8  2`>> Ā`2 `>" 4`j8&88@` "`"` ` 8@`"`@`"``"``@"`8"`|`;> ` `   } >"8>ݰ`#p/> V(H /f * '  R * ?6 H p@   "4 $`@ , H /f * '  >  >! "@2` ?*  *  H " `   %H%` H 0  R *8 (" @y!  2 7 0 "     7 /7 0aa<?"a<8> @&*`㾸L0 @X8,'TE'P  "   'PTP @j˜L wL - HL $T<8;`,#\  H@Y@<8;`,#\  H@X@ "  TL  H" T  P@ "@   'PTP @j}L 2L` L T  P@ "@  PT@jߔ  0'PT  P@ "@  'PTP @jML ѐ0UL0L ``$\#\#` 4@p @<)8L  $T,;`#\ @X ,;`#\ @Xt   0L o H" 0 .-,4 L  $T,#\;`  @XO ,#\;`  @XD n  ,L ? H ,#\4\;`4 Ɩ4 $TL  ,#\;` @X ,#\;` d@X 2  <L  H2         (@  "@` >;   ?# 3<>#t 4  2H /f * ' >8 2H p@ """2 C <"'<" < '8< 8 # 8,`'8 \ @   <       (@  "@`S <;  ?# S3<>#t 4Z  2H /f * ' >8 2H p@ """2  <"'<" < '8<` 8 T#` 8T@n'8( 0  @  8 L' , E'  "  ` ' @h՘ ]@ / H L & T;`#\  H @W ;`#\  H @W  6   L H   @ "@` ' @h  ^  L   @ "@ @h  R  '>"> `  * @ @ @2` $@2`  (@ў  2 .    2  "   `"  K "  "6`    ?#ߐ @4N pH> !a` "`  $@bR`' ` ?` ` `(` `  "  j``  ?$@4b       (@  "@  >=  ?#5>#t 3   2H /f * ' >8 2H p@ """2   l>e^!X"'" '? " @'R##?R]! S @h 0       (@  "@` ;>   ?# 3>#t 2  2H /f * ' >8 2H p@ """2 . "'"  '>  `"  '# ##\#`   @R찒 A .  @ "@ ' @g %a        @#\ 'ܒ@hܖ q 0!m0>  H!`" @`Ĕ D R` ` ? '` ` `(` `  "  i ``  ?$@4a        (@  "@  >=  ?#5>#t 1ʐ  2H /f * ' >8 2H p@ """2 Y  l>d!X"'" ' ? "  'R"@` #? R[ S @f "Ӑ0]   #h#l#p#d#\#`   @aN T`/  2   ?" 4  ?"    ?`$ $    "      $   ?  "@''\ @XY `P@N\`@X㼐'L'P &0&@&,@Yi 0@D'L 'PZ L G  "  ` 'PLP @e a@ / HL &T ;`#\   H @S` ;`#\   H @S`   LL  HLp L  P@ "@  ` 'PLP @et  Z L L  P@ "@  PL@e֔  0?'Pې j 02&` +`"` `2 ఀ !`` &` "  @  "`""` ഀ 2&"` &抐 cld kerbnqnfstimrX@;  @27@>b#!   Ā4 Ѐ@4X Ȁ 2 X 2 &  & &  @& &K:   Q & @ʖ +>̀a>"Ȁ`2  P "   8  ''''@O;  ~{ '> ᰀC D * 2b &  D@Y@ & "`  @"`ྐ ` H&` t @kƐ  ྐ 600& , Oྒ $6ᰐ . ྐ ` @2  d  ܔ 2 &  D@  %  >寐&   " 2 &W R & @2 @>aX@  Ȓ!HΔc ?2   @;  䀢` "`  "@`"`& "@ 0ْ 3 20Ӓ  #" 㿘`'XX ` & ` ` `  `& `  @6``߄ 6`>` &`   `4 2 &` &` 2 &  & &` &`2 & &nfs㿘>>ـ`"@"H /` * ! >#8#8@  '>`"``@ 2`H 0 ``,+> )>ϐ a|  "0@   2!! @ `"``@ 2``ڐnqlc㿘  " !>ϐ 6  #Gٖ     ?`# @6 㿘 ?# @`6 Iibuild > MLENL0 @8,'TE'P  "    'PTP @bL wL - HL $T<8;`#\  H @Q$@ <8;`#\  H @Q@  A  TL  H"E T  P@ "@    'PTP @bL 2LX L T  P@ "@  PT@b  0'PT  P@ "@   'PTP @blL 0LL0 `#\#` 4@h "3L $T<8#\;`  @P@ <8#\;`  @P@   L  H @gW   4!0@H 2 4`t     0 @Hn 2,4`t    0  @@H\ 2,X4 4 $TL <8#\;`  @P5@ <8#\;` \ @P(@  R L  H@f<       (@  "@` <;   ?# 3<>#t ,А  2H /f * ' >8 2H p@ """2 _ <"'<" < '8< 8`" 8 '8$㾸`L``0 `@X`8`,'TE'P  "  ` 'PTP @aLL `L@ - H`L $`T<8;`,#\  H@O@<8;`,#\  H@O@   T`L  H" T  P@ "@  ` 'PTP @aL L V `L 0T  P@ "@  PT@ah  r0'P`L0 `#\#` 4@g' +`L $`T<8;`,#\ @O#@<8;`,#\ @O@ @ " `L 2N H `\ 4 `8,#\@ #`#dޘ4 4 $`T`L <8;`,#\ @Nߖ`L  D T<8;` ,#\@NΖ   `L  H "`L`  D T<       (@  "@@  >;`L  ?#@1>#t +t  2H /f * ' >8 2H p@ """2  <"'<" < '8<`L 8DT# `L 8 T D'8@eؒPL0 @ 8 , ?E  "    ' @_䀢  - HL $TԒ;`#\  H@N&Ԓ;`#\  H@N؀ C  L  H"m   @ "@    ' @_䀢  U! L   @ "@  @_  0'ޕ`  @ "@    ' @_h䀢 >"D   @ "@    ' @_L䀢 m  /7  @ "@    ' @_3䀢 T"D@  @ "@    ' @_䀢 :'  @ "@    ' @_䀢 ""D@  @ "@    ' @^䀢 '  @ "@    ' @^Ϙ䀢 "D@"  @ "@    ' @^䀢 ְ       ?  @ "@    ' @^䀢   (  @ "@    ' @^z䀢 '  '> !! *`" *  * ''  @ "@    ' @^T䀢 u  (  @ "@    ' @^9䀢 Z'  '> !! *`" *  * ''  @ "@    ' @^䀢 4 f  @ "@    ' @]䀢 ' L'  @ "@ $ ' @]䀢 e0?# @@>  /7!t@2'!t@2' !t :?!t@"''!t@"L'*`" *  * ''LȐ `#\#` ̖@c 3L $TԢ#\;` @KԢ#\;` @Kך؀  " #\L ڀ H, #\ 8Ζ \ ̔ 8Ė#\ #` #d햘`Q8̬ J   l@ p@ # :JL $TԢ#\;` @K`  xԢ#\;`@Ku  " #\L x Hʰ #\l ??2`tȀ &  H`<0`t   Ȓ @CJ ̖̔Ԓ ̀ $TL `Ԣ#\;` @K` D xԢ#\;`@K  5 `L  H ` #\8@aT        (@  "@`C ;  ?# C3>#t '  2H /f * ' >8 2H p@ """2 ; "'"  'Ԑ` И D#` ЖD@b'ЁL0 @ 8 ,p''F'  "  ` ' @\# 2z@ /L H $T;`#\  H@Je;`#\  H@JX   L 6 H"A   @ "@  ` ' @[ݘ 24 Q` L   @ "@  @\?  "'  @ "@  `' @[ /0@ 4 ? $ H )L  $T;`#\ @I ;`#\ @Iۖ  " LL  Hİ L  ``'#\#`#h''#d@_`  N' ,L  $T#\;` @I  X#\;`@I  kL l Hw d\  8#\ #`T#d܅( @  @ H d% h% H$  $TL #\;` @IA  `D`X2 X#\;`@I, V  L  H  @_  X       (@  "@` ;   ?# 3>#t %ΐ  2H /f * ' >8 2H p@ """2 ] "'"  '  ` " ` '#@O T       (@  "@` ;  ?# 3>#t %x  2H /f * ' >8 2H p@ """2  "'"  '`   #`  O' @_9@_30S       (@  "@`C ;  ?# C3>#t %  2H /f * ' >8 2H p@ """2  "'"  '`  D#` D@_'(0'@8'L ','L'P''''H'  " $ ' @Y܀ c 1 HL $T#`P#d#\  H@GȚ`#dP#`#\  H@GЀ`   L  H"а   @ "@ ( ' @Y?܀  N” L >  @ "@  @Y  0'>Ę"8  д̶/>''>ݐcp  $=  4 H /f * '   6 H p@  $ $$ 4  Β H /f4H* 'H   U H$ > !>" a 2  *  &  %HH 0  (  $ 4 $ ($ $$ ,$ 0    ( l ` $ ''"' $($"$ $  $ #$L `   %%=%#`#\ %%%@^ 3L $TP#\;` @F `P#\;` @F` ߐ L  H @]x ư t `  L \ 8#\ #`#dLmĒ}HĢ L0Ā "$T $TL P#\;` @Fd``  \P#\;`@FT` ~ L  H"l  @] 2a ` %   $"@ @\"       (@  "@` <   ?# 4>ݐcp  "  2H /f * ' >8 2H p@ """2 y "'"  ' Ȓ`" Ȑ '""nfsrv_read iovp0'L@ 8'H','L'P'4'0H'  "  ` '040 @WX, ,@ 0 HL %T#dP#`#\  H H@E `P#\;`  H H@E `   4L w H" 4  0@ "@  ` '040 @W, n,L L 4  0@ "@  04@Wq  0S'0!4  0@ "@  ` '040 @Vܘ, :,@`        0@ "@  ` '040 @V, ,@ 4  0@ "@  `'040 @V, (0,L@  '<  @ @4 L ''5L H %TP #\ #`H#d  H@DȚ'P  #\H#`#d  H@D''耦` L  HͰ L `#\#`H @\ 3L %TP#d#\#`  H@D`P#d#\  #`H@D{`  L h H  _  t  `     %L\  8 #\#` H#d.L! @  ?# c3>#t    2H /f * ' >8 2H p@ """2  "'"  '>  d" D`d'$@`'R`T       (@  "@`G >:  ?# G43>#t  1  2H /f * ' >8 2H p@ """2  "'"  ' `H" 'H'`D` ?` `>"8  "    (   @"   ?$  $b>#t ϐ  4 H /f * '   6 H p@  $ $$ 4  ` H /f'>͐* ''>H    H$ > !>" a 2  *  &  $HH 0  (  $ 4 $ ($ $$ ,$ 0$ '4 - l "`, >ۀ 2 Qܐ@ "        ( "   ?$ `  #@#` $  $ `  8    7    8L F' "s %TL P#d#\#`  H@B/`  X#dP#` #\H@B` G L  H4 8@X, "Թ@Yy8%@4  ?@ "@@"@Wϒ%@ `$@@ `>"D>#$@`$@ 0'8@ ', L'L'Բ '''`'@ `E  "   'ЖԒД @ST̀  - HL $T;`#\  H@A`;`#\  H@A`   L  H"   В@ "@   'ЖԒД @S̀ Y̐H L `  В@ "@  Ж@Sp  0>'Ѐ`&  В@ "@   'ЖԒД @Rܘ̀ &      '?   В@ "@  'ЖԒД @R̀ <0Ā ?  . `*Ԁ`К  "@ " " ` "`" " `" #"@"   2 60LL  $T#\#`#d @@  `#\#`#d @@ ` ڐ " #\L 〦 Hذ #\  `#\#` @X /`L $T#\#`#d @@ `#\#`#d @@u`  " #\L  H #\a 8L' t `     L \ 8#\ L#`"#d  @8@L 8L $T#\#`#d @@#``  x#\#`#d@@` > L G H< #\8 @V3 3 .Β %%` "" "2     %=%%%> H`"Hb fLx " $TL `#\#`#d @?``  ``L```2 #\#`#d@?`  `L ˀ Hɀ`l#\@U8 2        (@  "@` ;   ?# 3>#t 9  2H /f * ' >8 2H p@ """2 Ȓ "'"  ' `" ` '    >!P!P  T        (@  "@`C ;  ?# C3>#t ِ  2H /f * ' >8 2H p@ """2 h "'"  '`  D#` D@VF'nfsrv_write: nd_mrep not freep'D'P&D`'L" L 0 @ ,''% (% 4 % H> !!:`4`, @,`b2*@ *@ b 2`*  *`> a@C3`+ >#+`<B <`BI=` ` " ' @P  3 H`L %`T#`P#d#\  H@>[#dP#`#\  H@>LPv P @'`L  H  @ "@ ' @OИ T `hET `L   @ "@ @P3  0; '$  @ "@ ' @O $       @ =`%`H  @ "@ ' @O~  0; =` ` ;`B=`%`P #  "@ " " ` ""  "  # "@"   @ 4Ő %`T#\;`  @=#\;`  @=x #\ 8 @S  %`4=@%`,H /` * ! `H @   `` @`` `8`` @8` ` %` ` ` "`$`  $` %` `H` "`$&`H`H%`$`, h `t *  @@`  `h h@  2 ` `` @ `h``  @`h h@  "`"4` %```"`$``%` L `` `@  ` @͔ P 2@  `@`h `@`h h@  "`L0 %``"`$%`H 0> aa: 0(@(b2*@ *@ b 2`* @ *`> !B2**< @ B H /` * ! `H    2 4   4 2 `" $ $"`$ $ "@ `"  "`  "H p@ , L% , 8 #\ L `#`  h@T? ' '䀥8L' t      '  L \   8#\L #`#d L@4"  H    '`'`'` ?`  "'`6`H   2 2  + '`ɒ '@ "" "2 2ݖ> H`"Hf  Lf'x>>#pb8 &% T#\#`#d @; #\#`#d x@;#\8@Q% T  `L``2 #\#`#d @;c#\8@Q  "    (  @ "  8>  ?# 0 3  2H /f * ' ` 5`H p@ """2 Ē "'"  '> P`"  ' P H P  R   "    (  @ " C 8  ?# C0 ِ  2H /f * ' ` 5`H p@ """2 j "'"  '`  D#` D@RH' ,`% 4>J"H /`* !   =`H% `H "`$&`H% $(   `" $ $"`$ $ "@H 0 ݀ H /` * !   <`H$ `H "`$&`H$$H 0>  H 0H /` * !   4 "  ` $"`$ $ " 4P"D"@ 2 4H 0 nfsrv_coalesce: bad off㿘``"``"```"@` `"`$`$"`$`$` "@` @4  "` @ ` @`>Il $ ,>`, , (@ `,@@ 2@"@`> 1`, (`H` &`,`2 ( H 2 (& H ( &`  (` "`$& (&`$㽠`L`0 `@ `8``, ?@'''''$'EP  "  ` '@D@ @Kk< <@ /D`L H %`T,(;` #\  H@90 ,(;` #\  H@90 ː  D`L ÀH D  @@ "@ ` '@D@ @K&< y< @ `L D  @@ "@  D@@K  D0` '@D  @@ "@ ` '@D@ @J< J<@ 4 ? $ H".`L`L %`T,(;` #\ @950 ,(;` #\ @9(0 R " `L`L JHk `L `$ @D''#`#h '#\#d@NJ$` 8阖'  '$=`L %`T,( #\;` @80   x,( #\;`@8К0 `L H #\8 @Nژ$   0qD  @@ "@ ` '@ @JD< <@ "     'T ' Dl D  @@ "@ ` '@ @J< n<>@"D D  @@ "@ ` '@ @J< S<` /7D  @@ "@ ` '@ @I< ;<@"D@D  @@ "@ ` '@ @IϘ< "<@'D  @@ "@ ` '@ @I<  <@"D@D  @@ "@ ` '@ @I< <@'D  @@ "@ ` '@ @I< <@"D@!D  @@ "@ ` '@ @Io< <@`      ?D  @@ "@ ` '@ @IP< <@  'D  @@ "@ ` '@ @I6< <@'` '> !! *`" *  * ''D  @@ "@ ` '@ @I< d<@  H D  @@ "@ ` '@ @H< I<@'`-'> !! *`" *  * '!'D  @@ "@ ` '@ @HИ< #< H>T   '7 @'  @@ "@  '@ @H< <33$>ޑ2 cX <@' ' /` 7``  `    :? ' J``4`L`\  `8 #\0 #`#dئȖ,&(K  flH=ڔ ^' ``   ' < "8`Lɠ 雒6`L %`T,(;` #\ @6q0 ,(;` #\ @6d0 `L H" 0`L '`\ `8 #\0 #`#d( o,+(M`L  %`T ;`#\ @6(  ;`#\ @6 G  `L ?H"` ?# @'''n' + `L  %`T #\;` @5  #\;` @5   `L  H"* m @@" ȁ`L` %`T #\;`  @5  #\;`  @5 ڐ ^`L ҀHY ȵ 2 谒K0,(GȦ# Ȝ6薒 0?,*(  @-u 0`L `\ `8 #\#`#d??  ,(@ @H d& h&H$ Ԗ   $H@  2 $弒'0$%`T`L  #\;` @5   `D`T2 x #\;`@4 `L Hmb,       (@  "@`# ,;>  ?# #3,>#t   2H /f * ' >8 2H p@ """2 + ,"'," , '(,>  ( $" (D`$'(#@``#@;  @KX#\8@Jʰ ,       (@  "@` >;  ?# 3,>#t 3  2H /f * ' >8 2H p@ """2 ’ ,"'," , '(,  (` # (  ;V'(,       (@  "@`C ,;  ?# C3,>#t   2H /f * ' >8 2H p@ """2 o ,"'," , '(,` ( D#` (D@KM'(# " [ ْ@Ґ l  f㽸`L``0 `@ `8 `,P?H',E'  "  ` 'HLH @E4D D@ /L`L H %`T40;`(#\  H@3w8 40;`(#\  H@3j8   L`L Hİ L  H@ "@ ` 'HLH @DD QD :s `L L  H@ "@  LH@ER  L08 'HL  H@ "@ ` 'HLH @DD "D@ 4 ? $ H".`L`L %`T40;`(#\ @28 40;`(#\ @28  " `L`L *HK `L `, HL''#`#h '#\#d@H,` 8c9L`L %`T40(#\;` @28 40(#\;` x@28 ̐`L ܀Hڐ#\8 @H,  ş  H@ "@ ` 'H @DD ~D@> aP* @?  " {  cL` `H "  ` 'H @CD OD>@"D L  H@ "@ ` 'H @CҘD 4D` /7L  H@ "@ ` 'H @CD D@D@L  H@ "@ ` 'H @CD D@'L  H@ "@ ` 'H @CD D@D@L  H@ "@ ` 'H @CqD D@'L  H@ "@ ` 'H @CZD D@D@!L  H@ "@ ` 'H @CAD D@`      ?L  H@ "@ ` 'H @C"D D@  'L  H@ "@ ` 'H @CD jD@'` '> !! *`" *  * ''L  H@ "@ ` 'H @BD ED@  (?L  H@ "@ ` 'H @BȘD *D@'` '> !! *`" *  * ''Ȑ? L  H@ "@ `'H @BD D$;,@`*  ' ,  !'`L`\  `8(#\8 #`#dҸڔ W` S ג Q ϒj>8`L`\  `8(#\8 #`#d҇Δ ï"?# @'''' @@ Ó /㏒ؐ@) @ H d% h% H$ , i,%`T`L 40(#\;` @0@ 40(#\;` @03 ]`L mHkb4       (@  "@`# 4;>  ?# #34>#t  ސ  2H /f * ' >8 2H p@ """2 m 4"'4" 4 '04>  0 $" 0D`$'0#@``#@6  @F#\@E۔8# " D ’@» U  OL0 @ 8, ''''F  "   ' @A 2z /L H $T;`#\  H@/];`#\  H@/P z  L 4 H"3   @ "@   ' @@՘ 24 6X L   @ "@  @A7  "'  @ "@  ' @@ '0 4 ? $ H +L $T#`#d#\ @.ݖ #`#d#\ @.і  " LL  H L `  ''#\#`#h'#d@C`  PD' K t 2  0 2 0    @[x %L\ Ĕ 8 #\#`#dYL`" 8#\#`#dLĔ5xĀq0    '` $TL #\#`#d @.7  x#\#`#d@.( R L  H  #\P@D0 㼸`8`0``@ '8`L `,  'd'`'4'0','('D'@h'F'  "   '`d` @?\ 2\ /d`L H %`TLH;`<#\  H@-˚PLH;`<#\  H@-P   d`L  H"ְ d  `@ "@   '`d` @?C\ 2b\ 4Ɣ `L d  `@ "@  `d@?  "dH'`d  `@ "@   '`d` @?\ 21\ 4 ? $ H ".`L`L %`TLH;`<#\ @-OPLH;`<#\ @-BP l " `L`L 5 HZ `L` ` `D #\ d''#`#h8 '#d@BcD`` ݱ'4$ 'D C`L %`TLH<#\;` @,P`  LH<#\;`@,P  4`L ހ H #\ @B#\ H @BD  ߞ簀 Gd  `@ "@   '` @>X\ w\ - H`L %`TLH;`<#\  H@,PLH;`<#\  H@,P   d`L  H" d  `@ "@   '` @>\ 2\ 3 `L d  `@ "@  @>u  0'`d  `@ "@  '` @=\ g9D\ $' ^/ H`L `#h`,@  ''#`8#\'#dh@Aa@`` Hܯ'," '@  Px|` t``t `  ` `` 23 2 ``x ``2 H x ` HH@` B ` B  Ā  @ "? :|`L`\ Ĕ `8P< #\#`#d͈`L` `8#\#`#dz``L " `8#\#`#djĔ|ݥxޓ`'`""ނ}?P wp  D '0jD@ '(`@^ ے %`T`L `LH<#\;` @+1`  LH<#\;`@+! K ``L  H`40@A)#\,#\(H@A!' D "@@ "  p  Ԁ  z ``8`0``@ '`LP`,  ' '''''F  "   '  @   `L  H"    @ "@   '  @; 24 1 `L    @ "@   @;  " '   @ "@  '  @;h 0H 4 ? $ H *`L $`T#`#d#\ @) #`#d#\ @)  `L  H `L `#\#`ܐ @An <`L $`T#\#`#d @)j`  X`2 x#\#`#d@)X  `L ـ Hא @@#\ Pɖ  t`2 `LM n``L `  #\''#`#hܒ'#d@>h 䀢`` Pٶ') '䀦 G` "  H H 2  %`L`\  `8 #\#`#dӘ`L`" `8#\#`#dƐĔ@   ``c'䀢 ['쀦 $`T`L `#\#`#d @(`  X`2 x#\#`#d@(  ``L  H`А@?S#\ԐP@> 㽈 L 0  @  8  , ?  ''''F(  "  ` ' $  @9 2@ /$ L H % T ;`#\  H@(6 ;`#\  H@() S  $ L t H" $   @ "@  ` ' $  @9 2> /1  L $   @ "@   $@:  "$$' $   @ "@  ` ' $  @9} 2 @ 4 ? $ H ". L L % T ;`#\ @' ;`#\ @' א "  L L  H  L `  $''#`#h '#\#d@<ϖ`` 8' ' 0`V$   @ "@  ` '  @9 >@"D $   @ "@  ` '  @8 w` /7$   @ "@  ` '  @8Θ ^@"D@$   @ "@  ` '  @8 D@'$   @ "@  ` '  @8 ,@"D@$   @ "@  ` '  @8 @'$   @ "@  ` '  @8j @"D@"$   @ "@  ` '  @8P @`      ?$   @ "@  ` '  @80 @  ($   @ "@  ` '  @8 @'` '> !! *`" *  * ''$   @ "@  ` '  @7 @  ($   @ "@  ` '  @7Ԙ d@'` '> !! *`" *  * ''$   @ "@  ` '  @7 >@$ -V H А    h?x'p''h'l''t'  'p@5 `2.$   @ "@  ` '  @7r  `7. " LP Β@ǐ a  O \   8#\#`  {#d9 `2*?# @`''''  Đ@1 @Hd%h% H $ u   'c % T L ` #\;` @%9`  `2 X`2 x #\;`@%# M ` L o Hm`k b        (@  "@`#  ;>  ?# #3 >#t ̐  2H /f * ' >8 2H p@ """2 }[  "' "   ' >   $" D`$'#@``#@+  @;#\8@:ɘ)  7  "ׯ@ B   㽰`L``0 `@ `8 `,P?H'$' E',  "  ` 'HLH @6D qD@ /L`L H %`T40;`(#\  H@$G840;`(#\  H@$:8~d  L`L ․H L  H@ "@ ` 'HLH @5D ,D +C `L L  H@ "@  LH@6"  L0 'HL  H@ "@ ` 'HLH @5D D@ 4 ? $ H".`L`L %`T40;`(#\ @#Κ840;`(#\ @#8} " `L`L iH `L, `  HL''#`#h '#\#d@8,` 82'$ ',<`L %`T40(#\;` @#z8  x40(#\;`@#j8}$`L H+ #\8 @9t,   gp LL  H@ "@ ` 'H @4ߘD LD>@"D L  H@ "@ ` 'H @4ĘD 1D` /7L  H@ "@ ` 'H @4D D@"D@L  H@ "@ ` 'H @4D D@'L  H@ "@ ` 'H @4|D D@"D@L  H@ "@ ` 'H @4cD D@'L  H@ "@ ` 'H @4LD D@"D@!L  H@ "@ ` 'H @43D D@`      ?L  H@ "@ ` 'H @4D D@  'L  H@ "@ ` 'H @3D gD@'` '> !! *`" *  * ''L  H@ "@ ` 'H @3՘D BD@  DL  H@ "@ ` 'H @3D 'D@'`)'> !! *`" *  * ''  H@ "@ `'H @3D D|,` /7  '0 38`L`\  `8(#\8 #`#dä @m @ H d% h% H$ BT, 8' ,%`T`L 40(#\;` @!  2 X2 x40(#\;`@!l{`L Hmb$4       (@  "@`# 4;>  ?# #34>#t   2H /f * ' >8 2H p@ """2 y 4"'4" 4 '04>  0 $" 0D`$'0#@``#@(2  @7ј$#\ 8@7 4       (@  "@` 4;  ?# 34>#t   2H /f * ' >8 2H p@ """2 y; 4"'4" 4 '04`  0 #` 0 ''04       (@  "@`C 4;  ?# C34>#t Z  2H /f * ' >8 2H p@ """2 x 4"'4" 4 '04` 0 D#` 0D@7'0 "^\@U   K 8 0  @ ' L  , ''''F  "   ' @1 2z / L H $ T;`#\  H@;`#\  H@ z   L e H"d   @ "@   ' @1n 24 &  L   @ "@  @1Д  "'  @ "@  ' @1= y0`4 ?`$ H + L $ T#`#d#\ @v #`#d#\ @j y "  L L 怦 H  L `  #\''#`#h'#d@4` ݖP ' : L $ T#\#`#d @&  x#\#`#d@ yA  L  H#\ @5!8  `t   Ā `0 2  $  L  \  8 #\#`#d L`"  8#\#`#dĔAޒ@א 0r p T8' $ T L #\#`#d @  x#\#`#d@ x  L  H  #\@48 P L  0  @  8X ,','('E'  "   '(,( @/$ $ - H L & T;`#\  H@@;`#\  H@3`x] ` , L ǀ`H"* ,  (@ "@   '(,( @/$ U$%;  L ,  (@ "@  (,@0  0:'(",  (@ "@   '(,( @/$ "$        (@ "@  '(,( @/e$ w$:  ' L ` > < % %%4 L `#\#`  @5 4 L & T#\;` @'̠#\;` @u'̀'w` L  `H"l В @47e  L \    8#\ #` #d3 '耥`   @@F &   L & T#\;` @('̀  X#\;`@'}'ДЅ   0''Ȕ8'''ؔ''' '0?@'L'4'8'<'H'P'T`'  ' ̚`Ĕ ϯ`@`"   q`'  ;`BH X  " LR  L & T#\;` @  X#\#`Д#d@`vĐ` L /`H" ̔@3\ 0 젤 & T  X``#\#`Д#d@i v]А@32       (@  "@` ;   ?# 3>#t   2H /f * ' >8 2H p@ """2 t "'"  ' " '  Q       (@  "@` ;   ?# 3>#t   2H /f * ' >8 2H p@ """2 tP "'"  ' `"  '>#>  D E B 0 '' ' ''   '`    "  2 `& T L #\;` @j  X @@#\#`Д#d@S`u}` L 耥`H急[А@2       (@  "@` ;   ?# 3>#t   2H /f * ' >8 2H p@ """2 s "'"  ' " '  `  ` `(` `  "@ ``  ?&@@;> {@2>` $@@&` >#t   6`H /f * ' >8 2H p@ `&`&@&`6` s* H /f!>͐* '!>!H   r !H&` > !>"  2` > * 8 ?" ` @$!HH 0`  (` &`6`&`(&`$&`,&`0`  `( l `&` %`` @>"D$@`@ {@2>` $@@&` >#t   6`H /f * ' >8 2H p@ `&`&@&`6` r H /f!>͐* '!>!H   r. !H&` > !>"  2` > * 8 ?" ` @$!HH 0`  (` &`6`&`(&`$&`,&`0`  `( l `&` %`` @$@`@ {@2>` $@@&` >#t   6`H /f * ' >8 2H p@ `&`&@&`6` r* H /f!>͐* '!>!H   q !H&` > !>"  2` > * 8 ?" ` @$!HH 0`  (` &`6`&`(&`$&`,&`0`  `( l `&` %`` @$@`@ {@2>` $@@&` >#t   6`H /f * ' >8 2H p@ `&`&@&`6` q H /f!>͐* '!>!H   q1 !H&` > !>"  2` > * 8 ?" ` @$!HH 0`  (` &`6`&`(&`$&`,&`0`  `( l `&` %`` @$@`>"8@ w@2>` $@@&` >#t   6`H /f * '  4H p@ `&`&@&`6` q) H /f#>͐* '#>aH   p aH&` > !>" a 2  *  $ ` $aHH 0`  (` &`6`&`(&`$&`,&`0`  `( l `&` %`` @@&$@z@ @,@?`@ {@2>` $@@&` >#t   6`H /f * ' >8 2H p@ `&`&@&`6` p H /f!>͐* '!>!H   p !H&` > !>"  2` > * 8 ?" ` @$!HH 0`  (` &`6`&`(&`$&`,&`0`  `( l `&` %`` @$@`@ {@2>` $@@&` >#t   6`H /f * ' >8 2H p@ `&`&@&`6` p H /f!>͐* '!>!H   o !H&` > !>"  2` > * 8 ?" ` @$!HH 0`  (` &`6`&`(&`$&`,&`0`  `( l `&` %`` @$@` '? ''     耥  ?"  䀧 H@'. @ {@2>` $@@&` >#t ݐ  6`H /f * ' >8 2H p@ `&`&@&`6` ol H /f!>͐* '!>!H   n !H&` > !>"  2` > * 8 ?" ` @$!HH 0`  (` &`6`&`(&`$&`,&`0`  `( l `&` %`` @c$@`@ z@2>` $@@&` >#t ^  6`H /f * ' >8 2H p@ `&`&@&`6` n H /f!>͐* '!>!H   ns !H&` > !>"  2` > * 8 ?" ` @$!HH 0`  (` &`6`&`(&`$&`,&`0`  `( l `&` %`` @ >"D$@c$@@ `@ `$@&` ` $@@&`   X 0 ' L @  8 ,'L?@'''E0  "   '@D@ @'}< w< - H L ' T,(;`#\  H@0 ,(;`#\  H@0  oݐ  D L t H"i D  @@ "@   '@D@ @'8< 2<  L D  @@ "@  @D@'  0'@D  @@ "@  '@D@ @'< o0 <  '  L   @   < % %%4 L `#\#` $@-& 1' L ' T,(#\;` @!0'Ԡ,(#\;` @0'Ԁ 'o=  L Հ Hʰ ͒ $HŝL 0 L \ $  8#\ L#`#d$ @  @ L #L$ L ' T,(#\;` @͖'Ԡ,(#\;` X@'x'ؒ -$  ',('''ܺ'' ?'$'' ''' '(',`' - 'L$C`̘X$H$"L$ L` "  " @ $ "   L ' T#\#d#` @U #\#`#d X@G  nq  L  H ؒ@+ H B$#\' Tؔ#d#` h@ nGؐԒ@*H,       (@  "@` ,;>  ?# 3,>#t ͐  2H /f * ' >8 2H p@ """2 l\ ,"'," , '(,>  (" (>'(    D KH 0s@'' @$   @ " ` 2'  '`   "  "  h''䀦 ' T L #\#`#d @g #\#d#`@Y  m  L  H" Ԓ@*H,       (@  "@` ,;   ?# 3,>#t   2H /f * ' >8 2H p@ """2 k ,"'," , '(, (" ('(  ,`  (` `(` `  "@ ``  ?$@@  ~>b8`"k f$ H  " '` 2Y@v  Hd#@h#`  H $   GL W 9S `t'  쀢 '耢/'@)|>bD  ''x''p@@ x't,@>(` &@@$` p @  4`H /f * '  5H p@ `$`$@$`4` jђ H /f!>͐* '!>!H   jW !H`$` > !>a "@ 2  *  % ` $!HH 0`  (` $`4`$`($`$$`,$`0`  `( l `$` %@`` @"D&@`@ w,@>(` &@@$` p Ŕ  4`H /f * '  5H p@ `$`$@$`4` jV H /f!>͐* '!>!H   iܒ !H`$` > !"@ >a 2  *  % ` $!HH 0`  (` $`4`$`($`$$`,$`0`  `( l `$` %@`` @&@`@ w,@>(` &@@$` p K  4`H /f * '  5H p@ `$`$@$`4` iܒ H /f!>͐* '!>!H   ib !H`$` > !>a "@ 2  *  % ` $!HH 0`  (` $`4`$`($`$$`,$`0`  `( l `$` %@`` @&@`@ w,@>(` &@@$` p Д  4`H /f * '  5H p@ `$`$@$`4` ia H /f!>͐* '!>!H   h !H`$` > !"@ >a 2  *  % ` $!HH 0`  (` $`4`$`($`$$`,$`0`  `( l `$` %@`` @&@`p>"8@ w,@>(` &@@$` p O  4`H /f * '   5 H p@ `$`$@$`4` h H /f3>͐* '3>aH   hf aH`$` > !>a "@ 2  *  % ` &aHH 0`  (` $`4`$`($`$$`,$`0`  `( l `$` %@`` @@&8$@z@.@?`>"8 @ x,@2>(` &@@$` >ݐ#p  칐  4`H /f * '   5 H p@ `$`$@$`4` hJ H /f3>͐* '3>aH   gВ aH`$` > !>a "@ 2  *  % ` &aHH 0`  (` $`4`$`($`$$`,$`0`  `( l `$` %@`` @@&$@y@ ?' ' 4p$@ {,@2>(` &@@$` >#t   4`H /f * ' >8 2H p@ `$`$@$`4` g H /f!>͐* '!>!H   g4 !H$` > !>"  2` > * 8 ?" ` @$!HH 0`  (` $`4`$`($`$$`,$`0`  `( l `$` %@`` @>&@`@ z,@2>(` &@@$` >#t 럐  4`H /f * ' >8 2H p@ `$`$@$`4` g. H /f!>͐* '!>!H   f !H$` > !>"  2` > * 8 ?" ` @$!HH 0`  (` $`4`$`($`$$`,$`0`  `( l `$` %@`` @ >"D&@>&@,@ `@ `&@$` (` &@@$` ؒ Ւ `L0 @8,'E'  "  ` ' @Ę쀢 v@ - HL $Tܒ;`#\  H @ܒ;`#\  H @  h$  L 0 H"/   @ "@  ` ' @쀢 1  L   @ "@  @  0'  @ "@ $  ' @P쀢 gԐ0LА `#\#` Ԗ@% 6L $Tܢ#\;`  @ ܢ#\;`  @ y g " #\L  H #\  @#8 Ԗ Ԗ 8Ԗ Ԁ $TL ܢ#\;`  @ ;ܢ#\;`  @ . gX " #\L e H"d #\@#7 2Y        (@  "@` ;>  ?# 3>#t А  2H /f * ' >8 2H p@ """2 e_ "'"  '> Pؒ`" P '#@ #` L0 @X8,'E'  "  ` ' @E `@ - HL $T;`#\  H @  ;`#\  H @ {  f  L u H"T   @ "@  ` ' @   L   @ "@  @a  fk0"'L `#\#` @$  3L $T#\;`  @  #\;`  @   f8 L  H @"є `H `  $TL `#\;`  @ ֚ `  X```4#\;` @ š  e `L  H`@" 2 `  4       (@  "@@  >9  ?#@1>#t b  2H /f * ' >8 2H p@ """2 c "'"  '``  4 `"`  4 `+':  @ $$ : @ $ $   ;`@z; $ $ $ $ $ $ ($ $$ 0 $ ,$$  $ $ $  L  0  @X 8 ,'TE'P  "  ` 'PTP @L `L@ - H L & T<8;`#\  H @ @<8;`#\  H @ ؚ@e  T L vH" T  P@ "@  ` 'PTP @]L L   L 0T  P@ "@  PT@  dȐʰ'P L0 `#\#` 4@"| 3 L & T<8#\;`  @ w@<8#\;`  @ j@d L  H @!- 4 4#\& T<8;`   @ A@dk@! <       (@  "@`/ <;   ?# /3<>#t   2H /f * ' >8 2H p@ """2 b <"'<" < '8< 8 0" 8``0'8R   "?  #`,#` #`#`#` #`(#@#`#`#`#`#`$㾰L0 @X8,'TE'P  "  ` 'PTP @VL `L@ - HL $T<8;`#\  H @ @<8;`#\  H @ @ c  TL u H"' T  P@ "@  ` 'PTP @L L  L 0T  P@ "@  PT@r  c|0'PL0 `#\#` 4@!1 34L $T<8#\;`  @ ,@<8#\;`  @ @ cI L  H @  Ô, 4 (  4 $ 4  4 4 $TL <8#\;`  @ؚ@<8#\;` p @˚@ b L  H@ 2_ <       (@  "@` <;>  ?# 3<>#t p  2H /f * ' >8 2H p@ """2 ` <"'<" < '8<> >8`" 8, '8"(" "c"D$"" "x L! , & T;`#\  @D `;`#\  @8` bb  L 2 H x T ,  L & T L ;`#\  @ `;`#\  @` b0  L 2 H 8`2 t H <`"  0 t    2 0&  0  @4͐  R`  f @" nfsconnfscon sotype㿘`$P P TjX P` R $\  2>ݦ#p ( q  2H /f * ' >80 20H p@ """2 `  "  " r֔  p  =    4 H /f * ' >8, 2,H p@  $ $$ 4 _̒   $  ** 2 " jac Op (   2H /f * ' >80 20H p@ """2 _  " " rj   \ N 90`k  H /` * ! ` %`$`# '>>!X `"*9``"``$ 2 ```<@  2`` `$`>А  4`$H 00ΑH 0`A>!X*@ 4`~4`Z4`Z4`~T  ! * ! ! *  |* "` >Ր" `5># O  4 H /f * ' >80 20H p@  $ $$ 4  ^ޒ   "@ ?$ cq ` R `26>#     4 H /f * ' >80 20H p@  $ $$ 4 ^   " $  qz !a* *` t5 #>aX>`X `|@!L@4`|@~4`X* $l$$$x$t$p$$$$| $ ?4`H p@@.㿘 %> @' #>?  b3   >"Ȁ`" `2@`$ @"`$@`2` 㿘 P & Pp infs send error %d for server %s nfsd send error %d 㿘$ "_ D P 2 ? @&$_ : &$\ R    " V` @? ` j !> c $  @  &$>c( ֔ ? # 2 short receive (%d/%d) from nfs server %s %s (%d) from nfs server %s impossible packet lengthEgad!! receive error %d from nfs server %s `>"&"@  T "  P@  9   $`@ G 0- P`@%> ! 沒  _``$` `W   ?  " @ " 0 $ @2 @   s}x ̖А  ''?''''''آȲ @'Ȑ   l #   # $  #"'Ȁ 耢    " >`  $  w *@  ! ' > >`И  b ' @'Ȑ  kޚ #"'Ȁ "'Ȁ?"'Ȁ L耢H>  `̘ "  > !'''آĀ !Ā Ȓ 'ȐkĀ`^z #   # $ = #耦 "Ȁ  >  " " '̀ G E?D ^Q  & > `  @ 1 " 0*2. ,    А"@'''̤آ'Ȑ kN # $ 倦 #"'" '̀ "^ &@x nfsreply nil㿀> !@$ $ @N @F  ? # \  P2 $$` "]  '쀣`' '  @9䀢 ]$>!X ! ;耢 "$!( %!(!(`]%!($>"Ȁ`>1>#Ğ#` 2@` 2@>$` $`耢`]$`>c * * " `4* " `4*` ` dl|` *`l |  :    : *`l |  :    >  ! `4*` ?*  `4*` ?*  ! d  h` $ (`$ "`8"@ #`  ?"@$#4`$< @@@{ $$`$ ?$`$$`$ #`4* `*` l `8: #@  `# `4* `*| :`#@@ " $`2Z` ` @!$`\%!$ $2 $   >"H$ ۰ is alive againnqnfstry@'D H !'H'L'X @k L$<H$4D    $$  @' $+'ܐ 'Ԫ@}-   Ԕ@$g "#\#`@#ٚ " \H0JW     *  '#lH#\#d#p#h#`ܖL@܀` ǒ  T 20L 2  ?" 4 ?"   ?`$$  \ "   $ ? "@L$̓*`$ '/>->   e h$(> $,`$8 $$$$> !a$  "aH /` * !  $$"@"  P ? T  (  @2H 0  \ @  P `  \ \`@ِ  $ @  !% $` $$H 0 ?$8  H /` * ! `""`" "H $` $$ ?% 2 $ > <`@ ' '-   "    'ĖȒĔ @ט 2>!@ "> c2 -$>  Ԁ 2 2  PА[@"@[=  [8$ ` #\@#Tİ  `Ȓ` Đ " 6   @Ā 0'  Ē@ "@ $ 'ĐȒĔ @p    Ē@ "@ $ 'ĐȒĔ @X u ?"% #! FZϐ @ .`7> #> နc  @ >#x <`` F2pD" X"@\"@` " ZY!L  Ē@ "@ $ 'ĐȒĔ @  4  Ē@ "@ D `'ĖȒĔ @ Zi0-@@        #\Ȱ X"\"`"ZCީ 0 Z= +Z:ޠ build > MLEN㿈>ݨ#p  \А ! 4H /f * ' >8 2H p@   $4$$$ X >!  <H /f#>͐* '#>aH   Wݒ aH$ > !>"  2` > * 8 ?"  @$aHH 0 ( $4$($$$,$0>" @ $  $ >`X &X &I >>!&   > `.& & ?S$ > # & & K&#&`L @ `@|J *  L r>`@2`<     @ ꀦ\>l?'p '&&& `  (   "  #p7   ?$ 40 #p    2H /f * ' >8 2H p@ """2 Wz  $ $   $ ` & &&& &J KHfg L]a & & `    (   " #p7   ?$ 40 #p  ۂ  2H /f * ' >8 2H p@ """2 W $  $   $ `L`` & _&  & Z& W& T&R&      (   " #p7   ?$ 40 #p  &  2H /f * ' >8 2H p@ """2 V $  $   $ `@#&&`L ` X      (   " #p7   ?$ 40 #p  ΐ  2H /f * ' >8 2H p@ """2 V] $  $   $ `L` & &`\ &@  &`J&      (   " #p7   ?$ 40 #p  x  2H /f * ' >8 2H p@ """2 V $  $   $ &``%@`"d "> aa "a not responding㿘H /` * ! >"->퀤 )> > !   $ 2 <@" " 8 $ $ $ ; $ 8h2"d 4>#*` d *l@ |  :    : *l@ |  :   ` >#x*   8 `4 $`$ $  ,@$  (>$ <`@( $` $ $ , (@& T  $  $`r$ $ ` dl$ , di$ ,P`e?$ 8`\``"@`h`d" 4  `V (   $  @6J 沔 W  "A  `    @     `@  )?' #"&\ "!4`$  $`"` ,  $ $ d$ , d$ ,:  $!$ਐ $$ $!$$ 8 2# !!@!@%!!: 0(@(b2*@ *@ b 2`* @ *` B*2 *> @ ;ФB  H`"@8 `8@g 2 HH 0>!LM`"`$" @" 耢` *@!(  nfsndlck㿘 `  `@`<*  !(  @@ @'>%`ɔ  & <!2>!X *`@@2`@@& nfs sndunlock㿘@@*@>% " & *&nfsrcvlk㿘  *`@ '>%  < "  $`a2>!X *`@2  $ nfs rcvunlock㿘@*@>% Đ# & *&p㿘 v   "l    ?  6  ( " ?@&  &  &     ( "&> @4:9   ? 4   $    $  (   "   $ <` $%` $@Ҁ`      $  2$ 0 2 Bad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad P`0`@ `,''   " ' ( ' (@ \ B>ڴ$`X 0    "    ' @ ? %$`T$`L>"t@ Ӓ I>!@ > ! ɒ J   " K`  K `2 $`L`$`D ` 2`L`8 L`L ` L2 `D>ap* @$`D!`L> b ? $`L    "    @ I 0'  @ "@   ' @  `@tƒ P 4`$`$` f  *` "    ' @  z `4*"`4 *`:  4`@`!1 #   "  ' @ ْ  0C>aȀ   w 0?  ``&`&` 'Sʐ4 H   Ж`!?''''Ԁ 'ܔ@    @ "@  ' @  Ȁ  >& /"`  @ "@ ` ' @    >& "`an  &a`L`@$`L` &` >& "8s`  @ "@  ' @  Ȁ  >& א"PN`  @ "@   ' @  ' @u'` *   L``5> `2``< ``    @4` 뀦` > !`h@  `l@ ``pĀ@ `&`h` $`D$`TQ @``L  $`L  $`D$`TD ; `D 6  @ "@  ' @ 7 `L $`L  @ "@ ' @  R0  $`\ $`0$`@nfs server %s: %s 㿘 " >)`Ӑ h`0`V H'`$ 沐`t&`0沒 "'̐'ԔؖИ _̠  #Ѐ2` ##`0%   "`8" $@&`&`8 "&`  2&` @T > `0 9&`0 6&`0沪"ԦؤТ̐ '̒' _LЀ`  (Ԁ`Д "`( "&`$" &`("    ` #2`0Ѐ Ր  `$ `0 @nfs getstream㿐 0  >)" $ 0 < G 8 $ 0    Δ   `?& &      *   `?& &   8* ?$ 8$ < 0  0 ?$ 0 < !@ F 0 8  $ $ $ <?$ 88  @ .  @ "@ RF $  < "@&  < ""@&  < 0 #  $ <@֒ 8$ "$ 8$ < 0 ?$ 0 ,  ,@@ 2@"@ 0 "e < , ( (` ,"`$ $ ,$ ,V$ (㿘& 0 ". 7 $`2`( 7 & $$`& (T`  $  ӹ ؠ$ ,$ 0$ <`$ @   &&a Pe nfsd wakeup㿘 0 #> @" 0>*  ? `" D `& D" 0 2 0>H & 0`"H㿘>`>ђ 4t槔 >"`p> !"!"`nfsrcnfsrv cache㿀 <  > >*, p ߖ > X `t2  >ɐ `p*  q'> > ! X @2f   D 2a       8@  "U   2ϐ  ` ,  "` "@$$ "@$   >*#x2 a,  )$a, a4 $a4 #`#d#\       a4 $a4  Q & a0  $a0,    ,  ,  0 2 X> 8#>b` "8 4 Ɛ @p b  $b, %> > !  " #>* ,  cp:      ,  `"  "`   "@`"  "`"  " " O   @"` H /f * '  >R 8* ?2 H p@  ` "7 `$€ / H /f * '  >  > "@2` ?* +  > >!Hb8" `   #!H"` H 0  >p' R *  , $$ "@" ,  X$  8  `  ,  $ 沐 @,  8 P, $  F4  X`t2   p * ` $  X 2  * "`  X`t2`@ p @ *`"  X2  * $  ,  ,   㿘 < g X>`t2  >ɐ `p*  Z> >>`t!#>* X @2L   D 2G       8@ 6  ";    cp ,  ,  X  , `,  D*  `"  L 2  * ` T $ 沒 O $ `,    ,  , 줐0 2 X㿘> !">բ!` "`  "@`"`$`"@  4 2>""build > MLEN㿘>ݤ#p  :  6 H /f * ' >8 2H p@  & && 6  Lɒ `(< H /f5>͐* '5>H   LL H& > !>"  2` > * 8 ?"  @&HH 0  (  & 6 & (& $& ,& 0 `& `H!a> `ᰀ   2 >".` ᰐ  >".` `   @   `M      (   " p7   ?& 40 p  В  2H /f * ' >8 2H p@ """2 L! &  &    & "  J"     (   " p7   ?& 40 p  G  2H /f * ' >8 2H p@ """2 K֒ &  &    & " &㿐>ݐ#p 'T  'D'` h p ! 4`H /f * ' >8 2H p@ `  $`4`$@$`$` KԒ `( `< _H /f!>͐* '!>!H   K !H$` > !>"  2` > * 8 ?" ` @$!HH 0` (` $`4`$`($`$$`, $`0 8`" @$`` @$`$` `  `` `( "  >6` %@ 41` >ݐcp  }  4 H /f * ' >8 2H p@  $ $$ 4  K  $@`$` ` >`  $`  '>䀢  (/>Ւ $b'% ->a(b'->/>ղa~ `&  %  `&$ $t $ % I$  a"$   $ $>!ؓ. $ $ $sT`` ` ` `(`  "T  >>T` ?T$@@6>ݐp    4 H /f * ' >8 2H p@  $ $$ 4  Jp T l($@>,4#`$` T`   $` $ $D  $ $T :`?$@  D .``$@  `>"8` " `` `(` ` @ `  ?@2i`>ݐcp  r  4 H /f * '  4H p@  $ $$ 4  J `(:$@H /f%>͐* '%>H   I H$ > !>" a 2  *  $  $HH 0  (  $ 4 $ ($ $$ ,$ 0$@`$` ` " `` `(` ` @" `  ?$@8 U` &$` @kT ?" $ `$` ,` $` `  `` `( `  " >8` `  ?$@ 41` >ݐcp  ǐ  4 H /f * ' >8 2H p@  $ $$ 4  IV $@`$` `  $`  \ $\$ >"8` " `` `(` ` @ `  ?@2i`>ݐcp  v  4 H /f * '  4H p@  $ $$ 4  I `(:$@H /f%>͐* '%>H   H H$ > !>" a 2  *  $  $HH 0  (  $ 4 $ ($ $$ ,$ 0$@`$` ` " `` `(` ` @" `  ?$@8 Y` &$` k\ ?" $,` $` $ $@ d$@%`l%`"㿘  "@ "P ` $] @`2`W @@`*0"L H "@` `D`` < B#$@>`&`$`@@`8@``?&`&@"@@`""`&4`&&6 @&nfsm_uiotombuf: iovcnt != 1㿘  >1ِ#Xm`? ?"Į >"8      ( @  "@  ?$`y >#t .  4 H /f * '  5H p@  $ $$ 4  G ":$ H /f'>͐* ''>H   GB H$ > !>" a 2  *  %  $HH 0  (  $ 4 $ ($ $$ ,$ 0$ %      ( @  "@   ?$         F $  <`  B#$> & V&"`"@"``$Q       (   "@  >4   ?$@,>#t s  4 H /f * ' >8 2H p@  $ $$ 4  G $ % ` @*@` $ '@  '@' nfs S too big㿘 & &@&@'@c `` H(>>3 (#t   4 H /f * ' >8 2H p@  $ $$ 4  F $ $"$  '@9&@  " H   & ' @"$ $ @ 40$ & &@   "   H &" "@㿘     (   "  ?$ ?@"@ ` $   ܔ &$ >"8>#t t  4H /f * ' ` 5`H p@ $$$4 F l(:H /f!>͐* '!>!H   E !H$ > !>" a 2  * ` %`  $!HH 0  ( $4$($$$,$0  ( l `$ $  "@ `?$      ?"@ K@&$ t&  &@ struct nfsnode bloated (> %dbytes) Try reducing NFS_SMALLFH struct nfsmount bloated (> %dbytes) Try reducing NFS_MUIDHASHSIZ struct nfssvc_sock bloated (> %dbytes) Try reducing NFS_UIDHASHSIZ struct nfsuid bloated (> %dbytes) Try unionizing the nu_nickname and nu_flag fields 㿘>aX> ?a% ⣘ I > >> "t7>#>)>+>->/>1> 3> 5> %>'>$bt# @ &%"%aX%%&#&`&$D$ d@e) !>Հ $!L$!L@ ^ > 2>>>aP>> b  >̐c8"c8" !> >Ζ! / $!>В""""`!>Z!x>$`8녔㿘>!>ϐ L"? 6"` "` "  㿈 DH@!  b"  T ߘ쀢 ` @>`' ``+P`*``D*'`H  %'@> a0* @`< >ސ#X2`  ``4'`8*`" *  * ''􀦠2t" t'ऀ$t>"$Lt? >"H$L} >$ $$ $L~$$&$$(( /6 & D`& ,& 0H`d-& ` "6 `  & ` & ``     @ > & ``       > H`8& `<& $`@& (`L& 4`P> P& 8.& @` 6 ` & `& ` > `& ` : 2* @* > H`(& `,& $`0*`" *  * & (& (& @`< & 4& 8`@ > P& <  2 @!>  2   8 2   @( >  < @_ > <> !$q `$!"&$&(" &,&0 㿘 > `  H!`#`@c" t 2` 2      > a`  E"`a`( "a ` 2`( `@!`( 2 `  8 `2  ` @( `<  <`` @ <` ``$!"`&`$`&`(`" `&`,`&`0 㿈\$`  $LJ$ @  @@"@ $ "| H "K  /2 n `@$  ,@ @`'@ ?",@& & 2Q  $@$ #\$ h0 #`@V 2> `t }q 4 |ې `$$ # !$ d$ w 2   @@`  |}I|  $@d$   Ⱥ     +" ' (0! , " "   ( #2" 㿘\`@N@      (   " >7   ?$ 40 >#t ƙ  2H /f * ' >8 2H p@ """2 B( $  $  >c $ #@]      (   " >7   ?$ 40 >#t M  2H /f4 * ' >8 2H p@ """2 Aܒ $  $  >bD $ #@` #@#`,`#@0#`4`#@8#`$@'@@㿘`N      (   " >7   ?$ 40 >#t   2H /f * ' >8 2H p@ """2 Ar $  $  >c $ "Q`      (   "W >7   ?$ W40 >#t ŗ  2H /f * ' >8 2H p@ """2 A& $  $  >bD X$ "@`X&'㿘V`&`& ` & L +>@ * &`&` &`&`H&`L& `F&$`G&,&(`&4&0`&8`$&<`(&@`,&D`0&H`4&L`8E&P@>`* @&@`2>>#` *`# ` &`&` &@ ?`D&`H*2 @ & `&$`&(`$&,`(?"&0@`#&0`,&4`0?"&8@`#&8`4&<`8?"&@@`#&@㿐>"\&`xt 2 a F`0 2X `   O` ` 2`c R`` h`+0"z11  d ` &`&R 66     "R   6   $$`       @  nfs getcookie add at 0㿘 cC + 3`  `2 "1>>9ɐ#hG `5?;  @!&` &@" &#&`?ဢ 2 `  6$    !"`@ "@@" &@"` 4@`  &`.  @H( ``H2 `d `X00 0`2`HH  L`R D>`(R   P?# @ >@  ( * " **  㿘@an P 6@  &` &` 6` V 6 V` `   " V V` Ð`㿘`>  H !`@_#" t 2!!!!`     nfsd init㾘 @˄!6 Q>b "@ '> #>:"В`$" c "`@ 4 N!6` 뿔 0 D'''''r %0 " H xa쀦  @ @ $ `@  `뉔  ^ `']  @ܰ`j | @ À   `0 "@@bՒ *  L    @2  <      ,  逤  > `@ 6 `0 $`@ | 3 `0  G 3~@ ` `"  "`   "@` "`$`  "  ?   $ 칔 PT $` 4 $ 4 l> $ lpx$ p! xt  $ h < "$  `   $ ` $ 沐 $ Ḕ`< @Z $ $` $ ` "@$` @bE *  L` $ @b< *  L "` @b4 * " L@b. *  L@$ Ḑ``L @"`L@ " `"` $`@ ? 㿘(` R`   >  0`"T@?9 T@  !!S+ "T@?(0 26` ># ǐ  2H /f * ' >80 20H p@ """2 =V  "@ ?" cP+ ` `29`XR 25`X>#   2H /f * ' >80 20H p@ """2 =  " "  O `X4`Z`|  ?4`X4`| 4`~  2O!@_/!$  $ $> $ "@"$ $   $ $ H /` * ! >) p$`$` $ 0판H 0 nfsdmbuf siz=%d Bad nfs svc reply㿐'H'   H /`  & Q* ! 2  4!'@^Ւ!$$>Ք@$"@">`Ȑ "` 2  ">"H`!>%>= Ē`$$ Ē!X  İ $  bH "2 >"H`> !Ѐ0 ` 2D  &0&D$ 2 bH ?$bH "0 V  @ ?4&0 纐c 쬐> :`, 4` ,`@c3`+  +` b 2* *> @a`C!> 3`+ !  +`<B  H`"@ 8 2 ` 8    $ 0   "7 2'H 0 `  `V@4􀢠s> !"`a`"d`< ""`8 # ?$8`' ' \' d ` 2  hᤀ 2 H藔 |  >쏔>`̀  >"!@`>Ѐ >!"@#"#``̀ `L 2`D  "`D!"`T> "`  ?$ "`D "T > !S8F C`2 D`>>#` > ̀` ᴐ > D*` ᴟ  D` a 'a < " <>  DbL+ @  #@ " , #>   !@  >= ?>=Đ $ .$   2   ?" 4  ?"     " " <ٔ  "    "   $   "@A 0   < ܘ<[ c @f <`"c ,H /f * ' > <8R`* ?2 H p@  < `8> $`@1H /f * ' >  <> ! "@2` ?* * > <8` !H"`<   #!H" H 0 >`<pR *Y  ,  ; @  ?2!@ @]H /`* !w >#`@Ԕ ;`,;`< !>  '!> !!: 0(@(b2*@ *@ b * 2`@ ! *` B2**;@ B H / 4H* !H` @   2 `    H 0`jH /` * ! 4 "# $@$ `""`>" D"@H  4>`'? "`@ڐ 㿘 0  ? & 0 &   K" 5 `\H /f * '  >R 8* ?2 H p@  ` "7 `$€ / H /f * '  >  > "@2` ?* +  > >!Hb8" `   #!H"` H 0  >R p*0 : : $  ! ` "`   "@` "`&  " :   3`2 H /`4 H* ! H  "$$$ $$ "@   2 & HH 0㿘 D? & D 0 `"  "`> "! "@ʒ 2㿘>" " >:{#$⬀ #> +>/>)>->aЀ a 0 ` "`$ "@ 2 2 0oa$a$ ⬐ `$⬐ $`@" %`@H ?%H  2!% @Z! `"` "` aЀ "a" $  a$a" !  2%$@Z!$" "" " "@$$ >Z* (      2 L@ @ L@" D@ @ D ` 82 ` `>  `"*  `( d (`"@ ( ` ` `!   !!nfsidl㿘> (`?      (+  2  > *(" ` `"`  '>% g e`>!%>A! $@՜  `U ! Q `"``"` " ``"@`0 h| < ?!`\H o *@ e  d    0 2 [Ȑ 0 $ 0   0  \$ 0z3 \`h "`hH 0 l{Δ 2`\ `2`  a`(?"@&a`㿘>abŐ nfsio㿘>Ϙ (  >, `2  ,  )Ԑ  8 " "#>B!>Bb\  s"x? b\  >Ϣ (, @  ʵ      , 0Ԁ 6"ԁnfsauth1nfsauth2㿘\@ %#>B>!X@&*  Քc`<S E@">*@&  5!&!& & &  & ]&  2 2 ;>B5>X ė* Ԧc`<$@ X`  *@& P "   *@&' А `$L * @ & *@& nfs_getnickauth verf too small㿈`4`>CP! C@Z*  쀧`> `2``> `h! 6@> ``"`& `@"@'@ '` "@&     "`t & &" '`laa   a  `p` `a'`l`'`p`'`p`l '`p'' '' x @'\ '   "  ` ' 2܀ ܢ7~@> `'@ '`@, a,n>  6   &  | 3? `"  "`  "@`"`& "@&`&x&h &l&tu&p& & "@& `@Z+ C*  쀢` &`@Z" C*  "` `@Z C* " `@Z C*  &     " &  ' / 78''@build > MLENp L "'}   5 @> @> a` "`  D h' R ``  `` `(` `  " $ jS ``  ?$@4bS        (@  "@  >=  ?#5>#t m  2H /f * ' >8 2H p@ """2 4  l>D!"'" '? @" ' R`#  "  R_ 찒 X6w0`  `` `( `  " ; `  ?$@ 3>#t     2H /f * ' >8 2H p@ """24 "'"  '   #  ' & #\#`  K谒 " .#'  @ "@  ' tܖ 9  ؖ w -؀ 耢 5䀤` `  " 30   4''  4=ܖ 5 0b&@ 8 8&`"&`      @ + 3`  &`        @ + 3`  &`      @ aC 3` +  &`c &`$  &`&`&` &`&`&`&`D@ `Tp Z`l ZLah X `D`@U 5_nFZp> a` "`  D泖`R`' ` ?` ` `(` `  "  j```  ?$@4b`       (@  "@  >=  ?#5>#t   2H /f * ' >8 2H p@ """2 3J  l>D!"'" '? " `@'R#@` #?` R S  4Đ0#\#`  찒 t .'  @ "@` '  $@   ܒ 쀦 M  @ "@/$0 ' 0 4x 08@a >$  $$@a >$ $$@c <$: $$ $4@root/root on %s nfs_mountroot: getattr for rootnfs_mountroot: can't setup swap vpswap on device 0x%x swap/swapswap on %s nfs_mountroot: getattr for swap> >`;" <"А@T!(x>Gapy=l>Gax @>G!ꉒ>Քb`$$b`  "`"`" >l"di pl? >G!@H /e4>>* &>>a >k&a\ %>L>Gא!TT>GH!- l>Gax>G a@Di^>G|4"l "`tl?"0l$T$  @ >G訐" *2 @ $nfsnfs_mount_diskless: vfs_rootmountalloc failednfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d8>H xi# >Ht <@"<@SҒ X    j'''''' 2H  >H X    .& @ >H Dnfs_args: retrying connect nfscon㿘H /` * ! ?` ` ` +@ @  @ &H 0` 0 `, +#>%>L@QMaXg @QG & dL@QCaX d@6aXaX@Q<L& dL@Q6* "@ d*` @Q-* "@*`& d` " ``0  d& h d& h`"`  ` " `  > & "&   @   4&  @ 4& ` " `$  > & "&   @   4&  @ 4& `@" ``(  <# & $` "  &  4& ` " ``4  $& `@" ``8  $& `@" ``<  <$& `@" ``@  $& `@" ``H`?#@$`J6!`@" !`L`?#@$`N6!!! 86!`@ `P`?#@$`R6!`@" !`T`?#@$`V6!!! 86! P "  T 2 %>H#>  !>H|a "   &  &$ &( d&, h&0 &4 &8 &< &@!&H!&L!&P!&T0   2m   H ? ^ K Xߐ * T'>`Ԁ 6 < "`  <@@!쀢` A @ c '!Lj6 ܶ 2/@ Yl 2% Z$@@Q^ Y 2$@@Qߐ@N–  2 '@0`<@@ 19w  ܐ"@Q"&a$``$`g !$` &`@>aX>@OL     $`h$`$`$`$`$`$`$`$`d`$`$`$`    < $`L` 4a4a4a4a` ``@Q ` Z` ZaL X$``  `$`X$`T `L&`Lwj  >` '@<0- 0nfsdism㿐!6` L` wG A `4`$i08    $'> %>J နhϖ  ` j' " i*@$e @$ijihk И0y `% ے  㿐!`Lv`  t`  "t "0&@ 㿘 ` $ H2` 2 X d ` hA  2h X 2 H -㿘`(7   $ -002!L&* !K!L&$ !> !U!L  aL  !B!L >       - -㿀 D #\#`   ./build > MLENpH  b<  `t    `T `N> a`P "`P  HR`' ` ?` ` `(` `  "  j``  ?$@4b       (@  "@  >=  ?#5>#t    2H /f * ' >8 2H p@ """2 -  l>Ka#H"'" '? @" 'R`#  " R$ S   /0       (@  "@` ;`   ?# 3>#t   2H /f * ' >8 2H p@ """2 -1 "'"  '`  "`   ' t@  2 @2  #2 @2 # #\#`  ٚ찒 I .'  @ "@ '  . 0.   ܒ 쀦   @ "@  ' ߘ  2 .]0@K\open eacces vtyp=%d 8  t H  a쀢>M!  !5> !` $s H!`` 6l  } !" 2e` `@2  `$`@2 ` "S   o  N @ΐ` D<``    o  "= @$` t 2   <`  ` +#$`  V "`Ā@" t 2   <`   o    @$`!"$` 㿘  t $H!@a b     @H   4    o $   ? 4  x H!  ` "3  , >   a`D "`D  D ٖ'R ``  `` `(` `  " $ iS ``  ?$@4aS        (@  "@  >=  ?#5>#t ސ  2H /f * ' >8 2H p@ """2 +m  l>K2#H"'" '? " 'R"@` #?R_   "X ,0t`  `` `( `  " ; `  ?$@ 3>#t u    2H /f * ' >8 2H p@ """2+ "'"  '   #  '٘   #\#` Ͽ찒  .   ' ,x 0,u㿘` `  @? - ? ?2H $?2 H ,?2 H ?#@" H <`y  ? ?"F ,t?`#>O#*` €e  ,?? $?? ?#@ ??2 ? ??N ?5< H <`F  ` ` ` m  6   <@@<`?2t $?"`t  ``  mԘ  2` `` @  ?2< ?<@<@=|=====p H> !H  "Hb  D`  < `' R ``  `` `(` `  " $ jS ``  ?$@4bS        (@  "@  >=  ?#5>#t !  2H /f * ' >8 2H p@ """2 )  l>Ku#H"'" '? "  @'R #? R8_` 5 X`++0J`  `` `( `  " ; `  ?$@ 3>#t     2H /f * ' >8 2H p@ """2)F "'"  '   #   ' `?`#@W       (@  "@` ;>  ?# 3>#t ]  2H /f * ' >8 2H p@ """2 ( "'"  '> !>`" D ' `T        (@  "@` ;>  ?# 3>#t   2H /f * ' >8 2H p@ """2 ( "'"  '>  `"  ' `?V       (@  "@` ;>  ?# 3>#t   2H /f * ' >8 2H p@ """2 (A "'"  '>  " D`' `R        (@  "@` ;   ?# 3>#t ^  2H /f * ' >8 2H p@ """2 ' "'"  ' `"  '# ` ?V       (@  "@` ;>  ?# 3>#t    2H /f * ' >8 2H p@ """2 ' "'"  '>  " D`' ` R        (@  "@` ;   ?# 3>#t   2H /f * ' >8 2H p@ """2 'E "'"  ' `"  '# `?`?"Z        (@  "@`  >=  ?# 3>#t ^  2H /f * ' >8 2H p@ """2 & "'"  '>  # bD ' ` `Q       (@  "@` ;   ?# 3>#t   2H /f * ' >8 2H p@ """2 & "'"  ' `"  '# `$> ! X       (@  "@`  ;   ?# 3>#t   2H /f * ' >8 2H p@ """2 &> "'"  '  ` "  ' `$ `(        (@  "@` ;   ?# 3>#t Y  2H /f * ' >8 2H p@ """2 % "'"  '  `"  'R        (@  "@` ;   ?# 3>#t   2H /f * ' >8 2H p@ """2 % "'"  ' `"  ' `,> ! X       (@  "@`  ;   ?# 3>#t   2H /f * ' >8 2H p@ """2 %? "'"  '  ` "  ' `, `0        (@  "@` ;   ?# 3>#t Z  2H /f * ' >8 2H p@ """2 $ "'"  '  `"  'R        (@  "@` ;   ?# 3>#t   2H /f * ' >8 2H p@ """2 $ "'"  ' `"  '        (@  "@` ;   ?# 3>#t   2H /f * ' >8 2H p@ """2 $G "'"  ' `"  '#        (@  "@` ;?  ?# 3>#t f  2H /f * ' >8 2H p@ """2 # "'"  '? c " ` '> !t t`>>#@ *`#  $`?2$ > !t$ ` ?2$ > !t$ `$ `$$ `(?"$ @CŒ#$ `,$ `0?"$ @C#$ #\#` } c .`Q  @ "@ ' ܥ G>"D   @ "@  ' ܌ .'  @ "@ ' w    zܖ   'ؒoؖ $ 0$   H! @  &@H <`"t? ` t \ ऐ'xLJ :  8> @`D] \  2'&@`D  { ` @ > ! `"  % ($  MG]l&@> a`  `L "`L"`   ? $ H Ԓ 'R `   `  (    " $ jS    ?$4bS        (@  "@  >=  ?#5>#t ِ  2H /f * ' >8 2H p@ """2 "h  l>K-#H"'" '? @" 'R`#@` "ऒ R]   V 0      (   " ;   ?$ 3>#t q    2H /f * ' >8 2H p@ """2" "'"  '   #  'Д # ?   ?`    ( @  "@  h   ?#4`       (@  "@  >??  ?#6>#t   2H /f * ' >8 2H p@ """2 !  l>KR#H"'"  '? @# '#@` "   "#   #\#`  0 .n . ''|  @ "@` ' X .@   [| "|"D !   @ "@` ' 1 @  @" H"    "    '   vxs qR`2 H`@CB 2H"} 0i x qxF 't  @ "@` ' ט @   tڔ t'p  @ "@` ' ٵ @  ۸p  0} 'lۮl ul&@"  ($R`2 H`@BӒ 2HZf hx x"0 F'h  @ "@` ' e ;@   hh /h'd  @ "@` ' C @  Fd  d '`;` ! % `  "($@"&@ x 2 &@x\"Iٔ&@! "`"Zn    H`< ?  ($㿘 `t 2    ^b 㿘 `t 2    ^T pH> !T "Tb  D ҟ 'R ``  `` `(` `  " $ jS ``  ?$@4bS        (@  "@  >=  ?#5>#t   2H /f * ' >8 2H p@ """2 3  l>K#H"'" '? " ऒ@'R#@` #?ऒ Rͻ_` ظ "X` 0`  `` `( `  " ; `  ?$@ 3>#t :    2H /f * ' >8 2H p@ """2ɒ "'"  '   # ख '] `#\#`  Â찒 " R . "'  @ "@` ' ׫ 5@   ܒٮ )쀦 )  @ "@` ' ׉ @  H0 ђ  0p`H ` ` = B "`  0۰ H0װ 0ـ >>#pb8> a`X "`X` , P %`'`R `   `  (   @" $ hS    ?$4`S        (@  "@ 4 ;  ?#4 )  2H /f * '  5H p@ """2   l>K#H"'" '? @" '`R`#@` #?` RB]  ? V507  "   (   @"  8   ?$ 0    2H /f * '  5H p@ """2R "'"  '   #  '`        (@  "@`  8`  ?# 0 q  2H /f * '  5H p@ """2  "'"  '` ` "   '`#@` #`#`` #@`#`#@`#\#`  찒 "`| .`9'  @ "@` ' ژ @   ܒޔ }܀ s  @ "@` ' չ g ` 'ؐؒ׽ \  @ "@` ' ՚ H@?   ;%` 2      1> hH 'T! T"``= B'P 'L 'Ԁ`   ٰ Ԁ>b8> a`\ "`\   ?` 4 X &`'R `  ` (  @" $ gS   ?$4_S        (@  "@ 4 >=  ?#$6>ݔp (  2H /f * '  6H p@ """2   l>K~#H"'" '? @" 'R`$ #?ऒ]R༐ A Y7 " (  @"  :   ?$ 2>ݐ#p     2H /f * '  6H p@ """2Q "'"  '   #  '`\       (@  "@` :   ?# 2>ݔp k  2H /f * '  6H p@ """2  "'"  ' " `' $` $  $P @$ V$       (@  "@`$ >9  ?# 42>ݔp   2H /f * '  6H p@ """2  "'"  '  " ` `'$ $ $ $r K`L#\#` S  .`   @ "@   ' y %>"D   @ "@  ' `     @ `?'  @ "@  ' B   ܖ F ܀ d  @ "@  '    6@% " "@;` `` b >`&`Ԁ`  'Ԁ2 "'#2  Ԑ s '@<(  T "@b   'ؒސؖ {؀`T"`L%y> Ԁ P"&`h H ! ` "D  > tS -!t> l``"l  ? 0 T`` `< y `' R `  ` (   " $ kS   ?$4cS        (@  "@ 4 >>  ?#7>#t }  2H /f * ' >8 2H p@ """2    l(>Kѐ#H"'" '? @" ' R`#@` "  Rǔ] ґ "V0   (   " ;   ?$ 3>#t     2H /f * ' >8 2H p@ """2 "'"  '   #  ' 8  0r ?`  ?`    ( @  "@ $ i   ?#4a       (@  "@  >>  ?#6>#t   2H /f * ' >8 2H p@ """2 /  l>K#H"'"  '? " @'#@` " Ƹ ` ѵ ` L       (@  "@` ;>  ?# 3>#t 4  2H /f * ' >8 2H p@ """2 Ò "'"  '>   " ?*`  '#@ W       (@  "@` ;>  ?# 3>#t ڐ  2H /f * ' >8 2H p@ """2 i "'"  '> !>`" D '#@T#`       (@  "@` ;>  ?# 3>#t   2H /f * ' >8 2H p@ """2  "'"  '>  `"  '#@       (@  "@` ;   ?# 3>#t 2  2H /f * ' >8 2H p@ """2  "'"  ' `"  '##@       (@  "@` ;   ?# 3>#t   2H /f * ' >8 2H p@ """2 p "'"  ' `"  '##@       (@  "@` ;   ?# 3>#t   2H /f * ' >8 2H p@ """2  "'"  ' `"  '##@$> ! X       (@  "@`  ;   ?# 3>#t 8  2H /f * ' >8 2H p@ """2 ǒ "'"  '  ` "  '#@$`#@(#`       (@  "@` ;   ?# 3>#t   2H /f * ' >8 2H p@ """2 q "'"  '  `"  'R#@       (@  "@` ;   ?# 3>#t   2H /f * ' >8 2H p@ """2  "'"  ' `"  '#@,> ! X       (@  "@`  ;   ?# 3>#t 9  2H /f * ' >8 2H p@ """2 Ȓ "'"  '  ` "  '#@,`#@0#`       (@  "@` ;   ?# 3>#t   2H /f * ' >8 2H p@ """2 r "'"  '  `"  'R#@       (@  "@` ;   ?# 3>#t   2H /f * ' >8 2H p@ """2   "'"  ' `"  '#@?        (@  "@` ;   ?# 3>#t =  2H /f * ' >8 2H p@ """2 ̒ "'"  '  " F`'#@Gv#`       (@  "@` >:  ?# 43>#t   2H /f * ' >8 2H p@ """2 y "'"  ' ` "  `'># >ސ#*`  > !t$$ $ $ $$ (?"$ @3Z#$ ,$ 0?"$ @3Q#$  #\#`  찒  . `  @ "@` ' 7 @ C`!  @ "@` '  @  @  Hڀ     " @  '   H[  `/  @ "@` ' ٘ "@@   @ "@S  T; T 0~'䀦 ؖ 'ؒÔ s؀`"M  @*_ ` d  @ "@ ` ' ˈ G>@"D    @ "@` ' n -  ` @ `?'  @ "@` ' O @  RЖ ǰ  Ѐ쀦 "L @;&@  ` 2` " L㿐  X L{h H  ' b   < X (> !``"``  ? ( L` `< ǖ'R ``  `` `(` `  " $ kS ``  ?$@4cS        (@  "@ 4 >>  ?#7>#t ː  2H /f * ' >8 2H p@ """2 Z  l(>K#H"'" '? @" 'R`#  " R]` ߒ "V`0`  `` `( `  " ; `  ?$@ 3>#t c    2H /f * ' >8 2H p@ """2 "'"  '   #  ' ` ~{ ?`  ?`    ( @  "@ $ i`   ?#4a`       (@  "@  >>  ?#6>#t   2H /f * ' >8 2H p@ """2 }  l>KB#H"'"  '? @" '`#  "` `    U       (@  "@` ;(  ?# 3>#t   2H /f * ' >8 2H p@ """2  "'"  '( `"  e' #       (@  "@` ;>   ?# 3>#t /  2H /f * ' >8 2H p@ """2  "'"  '> `  "` ( `'`H>]#>]!#  "## ?#@W       (@  "@` ;>  ?# 3>#t Ȑ  2H /f * ' >8 2H p@ """2 W "'"  '> !>`" D '# T#        (@  "@` ;>  ?# 3>#t s  2H /f * ' >8 2H p@ """2  "'"  '>  `"  '#       (@  "@` ;   ?# 3>#t    2H /f * ' >8 2H p@ """2  "'"  ' `"  '##       (@  "@` ;   ?# 3>#t ϐ  2H /f * ' >8 2H p@ """2 ^ "'"  ' `"  '##       (@  "@` ;   ?# 3>#t ~  2H /f * ' >8 2H p@ """2   "'"  ' `"  '## $> ! X       (@  "@`  ;   ?# 3>#t &  2H /f * ' >8 2H p@ """2   "'"  '  ` "  '# $ # (#        (@  "@` ;   ?# 3>#t А  2H /f * ' >8 2H p@ """2  _ "'"  '  `"  'R#       (@  "@` ;   ?# 3>#t ~  2H /f * ' >8 2H p@ """2   "'"  ' `"  '# ,> ! X       (@  "@`  ;   ?# 3>#t '  2H /f * ' >8 2H p@ """2   "'"  '  ` "  '# , # 0#        (@  "@` ;   ?# 3>#t ѐ  2H /f * ' >8 2H p@ """2  ` "'"  '  `"  '#       (@  "@` ;   ?# 3>#t   2H /f * ' >8 2H p@ """2   "'"  ' `"  'v#       (@  "@` ;   ?# 3>#t /  2H /f * ' >8 2H p@ """2   "'"  ' ` "  '`>>#  #*`   > !t$$ $ $  $$  (?"$ @+#$  ,$  0?"$ @+#$ `` #\#`  U찒  .   @ "@  ' |  `C!  @ "@  ' `   @  ܰ Hڀ     " @  ' > HSS  /  @ "@  '  `"   @ "@S  TĀ T 0~'䀤` ؖ 'ؒ s؀``"`E_ ``` @"`  d  @ "@   ' ͘ G>"D    @ "@  ' ó -`   @ `?'  @ "@  ' Ô   ŗЖ    Ѐ` 쀦  ( #`7` Dڐ  (` ` 2 ``@4%"`? `` 2`" D8   `t  `5 `4 ฀ $  b% 2W $4l   M    @$ "    ฀ 2 @!v  Do$Dm㿘   @ p`H> !p `"p" $H ʒ '`R  `  `  (    "  j`   ?$4b`       (@  "@  >=  ?#5>#t А  2H /f * ' >8 2H p@ """2  _  l>K$#H"'" '? @" '`R`#@` "` R^S  V0      (   " ;   ?$ 3>#t g    2H /f * ' >8 2H p@ """2 "'"  '   #  '`   ?  ?`    ( @  "@  i   ?#`       (@  "@  >??  ?#6>#t   2H /f * ' >8 2H p@ """2   l>KH#H"'"  '? # @'#@` "      }`#\#`  &찒 "6l` .d  @ "@ ` ' N G>@"D    @ "@` ' 4 - `` @ `?'  @ "@` '  @  ܖ    `܀ `` 2``" 㿐   HH @     "!` H@ 4 "` 4 $`  `2` t  @= 2`B8 `` ```#\`@6#` t`   t 11B A AB B  " 㿐`` #`` `#\@p`H> !@ x" ?` "x   H [ '`R  `  `  (    "  j`   ?$4b`       (@  "@  >=  ?#5>#t a  2H /f * ' >8 2H p@ """2   l>K#H"'" '? @" '`R`#@` "` Rx_S t W07      (   " ;   ?$ 3>#t     2H /f * ' >8 2H p@ """2 "'"  ' `  "`   '` _  ?`    ( @  "@  i   ?#`       (@  "@  >??  ?#6>#t   2H /f * ' >8 2H p@ """2   l>Kܐ#H"'"  '? # @'#@` "   cचR  `  `   ( @  "@ $ kS`   ?#4cS`       (@  "@  >>  ?#6>#t   2H /f * ' >8 2H p@ """2   l>KX#H"'"  '? @" 'R`#@` "ऒ R^`` W`0       (@  "@` ;   ?# 3>#t     2H /f * ' >8 2H p@ """2* "'"  ' `  "`   ' `^ ?`  ?`    ( @  "@  i   ?#`       (@  "@  >??  ?#6>#t '  2H /f * ' >8 2H p@ """2   l>K{#H"'"  '? # @'#@` "@  = 3`#\#` `\ Y찒 "6` .  @ "@ ` '  >@"D    @ "@` ' f   `` @ `?'  @ "@` ' G l@`  ܒJ `܀   @ "@ ` ' ! F@D@   @ "@` '  -` ` @ `?'  @ "@` '  @` ؖ a  `؀`X`  2` 2``" `" p  `H  `H b   @> =   \> |`"|  ? D  { '`R `   `  (    " $ jS    ?$4bS        (@  "@  >=  ?#5>#t   2H /f * ' >8 2H p@ """2   l>KԐ#H"'" '? @" '`R`#  "` R^  W0      (   " ;   ?$ 3>#t     2H /f * ' >8 2H p@ """2 "'"  ' `  "`   '`: `R  `  `   ( @  "@ $ lS`   ?#4dS`       (@  "@ 4 >?  ?#8>#t   2H /f * ' >8 2H p@ """2 3  l(>K#H"'"  '? @" '`R`#  "` R^` "W0       (@  "@` ;   ?# 3>#t ;    2H /f * ' >8 2H p@ """2ʒ "'"  ' `  "`   '`]  U( ?`  ?`    ( @  "@ $ i   ?#4a       (@  "@  >>  ?#6>#t Ő  2H /f * ' >8 2H p@ """2 T  l>K#H"'"  '? @" '#  "   ڐ "А #\#`  찒 "6 .'  @ "@  '  n` ܒ!   i  @ "@   '  G>"D    @ "@  ' ݘ - `  @ `?'  @ "@  '    ؖ 6  ؀- ``` 2``" `" : " h>  Ha h   b"h@"Q  ?`  L (`  < V `' R `   `  (    " $ kS    ?$4cS        (@  "@ 4 >>  ?#7>#t Z  2H /f * ' >8 2H p@ """2   l(>K#H"'" '? @" ' R`#@` "  Rq] n "V0      (   " ;   ?$ 3>#t     2H /f * ' >8 2H p@ """2 "'"  '   #  '   %`  ?`    ( @  "@ $ i   ?#4a       (@  "@  >>  ?#6>#t   2H /f * ' >8 2H p@ """2   l>KՐ#H"'"  '? @" '#@` "  `  '`?`#@W       (@  "@` ;>  ?# 3>#t   2H /f * ' >8 2H p@ """2  "'"  '> 1>`" D '#@`T#`       (@  "@` ;>  ?# 3>#t   2H /f * ' >8 2H p@ """2 N "'"  '>  `"  '#@       (@  "@` ;   ?# 3>#t l  2H /f * ' >8 2H p@ """2  "'"  ' `"  '##@       (@  "@` ;   ?# 3>#t   2H /f * ' >8 2H p@ """2  "'"  ' `"  '##@       (@  "@` ;   ?# 3>#t ʐ  2H /f * ' >8 2H p@ """2 Y "'"  ' `"  '##@`$> ! X       (@  "@`  ;   ?# 3>#t r  2H /f * ' >8 2H p@ """2  "'"  '  ` "  '#@`$`#@`(#`       (@  "@` ;   ?# 3>#t   2H /f * ' >8 2H p@ """2  "'"  '  `"  'R#@       (@  "@` ;   ?# 3>#t ʐ  2H /f * ' >8 2H p@ """2 Y "'"  ' `"  '#@`,> ! X       (@  "@`  ;   ?# 3>#t s  2H /f * ' >8 2H p@ """2  "'"  '  ` "  '#@`,`#@`0#`       (@  "@` ;   ?# 3>#t   2H /f * ' >8 2H p@ """2  "'"  '  `"  'R#@       (@  "@` ;   ?# 3>#t ː  2H /f * ' >8 2H p@ """2 Z "'"  ' `"  '#@ ?  ?`    ( @  "@  h   ?#4`       (@  "@  >??  ?#6>#t [  2H /f * ' >8 2H p@ """2   l>K#H"'"  '? @# '#@` "t  `q `g`2n       (@  "@` ;>  ?# 3>#t ~  2H /f * ' >8 2H p@ """2 ~ "'"  '> > ` "  '`!t@&& & & `$& `(?"& @i#& `,& `0?"& @`#&  #\#`  찒 "`` .`   @ "@` ' F @`C`!  @ "@` ' , @  @  HĀ`    " @  '    HB  `/  @ "@` '  `"@@   @ "@S  TL T 0h'䀤`  'ؐؒԔ ]  @ "@ ` '  G>@"D    @ "@` '  -  ` @ `?'  @ "@` ' v @  yԖ   `Ԁ쀦`"3ɐF  ` 2` " 3 " h > `  H ?a  d' "db $ H  <  ' R ``  `` `(` `  "  j ``  ?$@4b        (@  "@  >=  ?#5>#t }  2H /f * ' >8 2H p@ """2   l>Kn#H"'" '? @" ' R`#@` "  R1^S - V0`  `` `( `  " ; `  ?$@ 3>#t |    2H /f * ' >8 2H p@ """2@ "'"  '   #  '  ͐ ?  ?`    ( @  "@  h`   ?#4``       (@  "@  >??  ?#6>#t |>  2H /f * ' >8 2H p@ """2 ͒  l>K#H"'"  '? @# '#@` "`W  T J% ?#@W       (@  "@` ;>  ?# 3>#t {ΐ  2H /f * ' >8 2H p@ """2 ] "'"  '> !>`" D '#@T#`       (@  "@` ;>  ?# 3>#t {y  2H /f * ' >8 2H p@ """2  "'"  '>  `"  '#@       (@  "@` ;   ?# 3>#t {&  2H /f * ' >8 2H p@ """2  "'"  ' `"  '##@       (@  "@` ;   ?# 3>#t zՐ  2H /f * ' >8 2H p@ """2 d "'"  ' `"  '##@       (@  "@` ;   ?# 3>#t z  2H /f * ' >8 2H p@ """2  "'"  ' `"  '##@$> ! X       (@  "@`  ;   ?# 3>#t z,  2H /f * ' >8 2H p@ """2  "'"  '  ` "  '#@$`#@(#`       (@  "@` ;   ?# 3>#t y֐  2H /f * ' >8 2H p@ """2 e "'"  '  `"  'R#@       (@  "@` ;   ?# 3>#t y  2H /f * ' >8 2H p@ """2  "'"  ' `"  '#@,> ! X       (@  "@`  ;   ?# 3>#t y-  2H /f * ' >8 2H p@ """2  "'"  '  ` "  '#@,`#@0#`       (@  "@` ;   ?# 3>#t xא  2H /f * ' >8 2H p@ """2 f "'"  '  `"  '#@       (@  "@` ;   ?# 3>#t x  2H /f * ' >8 2H p@ """2  "'"  ' `"  'm#@       (@  "@` ;>  ?# 3>#t x4  2H /f * ' >8 2H p@ """2 Ò "'"  '> > ` "  '!t@$$ $ $ $$ (?"$ @#$ ,$ 0?"$ @#$ `` #\#`  d찒 6  .   @ "@` '  @ C!  @ "@` ' o @  @  H     " @  ' M  H;b  /  @ "@` ' - "@@   @ "@S  T T 0j'䀦  'ؐؒ _؀d  @ "@ ` '  G>@"D    @ "@` ' ֘ -   ` @ `?'  @ "@` '  @  Ԗ /   Ԁ & ` 2` "   `"`, `` `@ ?а  `t`2  `" `,`"`x\ ,ڐp  `H @  b,ː,ɐxF   > t``"t  ? $ H 1 `'`R `   `  (    " $ kS    ?$4cS        (@  "@ 4 >>  ?#7>#t v5  2H /f * ' >8 2H p@ """2 Ē  l(>K#H"'" '? @" '`R`#  "` RL] I "V0      (   " ;   ?$ 3>#t u͐    2H /f * ' >8 2H p@ """2\ "'"  '   #  '`   ?`  ?`    ( @  "@ $ i   ?#4a       (@  "@  >>  ?#6>#t uX  2H /f * ' >8 2H p@ """2   l>K#H"'"  '? @" '#  " p  m "c} #\#`  찒 "`6l .`d  @ "@   '  G>"D    @ "@  '  - `  @ `?'  @ "@  ' x   {ܖ   ܀vM `` 2``" ** " nfs_readdir: lost in space8  @tऀ``   `2E` (A``@4=`2  ` @86` 22`H!a> ! $  &!` 2`> a`  ("` `G 2` Ā@2 `> a`  "` .s 2U ` > a`  "`  I"2E   @ @@" , s  "@ "``>` >d#( ? @ "??"  @ :   @""@@`"@$`"@"@" "EEK! readdirrpc resid > 0 `H श !'L'А ` b C 'J '>"8''> ` "`  D  ȐC 'R `   `  (   @" $ iS    ?$4aS        (@  "@  ><  ?#4>ݐ#p  sG  2H /f * '   7 H p@ """2 ؒ  l>K#H"'" '? @" 'R` #?ऒR`` ]Ȱ YS0  "   (   @"  :   ?$ 2>ݔp rݔ   2H /f * '   7 H p@ """2n "'"  ' `  "`  ' [       (@  "@` :   ?# 2>ݐ#p  r  2H /f * '   7 H p@ """2  "'"  '  " `'  ` `Q        (@  "@` >9  ?# 42>ݔp r/  2H /f * '   7 H p@ """2  "'"  '  " `' Д` `#\#`L w䰒 " .?'  ܒ@ "@ 'ܐ ؖ g   Ԓ \Ԁ   ܒ@ "@ 'ܐ ؖ F'`'`0Q  ܒ@ "@'ܐ cؖ *  ܒ@ "@   'ܐ Lؖ      ܒ@ "@ 'ܐ 3ؖ   "̐"" 6@8@"@@'̔""``@ B ">`&``8 >(@@2 ̒@'&.6b.'```B @>`&` "@`? "`9 @$(@<"@`""``` B ">`&`   ܒ@ "@    3 0'܀  ܒ@ "@  'ܐ   ܒ@ "@ 'ܐ ؖ Y؀ ' '"    ܒ@ "@ 'ܐ hؖ /`?䀤 > ̀""@ 6@@8"@@`##```@ B #>`&`" ``?`° H0 0 >V"`   ""EEK! readdirplusrpc resid > 0 ऒH '|!'x`'L| "Ԓ ٖ  't'p'd ''l'> `"l ޔ \ठR`'   ?`   (   @"  j   ?$4b       (@  "@  >=  ?#5>#t o  2H /f * ' >8 2H p@ """2 u  l>K:#H"'" '? @" 'R`#@` #?ऒ R S l        (@  "@` ;  ?# 3>#t o~  2H /f * ' >8 2H p@ """2   "'"  '   " `'#@`#@ `#@ `#@x`` #@x#``#\#`L  V .'  @ "@` '  +@        @ "@ `  ' ˜  @`' @' ` p    @ "@ `  '  ` ` ݪ  @"t"" ``7`@8@"@@'t""``@ B ">`&``8'ppB(@t2 @'t'@/`7`/`'t```@B >`&` "@?"@@& & @$@,@<`"@`""``` B ">`&`   @ "@     0h'  @ "@ `  '   Sp "`@`'@`'@   "S `Th T 05'  @ "@` ' ؘ  @ L  @ "@` '   @``@`` ` "    ' W 2H @  2H#v' '1   ' _ ''' '' (>ޕ*c@  2 ' /`|@" & o`@&@  2|`%`+  @ "@` ' ? @` ``  "    0t'# '  @ "@` '  X@ pV   @ "@` '  ;@`?t p > t`t"`"@ 7`@@8"@@`##```@ B #>`&`p"``$? K!GB H=  >Ԑ#`  y "" #nfs: sillyrename dir .nfsA%05x4.4㿐א` ' l u: $@"_$``t 2>!, `  4>aŐ $` ``*`:  z,``@@ Ȕ  `@@  "` "`t@n7 h`H> !L ``""L  $ H  `'`R `   `  (    " $ jS    ?$4bS        (@  "@  >=  ?#5>#t l!  2H /f * ' >8 2H p@ """2 簒  l>Ku#H"'" '? " `@'R#@` #?` R8] 5 V0      (   " ;   ?$ 3>#t k    2H /f * ' >8 2H p@ """2H "'"  '   # ` ' ՐS ?` ?` ` ` `(`@  "@  i``  ?#@`       (@  "@  >??  ?#6>#t kF  2H /f * ' >8 2H p@ """2 Ւ  l>K#H"'"  '? # @'#@` "_  \ Rр`#\#`  x찒 "`` . `!  @ "@` '  @``@  H` `  "    ' { z@`"%UR` @ '܀`@4 `l[ `R `@ ܀`@ j "`ܐߔ 2 2 `H@ 2`H $ .[ܰ 0P `-'  @ "@` ' # "@   &ؖ ؀ @ 瓰 0 'Ԗ 燰 `쀧`@    ^0'@pH! r > a` "`  DR`' ` ?` ` `(` `  "  j``  ?$@4b       (@  "@  >=  ?#5>#t iȐ  2H /f * ' >8 2H p@ """2 W  l>K#H"'" '? " @'R$ #?R S  ѐ0       (@  "@`  ;  ?# 3>#t i]  2H /f * ' >8 2H p@ """2  "'"  '  #  '$$ $ #\#`  찒 z .  @ "@  ' ј R>"D   @ "@  '  9'  @ "@  '  $   ܒ 쀦 &  @ "@ '   0Ԑ@   !1㿘  "  `H L g2` $ nfs physio/async㿘  0`  >" 0  >" 0@" l h 0 '? (p 㿘    @ nfsfsyncnfs_fsync: not dirty8 ?' H'T!쀠''L'P*  !@  '?    H!@a T`^ H /d4 d* % dI F@ 0 2:`2ll@2?0- $0"@ T: `3`+ +` ;B  2` (`  `d"@ @ :`C 8 @   H 0 o P&% ! ,@T: `* 2d #* @ ; DlP !1@  H 7, ?0 `$0 n&H /d * %  h`& h0$d$00? @ $0$`%ђH 0 ͐H /d4 d* % dZ @ >0 )L 2L`2I0  $0Ò`H 0  8P Ha>!X *`'0 `>#T`0 2`T0 0$0H 0?M0H 0`L QH /d   hO * %  h 0#> 0 hd& 0`Xcȸ "! hH 0 P ݀a>!X *`'H /d * %  h 2 0H 0 d T`@  ?2 㿐   `` #\  tag VT_NFS, fileid %ld fsid 0x%lx 㿘 > #<`8 t`2>F->W#8  - - - - -㿘 @  bwrite: buffer is not busy???㿘> 0 " 0 ># 0?! @& 0H /d * % `` \$  \" \`0 "`0 \h "hH p@!@  @ 2 T : `* 2`  *`  0 : d@ "@ & 0 \ l , 0* & 02  0& d ?& 0& `  !1 \`H ` 0@ & 0> 2&  9`H /d * %  \$%H 00`0 "`08   H <`  t        9Y  2    㿘 > ` >ߒa3 ># `*"@ *`@ *`# 8ȕ* @㿘 > ` >ߒb3 ># `*"@ *`@ *`# dȕ* @8 ` c &>ߐd4 `4` >`H <`>ߤ !" ' ' ""  ' '  9>!>ȓ*` €㿘 > ` >ߒa3 ># `*"@ *`@ *`# 8T* @㿘 > ` >ߒb3 ># `*"@ *`@ *`# dT* @8 ` c @a > aa$ `*" *  * $  " > aa$ `*" *  * $  $4 `4` >`H <`>ߤ !" ' ' ""  ' '  8{>!>T*` €dev = 0x%x, bsize = %d, size = %d, fs = %s ffs_alloc: bad sizeffs_alloc: missing credentialfile system full %s: write failed, file system is full 㿘'@`  0  %@> @  ? `>"ЖC >Ȑ# >Ð#2  Ā "C   ">  `  ̡, <  (@ d$ 0>  @- " $06 2 `@ @Ր>"@i  ` `@ $`$`'@ @,ޖ  >@8> x#P dev = 0x%x, bsize = %d, osize = %d, nsize = %d, fs = %s ffs_realloccg: bad sizeffs_realloccg: missing credentialdev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevbad blockno%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optim㿐\% `0 e@> @ 2  ?  @  >`0!8g`>!x2`>! ".`````̡,`< :`(@ d$ $`.` 2 >`0!`A >Ɛ!?ɘ  ': @, "`0@@ `dT,@">" $] `$6 `2'`<`*`(@Ē `̀@#>>b `$``<`(Ғ@ d`̀@`0> bH`Ԑ  $`>"xږ`>_">"Ԑ@4 ,= `d,"`T@@ 6 `T&?  @ = `$$0 ""0H@% @+ `>@ Ŕ8>#P`԰ ffs_reallocblks: unallocated block 1ffs_reallocblks: non-logical clusterffs_reallocblks: non-physical cluster %dffs_reallocblk: start == endffs_reallocblks: unallocated block 2ffs_reallocblks: alloc mismatchffs_reallocblks: unallocated block 3 %d,>!l`V'| ` %$ O    `P@?'x!> ,`@T d 0@ `: 2`"@&   @ d 8-` >,``P "`Ȁ@,`  T@+>,``T "`"@T@:T@:2 Ȧ @# 2 x @# 2 `*`ਢ * ? 0?S  0и H @` *` * ?  ?* @*`  & >!#  0?$  H'| @T>!@ ,` @@%7>@"| ,``T d 0@ : 2 >c@`T d: "$>ch 8`@ߤ@ h oh `%> !! *" *  * '' 99   h  J @*->%> ,``T d 0@n:   d, "T `T d 0@ C: >!p` 8`@ܦ  @@  mode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free 㿘   "` Ȁ "X < 2@\,: @h. 2`>!d@ "9 `H   8F05 ` `"   >!0>!P>!hx&  쀢 &   &  &     &   > @ >!԰ 㿘 , @    l p8"ؑ;*  *` 6   @&    ; 㿘 `\@ .? 2X`8`t @  @``\ .?   @`@ϒ@` `,@p`@’`l`p8bؑ:* @ *`  6,`: @ `lb`p8: *  *`  6`: , `X (& * ``*  " `@0 $b`8 `D``|*"@ *`@ @p*`?@l`8㿘  "`,. @@6&@  , `,@   ݲ``,@"   㿐 pؑ>@l* .@ *`T  ': @/? 8? 4ư  *%.@   d, ?Ř @HbU  > #Ԁ  >    0!$ @T>6!8@"U@    :`c `   ?":@ ؖ璃@ 8" # 4@"U  @  ` :`c `   ?":@ "T T> " *` ? "*`   T>5 @"Uؘ  @   :`c `    ? #(*@* $$ $̘ pl>@$̑* .@ *`  ?"  , 㿐 pؑ>@l* .@ *`  2 02  PK.@   d, ? G@ H bU " #Ԁ     > 0> 6 ǰ !$ 02 T@۔08>   4. `   `@ `@ "`@ R   0@@~8 # 4@"U  ,` :`c `   ?" +@*8`@8  $"@ $ $̗+`p l>@$̑* .@ *`   " ,   O0N@ ,`@! 4@"U  ,` :`c `   ?" +*@`*@ $ "$ $̀p"l>@$̑* .@ *`  "" ,? $@*`   dpos = %d, i = %d, fs = %s ffs_alloccgblk: cyl groups corruptedffs_alloccgblk: can't find blk in cyl㿘  `H @`  `(" 8 @`@bU c``@ `@W> "#X ٺ%P լ |@ `@bU | -`T@`T@  "@"U"`X-` @@* @v "@Ȓ ߒ@j@h @c@Ԓ@ @,`T` @`@ ,`T`$`@,` @,`T 4 T `@,`T`$`,`T g @2%@ `@. %L ,#\ %T* R? >" >!#2%T,#\ t* R@"U`c``@@ 2 `%L?2%Xe`   `:@ $ >"b >#@ , 8@A&`( `@`bU >c``@@?@֐`&` Ē& `  p l; *`+  * " |@  |@ @   |@ @   @%P@ * `@"U@-` Ԑ@ `X%P@* @?4`bU -``T@`T@  ?".  ` ffs_clusteralloc: map mismatchffs_clusteralloc: allocated out of groupffs_clusteralloc: lost block㿐` .`T 6` ° .@   d, ?< @ HbU  " h#Ԁ  h.$     `@ @  @ T.`` `$z#  t# @8"8  @ِ`:  l:`*  &  *@    p *`    @   A @& @"U)> # `@ K 2`!H@$  `*@ @".>!h @3>"8a@@0 cg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedfs = %s ffs_nodealloccg: block not in map㿐 pؑ>@l* .@ *`  2  .@   d, ?K  0@ H bU" #Ԁ >   !$ @   :`b \  ?&:@ W 0` `:" ,  @"U@:" \ @ 2  @ "U@ " \ @ 2   0> M>Ґ!@bU "  \ *  ؀  *>!00>!@$ 0 @"U@:b \  ?  &+@* <?$ Ȗ pl>@$ȑ* @.@ *` ?" ,  $ pl>@$* @.@ *`  " nːdev = 0x%x, bsize = %d, size = %ld, fs = %s blkfree: bad sizebad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s blkfree: freeing free blockblkfree: freeing free frag㿐 08 @> @ 2  8T@>  $  >0!X>!@Q$@ > !> @0 [V-@   d, ? U0@HbU`  > cԀ > G 0!$`@0 |`@`bU >@c``@@  2 ` >!Ȕ2>!@"U@"``cؒ@@  @`ؐ $`Đp=@ l$ē*` -@ * `"|@|@u@|@k@i@dP@* `@"U@, Ԑ@ `XPà@* @ 4`bU ,`T8?.@  `@"U@:c@``@    " %  : :@ `4?@ %T > >@"U>@,``:`c@``@   : *#:@ " ` Ȕ >""``@@    ?# @ *@ +@ ʘ `$$`$̀ pl=@$̑* -@ *`  "  `@"U@:c@``@  8 " ?% ::@ @  `@`"U@= c``@@ B o`$8 " $`$8̐p l=@ $̙+  -@ +` #@ ``$`p=@ l$ē*` -@ * `"|@|ؐ@c@|ΐ@Y@W@RP@* `@"U@, Ԑ@ `XP@* @ 4`bU ,`T@`T@ @ "@ ,8㿘@ifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inode㿐  `l`,*>"0`@<`]``X- `  `d? , ` W0w@HbU   > #Ԁ > I i !$ `@q @bU 4 \ :  >"`5`L`Ҁ`2 >" @"U@4b \  (* * 0*$ 0 bؐ $ `<`p``l=$`ȑ* @- * `" 2,` ?$ ``p`l=$`* @- *` ?" ,`r bsize = %d, size = %ld, fs = %s checkblk: bad sizecheckblk: bad block %dcheckblk: partially free fragment㿐 0  @> @ " $>!8 ><!`@*>!x5 @r@k*   dࠓ, ?$ ?0U@HbU  " #Ԁ "t F?@0  @"U@# ``@>@ .T >@ ! @"U@,   ; # ` ` ` ?#@; 2` ``@ >Ɛ!0`?start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %d, fs = %s ffs_alloccg: block not in map㿘 @`  ` `, & ``: ``@:bU "@``@`8>#*   ?"? * @E +`@"U@ c``@`8#*@  ?"? * @% 2 > ` >@ " *  &`,:.@"U>>ax!    `:`c@``@  `8 "& $  : : @ @*`@  @ + `@ *`8Ӏ > @t`> X 㿘$l h>`.`# (.> . # (.@.$p@8(& .` . @ ` @  '? 8(! .> @ ?@ !$4/  ".  ". "$ (T  ? .`.`&uid %d on %s: %s 㿘>ax Ԙ ffs_balloc; blk too bigffs_balloc: ufs_bmaparray returned indirect blockCould not unwind indirect block, error %d `?' `@)`P e<` ` @`0@ $`>!`"6 `P@﷔ `'` R'P` 4`0 *: 8 e<2`0@8e<`0 eD `L `0 2` .-`0#\˒  `P+ ;   @<,  T`d:@$  $Z` ` -`  `P`* : 8 2`0 `0? `j "*`Pe<eD `L  @  ? K0Đ#\b 80`* : 8 eD2 `0(`0eD`L o k o '`d*@ " TH@<" @ `dT:@$ $`K"@@Z D `>!'* @ 2'  Z`0( $'Ė `0 %'`d, " TH@Y<" @ 2̠*  $'`$ O H I,2 `0  `0 ,&@*  `0 `d', <"TH@` J"`@ * * *` % `&'3,,* `0? _ H*  3Ð`0 E&@`0  `d', "T "H@<" @* `%"`J` `0?G "``0 \ '`d, " T` J"@  `0 `0 "#"  *  * `0?  ">"@* H%    =  @I "@ $$ffs_update: bad link cnt㿐```H <`  ?$ @   ?$ 2` |  " `$` $ " ` $` 0`B $<0  > aa$`*" *  * $ ?$%,`444 @~ @ * ~   @ @ x `?*   d , n 0 "T0! " x>Y#@ H* @|) `` ` H`<@> ffs_truncate: partial truncate of symlinkitrunc: newspaceitrunc1itrunc2и '@   >  >  !! *`" *  * 'P'Tt`$H @ :` ` ` 耢 " >"@O     = HP@ а@$$$$  <:0 2 4( 0    LE#\ ( @i= @E`?L L P %  ) @Q< `2PI= @슒  `   LE#\ (Y g = P * :  8  20 8<0<D L @t`L$H@L,`L0L0  : EP@K"8  T:  @< @'@@ < > 0,`@@ "`1"P`>  <@"#X=  @" % %  `%  ?@r ffs_indirtrunc: bad buffer size㿈  ''X   t|S?@-0:    `0" >"`, ",`0`<@ `8$`0$$`T>̐"' /Xs""`H0 O< 'y0t, "@@*` H <`@ A 2'ܐt?{?&@,  d. ?? 2'0L?@ @],  d. ?b 2'P  X`0 $`0X"㿐   P @E 40*:  8  20 @8<0<D L  " ?+ " 0 < H @#  "@㿘8>/  (-.`>>xᜀ  ': ) @@2 8&/@/8 /`/ 8܀ Disk overlap start %d, end %d overlap start %d, end %ld Disk buffer overlap㿐>>#H>* <" "D*  T:` @  ;)>"4 | 0@2/ | \ *  $ј 2$ |` @2 | < " | T4 |: $ |>F# <# T;  ?>x# | ˀffs_isblock㿘 8>>0#  >@ `?>@ *  @ *  *@  `?>@ *` @ `??!8ffs_clrblock㿘 8 >  >0 >.@>@ *` @ *` * * .@ >@+ * .@"ffs_setblock㿘 8 >  >0 > .@>@ * @ * * @ .@ >@+  .@"ffs_isfreeblock㿘 8 ">  >0 >@`?>@*` @*` *   `?>@>   #softdep_flushfiles called㿘> H softdep_setup_inomapdep called㿘> softdep_setup_blkmapdep called㿘> softdep_setup_allocdirect called㿘>x softdep_setup_allocindir_page called㿘>i! softdep_setup_allocindir_meta called㿘>[!Xsoftdep_setup_freeblocks called㿘>O!softdep_freefile called㿘>E!softdep_setup_directory_add called㿘>8!softdep_change_directoryentry_offset called㿘>(" softdep_setup_remove called㿘>"`softdep_setup_directory_change called㿘> "softdep_increase_linkcnt called㿘>"softdep_load_inodeblock called㿘>~"softdep_update_inodeblock called㿘>~#(softdep_fsync called㿘>~ݐ#` softdep_fsync_mountdev called㿘>~ϐ#ffs_mountroot: can't setup bdevvp'sffsroot_device㿐>">>a >a\  >>LcL!> d >##0?>>#cM 7 d@   ?"2MԒ 0%>՘`" "`@  #b` "@b`"`!   Ԕ Yt~ @ D  @Ba WARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck  tc l " <@@"{ L Ҁ `@  @ @,   <@0@ ><@; ``d !* " L р 2 <@>>!b ǰ !X] Ӏ   @< < @ $<   @s < @&(&&$&&,Ȑ t "x >9 `x&  `"<< !!`  ! k<@@#   xx`  2 ? ; )  YsM Z`" @ϐ  Ys@ Z`@’$ s5 Y`@踒$ @T )Lu% l D<@ $<`@<@"  L Ҁ ,  Ӑ  , ѐ@  ffs_reload: dirty1ffs_reload: dirty2㿈<   `f   S !  >|"x`h ?Ԛ " (<` @ ? F H%\aT @ 0@eg87 ̰ "  |tT$#Thth#@40 "0 (@+&@D@4?@ 6' 804v$d@*@ ?ꕘ `<* t^H8 Ӏ  Ӗ $А0p<*@&<$ $,  T$ ",  Y  H>  X`8 @`#    " >|7"`@kv༠@d* v @鼐@Xx`?* d0,  x@` H* @ s`U`%`qd2 H 㿈x  ?Đ kI > d b ?`  ,   N`<   ?Ɩ B `h  " (<' @鶖  F HaT%\  O 0@@eg(x , L ѐ ?`, Ӑ , `<@>>!X| %L!|  %L?  ڰ  H!P@֒!P h H %` HsC h h#@0 "0'` , Ґ , ,   4@䏐 %$  ,*  HĔ  @) 8@ 0 4u%  d@*@ 3찒 Hs `"ؑ<@* "@ꈦ' 8@@ݐ@%$ Ԁ `` , @ $#T%$`" ,@ &a&`d "`  "` &`h &`h`<%( &`@&`<%`%@%` t %`  d %`$ 8%`(" 6"x@Y"`!pݐ"`Ԓ" @4%0=aH 0   @⺑; B?%0 8 <%0%4 <%04 Ӏ   I  x, ѐ@^  I x" 쀢   ` ` I̒ Iɒ &a㿘  *   @ &  %L?&  &%P%, $  0*` * ?:   t:`>%0<  @P %0 B >%0 H L8 8   ;`; >%@>%8 㿘`<6` `@> 8a N`Ҁ 2 `Ӑ` `.`@  " &.`ђ  x?"  k N`Ғ      ? bIK IH IE `<*@$`<$a㿘`< a _` % , `@̔  , K 4`   ffs_statfs㿘!F aTe\ "`4>y#&``0&``(&` `8t``̠ &``<t`(@ d$&``t`,?&``Ȓ D@ &` `Tqt Z `qp Z!Laql l `D`@䄔  fs = %s update: rofs mod㿘! LЀ   LҀ "  > z>yn   2` H2  t  X%   ` d `@`0    2 ^`2 H` <@ 2 `d 2@ @iLЀ`@Ԓ 2inode㿐a @˒ & >!   " &`  - .  Ft!@T!><  =]  " ($ $$ $"?@ " Đ0h@s'༠@* s @V@x`?*  d , 0  @&@>x H* @ pvT$>>!P4@ p " %& $ 쀢 2,N `$ $ H`<2, $, $$ &㿘!`  ` r,`@  F@h  2@ "`"`㿘  ` `4?@ *b`8`0`4r%``d@*@  Q Ho`@[`8浐 2`8&`8 6 `T`d@ " `h  -,`> a$` `hoHeL?H"Pe, 4H8 H"@"H`:00y 2㿘8@ܐ㿘`  >   -0   -0>   >!l>!h[%s: modeffs_read%s: short symlink%s: type %d㿀  ` >> Pw``tH @@ 2 耢 2 >> pwy`` ( >> wq```e0 ΰ 2`` e4@(`0ŀ 2`   @ b  '  @T   '*@:   2`08 e<`0`P e<e< eD `L `0 ` ` *<@* :  @ <> ` #\   ?2@? ' 4' * :  2'@8eD 'eD `L '?#\#`  ?ۘ )%@`@$6`H`HVÐ ''` ` b 4X`P`8T`P " %ffs_write%s: nonsync dir write%s: typep '  >> Pv`t #  >&> &  >܀`"``= ` @ `  `@0   >> vT`> vP`'`    @ 0 B 2t4 t  ` ` B 2   R װ ܰ ` `` ?   P@  <0 @ #@* @$  #\ ݚ r<   B` `  B   =`@@{쀦` `@P`* : `8 `20`8`0  8L @@@ @ "@&HU H@`"0F  > ``    쀦  "  ` %` `2r        ` 35`܀&   ' @ b % =  `> !! *" *  * '' ϖ ffs_fsync: not dirtyffs_fsync: dirty㿐 `t 2 `x  "   <@" a   `?H /d4`d* %`d 3 > 0 *  0 u P &  0 $ 0H p@ \ 50㐐 0U " ɦ 1`h`hd$`0\ `h 2`0H 0 4H /d * % `d   ?`t >!xH 0> !! *"  *  *  ''`? 㿘  @,  H - `  .C˒ $  mfs_mountroot: can't setup bdevvp'smfsmfs_root㿐>">>a >a\  >>LcL%>d >uא 0W>>!a  O . AԐ $> >̠a>L d" L" " $ $ $`4$ $ B  ?"Cs Cp .0%>՘`" "`@  #b` "@b`"`!  `Ԕ Yj L D@7  㿘\F!T@2  0@@4 eg8$ >4,>L> "HnI##>]a?c >>L"L#a##Lmfs_mount: dup devi t z@<@> NҀ ` @   cNҀ Z<@2V.Y !Ȓ  I| Q>]!?|c  "t#!| " .>s# A $|" |$  $  4$ $ $ &|x Ԑ!iQx"`Ԓ" @ӐkF Z YiBx Z`" @ĐLk7 t ?$ mfsidl㿘! `?>`#+>)>$`@[` 2 $`̐!ZD #   2  ~ "`耤  ,(" P? *@, &`?2` 㿘D ``D@  D@ !LajՔ t -mfs_open not VBLK㿘  t`>r#(  mfs_strategy: bad dev㿐>  " D `4 2`>rː#p`  ` T 0* @   Hj <0  Hj <ې0" ` 42``@ 0& $"`[Z 㿘 T 0* @ @ Hh <& 4 Hh <& 4 4 "& @ 0(& 0䮐 "    "     2" mfs_close: ref count %d > 1 mfs_close: dirty buffers mfs_close㿘 `$`[ ` 2 $     4`>s!0` >s!P4 >` "?>r1!p$`Z mfs_inactive: not inactive (mfs_buflist %p)㿘  ``" >r"P   - 㿘  . AJ $ tag VT_MFS, pid %d, base %p, size %ld 㿘 >`"   sg mfs_badop called㿘>q#H 㿘 "   ` "      @  ufs_bmaparray: invalid argumentsufs_bmaparray: indirect block not in cache` H  a쀧 >` >q#؀`'@`L@@?"Ȁ "Đ@  6'Ę .`$*@ `&`" `` 4 @6 * .`( @ 2  @` ` '@6 ( "@ 0 ؑ* @ _  ഐ &`L i  0"2`>q5  0$ ,@ $ 0$ T>b,`",  H*Ķ `,`)`( @#@ė.` ?( @ @` '@ @ @ .` H ?( @ "@Đ? 'Ā`   "$E$,@`&?& 㿘 H!'`& ` X    &@   @ب >`   2? (?`?%@6  ""@ "&&& "  @f   @]@  &&:& @m  "  2 2' 㿘>ap>   Q>>"a "|>  >ӄ  (  222㿘>"'> %> @ *` " @ @2 2  ` 0 2  㿘>"    5 <> b>Ә @  * @` `2 @`@2 @ < 4  `2`"@ a *   & " " &    2   "" ffs_inactive: pushing active㿐 > c  ``4 >#} ": T 4# `H <`2 @  ??@    ?   $ $ 4   > !! *" *  * ''    `Ғ ufs_reclaim: pushing active㿘>#`"   4 >!0! {  $$   `"@ $  mangled entryi_ffs_size too smallh' <  'Ȑ ' '  ''@ ` ?  F @   H <`?  n [ 2@ D*/   ɔ "Ѐ` `> Ѐ      `Db "Ѐ    Ӕ`'@ K ''耦'䀦2 H "H   ?'H`L'`d  `:` 2 $`h`($`h$`h  ''Ԧ@  :`    >0 '$`p  ``h "`ܒ'>͒a`` 'ܐ "`` aB 2` * @ `h* ' ` "`hݯ`h :   Θ ֦ `2 H?' H@   >"0`@ ``h>@Ɛ `h"" @$`hT`( * 2   ?"@`@``h2' 䀥 '`h@2`h "' "`h  2`h @v  2`hH @`$  "e $`l $`p7z' @$`h    `h&q܀`d '$`h  2L `   @ @ 2D  "@ ` ;  .` `$`\aB 2` * @ *  $`h 耍$`h $`\ؐ% $`\ $`h@$`\a,c` ~ $`$`` А(% } ? @XV@w  2 >͒a`` "`   ? @`   ` `h>@   ?` <`$` `h >$`dG B @ `h!$`\" $`\``l 2H4'@  `" "'@`" '@ @ "'@G  '@Ѐ`~  x ,̀' $   g`l` 2H`   Y '@ (Q% ͒ L # ĐH ``l ` 06Ѐ`( %    0&`l` 2Hﲐ'@  Ѐ  '@ @@߈ %s: bad dir ino %d at offset %d: %s bad dir㿘 >`H!x  mØ D`>lE!First bad Second bad 㿘  ""  @ >Đ ? @ $>m!     >m" @    J@ `@ &J@J   ufs_makedirentry: missing name㿘`(2 >k"&`.``cɔ  H`@< 2 ..ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2㿀 \  ?` I h!">k#: #\  "  2ưh": <  @`$"6 Ha`Lh`H @ co g> aa`*" * *''   h : 8h2 hh\ : <h:   젒 2t    ?\  @ "`4   ` `"@  c\@   @ǒ  : 6>k$#66>k#4 b` ($` $:  8`2 ` ` :   G`` J㿐  h:   n 6 "@ * \ h"@  :`  Y ! \ " r 2```?`&`&``?6`} `$ 㿐 h:    ) "" H`@ * ```6`&`T&` `$ `   2D ?` ܐ  #\#`#h#d#l   Z 20 ܀ 2,     4 M  .`2M  "  M .2    D4 @8  checkpath: .. not a directory `` ` '= ; 9'܀6  ܀ 21 ?  (  @逢`# ]ܔ`H 찒 t   #`#\ #d#h#l   ݚ  2>kP"P܀ 3undefinedgroupuser㿘  H $`!  @d $  " ( ( 2   (@S    㿘`@ؐ`T`#?# $ , @ 6Q   (,&(&(  6 , 2  $  , @ @N 2   ,  , @ 6Qn   (@ 6&( ,   %s: write failed, %s disk limit reached %s: warning, %s %s disk quota exceeded %s: write failed, %s %s disk quota exceeded for too long㿘 $.  (  `" $  2X E 2S E >H"8 `>j!C  $ C`"B  ( >  . Ha ,ᰒ@ $ 8 20  >H"8>>ǐ" `iۖ8# > ! 8 $   2 E 2 E >H"8. `>>ǐ"Pip  4  E 㿘`@`T`#?#ߢ $ , @ 6P   4,&4&4  6 , 2  $  , @ @A 2   ,  , @ 6P   4@ 6&4 ,   %s: write failed, %s inode limit reached inode quota exceededinode quota exceeded for too long㿘 $.  4 , `" 0  2X E 2S E >H"8 `>i!C  0 C`"B  4 >  . Ha 4ᰒ@ $ < 20  >H"8>>ǐ" `h# > ! < $   2 E 2 E >H"8. `>>Ȑ"Phܖ  4  E chkdquot: missing dquotmissing dquot㿘   H>a!>ȕ*  ` < `  $ `  ncg#ؖ*Ha @'أ.''''ܐ  y`  t` @p i @d <  *`< @ &`<0  &0$N" , 2 4@#@&$  @ 2` 8 4& < 4$@  `꧐X2`H2`" t X8    2`eर ꆐ  ?-@㿘a. <S @   *@ `   t  X ٔ  $@"S X2` H2``2 t@60 $0  ǐ%@<?%  ?- @  .`"`<*@&`<㿐! @`   \Ҕ @a p!\  @DԀ 6 N     (' 4'   8' <'܀ " (@  $ @ > . ,@ ! '耢 " 4@  0 @ ؙ. 4> @  '& & $& (䀢 & ,& 0& 4& 8& < ?# @6  4 0@? #ߒ @6  0 2  $ 2  , 2   2   6 ?# @6   6 @ϐ  p!\- T @Ԁ K6 N   2  $`" 0 (   > . ,@ ! & 8 0` 4  쀢 . 4> @  & <& ( $ & 4 ?# @6  4 0@:  ?#ߒ @6   6 @r  㿘!  >  b``,``"``5  1 H2  t & X@`q     ,` $ `" `` "`@^``$ ڐ X2 2 H 㿘>ap>ڒ F$ >"cX>!"!"`dquotfree dquot isn'tp. @> < `>' c<>cX *  %>! 2   *` 2    ` "` "  "@@ϐ' 2 >!'>π` >>!p*` DD "DD    2 @@` @ %$ >d!' D ?@" >d!` "` "  "@`"  "` "@@`,@ $@" $@$ @u 4 $ $ 4 .  .`    ?ؘ''Ԣ ''''''1   @ @@ @    MD 4 `"  "` "@@6.' 0 2  $ 2   , 2   2  4   "' 8 2  <>  , $ 8 < 2 ' 4> @ $ <'  2 㿘`` ?6`` @`?* ` 6`>&`a``&` `""`dqsync: dquotdqsync: filep>"`>d"P` 2`] ``* @ >d "``c``6`L `   : ` `* ``6`  ` ?''''+`'''' А ` " ` "`Ly`?# @6`ג dqflush: stray dquot㿘>#>X*` @ % @> *`   c "# "@" 2X @:@ 㿐 `   &@㿘  >`#&2  `   " ` !69 K``H   ʖ @ #1 %!" 2 &$ )# %z ZZ㫒㿘!ʒ`@  `0`4&& 㿘>]a  "a 㿐 `` &` ``@"&6 & F 㿘 >c* @  @  㿘 >@c* @ ` @   `` "``D?2"` " t$ `䀈  2   `"` 4=5"> " > 0!@":0> ""> " > 0!@":0> "" 㿘  `t`>ΐ"*` €H <` g 2`   @"    ,` 2  :X:(:(:X:X:(:X:X:X   6"> " > 0!@":0> ""> " > 0!@":0> """"22"" "D:"$"(","0"4"8"@"< t( " 2 H@" L" : 0( @( :H t "0:P㿘     T ?2  ?2߰  ?2۰  ?װ  D? L? !`  @$`  @?c ? $` @ @$`` $` @`  ` @  2H ?" H <`z   @ q ?2t ?"! $t "e  " H   "H  <`V     B K $? ,?"3 H <`2> `@6!6 " $ X 0  ) $?" ,` $` ,?` $` $ ,3  ?#  H <`  @㿘  @ 66X "* "  t b"  O 60 2 d"  < o @ @$ 4  0 b2 @~ chown: lost quota㿘`"``@2!6@  !6`􀦀 5 2 `!66 `y` @`$$`$@2``($`(`  ? `$q  Ґ'? $`$`O 2/$`@`$$`$@`($`(_  2 F  1 P   '? $`$` ?@`$$`$@`($`( -  0$ >_!`2`@` $` @ @` 74`   ` ;4`    㿘 `t  ` @2   ` "     90ԐҐufs_link: no name㾈  $ >__!@t 2 He H@]    0P`#@ ` @6 `` $``$`4`> !! *" *  * ''    = " ``?``$`$`4`.<  Rufs_whiteout: missing nameufs_whiteout: old format filesystemufs_whiteout: unknown op㾐   >0=*>0:H`@ B @ -`(2H>^#@ @`4'>^#` `/``V / ט H @`4`>^#`*  $`  ^#`$`-Ȓ ` ;$`ufs_rename: no nameufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVrename: same filerename: lost dir entry㾀    ''$$2`H>^A!`H  " H @ ቐ 00 ` ް ` ` ؒ@ ( `t ϰ Ð^\ἐ ? %>]! %ݽ` = ऐ#@ऐ    @ ` @ ܒ  <  8          l  @J`.@      O $` @ ` > ` $4$ᰔ * "@*`@*`'' ږ   uK   | j`2% # 7 "   3@2>].!8 % ` 2R `@>]!X# !`# `` `$`4`$`~   ``?``$`4`$`  ـ ג``` $`4`$` R ɀ 2|`@>@>\Ő!X @2`>\!h""   `"  `@"    <     B`(  B 1 < 2  2 v  2  ``?`$`$`  ?`% %  2 `?4`  ?5    P ߹߷ ? %>\L!䀢   ">\<! 0O`>\1!  >R"L$h  Ͽ8   % ` v q0# i g` ?$[  ?`$$4O0߮ufs_mkdir: no name`` `$`>[ِ#X #@  !  ̰ 2  $`$` 2    "`* ` 04` $`̐ "`t4`$`@"` $`> ` $$4ᰔЖ *`" *  * ''А   2W H @`>"H>"`' ' ' "' ''`'' 8#\ ,"`  <`$`̒ @y "ȐHS" ̒    Ȱ  6̔Ȑ` 2`"@ $$4`$` $`4`v*U q㿘  @ x " @0[YG  @   < B`u 2`3 B @.   @" 0&   m```$`$`   ?$ $ ` 4`  ?4    Q㿀 (`  @ )@ H @@ 6 औ Rp  <`$ <   #`#\  #d#h#l  z ܐufs_readdir: lost in space㿘   !o $" "    2N  "J > >ZL! "@"  @ D  4@#@ #@<  ', "@ " @ "D @42 8$    @  2   @8" "㿘 H @@ 2  耢 2  9   k 㿘   Đ <㿘 औ  < `㿘 `F <ufs_strategy: spec㿘` \t? >Y# T P@2 T   Tۘ "  T 0h$ 0$ 40?2 T H@ <$ @ T?> x` $ D $L*` € 0˪ tag VT_UFS, ino %d, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %qd 㿘 > !  Z  > !(ZV  > !P Z  t`  <>Z!x 㿘 >`>`"b8 ȕ* @㿘 >`>`"bd ȕ* @㿘 `4 A`  `  ":>ߐ  # > !#    >  0`B # ; 0  "# ?> !# ">ߐ  # > !#    >  0`B # ; 0  " ?> !#   ?# >!>ȓ*` €㿘 >`>`"b8!T* @㿘 >`>`"bd!T* @㿘 `4 A`  `  ":>ߐ  # > !#    >  0`B # ; 0  "# ?> !# ">ߐ  # > !#    >  0`B # ; 0  " ?> !#   ?# >!>T*` €`>؄(`  `   ` $` "`     abbaaaaa㿐   `8` #\  㿘< >`cX 2 @`!$ t>ؐ#*` €$ L`ڃ > &  0Ȑ*$ 0$ L$ e$`$ L` 2`0 0 $ 0`0>" <`0" *` * " *  * " * <`0&cccbbccccufs_makeinode: no name㾀$`>WĐ#'<&  t䰒 & 0 $` `$` 2    "`&ݒ `0b  >4`$`cX2 @  " t`4`d$``-+ 2  -9 "` ;4`@> ` $`> !! *" * *'' ז  2W끘 2@& ڠ  &&| ژ`$` $`4`ڑext2fs_alloc: missing credentialfile system full %s: write failed, file system is full 㿘' >W "H `"/ "  @"' : 2   (@,?& $@'&&>۔ @ $ & :  `$ $   '>ِ@p>ْ$WՐ" mode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocout of inodes %s: create/symlink failed, no inodes free 㿘 "  ` "O < @ 2@S`(@ʐ?`(P-`2` >ے"@ "2  H  0.` `"  "   >ِ#Wܘd>Va#@Ē >> ᰐ  ""  $ > @>ڐ (WLd 㿘& @y  ?&,    $    㿘`x  ` `t @  & `. <.` (@C?Pe    㿘  "f. @@6&@  , f@ɒ   ݲ`f@"   ext2fs_alloccgblk: cg=%d bno=%d fs=%s 㿐 .`&,  `R &?*  õ&  0q H  $&@٢ 2 &@3 &: * N& : .&@$2  `2 "  @ 6  N "*``@ &N  @ 6 N "*``@ &N @ݒ - :`*N & :   >ڐ#VȖ$>UM# * .  .`&,$ @` ?2` ,&; $O  cg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedfs = %s ext2fs_nodealloccg: block not in map㿐 .`f, `|  ?f*   f i 0m H`(@ `(: * L& : 5" :`2  @   @   >ې"(VDd>Tɐ"H" L*  .`@ *  >ې"pV1d>T":*  &+@, `<f,?$`  ?2 ,ff,@ ` 2`Ó`(N bad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s blkfree: freeing free block㿐   $@¥&@ @ > Uې > @0:&,*`?&*  [& ú0* H  $@&@ `:`*L@ &@ :  @  >ܐ U$>T3! * +,@  &,`$   2 ,&"ifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inode㿐    @ 8`(>"xSd?@+f,-   ?f*  f M 0:`H@v`(4 L : 4 >ܐ"UEdLf`4 >SƐ"  +@*@, `- f,`$` < 2  @ @2,ff,@ `?2`,f¥ start = %d, len = %d, fs = %s ext2fs_alloccg: map corruptedext2fs_mapsearch: block not in map㿘 ``$@&`$2 `$ `2 " @=@  @5   >ݐ hdTߒ >Sd " N@*   *   >ې"pT͒d>SR uid %d on %s: %s 㿘>ݒa$Sn ext2fs_balloc: ufs_getlbns returned indirect blockH`'T'P'3 ` A .`@  ?"  P %x%t ( '`*@ " TH@Y<" @ T: $@T`%"  `4>Rא" * @ 2'  P  %xĘ '*@ " TH@<" @H 80 * $@`% > ` 8,` k Py ,`%x*   ¦', <"T@H  "`@ f* @*` `* %@,`^,`* ?_ O H*@ @ /P- 6%t%x \ ', `"TH@<" @`* %@&" `? w0q0 ( ', " T T"@㿘 "   ` "      @  ext2fs_bmaparray: invalid argumentsext2fs_bmaparry: indirect block not in cache` H  a쀧 >ހ` >Q#`'@`L@@?"Ȁ "ĐԖ  6'Ę .`$*@ `&`" `` 4 @6 * .`( @ 2  @` ` '@6 ( "@ Ӑ0  * @ _  Ɛ &`L {  0"2`>QG# 0$ ,@ $ 0$ T>b,`%",  H*Ķ `,`)`( @#@ė.` ?( @ @` '@ @ @ .` H ?( @ "@Đ? 'Ā`   "$W$,@`&?& 㿘ext2fs_inactive: pushing active㿐 >c  ``4 >ߐ#׆ ">  2:  2# `H <`2    ? > aa`*"@ *`@ *`'' $  $    > !! *" *  * ''     ` ג 㿐``H <`2[ `   $> !$  > 0`B $<0 > !$ ?$ 2 7 ?$ (?@}&,* @@ِ@u&$`? @& *@ &: "0&$?@ H* @G `  0ext2fs_truncate: partial truncate of symlinkitrunc1itrunc2itrunc3خ'@  > aa`*" * ऐ * 'P'Tt`2H @@  2 2>Oِ"@<P $H$   @2  P $ 9   27&@(4&& @&@E?    `Lr &@mX$@m4.LLP $    `2&.$@|    L> 2$&@m#@lL$H@ÐL9L&L&਒ :@ E&@IB?'&2`$ '&2 I$'&: 'D G <XP'<?   6"" @$ ,`@"  $ <F <F < $ `(   J?'&2`" '& 2 IHܤ "@' 8 &, @jH 2@H@` '@Z%@ '@ ޮ @> ,  D$&@: '@@> 0 <@"N>  <@"N2 $d >` >N"$@"@  $$ext2fs_indirtrunc: bad buffer size㿐  ''P'X    2 H?P@:  u `0" >"`, ",`0`<@ `8$`0$$`T>N5!  PXm"?`H  E,2` "@@y*` 2'2 ?Hf?&@,  . ?? 2'~?@ P @̒,  . ?f 2'   X`0 $`0-X"ext2fs: e2dir->e2d_namlen㿘@! &@ ` .`@.``` `6`h     f  @ ]  $""? ? ?''?''̦@ג '  ;$@   Ҡ     -֔  "@ "-M  @ E " %  @<q ` "   i  " "@   `    2  8& &$mangled entryi_size too smallh ?  @' `'' `'     &'&  ` eF [ 2[ `D/ @  ϡ "Ԁ  @` ώԀ`   @   D Ԁ  @ ` `& ''耥'䀥2 `H @"`H   ?'`H`L  d`"$ h @@$ h  ' $ h :`     ' ?@F h' " h h :   Ƙ   ?'' H@   >"0`@ٔ  h>߼ؒ  h$  $ hG , * 2`  ?"  h2`''  쀢' h'2` h  " '耢"   2   @h  "o  h$ h   ' h}܀ d '$ h 2C  @"?  "; `H <`!  Ē 2  ?@ȐE'$ h $ \$ h@ $ \؀@&'ؒ@Eؒ $ ``$  Ԑ(`%  ?@ $ l $ p  ?   h>   ?`$ $  @ h  $ dF @A \  h@"@$ \$ \  l 2`HQ&   " "& " & @ "&d  &Ԁ`  y ,Ѐ' @$  h l  2`Ha   Z & (R%  M @$ `H ` l `07Ԁ`) @&`   0& l  2`Hΐ&  Ԁ @ & @ rec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentry㿘   ` f>!>!(` ? > !@ >!h@@ >! >`@!`K>J! direnter: missing nameext2fs_direnter: newblkext2fs_direnter: frag sizeext2fs_direnter: compact1ext2fs_direnter: compact2 %u %uext2fs_direnter: compact2` (>Iِ" '/L #`` < 2 ?` >"ȓ*` €           // A\ `4 ?h? >I" : ?И'''Ȕ '''7''9`H`H  >I}"n?@CӒ$`c$hĚ:    W   \ ? "`4 @  ` " @ A#\  @@:7>I8#6 7>#8J>I.#X4 A` $``@  :` d 0000 0(㿐  \` h:   퇘 "" :   x   r 2 `$ 㿐 h:    ] 4`"` `L %``  <` 2 ?` > *` €           * * n `$ DL|T|\|d|l|t`    2C >` ܐ  #\#`#h#d#l  f 2/ ܀ 2+  "  4 L . `"  L .2 "   @   D 4 8  checkpath: .. not a directory checkpath`` ` '= ; 9'܀6  ܀ 21 ?  (  @逢`# fܔ`H 찒 t   #`#\ #d#h#l     2>IY" >Gސ"@ :%s: modeext2fs_read%s: short symlink%s: type %d㿀  ` >>#GctH` @@ 2` ` 2` >>#Gc (` >>#Gc   @; B?`  2`` (`0 2`  `@  b   _'@z`    `$' <2@(`*@@ ?@ ?'#\#`{  ?K +%@`@$6`H `H'3 '` ``  b   ` "H}H  <@ ` &`ext2fs_write%s: nonsync dir write%s: type㿈 `>>#Fb`t "#  >%>逢 %>逎" <  @  `ܰ  >>"Fb>#Fb耢`,   : @@D B?2`t@  `t `` B    #T  `    `_ @}   @"* $ ?  7 D <  B 4       @d %@c@"@@& H&C`  o ,쀦  "  %`2@       35&]%@ @ b $<@`> !! *" *  * '' i 㿐  `  @f  # ?f A0  f H @#  "@Disk overlap start %d, end %d overlap start %d, end %ld Disk buffer overlap㿐>>#H>* <" "D*  T:` @  ;)>뀤"4 | 0@2/ | \ *   2$ |` @2 | < " | T4 |: $ |>6# <  T;  F?>Eh 0 | ˀext2fs_mountroot: can't setup bdevvp'sext2fsroot_device㿐>">>a >Ǔa\  >>LcL!>Nj d >E=!x>>!a  d d0J@O  ?"d  d07>՘`" "`@  #b` "@b`" a "$@j !;  L`  @] @  ?: @u Dʼn 0@ݰ %s: file system not clean; please fsck(8) : l  `<@@"ia N #`@  @$ @   :   6:@  ڐ .`<@0@ N +`<@( `` @宒! 蛒 0 藔: .6: 6: . @ @&(&&$&&,h  t " x >9 `x&  y `"`<`< !!`䗐 ] ǎ0] G`<@@2@A  ڐ "aՐ0B !9"d@h" L  ` ?: @"@ @Y;̔ Z` Y9ǖ Z`@@I" N  : .> !&0>#hEL@"  ext2fs_reload: dirty1ext2fs_reload: dirty2㿈< ذ      >C#Ȓ`h ?剚 " (:  @p$ $?  < H `@F "00$` ;Y " @$(  :<0` 8 `$$$ $@$$ 2( @$$ #$($* ?O `H=, ?@; & "M  H>  X`8Ȃ @`   h " >C#`(?@B,* @@@:$`?@*@  r`?@$ H* @`:ǔ UH2 H 㿈`x ?ʨ - > d@     `<   ?㴖  `h 䒚 ' $  @XH 2  !P @;!P  &0 % @2&0$`H:` '  ,: 2 4:4: , " @$, ? :<` 4 8 `$$ $$@$4 ( $$@$ $(< ɔ  $$,$* ?? .`H<, ?@:' &` &a&`d`< < &`@&`h&`<% %%  2 %  % (% $`x&" ,H 쀢 "k`Y      + ( &a㿘6` `@C >a` L& 2`@   2 ` : 2` 4 :@ ``t "``x" ``L&  `  ⿔? `&,   `<*@$`<$a㿘!  `   堒 ext2fs_statfs㿘!; cS`8 "f>Ao!f(;ɒ```L5@`d 1 f  f D/`D    @   +` + *@ " @ 􀢀 񀢀   2݀f f D`D;&`f&``@"&` ` &``"@&`@&`` &` `T8 Z` 8 Z `@  fs = %s update: rofs mod㿘! L   >"Bm>@"  .` H2  t  X!   ` d `@`ô    2'`2 H` <@ 2 ` 2Ȓ L  > ,!$0@ 2inode㿐a Q & >!L '  }& H!@!> <  "$ $$ $$tN$x "(& ΐ0Z@,* @@$ ? @ *@ Q å<&@$ H* @8 $>>"  " È!& S$ 䀢 >> ᰐ  ""$H <` $ &㿐!`  2' F (:V& ` &`   ` ``@"&; & F   2@ "`"` -㿘   $  `H7$` R㿘` f   + f`$f* *    f9f, ? H7ff` f &f  2Ext2 fs: unsupported revision number: %x Ext2 fs: bad block size: %d (expected <=2 for ext2 fs) Ext2 fs: unsupported inode size Ext2 fs: unsupported optionnal feature 㿘 8;#S@" L- `>!( >!X @ 0`"  T > X >! `?>!@ 0 `2  d?  㿘 >c* @  @ 㿘 >@c* @ ` @  `` "``D?2"`F " tJ$`ࠀ  `   㿘   ` "` `` Ǧ` `  # > #   >  0!@# ; 0 > #  #  #` #` 3` 3` #` #`  #`D  ;` #`(#`$ #`0#`, #`8#`4 0#`@ 2#`@ #`<`t( #` 2`H@#` L#`   2`*  *` ;`H`t#@ 0;`P㿘     T ?2Ѱ  ?2Ͱ  ?2ɰ  ?Ű  D? L? ext2fs_link: no name㿘 ` $ `><ʐ#t 2HK H@C    r06 #@( g%  0" _ ` 4 $       " `   $ 4 `   אext2fs_rename: no nameext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: EXDEVrename: same filerename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dir`` `  ` `'`'`$``$2`H><"!0H@  " H@ א؀ Аj؀ dĐ0&  `0߰  ` ڀ ( t Ӱ ߨCA` ? %`>;Ґ!H %@ܔܐE " ऐ#`@ऐ Ғ  ` 0   Œ  `<  8     ؀   ܼ ܔߨ t ` `J`.`   `  ܔߋ W $`  )ب  ` ` 4`$`ܔ Җ  ܒ m[   tܒ b 2%# G "   C@2>;&!p 5ب  2;  `@>;! #@  ` 4 $   y      `4 $   a  Am` @>`@>:Ԑ! `@2 >:̐!""   `"   @"  ɰ  <   -  B  B ̔      $ 4  ?5 ?*` 5 >:!ؒ   Ζ   % ` ? %`>:j!H<܀   "`>:Z! 0S >:O!><   4  $  #`#\ #d#h#l   2 %  >?  >ђ  #`'#\ #d#h#l     2    ?`5 %   ?%   ^ Y`0 Q O ` ?$`ܔC   `` $`4`:0܁ext2fs_mkdir: no nameext2fs_mkdir: blksize``  `$`>9##@  !  gܰ 2 ܚ       4`` 4`$`4`" t4``4$    \@ `  '7/` `L  .``  / ./ '` ?7/` `L  .`` 2/ .  /#`/#\ #d#h#l   J 2H! @&H $`>9>#$` $`W "` $4 " ``4` $` "@ a }㿘   ` Ӑo:  / B  2 & B #  0 `  $ 4 J 4  3 w `75㿀 (`  @ '@ H @@ 6  औ 0  $  $   #`#\  #d#h#l  ן 㿘 H @@ 2   2      㿐 `   #\   8 㿘< >`X 2 >b'$ t>"p* €$ L`ϐ "`r m>  & $ L $ $`'`$ L` 2`0 0 $ 0`0>" <`0" *` * " *  * " * <`0&ext2fs_makeinode: no name㿈$`>8 "!<@& @ ܹ찒 ; W0X @ >X4  2     4 4 $  " t 4     >    >  ;4 > !! *" * *'' =  2ٔ 2@    &  4  $ 㿐   Ò`?> !!  *"  *  *''`? ext2fs_reclaim: pushing active㿘>#`   4 >!, dž " "&   H$   NAMAP_B2SLOT: invalid byte countamap_lookup: offset out of range㿘>b(b(?@ >79!6@ & >7.!ȑ* @amap_lookups: offset out of range㿘>"("(@  >7! 6@@  & >7"X.` .ܕ.amap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in use㿘>"("(@  >6! 6@ >6Ր".  @`>6ː#`"    >" €0  .   >6#8  "  *`"   $  "amap_unadd: nothing there㿘 @* >6".`@ 2"@ >6 h   @  *  ?.`#  @  * " ?& 㿘 0`  $   $  $ ` >b0   " 2 " $@Ґ $ ?` >"0  * @ 0    ,@# 㿘 0  ?@03 $    ?$  $ ` >b0   " 2 " $@ $ ?` >"0  * @?0  ? ,@# vm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapamappl㿈>S>S` b>>#`#d#h#@c(#\ (  @T 㿘>"("( >5Ӑ! 6>5̐!>̒@?2 `@U#@ 1 & ,`&& & $& & &  b6 &  b/ & ( b&      ޒ b  ؒ b@V6@  *@3 amap_free㿘  >  >5y   b  b  b $ ?"> b>̐#@@Vamap_extend: amap changed during malloc㿘>   (("  0  ,>5G!`@ 2 >5@!6@  @   $ ?@֖ 0  $ ? 6  "* @Ė  $@  $*  " * ? ""$  ,`?  b   b $A b?$ $ b z b u bp  & >4!x $@  ,* $  *, -*  @z $  *,  * @m $ %$  *, * @^    $ $( "* @O  *  % * ?%" b$ $ ؒ bՒ b ?Β b㿘>"("(  "  0>4{!2 ,` @ 01>` , @ "    " 0€ &` 0 '>`,   ,@ @6 `` *` ``0€` &`amap_wipeout: corrupt amap㿘  #> ,  *` `@ ?4"b "@@6   & & & 㿘`0 28 "*` ` >`b0"2   , @6.Y@/.R@w@* ` ` @@` `&`,"@ &`0` >` ?&`"("(` `" ">3Đ!2>̒@? `@S#@ 0. $ $$ $ $$ $ $  b/ $  b( $ ! b$      ג b  ђ b@T/#@ L`0   ` &` $ 0=@6!`,+` @ *`  "  @ `"`@ "@  "   *`"   $ `@&`,?    ? $  ?` `?`,@# `&`0 ?&`&`,amap_cow_now: non-resident wired page in anon %pcownowcownowpage㿘`0 @U?!/>-`@ - `2>"3 $>`, 2:`$   4`$H  4 @      @1V  `  ">@>@75"P@,Œ- ?$ " `$ @@,d6`$`@&amap_splitref: split at zero offsetamap_splitref: map size check failed㿘>b(b(?>2!6 2 >2#" " 4$>2# 2 @   &` `" &@㿘  b*   & $?& $  @$*  $  8"`"@amap_pp_adjref: overshot targetamap_pp_adjref: negative reference count㿘>"( "(>2R! 6 $-@.`,`  8 &@ $  $ "$@ $ $  ۑ,>2!@A.@,`  8 & $  $ "$@  $$$ `>1!`8 $ $ "`2@ő,㿘 66  3  ,   + *` , @@#@6"  *` "      +`  ?+ "    *`"  ?& ` @ ΀`vm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapuvm_anon_init: can not allocate %d anons uvm_anon_init㿘>̦"(` `: "@>c, @_   > 2֒>1[!@> c($P"`D  $T D""D> "#puvm_anon_add: can not allocate %d anons uvm_anon_add㿘>c. @&  >!2>1""  @Ȑ>̒b(`P `T"`T "`P> #($ D""D> (D >̆(T "D T"" " uvm_anfree: obj owned page with no loan count㿘    ,  @@   "  $ , ?>0А#($ ,$ `>@4 $" € 0@1@> (D>& b(`T"D "`T㿘  @BӒ   & >̒b(`H?"`H   ,    *2 *" ,vm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘 (>` $@* @  @  2 >  ! @PJ  &" $& & &   @ @uao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_set_swslot: didn't create elt㿘`  >? 1!>0!` @2 @  2`, >0" * @ "@    "  ?"  `"`"> ! @P 0` .`@"@㿘  @0  ( &/> $*@`>̦"(+>  `,  " @A H?$H  , @@Pba  & $ $ cᴠ />>̢"( , @ " @A̒ `H?$`H  &  ܒ c@P:uao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots failed㿘>̐"( `  . 2@ #>c >/U @l>]!?$  $ $  $c` >>]`!>/>   ">ڐ!@O   $ $ $ ``*> 6` @ : ! 8  cܖ ( $ $>/!.  c $ >/!@@ `  ?$ >"$ $$  $ $ >]耢 $ , ,"`0"$ 0uaoeltplaobjpl㿈>]䀢 & ">]"!>] c"a> >! c@ P   #\#`#d@M{#h>S>S`>>#`#d#h!cP#\ 4  @Mj  " 㿘 ` 5 2&  ,`" 0 0"`0 0 ,"@   >̦"(%> $`" 0@4 $  €  @\2 @.א  2 $`  &  uao_getpageuao_get㿘`@@_  T >?"(a?E@& /6@   @ є  `* `  ,`@     @, " $ * ` 4 $@(4 *  $ @ `> 4 $& >b(@'@`   } ?!#϶ +> 2n>̀h 0 @ ` 4 $  a0" `4 $& @&| 2 $   @,< 2 *>@2%!  4 * 9>̐b(  6@   @ B  `* ` ,`@`2@' $@@G    $ " $V $ @@-4 $0>c 4 $€ 0&>b(@ uao_releasepg: page not released!uvm_km_releasepg: kill flag set on referenced object!uvn_releasepg: pages in object with npages == 0㿘 $  >-\ >" € 0>"0 @"2@ `&@@-  "   " >-?!     >-6!8Q 㿘 @?O vm_map_lock: failed to get lockvm_map_lock_read: intrsafe map>] >] udv_attach㿘 >9* a|* ` @`R>B#@M>B#@I 1>̐@?@"(#>]a`% (`2` ` (`` `>&`   a`` &``&`}` ?,&` B a``2` ` a >#& &&  & &  & & & aa`&  "`$$a& $ " udv_detach: pages in a device object?udv_detach㿘#>!>  ?)&     " ,s`   &    힘   ` $"`$ $ "   udv_fault: !PGO_LOCKED fault㿘 `@\>,?!  >  b $ ?  >9* a|* ` @  &@  />@%>`8 >"( @ @ , >̑, @?      udv_put: trying to page out to a device!㿘>+#8vm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapfltamapcopy㿘 #> & &  `| 2``b  >+#x ` "`  @ 2   `| `b      " *&  ` " ` `| `b { &  `& ' `     j   `"  `| b` [ >@/# | b  N anonget1anonget2flt_noram1uvmfault_anonget: got PENDING for non-async I/O㿘>̐"( `"   >"a$p  "p>"a$t "t>̤"(    ,   ' $ @`  4 $`$       >    >ᘐ  / )    @)U 2    ה >`$@/5!   ɐ p`$p @=q  $ `| "`>*ǐ# ﲔ   @ 﨔    $ ?` $ ?_ $?aϐ  4 $> 0€ `      2$``2&>*!@*Ґ`   k  >#@ 0@$`"   ,)" 2  <$  N  fault: advice mismatch!uvm_fault: pgo_get PGO_LOCKED gave us a RELEASED pagefltagain1flt_noram2uvmexp.swpgonly botchflt_noram3uvm_fault: pgo_get got PENDing on non-async I/Ofltagain2uvm_fault: object has no releasepg functionflt_noram4uvm_fault: want to promote data, but no anonflt_noram5>'Lb( X  `?>'D㈐ b('P# X.@ ''+'ؑH/` />c, @ ,*0:H 0  '  ''`| ">>)#" ` @쀢  >     " *'`  `>b   ' `'耢c P`   >  j T `|   >" `] G  ( 'LL`L 'LL 2'P  P`2>   > b : }>̒(` ~"` 0    D>" `%  D`* 4>* cP*  @ >>)#!(  @ 2 8  @ "2  ?.@   @       ,% ݖ  4`2F'H &$ ##>ڑ. @ "   "  $ 2  , 2   ( 2   0b€ @" &. >̘( % @ .@  @ @  .`@>̒"(`.@ 'HH@S X? @ >€  :$ "7$@ @1$& ,'H@ `"(>`, 2$>`$ 2>@"  >̔(> "ؘ@ ` 0 `(`8  @  >b(`@`H` P @#`#\` L؟X  z 0fH 2d'P>̠b( T P'T$    % `XP ? 4 @#\#` T`A'PH@< ?# *($@@>'!'P@! >`$ؖ `0 `8 L `$ 2`$>(`@Ϡ H'PHّ- @   > >! P  ` ,`@ `2< 9`     @& 2 > b 쐒 >@+!@!>  "0"  `,?"`, ?"  * 2*$  * $  @ 6 $6 *& `V> R>̒(`Ȣ i"`Ƞ      @%ʚ   2(` >r>  A >̔(H@@ >'H"@2  ">`"@+"t@! $?! @6 $,ܖ @# @ $@b( Ē`"  >ؖ 8@ 0LܟPL @ݐ $?# @6 $U>@ > Ӑ P?'P   ` @ P >b!$p`"p>$ct "ct  Ɛ >̢(`  $`P'T  PܞT "   P  4#\#`   >&"( > >!X   ` $``| ">>&#" `냒 @ >b x  `  $`P $@   ,2"  >ْ  X  )P`$ P P$ >̐b( `" 0 >&L"h€ @א P? $cϔ z2 $a >̠(  $ `2P , P ʹ    @$  PP`$ P͐ P?$#ϒ @2$@P>b    >`$ @*V"=@ $!?! 6 $>P "€0P`$ P P#$ 2$P @% @%'P>%ِ"      @$2   8PP>`$ q @KPP? $cϔ 2 $>  ꜐ >̲(`H`@@ >%"@`  u&``>`&`@)"؀?$>>̒(`Д"`@m  >P "0P`$ P+ P? $cϔ 2 $P@  (Ԑ`@@",ܖ t# >ؖ 8@LP 0L @ * ? $# @6 $>̐b(  2@  $@ː $ " $  $?aϐ 6 $>    㿘@@  %>̐   @0(  uvm_fault_unwire: intrsafe mapuvm_fault_unwire: unwiring non-wired memory㿐 | > $"@Q>>"(`> € 2> $֐#@~ >#К 6`1>> 2`@: * * 2`` #  #@2`@: `2`? **` *   *  ""(@"( >͐@ vm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘  >, 8  5>`| !>> $i `" S @`" G >c   >"䀦@ >>cH* @* 㿘  >",>ٔ" 8   @ 㿘>",@ 8  @ 㿘>",@ 8  ,@ uvm_fork: uvm_fault_wire failed: %d㿘a$@֒>@r &` >c@ ؖ  cP> #"b &`&`$ $Ȕ!0  @  H`c@)㿘@ >c@!$  :`0  :8 :`  >:(b(``(   :`P㿘> !$@ H /m4N 1* .N 1  @r , & ,H p@>& b(`t "`tschedulerschedpwait㿘> !  J1 2, 2J ?* @ "@@ $  2J1` >>>  h  t > b(``2  > H/` /> @' H o@> 㿘> !    . "-> ,  2#  2 L 1   (  4  @ @@$`(    2 ,`>̔(@* 2@   " @㿘>!$@  @H@H /m * .  ,N 1 ?`& ,@ŐH 0>& b(`x "`xvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapuvm_init: page size not set㿐>"(`2> >"  l @R#(>ɐ("aԐ@@@Q@@$_!@+ vm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿐` ` ?@ m =#@f " >̮"( @  8   Q +>->c@ v   C(@ @( 4`* @ *6 5 $@86 ,$c`|  `  >"! c `" @@ c`| `    @   cvm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapkmgetwait1uvn_get㿘`@?  @4 ?!`?%@r    @ 3  @ $ @@4 $ @ $@ >  4 $&>"(`@ @Դ& P N  @I ? a+>,```8)>̀@4"(0   4 $ c@⿘  4 $& @ 2 $   @ٚ >@%Ð#0  "(@C $ 4 $&"(@@ uvm_km_init: could not reserve space for kernel㿐>'>"#>"bܒ >]>> c|"c"|"" "">̘"(#!>]""""?"" ""!>]#! "!@{ >#P$!E& c' @? ">>!!"#uvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation failed㿘\`@>", c'*   @f? "@> ϐ"Ȑ&@  @@ 2 @> #@$@@  > #0uvm_km_pgremove: object %p not an aobj㿘 >"@>> P "( &2@  *`@@8@" "( $`(@4 $ J6@ @ Ő(@@ 0     : $`(@4 $ +2 @  2 uvm_km_pgremove_intrsafe: object %p not intrsafeuvm_km_pgremove_intrsafe: busy pageuvm_km_pgremove_intrsafe: active pageuvm_km_pgremove_intrsafe: inactive page㿘 ?>>! "( &2@  *`@#@C%>#>!>@ (`$ "`*   b"@@ E (@@ 0# ` %>#>!>` `:`$ "`*ސ  ِbՐ"@@ ! `2`uvm_km_kmemalloc: invalid mapkm_getwait2㿐>#P@">>#Ȫ"(  ,  c'* @ '@7? G  >C@%@> #`,6" ?#%>'>   @ `$ 2`$2 `@#̐? `0 8   b( 8  b(&@Ӓ㿘>",@ 8 @ے@ 㿐 | 2 >"  2 " >=" & >,@ 8 @ @ | >"    @ " uvm_km_alloc1uvm_km_alloc1: non-released pagekm_allockm_alloc1w㿐>#P@">>""(>  c( ,@ * 'hc'@~? >L #``,>" ?#)>'>h@t `$ >А"2`$   " "`h   @$ `$ 2`$2`0>@#"` 8  (&@@`2h @H$@uvm_km_valloc㿐>#P@">> ",>  ,@ c* 'c'@?  uvm_km_valloc_waitvallocwait㿐>#P@">>f!", 0@  ,* "@ @  #> c( ,`hc''@?  >0 V c(㿘H / * ' >"(o`?H p@㿘H / * ' >"(H 0vm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapuvm_loan: intrsafe mapp | " >#  '/>̺(->'''''`| "`>ؐ" Ô @쀢    ⶐ   " *'`  `  ⢔ ' `'耢U ,  `5 X$   ؒ@P `ؒ@  `ؒ@ ?  ? ( @Ϡ  X ``*@& @   K 2w' Ԑ": ` @& @J loanagain㿘"*     >" €0  &@*"@ 0   "  ?> >! "  , 2,>" €0,`@&,@ "@@ &@fltagain2uvm_loanuobj: object has no releasepg function㿈 `` `0` @#`#\ '& '      >  b ͒ >  b  ᩐ   '`& #\#`    ٰ?> >!  а >̠b(  $  `| "`>" {   @ q     $  $@   ,*"     Q  %`$   $ ` 0 >I#( x @Ԑ ? $cϔ 2 $n , >" €0`, "`,@@G"@  &@"@`@&@`$ > 0:  `$  ?$#ϒ @2$ >b   (?&"` , >" €0`, "`,@s@"@ &@$`  ? $cϔ 2 $ loanzero1loanzero2㿘J>-"(!>"  ੐ >@ # & `| "`>""    @"     &`"l      @ " @d  $?! @4 $@"@`@N&@ Q$ ,3"( !>"  ` "E?ꅐ>@#` $` `| "`>^"" I   @" ?  `  $``" ? ̐    @ " @  $?! @4 $@@"@@ &@㿘`@ ? "@5 `uvm_unloanpage: page %p isn't loaneduvm_unloanpage: page %p unowned but PG_BUSY!㿘`-'>%>#> ,  ?$ ,@  ,     $ " 0bے€ @$ ڲvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘   8 @ &thrd_sleep㿘 $ & h& p& $& (& x>& ,& 0H& `& d& |&      & l& tHo o>㴘㴀 "㴐 "`"& H 0 㿐 | 2 >"  [ >g#  & @ɖ | >"  D  @Q uvm_map_reference: reference to NULL map 㿘 2 h>!@$S & huvm_map_deallocate: reference to NULL map 㿘 2 h>"(@$;4?  & h , 0@W mapent_alloc: out of static map entries, check MAX_KMAPENT# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpepl㿈>#>>T"T""`"` "`"`>>H"H#"" "">>$"$#0"`"` "`"`>>"#P"" "">">" ##ch" " " > x>]?"xb" L`# L"# L`<<#>S!>S`  >>!(c    #\#`#d@82#h>>#`#d#h!Lc#\ <  @8% 㿘 | ># >!L@9S ", 8H /f * ' > #(`L  "`LH 0  2 >H", 8@$`$ `$ ` $ `$ `$ `$ `$ ` $ `$$ $`($ (`,$ ,`0$ 0`4$ $ 4` & ` &`&` 0   ,f`, ` & `@$@ $ " "`   0 ` 㿘 | ># >!L@8Ւ ", 8H /f * ' > #(`L  "`LH 0  2 >ʐ", 8@$`$ `$ ` $ `$ `$ `$ `$ ` $ `$$ $`($ (`,$ ,`0$ 0`4$ 4&` $ ` `&  $ `0 `, , ` & `$`$ &` "`  N 0 ` ```@uvm_map: unknown offset with non-kernel object㿐7``0` 2`7` @ ?  |   >"  I `?`  & @@" |%  2 >"  0 ><#  & @@#\@@=  > | >"    `T "`T ?  (>>!#@`," @S` @N $@J`F" ```"@@<` 8`4` 0`$,`4(`( $`0 >  >bH  "bH `"`0@`0 h` $`  d@& d@2 |` $@"  |@`@2 |>a$ "a$ | ># >!L@7 ", 8H /f * ' > #(`L  "`LH 0  2 >u", 8@@$ $ $ $  $ $ @  @ $  $ $ $ $ $$ 4@$ (@>"0 *@  m $ 0$ ,$ 0 ` & `$`$ $` " d x@& d`  @:& x | >"     p $ "> @    >Є "  ( ( @  " # p2 "# p 㿐 ,\@'H`B 'H 0H@`  ,@  x $`  `&  'H  'H`H@}HH 08 *    $@"$ p` 䀤`$ p&uvm_unmap_remove: kernel object mapped by non-kernel map㿐 ,@* 08@8e   @& p  x @  $& x $'d& a i   ("  j$ (  "2  `+>#P>E `  @k@>#`,  "  "@   @]@>#`,  "  "@  $  ?$  @K  `?& ` "@ " d"@& d$ '@`* & unmap: still wired!㿘 B> #( ( " 0>"耢 ߯      8"  8  `" 8@  8  >!L@6yH /f4`L* '`L& $`LH 0  2 (㿘>", ,@  .@ &` : `?uvm_map_replace1tmpent->start=0x%lx, tmpent->end=0x%lx, end=0x%lx uvm_map_replace2uvm_map_replace3uvm_map_replace4uvm_map_replace5㿐R `2 ` 2 ` 2 `0 } * >>@ `Uh @ (Ė>I     >?   >8 耢2@>/!& p x@"& x ""@&"` `?& `@& p x 2 `& x `?& `@`"`@"  8 >!L@5  H /f * ' > #( L"" LH p@  uvm_map_extract1uvm_map_extract2㿀>̐"( @'L"`>ː#p'耏`">Ð#'L L  @ ' ' |   >"  ٖ >#  & x ` &@ `@& p  `  `'״ $Ө`'䀏` ` s `     K`   "$|`"># >!L@4) "/ 8H /f * ' > #(`L  "`LH 0  2 >"/ 8 "E ' ''  "@ ' '  `' ` "€ `' ' ``'   '  '  $' (' $ 0`' 0>̐b( 4 , ' ,  Z' ,쀥``' 4' 4%`` @:    " |'` @4`2%L|   >" ؅ `?`` & L @   ` | >" d  `耢 Z `" '& p x`*'& x'8  $4``` #" @耢 @i' `?& `"@""  '` @р``" ||  >"   | | >"   耢   `@ | 2>"  ># &L@ o| >" ̔      | >"  ׽ 7`ʒ `LM@ 㿐 | 2 >"  פ >#  &  ,@* 08@8{ `@` '`"! `2 `  ` `0 2 |` 2 | "`"` *" | | >"  N 㿐 | 2 >"  A >M#  &  ,@* 08@8  `@  ' $@ 2K ` " ` | >"   ; @"' `*`!   ` &`&` &`` >  ``` ?bğ`@" |`*`  | >"  ˔  㿐4R 6 |M  2 >"  ֶ >#  &  ,@* 08@8   @ 0 $  $ $ $ " | *  | >"  u  㿐 | 2 >"  g >s#  &  ,@* 08@8>   @  $  $Q4 |6 $ 4 | >"  )   " | *  | >"    uvm_map_pageable: map %p not pageablevm_map_upgrade: failed to upgrade lock㿐 |  >"p2 >"   >#  &  ,@* 08@8Ĕ   | >"  ʔ  I@Z $  " |  @ "y |` 8u | "*(􀦀(? $( $(" |*  | >"  Ձ   $O 2 2 "    h@ r(  @%$(  @( |(?$( " | 8( | >"  2 O #>*(#>٠ b !   @ ( 2  "$b  >"?$(*( | b      㿐 | #>># b Ӕ  ,@ 08@8 #b Ժ N  Դ H   $  2b  @"b`  b ԙ -   *    &@ @     " @ b   @b m  㿐S @  $@" `@*  ` 2 ` @ ` 㿘>ؠ @/>!(@ 㿘 @z 쀠@ `@` @  & & "`  Ą ĝ㿘 Ā @H/ /@ 0& @ H 0@1㿘 @֐Ā 2 |Ȁ ;z >0, 0H/ /@ & @ ϐH 0@㿐 Đ? )&  | 2 >"   >̐#  &  ``  , 0+  @q>ؐ!(@/X&fork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)㿘| 2>" v "># $|0 !, ̒N ($H+>`" ` >"g 8 2$>"a p " |42 2/`   @  | ># >!L@., ",`8H /f * ' > #(`L``"`LH 0 `2 >!",`8$$ $  $ $ $ $ $  $ $$ $($ (,$ ,0$ 04`$ 4$ (ׇ  `"  `` " `€  ` $ & `$@ $ $`"`" `" @/ ># >!L@- ", 8H /f * ' > #(`L  "`LH 0  2 > ", 8$$ $  $ $ $ $ $  $ $$ $($ (,$ ,0$ 04 $ 4  `"  ` " €  $ (` $  ` $ & `$ $ $ " "0 "(  (    R (  0 03- "    b   $ @   " @ `  bğ 2d& d| >"   Ȁ 9c㿘>2@<ԁMAP %p: [0x%lx->0x%lx] #ent=%d, sz=%d, ref=%d, version=%d, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%x, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d 㿈 ,># 0ƀ" `># d" h ƀ |!>##@cƀ`/ $ (+>##`1># 0#0    #\ ,ƀ#`   F T  F T  F T $  #\ (#` 4#dƀ 2 0㿘>2@$ԁOBJECT %p: pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%lx> 㿘>$  ƀ  `  >$ƀ!`>$ƀ!(`">$ƀ!8  #>$3>$ ƀaP@v)  2 ƀa`   @v  >$ƀ!h㿘>2@wԁPAGE %p: flags=0x%x, pqflags=0x%x, vers=%d, wire_count=%d, pa=0x%lx uobject=%p, uanon=%p, offset=0x%lx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< 㿘>$ƀ"p $>$ *" & (ƀ 0 >$ " ƀ ,>$ƀ"`c * 2 "  >$ >$>$#  ƀ *ƀ#P *`>$ƀ#p` 2  ">$>$ƀ# *ƀ# *  @`> * c(   0 >  #8> #@> #0 `>$ƀ#@ 2 >%>$ƀ#0ƀ 㿘> a@u  2>>@!>#>ږh2`@:` А 㿘> !` J`1   2 ` a 8`` 8` ``2J`1>#Ī(  S%@,` N4 $X=# '\#\ @ g1`.  > -0$ -0 @ 0>̐(!Ę q"""" """"" "$"(",> `8>`,/J`1+>&(> a>2`:`2`:` "22``2`,>̐"( ",   D  "  D "  " "(""" "$tPPvm_map_lock: failed to get lockvm_map_lock_read: intrsafe map N N NWARNING: converted MAP_PRIVATE device mapping to MAP_SHARED (pid %d comm %s) (>b( ````D@ `'`  "(   8   `"@  '@>@@@ ` @ @ *'@a`q @m+`@ 2T 0f d  (`t    0Y  ``x@` >@``t 2`` 2  `>&`4"X a `    01 ```@ђ $ @  0 0     ` #\#`@[ &㿐`@T`Q  N ">", @ @ $ *  A`"  | )>>& <"  " %  "  "@  "  , +@ "    0   0    㿐>",@`   1$ "D >@) 8<   | 2 >"  є >&ݐ"  & \   | >"  ͸  - |`>"  ͩ     㿘>",@` @  `   #@  @  C     㿘>",@` @   ` #@   @   0   㿘>",@` @   ` #@   @   0   㿘>̘"( @`   $ *  @:   2 8 (  #!6 "  '   㿘>",@`   $ * @:  !6 "      㿘\ `e >", 2t 2p `2@@ *  &@@ 2e #@x@@`?1 0t `?@ϐ`  @%k `x  ?ڹ  `t . , 2/ @/ `-  @6     @ "     0  vm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapH&(H>0> (2@<4(H (H0   2     2 H (2D(*>" >  4 *? >2*(`"`* 0 2 >  <" >  D *?2*( " (  (2(((2(> "#0 "  " >̒b(`"`*2*` "` uvm_pagedeactivate: caller did not check wire count㿘 * " *`"  "`> "#4 "@ *?# >6 *b(`?"` *`. ( " `0>)#Ѐ "> > &#8&#@ &  ""  *>̐ 6 *b(`> "`̟€ 0>"؟@ 0 ? $# @6 $`*!0 @2 ``>  <"`` >  D`@ `*? >2`*( `("`*@> ` `#0 `@ >2`*(>  "@#0"`" 㿘 $?#> @ 06 $㿘`$?# @>  6`$ 0€`0uvm_page_lookup_freelist: unable to locate physseg㿘>> 0 b0>Ѐ22: @*`  2  `2: 2?2>*א"ȓ*`  uvm_pageinsert: already inserteduvm_pageremove: page is faultingvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %d page(s) in init uvm_page_init㿐> #('D'H> > > >;>̒ "@"` ` 0"0"#c8"  @"`> "#H!"`8"`4""`<#!" > "ch>#Ѐ`>+t   >  "@  b( b(* @s`4-, , @@p >Є R>> (" @ >+#@ 8>+= `+` *  @* ?̒@ b(>"+ `$%   " 0`4 @ b(@8 b(` `%` '@Zb( 4>cЄ(>!b( D@*@">a H*"@"(> "#X"$uvm_setpagesize: page size not a power of two㿘>b( b("b(b( ">+͐#X` "    `* 2`# uvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memory㿐>̦"()>#԰ . #>!>a@ܧ! a%#!8  @ $a$!!a">,">, *@ $a)>'>,#>@+  8q8cP   b( vm_page_physget: called _after_ bootstrapvm_page_physget: out of memory!㿘>#И > >̦"(+ !>, `>,6!x@ 2:  :5 *&@ `#@  " @ 2 cЀ ?! cЀ + >` #И@`#? @ #? #?#?  #? #? #?#?  ` ` 29?` @ 3 * & ?@  @ h cЀ ?ې! cЀ^ + >` #И@`#? @ #? #?#?  #? #? #?#? I ?}cИ? A> + >̞ "(` @ ` + @@ :0*@&`@"$"cЀ 2?>,! @ c>#И`#? @ #? #?#?  #? #? #?#?  ?ʆ vm_page_physload: page size not set!uvm_page_physload: bad free list %d vm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%lx -> 0x%lx vm_page_physload: tried to add RAM after vm_mem_init㿘>"(` >-*!0>>-!X$#Ѐ  >-!>-! 0\ >  ` cЖ (`"cА `? >-!   耦    ( :cВ (@ +`? #  @ # $ # (# ,  # 0 # 4 # 8# <?   ?  cЀ   c@vm_page_physrehash: WARNING: could not grow page hash table 㿘>#Ѐ`  >   "@    , ,  &, ,  [   >. 0n ?  "" ` H /f * ' > #( 8  4" <" 4B" 8*@9> >̆#(b(@` "` !  "@ 3<4 *  <3 4 *@ `"2@ < 4 * @"`@2Ñ*H 0>!@[ [rehash: physical memory config [segs=%d of %d]: 0x%lx->0x%lx [0x%lx->0x%lx] STRATEGY = RANDOM BSEARCH BIGFIRST <>!!!! number of buckets = %d 㿘!>#>."V #Ф > '>.`@?` E #Ѐ ` >.>#>.;#> (>.85#Puvm_pagealloc: obj and anon != NULLuvm_pagealloc_strat: bad free list %duvm_pagealloc_strat: bad strat %d㿘 >/ >̔"(,@ > 0@ 4 > 4#P   (   8` (``(4`$`$ >> bT~ #> !  >/ ` c( ``0j> >/ 8D#(  #( ] ߀ >/ `6` "`" "@(& &" 6 $6 && & & 6 (& ,& :6 * 2c(<6@ 4* H /f * ' &  & ""H 0 &    &  "@ "  $ `@6 $ "6 *q 㿀!>̐"(  . '' #\#` @ >h c  ,'c' J? "@ V R> #(7>5>`h&  , $&@ @& >*#"(``<2 `4* H /f * ' &  & ""H 0 &    &  "@ "  $ `@6 $=" 08P   "( @㿘  J $@`@>*P#A>"0>  c(2 `< `4* H /f * '  ` "` "  "H  `"  "` "`   "@ $?#  6 $?" && `6 &`@ &&  $ 6 &`@& >*#>b0> (6<@ 4* H /f * ' &  & ""H 0 &    &  "@ "  $ `@6 $ "uvm_pagefree: warning: freeing page with a loan count of %d uvm_pagefree: loan count㿘 $`@V ,`?# @6 $ $@`@>*#B>"0>  ( 2@ < 4* @H / * '   " "`  "H  `"  "` "`   "@ $?#  6 $?" && `6 &`{0`" * *`?# @6 *n& `"  *>0# >1E  %>`"  "`> "#4 "@ *?# >6 *b( ?" *  0  `2   >  "#<`"  "`> "#D "@ *?# @6 *(?" ( (6 (` ?"` !> &#(*  & *  "@* "  6 *(`u"㿘 $@`@>*ؐ#B>"0>  ( 2@ < 4* @H / * '   " "`  "H  `"  "` "`   "@ $?#  6 $?" && `6 &vm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapuvm_pageratop㿐> >€#P 2>>2r "0>2 К` > 2`@: +  * 2`` "  #@ 2`@: `2`??>*` + `*  @ *  㿐>c!> # #\ I > >>"a""တ?$?"  >#ؑ, @@` @ , pager_map㿐   ˍ 2&=  >̦"( > aء.@  ' ?  >ـ`/ !  "a>2ؖ⨒   р #>ؒ   0 `8 (@㿐>"0.@ > a|   >" ¨ >2 ! `" @>a aY"a!`| >" `‰  疒 uvm_mk_pcluster: provided page array too small (fixed) 㿐  \  >*'8'>̤"( "@ 2@ @>3א & e& " 2 * &?c& '`(@("@3`2`$  2 `$>"؟@`0 `$ 7`$`$7`$`$ ` 3>"`7`$`0€ `2?&* &( &``? * ``: " `* 2`$ 2`$``uvm_shareprot: non-object attached㿘   >3#(  "   %>  € 0  2 㿐```$  \#\`$&$ &   ` ``@(  2 !  ` @- 0 ` !@ `ˀ`uvm_pager_dropcluster: no releasepg functionuvm_pager_dropcluster: object died with active page㿘 2! ``@x@s @f`?>̨cϦ"(c V 2 * !"   "    2 `$ "ؐ $@& @*  @2$>`0€ (` ( `02 >4!(  >4!X 2$>̟@0>#@0$ 2$`@ `  & &!`* >` " "0``˞2@ vm_map_lock: failed to get lockvm_map_lock_read: intrsafe mappagedaemon: deadlock detected! 㿘 H /d * % > #(>b ,>5 >aX: H (>̐"8  H 0㿘>̢"(` @d `: @ $`, : $`, $`,, @d $`0 $`0` @d $`8daemon_slp㿘>"> "cTH >̦"( +> )>5H /dc(* %c( T    (  !xl (`ؐ "` T T$ T" H 0>̢"( `"@ $`@ 2@ ( "    @dK 0 $ 4`$ 4  0@ 4  (@K((@ 㡐0pagedaemon: page with no anon or object detected - loop 1pagedaemon: non-loaned ownerless page detected - loop 1pagedaemon: clean anon page without backing store?uvmexp.swpgonly botchuvmexp.swpginuse botchpagedaemon: pageout returned invalid 'unlock' codepagedaemon: no pgo_releasepg functionpagedaemon: invalid nextpg! reverting to queue head x>̒(`@: * 6`2`*`# h'@# h'  '     ` b( >͐ $ @'€`0 "`*  r$ `2` `2!`$`  >5M#P2 `$`, 2?>5D#`$`,4`*`$ b(` P"``  "`쀊    E$   $ `$ b(`* 0 b(`H "`H>" €`0fb(`䀥  )"` 2%% >5 #0 * @4@H@ $`*>6 0  @ b(  b( @ D $`*>6  `0  2`*`" `*`  "`*@  ` " `* b( ``̞2@ `*>`$ 0``04`$@  b(` 7"` " `  @ ڒ % `}2@ . b( @:@ '@ 3  2 `$?# @4`$.  &@ % b( `^2@   `&''  "@@ b(6' 'b( $ #\  `` $ $`* "@@a'_']'M 2`$>6? 0 "`$`$?cϐ  4`$ F% >" `0€ @q'+  0>6 h€ @  '耤 >>"̟@`0 >"̟@`0>#@`0`$ 4`$ '耢   *  `>6e @'耤```s gb(p  0 *`   e  _'pagedaemon: page with no anon or object detected - loop 2pagedaemon: non-loaned ownerless page detected - loop 2㿘>̢b(`ܨ  .$`7``06 `` Y$`@`ܒ  ``< > #8`> #@ "("(`܀ 2 `< > #8"( 0䀣@ 4"" D@@ > H >  "# > ^#0 Z *`2   2 $ >7P#2  $ , 2?>8G `$ ,4 * $ 2<+` *    "  *@ Z  ?"  $c 4 $ * "(    2@  `@ C  $?# @4 $` >"  0€O"(a "a `4 $4 $vm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapvm_page_alloc_memory: alignment must be power of 2vm_page_alloc_memory: boundary must be power of 2㿐'L>8Ȑ#P?>8#>"( "(   * @e  .8'> #(`  ' *`"' > ->L àb(`>#Т4 ` 2`@: * *2``# #@  2`@: `2`?^b(  cЀ4 2: *  2  K2: 2? 2b(@et,  @@/ * *  * @ *`%>"(* *  * @  0?@  @  '* *  * @ *`*u 5'> >̴#(b(%>ա* ,  , @@`*  "` "  "$ 6 $6 *& & 6 (& ,&`& `"@'```  $`' Xb(,@ > 0@ 4 > j#Puvm_pglistfree: active/inactive page!%s:%d -- Already 0! ../../../../uvm/uvm_pglist.c㿘 @> >̢#(b(+>:)>: *  " >: 8`` x!)` "`&  " 4 *$r*  l$ *  f"@* "  $>`` א?"`` 2 *vm_map_lock: failed to get lockvm_map_lock_read: intrsafe map%s = %d 㿘>#耤 #>:    b  2 Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retrys)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, swout=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern/kmem/mb)=%p/%p/%p 㿘>:"`!>"(>:"(   "x >: "    ,>: 0" 4 8 X>: \#0 ` d h>: l#` t x>:# >: #   >: #  |  >;  ( u  >; Đ h  m >;j  >; ܐ  c !>;   \  >;!!0V L <>; P!XP T D>; @! HI >;F!> >;! !?!vm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapswapsysuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp bufswapinit: pool_create failedswp vnxswp vnd㿈>"!$>"bd>><( !(  >>a > >"v’a\ "><><s 0  `#\ \ % > "a ><c h><  #\#`#d   @Ś >ڀ "b><Q ><  #\#`#d   @ > "`><? ><  #\#`#d   @ >̀ "`><- @ U㿘>!$``` $Ȁ 2$8$ @ $82$` `2`㿘`< ,  \ &$Ȕ@_ >`.`,  \ z&$̔@_ &$Ё㿘t>̐"(  ("    r 2         5 ,  &  @ 㿘 ,    ,  $("@ ;  $ȑ* @(@ $ȑ* @(@ ("@   ( ": ȅ( *@ @  㿘>!$ #>  4 "$ $  $  $   "` " $ $$ $ $ "`"$$ ” \&  &$8 &$< 2 $ "$8$ b(`< "`<>$*>"! b($42$8`$8 $<" <$< $8 8 < # <" 2$4 2 㿘>!$@  "$  "@ ; \ 2swapdrum_add㿀>a     #`#d#\   ">=ې#0&$,&$(>$```"` $(&$8$, $8 2$(` `2` minirootswapctl: miniroot copy failedswapctl: copystr@>ͬ`!(  @  >"d &22>!$ )` `>̪"(`$$* : $ 蛔$ `$$ ը $8d` 2&ǰ 6 (``2@> d u.  @ * >> $L " @>>> 0    $ 2(  D'''''o3 (@    ( 0} 2z `t "`xv >L p"P` \  ǒ   v Z0Q` R  \ l$Ԡ \ g  @]$Ԓ $ $$4`t 2?`x $`t @$$ĒE \  F$$$$$Ɩ ">> P@P  u`t 2$ǂ$$ \ \0tѐ0 t(  swap0x%04xdisklabel regionswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap 0>d4 `d@ @ @W  `t  2˰ 4  >8* "@*` `" @?)  @ d`H + 3`    D d`H>`L&d@ `L   &dD&dD>̕<  2* &`"(  @Y* `t      \x  | ># >?##` #\  \ ꣚ &d0   "d$>?ې b(&d$DH@"H"Dd@3>>"b(`HD #:` `*  `* 2@ $d0>? ВĖ  "d$>? $ &d$`H>?`D@  $`H$`D! >?!@&>#``b( ? &`&d @@X"@  d@ @ 㿘>@>!" 5㿘>@>!" ) swstrategy: vnode type 0x%x㿘>̢"( T`*` :@~ 2 ( 0 (& 0& 4bp0<4$``t,`2: `>@;!pH /d * % & T4tC& D 0@2 \zJ h $ h \ "& \{ѐ& \H 0֐0 @sw_reg_strategy: swap to sparse file㿈H /d * % >`@ڒ H 0 %`%`%` %@%``<. `H &`@$4$@@Y'씒 ?>@ɐ""$@H /d * % %`@Y $ &H /d * % >`@ H 0`0 @$ 0$ <$ 8$ 4$ H<  $ T`,>A!P#c!$ ,$ X$ $ \$$ h$$ l$ x`d >$ `$ d`<``""@$ ``<`d""@@8$ d`t 2`<$ p$ t`p""@$ p`<`t""@@8$ t T$ |$ @H /d4`* %`  `  %` z$H噒@:H 0UH /d  `@ʒ `* % `` ?`%```">`0&`4(&`0>`@a1H 0㿘  & $$D & $l" !$&$l&$0\`h "`h $$D6 $l2$  ?& sw_reg_iodone: vnx pending: %d㿘 | H /d * %  < @`@" "@$`@ ?$  4 2$  \ ">zd>`@M  "`@`0($`0 $`4  2" 2>`@8` 2 `" >A# 2 >`@#`x$H 0㿀>"d`$\ >!$`O``F>̨"(  "<$8$$$  46$8$0   #`#d #\ s 2'$8$8@$<$`"d<$<@$8"d8$$8`$$<`@2`$`"$8$`$$ $$$ D % D$( $`` `2``` & uvm_swap_free: uvmexp.nswapdev < 1 uvm_swap_free: startslot %d, nslots %d uvm_swap_free: unmapped address warning: resource shortage: %d slots of swap lost uvm_swap_free: inuse < 0㿘>̠"( <``>B͐"2 d(>B">>BÐ#d0& 3  >B#@0d$"$d$ D"@$ Dd$ 6>>B#x `. ' "d($: * @d̓*` 2d($: * @d̓*` ` 2@S ߠǖ 㿘@?@3 uvm_swap_get: ASYNC get requested? 㿘>̠b( L  'D$ L>Cϐ!H H?$ HD  @    b(`H "`H㿈>̐"( @:@ *`2``'H2`.@ *`: 6# 'D' `  '  >>#` '>` 쀢`8Ha쀢^ 6   *-s  <@1'>̲"( H(" : * @̓*`   2 @  4 ,`@ *@2*`@- ``- :  :D@ @֨ D'   P H /d * %   >> T ` `>b@ x H 02 쀢   H(" :`*` ̑* 2(":* ̑*  ` @/Hܰ  2   >ڔ`h$0$,`!P#!$h$$l$H$T$xH /d * % !>pI!\!\$\H 0>͘ a\`t 2>`x $D>̖b(0.@ $$<$`.$dH /d * % !\h "hH p@> H?0>E>Eb @@$|$0$X$$$ f ]̐0$4>2` 5 `0@10(- H'<`>̮"( H& ($ :* ̑* -@ @͘ -@:  @ : D ؒ0@쀢`ԒH /d4\* %\  w<>b@ %H 0uvm_swap_bufdone: private buf wanted㿘H /d * %  0 @" \>E[! "> w > #|&   |&   "" ?ԑH 0uvm_swap_aiodone: aio too big!㿘>̦"( @: *2  2  * # @ `>E$!   졐,   ($ @  L  *`@ J0     H /d * % >b@ H 0swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystr㿐>L#T>EG#H0Jm  \>E>#`0A D$Ԣ \ ? $Ԓ @Va $`$d4 *$@  \ ,$d $d>Ed#xખ !>>E꜐#"3 X md4dВ \͒ \0" vm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿐`*  >   -0 -03>c'O   ( &c > `㿘6  #>x &  ` $`㿘@>`&  && & & "`㿈>`  "`@| >8 8''7` ''+\!耧`@ &` &`! &` +F& ` swap_decrypt: key not initalized㿈> `>Fא#P@8 >8 87`''''!+ 耧`"@&`&`a&` /=& ` @&&&& 㿘!>#  >!`>!) $#㿘!>#  >! @U'"$#vm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapsbrk: %s %ld failed, return = %d growshrink㿐>̆ b(` @   * #   C'($8>   *  @ @*@'1 ` cп? 2>G  ؓ6@   @ܔ  >G  ؓ4@ "  $ ؀`!P>G!x>G!`&   㿘 耦@>'  (>ܤ*#@: >0 " 2 ":`0 B ; @Q4  @  $ܰ  uvm_coredump: user process with submap?p`   $ (  ( ]=>̮#b( ">G豐# "KF >@ 8  耣 > ( * "* 5  ( #* @#@ aH ''' #\#`#d#h#l{  @ D #`#\#d#h#lj   @ D & $2vm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapuvm_deallocate with null map㿘 >H@! >",@ 8 @  vm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapuvnsync㿘>"!(>>>H"a,!`x   uvn_attach0   !>H &   "2     t 2  x>8 *`" * `"  " t  `k ` &  "}>(( & $( $"`("(& ( "o&  `!&  x>8 b*" * ` @>  `h@  `(  @O   >"@ " " >  "& F& 6 b(  8(> ( > & &  & &    & & & `& >(( & $( $"`("(& ( "& j uvn_reference: ref=%d, flags=0x%x uvn_reference: invalid state㿘 `2   >I贐!>I9!Ȑ & uvn_detach: vn %p has pages left after flush - relkill mode uvn_deref: vnode VM object still has pages afer syncio/free flush㿘 ? =&  0  ?` & 0  @a jĐ0.`&   @W  ` >Ij"( `&  ""   $`" ( ("`( ( $"@  " >Iڐ"h & ϊjuvm_vnp_terminate: detected unbusy pguvm_vnp_terminate: no I/O to wait for?uvm_vnp_terminate: waiting for I/O to fin. uvn_termuvm_vnp_terminate: io sync wanted bit set㿘  U  ?&  `H&   @  `") '>J %>J#>I `  >I`$ 2`㸀`2`$wc `&   8   2     & >J[ H" &  $`" ( ("`( ( $"@&  uvn_releasepg: page not released!uvn_releasepg: kill flag set on referenced object!uvn_releasepg: pages in object with npages == 0㿘 $  >J!>" € 0`&@\ `"&   " >J"  b"   $`" ( ("`( ( $"@  " >J"@ "$ Ν$  uvn_flush: strange, got an out of range flush (fixed) uvn_flush: PGO_SYNCIO return 'try again' error (impossible)uvn_flush: obj=%p, offset=0x%lx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushx>̠"( @:@ *`2` 2 * '#h ' ' '     *   @8 @  @>J#p &2@ *`@ `?0   $`* " `$/#` :``$ 4`$``2` @/# >`$ 4`$(@@  " ֒ %' >`  `(`@`$  `*  '` $' " `$`* >b`0€ `$  >"؟@`0 ?`$ 4`$`$ 2  4`$`20`$ @`݆?`( 2Т>`0€  Ǣ"Ģ`$`@4`$>`0€ > 4`$`0 € `&2 ''#\ ">J䥐#   -`&2 @2 `@+{u  ,@l `&-2 @2  `@ 2S# $ ? $?ϐ   4 $7 <j  4 $>#@ 0?`(` ( 0b€    $`@4 $"  0`>J`垐#>K囐 (' 0b€ j`  `ڀ @ Հ "  " !>K  `&    `.   2  !" ̤   >& uvn_cluster: offset out of range㿘& @ @>Lא#X@ &>b,  * 8&㿘@ uvn_getpageuvn_get㿐``@0 @ $   ?@ '`$"  @`> 2`$$>"(`@ @ &p n  @h ?!#Ϡ  2Y>̀@`T> '>L%>M`$   2`$    2`$$  '   ᴚ '瞐 $>̐  @7 `$   `$ 2`$~0>$ 2$㰟€`0$>"(`@ @  uvn_asyncget called 㿘>M䇐" uvn_iosyncp@6   #>M  a&   b*       ז  2 2 y ` &  Ɩ >̦"( 'г.   8"@>"   '?'쀋 @''''' ` 8  `0  `N   @ 耦`&@`( (@ (   @. "@N" 䯒  ?`&    `  㿘   "   `& e !>" & n <"`  㿘  #>b(  8(2  @ (   82 & @| & uvm_vnp_sync: dying vnode on sync list 㿘#>!>b!`  >a0" "a0>!(#  "H2$ 2$  e $!0!0 $,,"`$a0$〦 a0(1>N  J"  + 1`" $`("`(($" $,2!`  vm_map_lock: failed to get lockvm_map_lock_read: intrsafe mappr_rmpage: nidle inconsistent㿈 Ē d  \#\#``d#d#h@*  @Ӕ @ pool_init: page size invalid (%lx) pool_init: must specify alloc and release togetherphpool㿈\`d>"(@ >O!8G   >S>S <`d  `>O4!``"b(" ` ( >H&& "@"&  & & h`? ? & (& L& D& H& 4& ,& & $& T& & & P& 0?4`  & 8 @& T&  \ 9>&  \9>  "?@N&@N&  $@@O#& <D@O$@?&  & X& & & & & & & &  F !8`  >O a#\#`#d#h (  l pool_destroy: pool busy: still out: %lu 㿘  @ " T>P"@ ઐ D#>?  2  2?>O & ` "`&  "@ H  0 L , ? T`& ,@&  ` "`  ">!8@ 2   `"& ` "@&   2 `"  "`>" L "$`T T  dpool_get: staticpool_get: must have NOWAITpool_get: urgentpool_get: %s: page emptypool_get(%s): free list modified: magic=%x; page %p; item addr %p pool_get: nidle inconsistent㿘 T `>>P!>b  `" >P! 2@`'@` \ X _ % D 0 L 2 `  >Pߐ!C  T`$ T Ő P     $ @u   Ȁ` 2>P Pߺ"7o"" >P P"0߰` "`"   "2 ?>Pߜ"x `$   + $  ` "`"`$ " " " $ $  ""$  "$    $ pool_put: %s: page header missing㿘 4 T @@  ` 82 *  |` ``  ``2` 7o>Q P;!`b&@  &` " $ $  &` $    `& &  T  ?& T `  & ː0g  d  , (@>&   2 2& >O ` "`&  "@ H  0 L , ? T`& ,@&  ` "`  ">!8 + `"'& ` "@!& ` "`&  "@$ $  "@& > !!$  $ $  "&   "& pool_prime: static㿘> T  b>Rޝ H  ? b \     <@?@L@L < $" ? T  0@ D  0 L`@ $`& $ ? $&  (@ `& ( J  㿘 T  @  %@>!84  86@ *  |` #  8 6@ *  |"` 86@ * " | 86@ `*``| #   # " & &  # #  # # # # $#      & @ & & $@@ <7o"&` `&` "# &@ @  "&  ,   & ,&  㿘>" \ Ҕ ` &  <?@L7@L <& $& $" \  㿘>" \  `  <?@K@K <& (& (" \  㿘>c8>̕6`0h 㿘>c8|㿘>c> 6`W 㿘>ck㿈> !! ' T i'  e , $@`Ф"@  S` " ' $" `'@?> P耢@ @`  2  2?>OW & ` "`&  "@ H  0 L , ? T`& ,@&  ` "`  ">!8֒  ` `"& ` "@& ` , $@@㿘H /f * ' >`T  > H` "TH 00 Tn"TH 0㿘 8> >!<  ` L >  (`" 1 6 2  $ 2  ( 2  , 2  0 2    `  `` `k`` `` `n /@ u "`d &` `` 2 ``?#@2`T 1` ,`  2",`2  #6F 2>>А`(4 w " ` 8R  2`, 0`& $` & (`& ,`& 0` 2 `` 2 ``?#@ ``<* @ & d`2 6 6 $@   㿐`8>` 7 b     `2`` `` >>!a 6  # "X   >>!a-`,`2 2`:  ,`i@I$7$@,`2`" 4+>А ۰ 10\?* 2`@45: 4  z `( `$Ԛ ܐ96`6 ,`i@If$7@,`2`$ 49>А  10$ * 2`@ 45( 4  B  ( `$ ܐ6`6 P` ` 'g'`   /`  1`  `  `?#@02)`$` 2%`$`?#@`$  `( 2 `$`, 2`$`0 "4`.`$ ذ `( ?`,#@"@0̀ 2 @`( 2 @`,?#@ @'`'`'` '`'`'`'@ "&` `$ 21``( 2-``,?#2'``0 2#`@Fv   // `8R` `@ @F` 7 Ҕ `@``@`$@Ϛ 2 `@ h 1'd  @'@,`k`$`` ``(  `$`,  `0 `$ `6  A 0`$ `(  ``, ``0 "`6`2 ``( 2``,?#@2``0 2``6 2 $`$ $`( $`, $`0`$``  $``$``$` `4`4`$`dHuh? Thought in6_pcbnotify() never got called with mapped! 㿈>٤\" `?`''''` 2 ` `` 2 @` 2 @` 2@| @ `  `?#@2>Vۮ! `>>a##`  `'`''' > PQ `!IL@E  ":@E  238 ./ 2 `6 2'耢 $쀢  $ $ $@E|  2.2 ` 4 2 2` 㿘`  @E(&`  , ,`64 `$`$$ `( $ `, $ `0@$ 㿘`  @E &`  , ,`44 `$ `$ `$ ` $ `$  㿘># too short mbuf to rip6_inputp 'Ԁ '@>W{   2  2 ?#@怦     ?#@אԶ@D ؐ@D   // @j @ (    ) +" <  )??  (؀? *   ? *   "ݖ :? ` : @'Ԑ   @>##䀤z<*   *  `!"n  j 2h  $  $ (   $ ,  $ 0  $@Dy  2R             @Dc  2<   "1  $]  ") & `@@B 8' 8Ԑ 88G  87\ 8 8 "     #h 䀤2 ` #^!``>ل"`^@ Z`X `>  P `L"  `'`'`@'` '`'`'耢 '      07‣ ? ' ' ?'  ' 07>#\#ؔ  0 >>#\#(ؔ  8'T'X'H'L'P  ' ' @]M '  R `:2   &   2  7w'     2   ?" '  (?" '   ?ؒ`(& &  (#  "   "  (& < * '  `/ `j / `$`@| : `@` $``$@ 2  '  1$'' ' '  ' `@ > @`0* '@?/  R `: `?%`:2``@`( '   `` @`&@` (@``4 @ (4`@P 'R` :ۀ ǘ  0>c > > ` *@`B :  "  0㔀> > ` *@ `B : ?`>[!<*` € "  0㔀> > ` *@ `B : l "j> 0㔀d> `> `\*@Y>`B S: "P> 0㔀J> F> `B*@?>`B 9: "6> 0㔀0> ,> `(*@%>`B : "> 0㔀> > `*@ >`B : "> 0㔀> > `*@>`B : "> 0㔀> > `ڑ*@>Ȓ`B : "> 0㔀> > `*@>`B : "> 0㔀> > `*@>`B : "> 0㔀> > `*@>`B : "> 0㔀z> v> `r*@o>В`B i: "f> 0㔀`> \> `X*@U>ؒ`B O: "L> 0㔀F> B> `>*@;>`B 5: "2> 0㔀,> (> `$*@!>蒂`B : "> 0㔀> > ` *@>`B :>#+   B;  R Mfghhllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllhi<ij jtjkDkll|㿘`): i   }T䀢i le ); 0kjkh)耢  @D `7 0\[  @DDVQ2 O `K` G`"$  ' "  4": 12 / `+` "`0% W S ^ ' "   """ " """" @Urip6_attach - Already got PCBrip6_detachx `$    8@?   //`'`'`'` '  9rip6_usrreq - unknown req 㿐`>]"h.` € `" >\! >ذ > 2Ր 2а>cy 2ɰ  :.`j &`  j &`  * ``(*    91  2 >\ϐ!1  2  >\Ɛ!  2 >\ӿ!  & {  2 > #`  2} 1     " u 2f 1 &`$ &`(&`,]&`0 2^   R /``@``$@V 2  D 1'@&`$ &`(&`, &`0&` &`&`0&` -1ϐ(  "'    @Z   - m  >\,"rst(vtvsuvusuvvvvv,vgif%d㿘!> x * *  *   *  x*@ *`@ *`>@ " |@>\*` x   >^>]aT#%>]ԍ` %,`8$`<4`4$`!$`|`( C x `ԁgif_output: recursively called too many times(%d) > ` " >]c C > !!$ t $ x` <6` 4`3 / + (  t't'' 'x"x P $ P` ` @$ `   " 0@Đ @xM 2 $` T $ T㿘 !F@<  a@" a @a@   a2@a1@* 0aH@"   !F@aG@"  0HaG@aH@"  〦2 / !F@ !F@1 )հ Ʋ  2̰  ` 2Ȱ /` 2İ /` 2^ > x> `|@ `    1 `F  ,, 2  ` 2 /` "` / 0 ` 2- ` 2) ` $> x> `|"`"` 2`  ` ` g 1 Դ  "        @=s&   @<g 4&  6 4Ȑ8  10!G@0H!G@* 1  4#  0!H@0H!H@ 1    . 1 NULL pointer passed to ip_ecn_ingress㿘` >_6!" @ @ .@NULL pointer passed to ip_ecn_egress㿘`?>_"X   @  .NULL pointer passed to ip6_ecn_ingress㿐`2>_"@22`//@* * @&@NULL pointer passed to ip6_ecn_egress㿐`2@>_͐#x22`//* * @&0 B ?  ; `7 4@S 3@<!@@<  /}/|<'/a/``'d'7` (0    2. 7 @ *  N" /'۔    ޖ [       㿐  'L ,'P'T'X @'H> x>`| 1 3 ' #  2   2 4  ` 2 2   2` @" ՘ Ԁ& S0)0  K `H  D `@ 4@@;M!@@;I  /}/|<'c `''/a'/``'h` 'l`'p`''t7` (0    2X 7 @ *  L /' 2D2 > S %& `@  `@;-  @:  ` - -`% ` % `% `%  `"  `8 ݐ?"`8&    S  G 30    @Hǚ 㿐   , Y'>> x  H| @ x `"=  8 x ` 4 x 4`/@ @:ϔ  2  ` 2 ` 2  ` 2  ` 2   @:    x   @:  " x Ԁ!" P@0 ! P'@:0 @:,  >a/   >a/ cc' ''''''  ' ''Ā 'Ȥ@S֘   ` D@ "` ?R ` "` `  &` "`D``8?"`8㿘 R  @ 4`    8?$ 8㿘 >!<   0 @9  2 ``$ `v  #> >??#*` ??? 2  " 2?  @"   *  @   :@2㿘@9b   . ``:` `*`?&@ #: . @ >  0 @ !ka@ 0!j@@={tj0 W@")0!V@ "&!UL@N@0HaP@ aO@aM@ ai0J!J@ 1!K@  aiE @_^?@ag@ ad@af@  !0!e@  !"& @Ԗ@ "!@ 0!@" @ #0H? ?  `"00@" 2 `0@ "@.0Ha"@a!@| Ha@".  !@'a @$0Ha"a@a@0Ha"aI@"a`a%@[0Hua"aQ@UaR@W0Hla"` 1  /N`>   }  7@8Y `( $@,`),`(4 ``$`,`a,``$`@8I ><`|$`` $` ` ``` 2`"`"<``  $` $`$`"@&`  $`  !@0Hh`0H\ 1`W `? N ` ? G 0Ha"@"G4 H@"4  !@6 @0#@@0a!@0aQ@"` a%@1aI@=0aS@"; aT@N0`(&`,&`0&`4&`8& `<&$`@&(  ``&`d&`h&`l&`p& `t&$`x&(`|&`&`&`&`& `&$`&(`&>  >0`*`@7 Ű   >  >0`*`@7p! ! ?``'`d?'`h'`l'`p'`t'`x'$``$`d$`h @ $`l @ $`p$$`t( $`x`j`"00@ 4`j  a ` i$`  R{``$` Ru ] &`&`&`T&$`$`$`$` $`$``?@$`>$`@' 8$`| $`$`$` $`$$`(@6$`  //7'``0 '``4 @'``8 '``< @'$`D$`H$`L$`P$`T$`X$`\  `( &`,&`0&`4&`8& `<&$`@ &(`0@6ޔ  " 4 " I-  ܰ /I  ְ /H @H $`|L$`P$`T$`X$`\$``$`4 D- @@``?'`d?'`h'`l'`p'`t',`x'$``0$`d4$`h8 @ $`l<@ $`p@$`tD$`x`j`"00@ذ $``$`d$`h$`l$`p$`t~$`x4`j  @_  V4@ @6''$<0c'  7'/7'@ "d ?$`h$`l$`p$`t$` $`$``?$`$`8 #"` " ` 0 6  ``$`@gf _` "@@2 "@  - - Didn't unlink in6_ifaddr from list 㿈@ƒV`4 @1%>ՠ@5  <<`0c'  77'/'` ` @ "`  2`` `   @5  2 " @ ` "`&`  "@  ?& < 2 `  $<NX< ` 2`` >f "`NE0c!ϐ "@@+ " @ ?& invalid argument to in6_lifaddr_ioctlx2 >fĐ#!@ "!@"/ -0!@2* - @" 2!  2  `  2  @  " 8   !@ ^p!@"  -0!@Rp - @ @O " 1@ڤ ` Ԣ ` ܰ  @4Œ x8 4' '  & ' '  //Ȑ= *@' a@4  @$0) P Pp T X'P\tx | 'T'X@4'\ 2  !@    Pٔ   `Ҕ `pP @ d h'`ltx |  'd'h@4{'l   ` 2۠`0D 1!@ ((4 ` `0@4 !& *&@4 x  ((4   `|` @3 |r| H'<a㿘`  4   O7 ` O2 ` &`x H /f * ' `(&`('`,&`,'`0&`0 '`4&`4'`8`<&`8''&`<`@&`@`' a  " `8H 0&`(&`,&`0&`4&`8&`<M&`@ `8 " `  "`0 # `> <`> a&`&`H 0&@{`(&@`@&`$`4  @  &``a   N  ` &`jT`4 @@h㿘  , 6 "   2  ! O  ` L  ?"`   $ &  & " $ & `2 03 * $   $   ` K & ?"` &  & " $ & `2   >cc $" $ "c 6㿘>#*2#  " `&  " " & " 2"`""`"@  602㿘>#  2 @ `"  "` "@l 60 2 xH /e * & &` ` @ "`  2`` `   @2  2  ,  v&  6t  2 H 0% 7 &  &  &  & & & `   "  22&  6H 0 1&H  `"  &" "& ؐ@2 `   `/ / ''''  a1@& ` "` "Β 6H 0  @NH 0xH /e   JƐ "ؐ* &  ? /& @NҐ`"  "` "@ `` ?"` ؐ@1      / /  '''' a2x 6H 0 ?? " 2  2  2 㿘 `"  ` 2 `@1  2 >>(@ *` >@ "   :  2 23 *@(2  0 2  0*@`*@` *@`*@` 0 @*@ ` @*@ `0 @*@ ` @ *@`*@`$ŀ  b(* *22 2 0 ? ?>' <`"# `0`2``4`2``8`2 ` `<` ``2`0 㿘      0%>a   "    0 0  # @0ٔ  2   ``   㿘̐ "  0   ?    @ `  (0  in6_are_prefix_equal: invalid prefix length(%d) 㿘>kb   : . "@0 2  @  "@ : `?in6_prefixlen2mask: invalid prefix length(%d) 㿐        ///////`/>kc 0@0 ``: * @ &@ . `@ &.  ?. in6_ifawithscope: output interface is not specified 㿘$ ? >l 0> #`{/>EA2n`` "j` ` `?` 2Z  2W  2T  D#6@ `6F   >#`"?  ";  ") # " *  4&  4  $ 42 `  0  2`` 2 蒂`B &:耥,),*p B; p `B ;  `B ;㿐i ? ' 5' ` 2-  2)  2&  2#  >#`2' G`2  2 0z $   2 ' ># `2  2  2   2  2'  2  " 㿐@  ' `2   @`<  2>  >H42 0(@824 > 0 X@.@''>!>`@@'0@'[` `   .` 㿘 `"s?@  2 ` "` `2 ``2@a? 8  #; %  ?0SD ``M?>`@. 7>`@.y 0``` %`2#`  .`  .` .` .` .` .` .` .`` ?  `@. `   .`.``  ?  .`>` `@.>  ? %s: failed to get interface identifier 㿘| )`u "# > #`@ h 2` 2 ``@> >n  ? %s: IPv6 not supported %s: SIOCSIFADDR error %d 㿀 2&` & & &` `&` "& ` >a<   &`   2 $ $<`  &`  `"'H /f * '   a 'H 0䀢1/ >n>n!pà  `F^ !z ```"`& ``"@` ?&` `$ FCU?$<` ?&` M?>ac`@-v      8 >` <a&`&`!`(  `| F `!`,&`V 4 @'F@- `<< 0c'  7'/7' 8 " ` #  0 ` &` 㿘   @,  4(`$`$$`| $  @,$>a#` # ` $`$$$ ,|@,,}( ,`@,,a<b 4 0`,(,)4042 $4Ĕ0   ? $<$8 @$$ ? 㿘   @,  | ( `$   $$ @,$ >a## `  ``$ $ $ $  , |@,, }>a# #   , `, a$ h$ l$ p@,u$ t @$ $, (, )$ 0$ 4$ 8$ < ? %s: not multicast capable, IPv6 not enabled %s: failed to add link-local address ia == NULL in in6_ifattach> `+>> '>` Ȁ@*;V 4Ȁ * @:* "Ȓ *  A@,! " Ȓ, >*`" %  +@, ` |,` >%`" V 4 @>o# 0"b 2 4 W 2 4>o#0 /> *3>a@+ג c  x    c ' '''/@+/>a##` '`'`''/x/y  ( E c   'tc 'l 'h 4  'p-h    2V 4>o1#X @/>@+ >a#p#p` ` ` '''Đ '/@+y/>a#@/ؐ#@' /   0'''7 ` @ "`  2`` ` @+  22 4 ( !E d 4 Ac c 'h` `'t`'l'ph>ac0c0 '''' ` @ "`  2`` ` @+H  2ఀ   (  Dؚ {d < *% 0* `2 0    0 *#  0*@*  0`* `  ! 0!`*#  0*@* @JҐx@@M ؀`/>a@ `` `2@ `_@ `2W`? ? 2P` )>` ` `(B " `CM6, <   `|Da ```"`& ``"@`  ?$` !<@ 2``%!<Ch!<Cd` 2`` "` `"`` ?$` `2@@M @*T @@' 0    / /'''7B    0 D 4Bin6_cksum: mbuf len (%d) < off+len (%d+%d) in6_cksum: out of data 㿐 @ >q#@*  ?/'?   ? ? "```?`` `  `  ?` `   ?? "``` `` ` ``       8 &   " `& + 2 3 ?c 4#  * @+ `  %@`` ` ``  `  `` ` `` ` `` ` ߚ` ,@`` ` `+ `"32 3 ?c 4# `@``+ 2 3 ?@ 4# +   @     ? @ * @ ?    @  ` *`& + 2 3 @4# @ * @+ `  %@`` ` ``  `  `` ` `` ` `` ` ߚ` ,@`` ` `+ `"12 3 @4# `@``+ 2 3 ?c 4# +   @     ? @ * @ 2l >q4#+ ?# + 2 3 ?c 4# *@ 㿘  `'@`           2  2  2  " ` >#*` \``00? ? " $` >#@ } >#* `  ? ?@ > "ΐ ``   @Kv ŀ``@ "`D0@ &I 1  @(*  " `8 ?"`8&  @ 2@'   ..&  & & && `@ &?   D  `0 D``0 A 1'@  `  `>>`0!H(`#`  # `# `# `"? ?? ?9 '`` `>(` 3 ` ` `` 0 3  >  >+`3 2" @# `?# `?# ` # # @ @ ? @?  > " # 42# 0"#  3  in6_prefix.c: bit_copy: invalid args: srcsize %d, tgtsize %d, off %d, len %d 㿘     >u` 05  8?  " @   :   +  @.:. `8`  * @.:㿘  ` 2  2 `*@4 in6_prefix.c: search_matched_prefix: addr %shas no pointer to prefix %s 㿘`Ӕ`, > `: @ ` 2````,4``+ ` ' #!>u ` 2  2 @`  4  !>u@! ` in6_prefix.c: mark_matched_prefixes:no back pointer to ifprefix for %s. ND autoconfigured addr? 㿘` ,  !h ` 2"  2 `0  8  *  4   P @ @$ P@$ P  2` `2 !h!>u@ ` 2(``t0@ 4 ` &` 4`` @P @  "P@ "P@z  #P``2@㿘 ! `2  2   $ 2  P& P  2 ??2   2  P  " P  2 <>  L " D" D 8" " @ L" @" @rr_are_ifid_equal: invalid ifid length(%d) 㿘 { >vb1  : " *& @ "  @%` 2   @ * `?㿘    $@ Β  "㿐@w ".   0% " `  " H /e * &   "@ "` & " H  @A\ ?\  `0  @ @`@$ > P ".  ` @2% H /e * &  \ "@ \"`\ & \" H p@ \@4  2  ip6_prefix.c: addr %s/%d matched prefixhas already another ia %p(%s) on its ifid list 㾨`0?  ? "z`0`  ؒ 2I @@$ T`    /'//Ē   /s  +*   ?/''''@  @30A @$``7@B@& 3`  +  " ` "&`!>w!ܐ` 0א0 0$``  &` &`  "&`㿘` 9В`0 ".`H /e  =  * & ` "` "H  `` ?"` ʒ ~`` @ސ 㿘  `  2 @ 2in6_prefix.c: add_each_addr: addition of an addr%s/%d failed because there is already another addr %s/%d in6_prefix.c: add_each_addr: addition of an addr%s/%d failed because in6_control failed for error %d  x@#` `@# `   ////Ȕ`$  v `  #@  n ` C` "7 ` ?"` & % x` ?"` &  .% !``  0  0 > '>" `a  !>x!Ð`  in6_prefix.c: rrpr_update:%d: ENOBUFS for rr_prefix 㿘`  ` 2 2 ` 2 ``$ 2`` T `P`P@(`H˰ `,`H`L,`L`8$`8`<$`<`@`P$`@`D* $`D$`P` "`H``"  "` "@y   `` ?"`  ~!`; H /e * &  $" $$ H p@ ` 2`Z`H }   >y`  J"g 7 T$``>ۀ ````"  "` "` $`" $`$ ` 2``$@ `" " `` 2`"` ,` H /e * &  P P $` P`"`# P$`H 0 `H@" ` "  `` ""` 2  㿘~Couldn't unlink rr_prefix from ifp 㿘H /e * &  @2` "` 2`` >z "` H ` "`  "H  }in6_prefix.c: init_newprefix:%d: ENOBUFSfor rp_addr 㿘  ~ܔ  &@!  >zaH z#0 7㿐@! T . ` &`  . ..$    L `  "@ @ @     ` ,# >  " "  " "   *  " "@"`&"    &8 &< @ "`H 2 H *`* &H @"`H 2  H*`* &H $ .L .P㿘 `"  "` "@ ` ` ?: "`  ~  2 @`  ` 2P @ E  >  "  2㿘 P`(, = @``"``@"H ` 2 "  ~ 9  ` `` ?"`  ~  H /e`* &`ʖ  㿘 ! `  2 P `2in6_prefix.c: link_stray_ia6s:addr %s/%d already linked to a prefixand it matches also %s/%d 㿘  "8 )>{ ` 2.  $`̐4&`2    "@  "`$ݒ 2Ր  ` ѐ  "2 in6_prefix_ioctl: preferred lifetime(%ld) is greater than valid lifetime(%ld) 8   . ah@ ag@ ad@Zaf@0ΐai@0!e@&0Ő J " 1 ˔   !g@=05 " 12 1 P. .8&<&H6J6L6 N6"&$ &($&,(&0,&40&84{&< >|`b p @ T'/$/(','0'4'8'<''''7 7"77 B 0`"( ` 2$`?? 2 * #@   H  "@"`'" 2%    1"00U 㿘> !>>!X!>|#h H /e * & > P``@  6 `D`* `D 6` `H 0internet6m_pulldown malfunction㿐@     @:>}f    2 P!   *  ֖   @:>}A    ,?  @   0 > `> $@ @)?"! $ @&@ `B :!㿘@> >c""`8"`<m_pulldown malfunction%d bytes of a fragment from %s overlaps the previous fragment %d bytes of a fragment from %s overlaps the succeeding fragment㿐'D'H@'  U   @:>}"    >!6ϐ >#? %> 4   @=   ?`8 ?"`8>"# @   , , $  $  $  $$ 6 "  D 2  `2   @| >0c> > `*@)!`B $: ""@   @Y >0c> > `*@!`B :>!`B:`>#0 > > ` *@> x`B :x> #`8cȀ @28 @  28 (@  282R > >c  "  "'a0`B :0>#0 > > ` *@c`B :c@`< D L  p@* Dc@Ԑ$ $  x$,, ?$ $ $  $$ $( $, $0 $$@$4 ?@2 $@, @"@@  @ U!`1 $,?#@  @       $ ( , 0 4@g $2@ $ ~ה  @ $`$@ 4` ,` ,`  4` $`$`$`6$`" 4  " `@$ @ ```@"@ !>}#" `` "  !>}#P7  @   >  `>7> ``@"`@ 2$ 2` ?5 % %  % $% (% ,% 0% 4% $     %%    @ ?F&r I@T*@Ӓ >?` &   @%ah`B :h>0c> > ` *@D`B :D"H"@'"" >0c4a> :a> `" a*@"a`B :a !`B : 㿘 @*'> `@7``           $  (  ,  0  4@ $O @2`@F ?$" `" ` "`     " <`8" 8`8 <"`8 8 < 8 < 8 <㿘H /e * & > #8>  "` )> '> >! ?,  8 < ` `(`B <`( <2 !耢@>> !c 0`<Bs< 0!耢@8 0%H 0㿘> `> #8@ >! `  8BR<`  82` 㿘@7>6`>"`D`6 `` `"+(\`;`"SXV`R>ԇ*@L:@G:@B:@=: @8: @4:(" 8*`0@(:0@$:8"H"@`" P`@:@@:H@ :P@:X`@:`m_pulldown malfunctionENOBUFS in icmp6_error %d 㿐>c B:c>#Xy ' (   #    2  ``Հ  2  2   2     ?' ) @ 5 :23  @  4   @:>"   `2 J@c `B :    @`2  c`B :  @o c`B v: $$В"@E  2  " 0   0& &  0       0&   0n 0 2 >#!20=? ?#  #  #  #  #  #  #  $# $  @ ? @? 2 4  ? ? ? ? c4 c+ ( (.`" *  `B ;@ Ò (0ڐICMP6 checksum error(%d|%x) %s MCLBYTES too small icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) H`'`"`>e `@ QĔ   @:>"  '2 > : !> #窐 ̖>(`B t:( >c+ @ `B :   0>c> > ` *@"L`B :L   > 0c> > ` *@" `B : ?`ʖ>"*` €  > 0c> > ` *@ `B : >"t-  €   > 0c> |> `x*@ `B :    > 0c> > ` *@ 0`B :0 cy   > 0c> > ` *@  `B : c  X`/  > 0c> > ` *@ (`B :( ":    cice- +   > 0c> > ` *@ 8`B :8 Cc沔   D   :_ T`>ݐ#p*  y  "%T4 H /f * ' T`>8*  2 H p@   $ 4 $$ $   2`$ `N$ ` $ ` 4 $  ( H  0$ $   (` $ $` ?4`@ . . c(8$ B`B ;$ ;(8@˒  f> 0ca> ]> `Y*@V @`B P:@`   1> 0c,> (> `$*@!p`B :p  > 0c> > ` *@x`B :x沔 H  @4Eu'@4Ae  > 0c> > ` *@``B :`BG> 4`@` ` 5   沔    .c@2c>R`p*  xӔ  & 4 H /f * ' >R 8*  2 H p@   $ 4 $$ $  R F 4 `C H /f#>͐* '#>aH   ڒ aH$ > !>"  2` > * 8 ?"  @$aHH 0  (  $ 4 $ ($ $$ ,$ 0   a    $  (   " ?  $  L>!4  (`( `0@! > @`4#N$ 4$  $  4 $ $ $ ,`(.  nc(8$xB`B ;$x;(8@U (b Tc]  > 0c> > ` *@ H`B :H 5c`8沔   @Iє;'@I̔*  > 0c> > ` *@ P`B :P c`沔 ܖ  @JȔ'@JÔ  > 0c> > ` *@ X`B :X ϔc`沔   @@o'@@jĒ  > 0c> > ` *@ ``B :` c`沔 v  @C'@C  > 0c> > ` *@ h`B :h ic`'l沔 C  @ p'@ ` Q`UZ>#@ ㉐㆐  "  0L`A `/ c `B F: `0 @  0   0@:>R"  'c`@   // '$ '('>','  3 3 < += , ` ` `      @:  '`р 3 ` *  * @ @>`   n   @:ڐ  ' c   `+*   2( @ Ր I   @:  '`c ` 2 2  *  @ q@` @     @:  'V?#@ J` /  0   0@:>g"  '4 >ـ" @ʒ>ِ! >*` *  Б* ?'Аc`B :c0`B :0έ : !c !`B : !T\ T xx\( ",",x`@     / /''''+$  4  8 ?"8@ g 4 P d  "P+t 0+q 0@ <@ T8"T8 ?"8h`  8'В``   Ԕ   @:>&"    @}   /ٮ /  2     " <  ,     <@Б*  8(4(,  < , ` 2`"`?``4T`    "vT` ` ">>Q O6    eE` 2``  `  ? ? ? ? 7@,  ";T`0``*@! >@# @     ` @@`̔   @@:>g"   @ 2T`>ݐ#p*  sҔ  "%T``6 H /f * ' T`>8*  2 H p@   & 6 && &   2` & `N& ` & ` ` 6 B& (H /f!>͐* '!>!H   ʒ !H& > !>"  2` > * 8 ?"  @$!HH 0  (  & 6 & (& $& ,& 0  ^& & ` (  `( 6 "     D, & >,, 94 , 4 'Ȓ`8 1 , >! >4 "8 @@< (&@ $`   & ,   8& ` &   (  `8"  ?&А@ 8& &  ,Q0 N " I should not reach here㿘(`>#t rݐ  4`H /f * ' >8 2H p@ `$`$@$`4` l `Al@`H /f!>͐* '!>!H    !H$` > !>"  2` > * 8 ?" ` @$!HH 0`  (` $`4`$`($`$$`,$`0` t``p $@`$` *``Ĕj`$` `` `(@``[@@  J@ ." `@ *J@   /@@+ @  J@ N  .2  ( ?& .@J@ ."`@*۠  . `&$` ` Y 㿘@ @  c `_\@J?`2Y J? 2T GE& 4H & 4B N`&> N9`?48 ?45 `ˀ`ŀ`%#@ 2" 4 4  @ &&&& &  㿘> #` B  `6 @ `2.`` 2 ``0@  " ` 2`` 8 "`ށ`0 "`  "``"` `   2 ``2@" & ¨㿘 > #T`  QR ` M6``C@ `2:``   @2 `0 @2.` `01 "   "  `" `   2 `ːS `0? ? "4 ``2@22 sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cassumption failed in icmp6_reflectX `' '>>!ᰔ (&0g`(آ  ( 0K 0 U  (   0< 0 F  : `(,` ?`? `(?'`'` '`$'`` `$``$` $`$ $`  04`  >  07>!<  0@x  2  2  ? ?   @2耤  :蠒 2 0 :$`$` $` $@ @$`  `,@,`  > 0H*` ,` : (44  |6     @ > 0c > > ` *@ `B : ? ` 0㔀> > ` *@?`B :?`>#ԓ*` €  0㔀> > ` *@`B :o l 0㔀g> c> `_*@[`B V: R 0㔀M> I> `E*@A`B <: 8 0㔀3> /> `+*@'`B ":  0㔀> > `*@ `B :  0㔀> > `*@`B :  0㔀> > `ݑ*@Ȓ`B :  0㔀> > `Ñ*@`B :  0㔀> > `*@`B :  0㔀> > `*@`B :  0㔀}> y> `u*@qВ`B l: h 0㔀c> _> `[*@Wؒ`B R: N 0㔀I> E> `A*@=`B 8: 4 0㔀/> +> `'*@#蒂`B :  0㔀> > ` *@ `B :릐9:|:;L???????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????;<<<=T=>$>>?\㿘@)(src=%s dst=%s tgt=%s)㿘#>!>c"2/,$ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s 㾘  `   `'` '`'`U'R>#Ԁ`L> `H@ @   @:>U"   `2 `> `B ):  ?'` '`?'` '`'`'` '`$'07Ȑ 07 !>"# `  !>" `= 0 @ q  //ߔ " "0!>0`!> `  `ؠ# 8@ ~  !>#Xؒ 8 O?$8#,"8 ?$8Ȁ !>#? ? ؠ`?@ F `?  !> kƐ 0x`(@*@+ !> hV 0c"0``` ``* ` 9 ?!> s 96? @2! *`@  @@   @    /a/!/A/`H/ /@ h (   "  @   // _ assumption failed in %s:%d p>#X ' >#Ԁ` >#䀢`뀤 瀦`怤`4 ․`@ݠ @ Y   //``'` '`'`ش''@-. À `  @ǔ >#x kP ! 4H /f * ' >8  2 H p@   $4$$$  H /f!>͐* '!>!H   ` !H$ > !>"  2` > * 8 ?"  @$!HH 0  ( $4$($$$,$0O $  ( " ?$8% 9 ? 0 6$  2`0  0`4 ? ?   $@ @ : ```,@,` ,``  ``  ,`(`(- % `4  `0 ``@   (``0 `@  (*@+Ԓ $&@ 9 ? @&@4 $$&@0  &@"$    - (< .`  *  9@&@$ a$%  @ ? " & &  >    >>"a(? -&   ?$  ` "   (  @ " @     ?&@   " "@ & &  " "@ & &   & @ <  .@.``&@$$ $  $`? ? "5` ` "5`  "5   "5  :?4`5 ` (ݤ5     @Ԁ 1> 0c > > ` *@`B :Ԁ > 0㔀> > ` *@">`B :>``B  :`  㿘> 0>>#k`@`?㿐  "9  4 *> 0   !* " P   0$"P T"T X"X \"\ `"` d"d h"h l"l p"p t"t> D>`#̐  icmp6_mtudisc_timeout: bad route to timeout㿘 2 4>#  2  P      00 "& T㿘`V ?`P>!*` €>A >; $>F 6>+!>%! >!>!>!>  4> 0>! A *TTTUUUUU(U@UXUpUUUUip6_init㿘    >>'"(Д#@ *"@ *`" *  *  * " * ">ْa: `*@@ 6*@>#  @/> З+ +`" " **"@ " *` * @  *`*  @ *`* " "@ *`* " #@ >ٔ@``2 `4S```:* `4@ >`H> @& " (>"aL@ 㿘> " !>!X>"r >|!X#m 㿘H /f * ' >Ѐ` ` """`?"H 0 `@ 0܁ip6_input: packet to an unready address %s->%s m_pulldown malfunction㿈 (?'''D    >Ȩ `B 2:Ȕ `B +:  @> "0>! * 0  >!*  @ `B ;@> `B  :> `B :D  > 0c> > ` *@!`B :!`B =!D` '#!` : ( 'D``B  <`> 0c> > `*@D` ` !`B :` > 0c> > `ۑ*@`B : !* `B : "    2  2   $ 2  `B 80`      ?#@!    ?#@      D  D D $ DD``4   !`B :` 4` D? ? ? ? 2 06  ? ? ? ? DD `06 D 4` ?  ? 2  ܦ   O>D  "D 0>c> > ` *@D`B :D ` ` @ "`  2`` `    @  2 2 > h`2D!  @B`DB ; @; u`D ##4 `  @q   c!p`B (:p $cc !x`B :x8 ?"8$c!>ڠ#@ ?  , ,  $  $  $  $A$ c(>4  #>@ 8`>Dऀ D 2ऀ !> 2  Ҍ ҉  0#Ԁ`2# ! @B: @D` t> 0co> k> `g*@c8`B ^:8 '  ~D@W쀢 RD`  G  2D` !`B :` > 0c> > ` *@D8`B :8D  > 0c> > ` *@D`B :D   0 ` (` )   (ꅖ蔒   @:>   'D`!`B :? @>#Ԁ`2 DD`؀ `( ( ` "@ #` D ("`噐   > h`D@   !`@DB:`@0 DD0D@ϒ 0  `2   2   ?#@!  1!  2.P ?#@2(P! B: D` ~> 0cy> u> `q*@m `B h: `B c:P`B :P>0c!> !> ` !*@!@`B :@!C >>!`># D`@Δ!`  * @*`@*` D!>0!!`B :` > 0c> > ` *@0`B :0D㿐 )  (z   @:>    2 &>  (  ( * `(  (U   @:>      >?`B :@% && ?length of router alert opt is inconsitent(%d)length of jumbopayload opt is inconsistent(%d) 㿐V?# @ "  0; 06? m> `: g> `>`x `;  (&U> `>`}  `  `$  %(0> '9֔$@ @@?9 &@4 >! ֚`C : $@  - &?>! Ԛ`C : $@   ?! Ԛ`C : $@    ?>`B :ؐ?㿘 @/ "- 0( >0#>`B :  ?`B :`   ` #  Ԕ ?ࠐ?x 8  `  `@    * ) &@ `@@* ``  `   7…  "  0'   ) &@ `@ 'ܒ   ) &@ `@/ . `2( ` (@w >    *   01>`B W:    ) &@ `@G (  3  <  +098@? ր 3 ` *  ` *  ƀ 3" @ <  + 0   ~ ) &@ܐ0 @א 3ip6_pullexthdr: invalid nxt=%d 㿐3 <+>#[ [3 *  * >#t bS  6 H /f * ' >8 2H p@  & && 6    D kC H /f5>͐* '5>H   c H& > !>"  2` > * 8 ?"  @&HH 0  (  & 6 & (& $& ,& 0    2   &   (  "    &  ϐ  Ĕ& `(   (   ,3 ((    ip6_nexthdr: m == NULL` 2 >"x "d? _3"<`<,"$`U2)"`(+=`L?9`H?5`ClA;@ > (eЀ&@ 2 Y?#@)?&#@  FȀ&ɰ . @@  6Ȁ&ɰ . @?㿐?' ?19991208/OpenBSD-current㿘`f ?``>"t*` €>Q#>K#>E#>?#>9#>3 >-#>'#>!#>#>#>w>#> w -uuu4vhvhvhvhvhuLvhvhudu|uuuuuvhv v,vDcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_forward: outgoing interface is loopback. src %s, dst %s, nxt %d, rcvif %s, outif %s 㿐 >  #  a  > 2,  2(  2$  2 >>@>` `B  :@!>#` "̨̫  `Ȑ 0     $>ڐ?, $Ѐ4 , >ڀ`-#?`!>`4 #` `8 ?"`8>ڠ"### L#>`B `:   t >? @  0!>?` !>`8 ?"`8>ڠ"#@   -- #% %  % $% # #>`B `}:  v # @@E>! @ B`B ; ; @@ > 0c> > ` *@>8`B :8>># @ @`" @>  #\c` `-  ' @  < &>0c> > ` *@``B :`@`<  ܀04`20 2 4`24`0" 4 ? @? ? @ ? 2  @  @ 2@>c* @ 4` ? ? ? ? 24 ? ? ? ?  4 @@&% ">@ > 0c> > ` *@">X`B :X>@`B ,:@!`8B:`8@>0c> > ` *@H`B :HH`B :H`` A >#D+  € 0    0ʐ44㿘 l> h@ ?* ?`%>! *` €@ג@ @@@s @@ -㿘> h@    M k& -0@㿘0 !k 0!j  @ @\㿘H /e * &  > >    $  ( ,  0 b0 "*` B ;b0    @  2  $ $@  2  2 `0`B :H 0`2``  < 8`h< @`p< H>t* >ߔ@*`  (: 0: 8 : :  >  "@ >   㿘V 23 - R `:`, -"* *` 2& *``> *h > 0"`l>"h"@$>ِ#h@!>!X>>""`:<  xH /e * & > t< `)>*#>a##!,`2 * @*`@  ` `   / ''''   a2ؐ`* t2`@ ޢ!@>" >4t"/ >ͦ" *````   ٲ^q 8 2 `^j 8`2``*`>͐"@$>>>2 v"`h"lH 0 register_mifx`? *` >ߑ* a `~ 0># >t #*    !> v?#@>>l>"Ȇ ` 4"Ȕ#l`* `""04004 v>. XT4 @K -H /e * & >a##` `/` '''' a1ذH 0 $H /e * &   <`8,@$`<` <`(<`0H 0>t `2t x>>ߓ*@ t*`! @  C H /e4* &  >a##` `/` '''' a2ؐ@ ``t?* @ *`2    ?* @*`@ ` 4`tH 0 add_m6fc: %s o %s g %s p %x dbx %p multiple kernel entries㿐> > b    $  ( ,  0 "0 *` B ;"0     @  2  $ $@  2  2 b0`B :'H /e * &  848 <$< @$@ D$D H$H L$L P$P T$T X$XH 0# H /e * &  b      $  (  ,  0  , { >ٮ#h 7>5>@!  2l $$@  2d "`*`2   ur 8#\ p $  $ $ $  $ $ $ $ $  $$$ ($( ,$, 0$0 4$4 848 <$< @$@ D$D H$H L$L P$P T$T X٨#h   @  22$ $@  2+$ $ $ $  $ $ $ $ $  $$$ ($( ,$, 0$0 4$4 8x48<`͓(`"@@  @  2  $@  2  2  $@[ 8H 0  H 0 1㿘  8̖      ?cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full 㿘 > !?  ?@@ ?@̐ `,.  (  $   >>@>` `B  :@!>#` "ʐ ǐ  `  H /e * &  > >         $ "0 *b蒂` B ;"0     @%  2  $ @  2  2 `"0`B :`"0H 0@M`B :  8X   沑H 0: 7      'k ( 2  Z~ 8H 0 7b            $  . ` `@  2` `$@  2`` "``2`  8X  ZC 8ؐH 0ܰ 7  (֘  >Z/ 8ĐZ* 8H 0Ű 7  x"  >"   " l   d" l0   +`+`  ((Z 8ՖY 8H 0 >> ta  >*`2  `2`ldlh +`0h c`x "0>b "0``B :`YÒ 8XY 8H 0Y 7`B :@ђ   ,`,@  $` >$`  h$` <,`,`$`# b$`$ .$`( $`, $$`x$`0  *4`8 $`# !$` 8 8B: 8YH 0   `4"0 ` "$$$H 0 㿘H /e * & >Ͱ" 5>ْh @ 1 - ,>"0 `"!x ? $x@`Y/ 8 2@@ @B=@?-@$Y  82 ˒hH 0>aX>":zt 㿘>8 t   (>ߡ*  @" >"0 0B: 0p`C >p(>ߑ*   " > `"   @2   (.      ' פ ( > 7 l d l" 0   * * (; ϰ >t>ߤ! `>> l l `*`2  `   l2` l d lb0 *" " " 0" " ""b0  hB<    ` 7`B < ` 08( @< B`C ::@h` B#>`t`C >>`>hY >!<  .`2 2 * @ :@ `A>8a* @*` @ 2(8* *  @`2!8Ø`Ó2 ਐÍ`É" 8਒`B >਒@`( B`C <(<8 @`>* t2`@ `  㿈`H /e * & 沔 #     '֙ ( g "4 `2`   //>'  @ H p@0K` @ "`  2`` ``` ` @Ք  2@`>#  + +  #   #  #  $@E#  `< d>c  +`+` #`  #` `#` $#``| 0㿘># 0>ݖB#x: 0 Uz  ! 4 H /f * ' >8  2 H p@   $ 4 $$ $  G  \>!ܖ ( $  $ 沐 i  $ҘJ 7    `  ??""@@4Ԑ `(Ҁ 2 7$  >>"a &@ *`"   *  "*   * "   :  >b02** >``hC > Q & ` `B > ` 7m_pulldown malfunction㿐>Ц `B @: @" '`!`B ;`- 0 /  0 @@̖   @:>7!8  ' 2 !`B w: /!  ge  `!B:`0b<   `!B:`0S !L '>>vB t ,8 ?#' @8/4 !(`C B8(Ѻ80,  !(BѰ8(0" `0v  Ѥ!0ԝ`v>ߓ*@ !*`@`>q '2!ip6_output: IPv4 pcb is passedassumption failed: hdr not split'@ 't  `1 ``" ` `Ĕ@* y'``" ` `Ȕ@* m'``" `< `̔@s* a'`<`  `@h* V'nđH /e * &   `"#\ ` 2 #\`@  2#\ #\  ( ;   H 0 ?6 "'0~  'p ? Ē@   đH 0 Ā  AȀ   À  AЀ  A'Ā   Ȁ " ̀ " В ( 'x  `  " 2 @ 4 '  ?@ؐ#$ 2 @  '  @0 '44И  2> X <"$ `*,Ā  2 > X *@+"@`$Ȁ  2 >| X < *@+@"@`#@̀  2 >h X + *@+@"#@̀ ", '' '$'   F'  $  $ $  $$ }* ?* " " " "  2  2  2  2 2 >!  -B: ' >>!  -B: ' $ *&X`B :Xؐ@` `'t` 2`  4  @  " `8 ؐ?"`8& `@<   --%%  %$%`"> H /e4 * &    > , #,` p`?p`,p 2 A'xtؐ |4 d 'H 0 "u 2`2 `t>  AB: p' "`t4 `@0 <`4>#`0 > > ` *@`P`B :P`3`` /` `+``4 '``0 ">`B `:>`0c> > ` *@ AX`B :X A'``?``, >"  4 , 2`> #,`"``" ``>#*` ? ?@ +``&> `4 "> >!ਔ 3`B :'`0># ֨> > `͑*@X`B :X"```?``, 2` &`2 `t>a  AB: '`@ "`t`>#`0 > > ` *@`P`B :P`>#`0 > > ` *@"T`4`B :T`4 @2#` >`B `:>`0c> > ` *@ 3X`B :X 3F'؀` @ "`  2`` `   @ϔ  2    @ G > h` 2 %   `4 `0( !t`2'@t1t ` 4` t @   tt`8 ?"`8t"t@ t@G   , ,t$ $ $ l$ t>`0aH* T ( `4P  "T`0aH* `4 ? @ ? ? @ ? 2  @  @ 2 '|>c* '|'|? ? ? ? 24 ? ? ? ? 4Ā``@4$ `*` 6 A'$ ?4@ |@-3'$ ( > ?c'l "  x$ ? ? ̐ (`;'>`0c5> 1> `-*@)h`B $:h  Ȁ 2 Ā "   , *>>Ĕ>a ` 7B: `' ,,x>#x O ! 4H /f * ' >8  2 H p@   $4$$$ N  #N @4%>!܄ ( $# x&`&` &` &`&`&`&` &` $&`$@$ 'x& 2 '@` 2`x ?6`<  A $$>*`!l" *x`B `:x>#`0 > > ` *@"p`B :pd>݀`>#`0 > > ` *@" ``B :` #& $  |@ ' 2  >p`B :p t؀` `8; ؀``8 ?"`8Шߐ܀㿘4y 7>#t Nz  4 H /f * ' >8 2H p@  $ $$ 4     ClC`H /f#>͐* '#>aH   Ɋ aH$ > !>"  2` > * 8 ?"  @$aHH 0  (  $ 4 $ ($ $$ ,$ 0  `  7$  xd& 㿐 23>#t M  2H /f * ' >8 2H p@ """2 ɋ  " ,`&  "   @ ( "   `  ?$  `(4 7>#t M  4 H /f * ' >8 2H p@  $ $$ 4  >  CH /f'>͐* ''>H    H$ > !>"  2` > * 8 ?"  @$HH 0  (  $ 4 $ ($ $$ ,$ 0   ʡ `& 7$  w ʒ@& `$  ,`,@ ` *` ,` ,``'`w~ `  "`㿘( ؒ (9  P 7&@ 2  >   &  >&  & ``3&`#t L  2H /f * ' >8 2H p@ """2 ȁ 2 7 " && p>"`` `  8)  `ˤ  2ϰ 4 >#<* € @d` 2 `>"ԓ* €!8 $  ` $ ` ?$ ` ` $ ` ?$ ` ` $ ` ?$ `@+ ` `-@# ` `% ` ` ` `  ` ` $  ` $ ` `*@$ ` @4`" `" ` "  `  ?~$ ` ?ߐ z$ ` ? v$ `H /``* !` ` $"`   p  H 0Q``"N ` 2I `B >0-0*>!| 6%,  !6T  2 , ! 6,  !6S 2 , >! 6 ,  !6S ",   ` *  @$  *`ș`7>!*` € 沔 ɫ '  '" ` `3>!*` €,  `)  `2 % `2 ! ` `2  `2  `2  `2    `2  `  2   ǩ '` $` \"@ @VH /`4 * !  !   '   ' ' ' ' ' ' ' u/' $$` `u` $H 0   $` " `" ` ` "  *  `@HTdtˀːˠ˰XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX   08ʈʈʈʈʈʈʈʈʈʈʈ\|ʈǜǼʈʈʈƤƤƤƤʄ44444LʄʄʄʄƤƤʄƐƐƤxƤʄʄƤʄʄʄʄʄʄʄʄʄʄʄʄʄʄʄʄʄʄʄʄʄʄʄPPPȸ㿘>"    " $.$ @ {J) $` ` ` Kܒ {`  a6`RN " @˒ $ p@>"'Ԑ  5I 2&@Y 7$> # ,,$?`5>"*` €.  "( >@ " >#.  V4@2$ 1    a? 2,> #,    (,     2  2  2 2  !6Q  'Ԁ ΐ ># @ Ȑ )>? ?@ > ""ؐ @F'ؐ /ܒ , $  $  $  k$ ؀  1 @#*  V4@2 1? ? 2 6  `2 `@A  2  w 0  6I  p 7vԀ c$ $  "`$_$ [  W  2  2  2 2  !6Q. >= : ># @ 4 >#*? @?@  6  `2 `@ޔ  2  2  1`"  "`  "@Js 6 -' ># @     @JZ 5&@ԁьP҈؝㿘    &&   -0! ``"` @`2`0" `` "`  ` ``"` >#"`"  -㿘  `"  "`  "@ "RJ  6  2 J 5x  ` @ @?&``"&@Ű  "  @`"  @8 ` )2@`?퀢`>#\*` €@ $`&`  ?` ? 2`2`>#@ 8      "t@@̒ `  //''' 8'쒒 "m 1` `  0@ 2c 1 2Q@] 1@ 2Y ``!E&`R "O @`"K  ` @*F `4&` @ z` &`@ (9 ` `&`&`< @*`` " ) @ ``&` @*  @2   2   2@  *@   ?@& @   ?"@`D&  شPhڸ㿘沔 Ł  9   '  ( , '8 4ğ 0$  ? ?  ? ? 2 3  ? ? ? ?  3  X 㿘 (Q >#x G ! 3`H /f * ' >8  2 H p@ `  #`3`#@#`#`  `2 D! 7#` N#` `X#`  ( 3`#`    `(& & 6 #@  & q' (&@  2   ("("<(<(m_pulldown malfunction㿐@`   ˘   @: >y"x   2 )>   2/   * @ p   @: >xې"x    >!`B  :@ !0 >! `C : $    !  * @&@ 㿈 `2ǰ >! `C : &  ɠ ?2  " >! `C : &  Ɏ ?*  . 1  2  2   2 "">      ?#@">2`  2`  2`  " `>`B :d?` 0>` `  ` `$ " > ` ` ?#@2`` 2`` 2``$  " `>`B :)?`?#`  ? # '` ' # '`$'# 3   &`&` &`$&`  06`  ?㿐>!> " X   , , , 7 , , o > ?" " 㿘H /e * &  > 0`2` @I  "& $  & $& ( @ l@9 2  & (& $>" XH 0㿘 > 0`3  >0 4  $   @     @g mld6_input: src %s is not link-local m_pulldown malfunctionmld6_input: illegal type(%d)㿐 ??  !>!8P wt 0 `@ Ė   `@:>w/!`  `2 @> `B :   >ax`4 ` ` 2 `` 2`` ?` ? @? 2` `06` `   "   2  `@( Ȥ ``2 >`0 2  `o ` @l  3 `  (/@` ``  `` `` `@R  2@2 `( @ $`($`$ ( @q@> $`(>" X@`Ơ`1`  @7` 3?` ? 2` `06` ` ` @ "`  2`` ``` ``@   2@`"`$`$$`(`? ? "6` 0 v 8㿐>`X H H /e * & $X>!<'' ` `` '' #  (  ? $ ( @ $ $$X 2 ` `` '' 2 (H 0㿀  'ݐ />ݤ#p  C ! 4`H /f * ' >8  2 H p@ `  $`4`$@$`$` N `p  CT  3 H /f * ' >8 2H p@  # ## 3    2`*0є @`8 ($`$` $@$`"`8 `8 :  `*`8* 0" 4"  8" < """"    " " "  "$  # ,, 4 4 4  ?$  $  ?$   $ 4  (  :4 @Œ > h># .` @ B8 />'/`  䀢 m> 0c > > ` *@``B :`#`` 0M40JI 0㔀D> @> `<*@8`B 3: 0 0㔀+> '> `#*@`B :  0㔀> > ` *@`B :nd6_init called more than once(ignored) 㿘>aT  >ct 0 > h*h * > +  (+b"b"  >!X#aT*`" * >Ő ԕ*eR 㿘>!H`>>D@*" 0D   * :* "aDD |*  B@H lR4 HC |$H 0H*` 3>#*`  @ <#  00* *  0H*` %"  0#H*  2 * * @←$  0#H*` "` 0 * * 0H*@ @"`㿘> 0!H*`  8 # %"  < <"  < < <;  @%8 % "#܀8""  @ `"> *"0㿘@[ (&`& & &ndopts == NULL in nd6_option uninitialized ndopts in nd6_option 㿘 2 >sӐ#P2 >s͐#p`"  2 `*  @@# (  &  & &  ndopts == NULL in nd6_options uninitialized ndopts in nd6_options duplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt 㿘  >s{ 0  2 >st P O @ђ (J?#`@  B>;@t֐ <    怢'> `>"|*` € *` >t x>& * `"&& $>`sY >!  >  rt=0 in nd6_timer(ln=%p) rt_llinfo(%p) is not equal to ln(%p) dst=0 in nd6_timer(ln=%p) 㿘> !H /e * & >!X>!>mK"c >!$!$->`/>@ ` @ @~>0 `* H  s@ L`@>"r2`>"r * : `\>#<*` €>!` 6`  $`0#H* @@$`7 8`2"   Ú 0$` 3 14`     4`$`# !4`>!`  $`0#H* @@$` @ m  @ߐ@ې a$2x`耢 "L `@:@`J`8 2@`< 2 @`@ 2@`D 2@ `8`$` 6` "` 6`P`8 2@`< 2 @`@ 2@`D "`P@@Ւ`8`P  .6``@v`H 0@p>"`#>+>'>@`" "` @@ 2` "` aL@ aL a  8   <    @   D  @ 8@)`2a 0@2@ @ $@I @$`!$@``@0` `  ` 0@ @ $2`$`$$@!`@0` `  ` 0@      $2`nd6_lookup: failed to add route for a neighbor(%s), errno=%d nd6_lookup: failed to lookup %s (if = %s) unspecpؐ@ܕ     / /ْ''''쒒 '`4$ Ԁ` `8 ?"`8'Ԁ 0Ԁ` v 2 L  '>$h > +Ԣ  !>!q Ԁ "0  L`?2` 8" 84 $$`0 ` `"D @`>!ǐ>" p  ԁ㿘 ? ? 2`  `0@"& `   `2   0   ``    2R @ 㿈     L' ' ' '>#Ԁ`2E 8>#䀢`"@ 8H /e * &   @@ T` 2 @ "> @@耤 >4`" "` "`" "@$$ "@@U"@H 0 8 $  0`"  ` 2  *`?4`$` 4 ?& 4    J 㿘> !   3 Ҕ . 4 $$) L % 0 !  S  2   >a   #   ` 3  @> 0H*`  # nd6_rtrequest: bad gateway value nd6_rtrequest: malloc failed nd6_rtrequest: could not join solicited node multicast (errno=%d) 㿀`4> `@`!`0`L "  e0"`40>` XА`0 `8,`04$  "`4  "$ `4!`4   > 8 `8c,`04 ֐  <  &`L>co 0>> d``# d"`@ڽ  $ 4  $  8 ?4 $ `4>$&`4a$a$$"a$$ " ` `@*` "'`4@ Ԑ 4 $  $   ` `9g `9,>!`> `D" &`@` ʐ?"`   & |&`D@x 4 $ $ T`4 @p<` # '  '''7`07'/'䀢`V>pd#0RQ@7%>T`4 @2<` #` '`  '`'`7'`0'7/'` ` @ "`  2`` `   @R  2 `:` ?$`"` "$ `4&`L ;&`4 "w=ݒ 㿘`4`2`@  "!` 0+a >` l`0 8* 02@># ` ` `   @  ` `@Z` >!`> "&`@default router list contains a non-linklocal address(%s) a router(%s) advertises a prefix with non-link local address `0 W 4 0!V ">!Uܰ0ߐLN00HaPd aM&aO-00J!J1!KM0@p!(H /e4>* &>"耤 2 /,"*  @'> ?&` &` ?&`  &`6` n x `.`  6`" &`$ `06`( ` $ H 0v@&'H /e * & >!LW1>ۮ* +@ "`$"`(" `,"X * `*!H L#@  020P \ +->€` 4# ,`, @ 4  8  < ? @4?  06$@r  m ۢ`* * @2 2* " , P) ',* * $ ( , 0  H( (!8 $< (`000@02 , P("Ā $$H 0װ>!H#>!D :Ͷ 0* &` &` &` &` &`  &`$ &`( &`,>!H>!D *0 `$* " А@Y $@ @0H /e4>* &>!L   8   < 2  @ 2 D @ 8@D`2 8H 0qH /e4>* &>"耢    @~ @ybH 0N`?` @`?` ''''? @? € 07‘H /e * & A 2  L H 0R&`(&` R&`$&`,H 0 !&`@D`ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdr㿘> ! >l2!Ȁ`2@>l,!耢 `  ` `        "  4 $$" L{  0`` `@ `  `` 9@׆@ @    9`.`` 9c@  `2 `    ?  4  4 ?& 4   @$ "$  "  "4 0 ` 4  4  `  24   4 㿘H /e * & >!X *`" * >Ő Ԓ \$*>c# !H>!D@ ,` ` 1 $ >!P$$  #2 * * @ى$ 㔢` @>H 0nd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) 㿘!> ! Ѥ  8 "  #   | 2 | G` 4 2`4   `8`@?@$`8`4 "+`4`0N   " `x`4 2 @ 4 2 | A " `0`4  `0 $`x " A`4 @ A @``4$2`L    `L`2 4 4 2_ |> 0H*`  2V |!>Š!jА Q  T   4T 2 T>!   4$$T 2`* 2  (4 "Y  $ `4> ?$`4a6& $ 0>!H*@ `@؞#$ @h   |(nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0 㿘"` 8 "  3 #  0+ 0( 3/ / / / / / / >`0` >!`` a@ >Ɛ!kx nd6_ns_input: invalid hlim %d nd6_ns_input: bad DAD packet (wrong ip6 dst) m_pulldown malfunctionnd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s     ` '` '`'`'`'`'` '`$' ` >ƒci 0K2  2 2 `2 ?#@2 >ƀ` >ƀ䀢 " gc( @@іl  l @@:>i<#X  `2 `> `B &: '` '`'`Ȁ`'>6cp? ? ??  07ʠ` 6>c`"` ``* ` ` ` ` 2 ؀>ƒci !>ؒȐ `? ϐ .p@? Ȑ ̒ /p/q'x'|''u  4@  0 `     0 `ϐ`@' '''`  ~  9 ? !>Ǡ  9 h@$   !>Ǡ Ph 0Z耢 U쀢 R O L@c0H -쀢 * ' #>a#@#@` '`'`''0 7ꀧ "->#Ԁ` @q0   "->#Ԁ`0@W0$ xhH !>ǐ h@ !>Ǡ Ȕ h8nd6_ns_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) 㿀 k' 9> aܐ ?  @g >Ȑ"iZ(0Y>#t 5^ ! 4H /f * ' >8 2H p@   $4$$$ + ,`ܐ _CH /f!>͐* '!>!H   i !H$ > !>"  2` > * 8 ?"  @$!HH 0  ( $4$($$$,$0  䀦`"@   "4/'/ܐ @$@ $ $"@ @  :  `*@  , ` ,@$`$`$ `  $$<c4 0 4$ $ $$,$ ,   ` (`  ^  J 200$4$ 8$<$@m  ,((.`&`?&` &` ?&` &`? ?  6` 24@ ` 9  ?@$$ @@ .`< ,` 9 ^`4 : (6`6`@   $䀢 1> 0c > > ` *@`B :䀢 > 0㔀> > ` *@">`B :>P`B :Pnd6_na_input: invalid hlim %d nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) H   '' '$'  >}`  @@   @@:>f#X  `2 `> `B ': ?'` '`?'`'`2 2 2  ` ? ? 07؀ 2!>ʠ!2؀  `>ʒa0f  0`W >ʒa`e 0ꀢ`" ``* آ  !>` `@ 0 !>ʠ!eݐ 0ˀ 9 ? !>ʠ! 9eʐ  g L`0 V` % 9  , ` 9 ]Z` ``6`@> 0> H*` !  y&` v6`2    ` 9@ @    ` V` i g6`  `2%V`  9 , ` 9] ` ``6`0>aH* > a  &`` 6`V` )2(6`  H o *@ f @@ ">@ڞ,#Ԁ` >#䀢`@@ H 06`4 ?&4` &` &` nd6_na_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) 㿀 9> aܐ ?  @g '>˒ #xf7(0X>#t 2; ! 4H /f * ' >8 2H p@   $4$$$  Hܐ _CH /f!>͐* '!>!H   F !H$ > !>"  2` > * 8 ?"  @$!HH 0  ( $4$($$$,$0 ͐ @` "4/'/ܐ @$@ $ $"@ @  :  `*@  ,,@  ` 2@` 2@` 2@<c4 0 4$$. $ $ $`$`$ ` $$: 20ݐ0 $4($ 8?$<,($.`?&` &`  &` &`? ?  6` ` @y`  ` 9@ ` @  ` 9  ?@$$ @" .`< ,` 9 [`4.4&` : (6`6`   䀢 1> 0c > > ` *@`B :䀢 > 0㔀> > ` *@">蒂`B :>X`B :X 8"  #  2  >"  22 nd6_dad_start: called with non-tentative address %s(%s) ???nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) 㿘> 2  > " "` " ``>͠!  0 ``>͖"0c' 0t #>c 2 k& 2 4>b"8 b ]  |0a  2>͠"`ܐ 0 ``>͖"0b 0F@/ $>  $ "@" $  `c$  & $ $ $ $ @| >`0>H* !X!>]!@ߒ#ST0@  g>@3X `>X2`@ @):`@@>&@!S9nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? 㿘H /e * &  > ` 2 >ΒabY 0o >Π!@* 0 `>̀2>>Π!x 0 ``>͖"0b: 0P! @  > ab/ `24 4   @6 @ >`0>H* !X!>\G!@ #R0% @ `2   @U0+0& `"  "`>"  "@1 | ?& H 0nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: %d NS, %d NA %s: DAD complete for %s - duplicate found %s: manual intervention required 㿘. 2  >ϒ`(a 0>ΐ0; 0#>Ϣ`X ta  >Β `& RP! !>Ϡ `_a  >ϒ`Ȕa| `""`>" "@0 | Ɛ?& 㿘 `  & 4  @   `& `0  2 ifa == NULL in nd6_dad_ns_inputnd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) 㿘 2 >a"h 0   4 $>!` !>Ϡ" a 0"   ]0 "ifa == NULL in nd6_dad_na_input㿘 >`ɐ#t ... ... . ..misckeymapschester:ns#83:nt#15:nc#2619:\ :pb#498000:ob#0:\ :pc#3260655:oc#0:\ :ph#2761410:oh#498000: Seagate ST1239N SWIFT:\ :ty#winchester:ns#35:nt#9:nc#1264: Seagate ST12400N 2.4GB:\ :ty#winchester:ns#82:nt#19:nc#2668:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#4156744:oc#0:\ :pg#4058590:og#98154: Seagate ST12550N:\ :ty#winchester:ns#80:nt#19:nc#2747: Seagate ST1480N:\ :ty#winchester:ns#64:nt#9:nc#1456: Seagate ST15150N:\ :ty#winchester:ns#78:nt#21:nc#5119:\ :pc#8384922:oc#0: Seagate ST410800N Elite 9:\ :ty#winchester:ns#108:nt#27:nc#6087:\ :pc#17749692:oc#0: Seagate ST42100N - Wren 9:\ :ty#winchester:ns#96:nt#15:nc#2574:\ :pc#3706560:oc#0: Seagate ST42400N Elite 2:\ :ty#winchester:ns#84:nt#19:nc#2604:\ :pc#4155984:oc#0: Seagate Sabre-5 ST81236J:\ :ty#XD7053:ns#82:nt#15:nc#1633:\ :pa#99630:oa#0:ba#8192:\ :pb#261990:ob#99630:\ :pc#2008590:oc#0:\ :pd#548580:od#361620:\ :pe#1098390:oe#910200:\ :pf#361620:of#0:\ :pg#1646970:og#361620:\ :ph#1908960:oh#99630: SeagateST3283N:\ :ty#winchester:ns#57:nt#5:nc#1689: Sun1.0G:\ :ty#winchester:ns#80:nt#15:nc#1703: SyQuest SQ555:\ :ty#winchester:ns#34:nt#2:nc#1273:\ :pc#86564:oc#0: Toshiba MK 156F:\ :ty#winchester:ns#34:nt#10:nc#815: Vertex V185:\ :ty#ACB4000:ns#17:nt#7:nc#1163:  @ :    @@: LI@@P^<@`bT U: ; ph(A: z9: z9: Ch C: W: W: > ײ3A: t: e: e 0!: ': ':  n/$Ba: z9: z9: 9Ng@!: f: f: 9nca: W: W: 9+!: ׄ: ׄ: tnsF[a: t: t: 9 !: : : tnpݔa: e: e: 9 $!:  /:  /: tnt$a: ": ": 91#!: $[܀: $[܀: tn!a: &6: &6: 9.!: 'c: 'c: tna: *T: *T: 9 s!: ,: ,: tn$a: .}: .}: 9h9a!: 0G: 0G: tnUa: 2: 2: 9]!: 4s: 4s: tnsa: 6: 6: 9;!: 8C: 8C: tn,2a: ;3: ;3: 9!: : : tn*ia: : : 9V"T!: Ĵ: Ĵ: tn{Pa: ': ': 9'!: р: р: tn-da:  S+:  S+: 9̨:!:  X:  X: tn pa: I: I: 9-!: v: v: tnfya: f: f: 9ݿB!: ܓ: ܓ: tn҂Ba: ": ": *T0ܞ!: $[܀: $[܀: +n0+_@a: &6: &6: *T1Y!: 'c: 'c: +n1Va: *T: *T: *T2!U}9!: ,: ,: +n2a: .}: .}: *T3 ܳ!: 0G: 0G: +n3a: 2: 2: *T4[2!: 4s: 4s: +n4Q a: 6: 6: *T5 !!: 8C: 8C: +n5ֵm'a: ;3: ;3: *T6!: : : +n60]Va: : : *T7{F!: Ĵ: Ĵ: +n7TYa: ': ': *T8u!: р: р: +n8oa:  S+:  S+: *T93!:  :  : +n9`~a: I: I: +:_)X!: v: v: +n:'"a: f: f: +;uP!: ܓ: ܓ: +n;&Ja: >: >: +<YmL!: : : +n<ma: k : k : +=i]<!: 4΀: 4΀: +n=H $a:  /:  /: +>ᖈ!: !`: !`: +n>D֬a: $[܀: $[܀: +?!: % : % : +n?`a: 05: 05: 8ـ!: 2b: 2b: 8ـn'`z~a: 5 R: 5 R: 8ـ>)h!: 6=: 6=: 8ـnsa: 8ـ: 8ـ: 8ـv2!: :i: :i: 8ـnd a: 1-: 1-: 8ـE=!: : : 98pn&ava: ]J: ]J: 8ـ!: w: w: 98pn Da:  h:  h: 8ـ%!:  :  : 98pnkq#a:  :  : 8ـc0!: 沀: 沀: 98pnra: I : I : 8ـwyw!: : : 98pnejESa: u*: u*: 8ـ !: W: W: 98pn+]a: G: G: 8ـ_!: t: t: 98pna: e: e: 8ـ!: : : 98pn* a: !`: !`: 8ـT_!: #*: #*: 98pnحa: % : % : 8ـ !: &6: &6: 98pnBaa: )': )': 8ـ,t4!: *T: *T: 98pnTa: -D: -D: 8ـ[i!: /q: /q: 98pnva: 2b: 2b: 8ـ?!: 3B: 3B: 98pn6ϻ !: À: À:  XE՘!: ,: ,:  XE~~W!: ': ':  XE!:  h:  h:  XE9F: N: N: Naudio0"t: I: I: Imixer0\Lw: I : I : I sound0~8 : z9: z9: z9audioctl0A!: W: W: poj*!: e: e: (oٱ!: % : % : &6o؇i!: ,: ,: -Do$@?a: : : !р ?(!: À: À: !р %{ta: ,: ,: !р |!: ]J: ]J: !рɼ/a: X;: X;: !р Q{!: h: h: !р a: : : !р ˢ!: : : !р$5a: ߀: ߀: !р !: : : !рza: C: C: !р {{H!: u*: u*: !рjɷa: p: p: !р v[W!: G: G: !рwa: 8: 8: !р ̛p!: e: e: !рʳa: U: U: !р e=!: ": ": !р_"Aa: $s: $s: !р b5!: &6: &6: !р a: ) : ) : !р l!: *Q: *Q: !р a: -L: -L: !р +!: .}: .}: !р $$$a: 05: 05: !р H!: 2: 2: !р n\ a: 5 R: 5 R: !р x_ߧ!: 6: 6: !р $a: 98p: 98p: !р ]!: :i: :i: !рMa: !À: !À: !р 1!: !: !: !рRMLa: !I: !I: "p -ߌ!: !I : !I : "perOa: !f: !f: "p S>!: !ܓ: !ܓ: "p0%a: !ׄ: !ׄ: "p iC?!: !: !: "pYŤa: !k : !k : "p 7!: !4΀: !4΀: "pa: !(: !(: "p AK!: !!`: !!`: "pGya: !$[܀: !$[܀: "p D !: !% : !% : "pmLa: !(: !(: "p :J!: !)': !)': "p\a: !,: !,: "p i!: !-D: !-D: "p­8a: !0G: !0G: "p 9kHw!: !2b: !2b: "pla: !4s: !4s: "p  p0!: !6=: !6=: "pӳ2qa: !8ـ: !8ـ: "p !: !9: !9: "pgfa: "1-: "1-: "p u!: "bZ: "bZ: "pLa: "]J: "]J: "p K!: "w: "w: "p0a: "р: "р: "p |vn!: " : " : "pma: " : " : "p !: "N: "N: "pM"a: "I : "I : "p !: "z9: "z9: "p!a: ": ": #'c w.`!: " U: " U: #'c $Qa: "#*: "#*: #'c !QW!: "$s: "$s: #'c!#0a: "'V: "'V: #'c "j!: "(: "(: #'c"# Ja: "+: "+: #'c #N!: ",: ",: #'c#a#a: "/q: "/q: #'c $S!: "05: "05: #'c$aa:a: "3B: "3B: #'c %?!: "5 R: "5 R: #'c%b\a: "7n: "7n: #'c &Ɖ]!: "8ـ: "8ـ: #'c&Nga: #: #: #'c '!: #1-: #1-: #'c'B#a: #Ĵ: #Ĵ: #'c (iw!: #: #: #'c(e$a: #р: #р: #'c )ɦ!: # !: # !: #'c)E*a: # X: # X: #'c *[!: #N: #N: #'c*lla: #v: #v: #'c +NjY!: #: #: #'c+1a: #ܓ: #ܓ: #'c ,T^j!: # : # : #'c,#0fa: #: #: #'c -!: #9: #9: #'c-ړ+~a: #8: #8: #'c .!: #e: #e: #'c.l+a: # U: # U: #'c /,!: #": #": #'c/׌a: #/q: #/q: % 0@:*!: #0G: #0G: %,0"7a: #2: #2: % 1Qr!: #4s: #4s: %,1Ka: #6: #6: %, 24!: #8ـ: #8ـ: %,2)|a: #;3: #;3: %, 3>H?!: $: $: %,39a: $: $: %, 4h:l!: $Ĵ: $Ĵ: %,4ڊa: $: $: %, 5ɕ!: $р: $р: %,5Ea: $ S+: $ S+: %, 6q#!: $ : $ : %,6Lvia: $I: $I: %, 7&6!: $: $: %,7EZa: $ܓ: $ܓ: %, 8t1#!: $W: $W: %,8EB-a: $G: $G: %, 9+!: $k : $k : %,9bɗa: $: $: %, :f!: $ U: $ U: %,:Ia: $#F: $#F: %, ;J!: $&%: $&%: %,;lja: $) : $) : %, <J!: $*T: $*T: %,<;a: $-D: $-D: %, = ~!: $/: $/: %,=y*a: $2: $2: %, >z!: $5 R: $5 R: %,>ց a: $8C: $8C: %, ?;!: $9: $9: %,?3?a: %v: %v: &&6r!: %z9: %z9: &&6{ a: %u*: %u*: &&6ϱ!: %>: %>: &&6{a: %9: %9: &&6/r!: %8: %8: &&6{īm0a: %(: %(: &&6o4!: %!`: %!`: &&6{"a: %$[܀: %$[܀: &&6Ք!: %&%: %&%: &&6{va: %) : %) : &&6'^1!: %*T: %*T: &&6{a: %-D: %-D: &&6 />!: %0G: %0G: &&6{Ja: %2: %2: &&6Lj!: %5 R: %5 R: &&6{7 ` "`=nd6_rs_input: invalid hlim %d m_pulldown malfunctionnd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) X >   ' ''c䀢 m'>#Ԁ`h  >В`` 0_ &2  `2  2 Q @@   @@:>`R (   > `B 1:  H쾐 >В`@`c 0 ` ``*  `9 ? !>Р p( `9 `J ݚ nd6_ra_input: invalid hlim %d nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%d sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%d sent from %s; exceeds maxmtu %d, ignoring nd6_ra_input: mtu option mtu=%d sent from %s; maxmtu unknown, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d)  > > 0*' 'H'@ # S' > b? @?  !>Р"J_n 0>  @@,  , @@:>_* (  ` > `B : ` 떐 6`>Вb_; 0 > 耣`''''`/`!*2 @'7' "@8` ` "` $``#2 * * @>aP$` $`` 2$`` 2,`@]̴`v r->+> 2e  >c( `>Вcx^ U   ?  ?    ^ӒB  20`@" 0  ^Ēc3 @ d  /=/<  'D 'H 'L 'P '0 2`* *` ' * 2` `*` ' / 'x @'| 2 @ *  ( Ԁ7  24 d !>Ѡ @T^w %` @ !>@$@Ġ <`^^  !>Ѡ 0^S Ĵ ` ``*  9 ? !>Ѡ! 9 ^9  ̐@yܐ8ؐ@` @\ @X      / /''''////H /%+&    H p@defrouter_addifreq: failed to find an ifaddr to install a route to interface %s defrouter_addifreq: failed to install a route to interface %s (errno = %d) Xؐ@ @   ////c0 2 4>Ғcؔ ] 0  > Ⳛ >Ӗ`0 ] 㿘>"耤 "  2  @  2 2  8ؐ@ȸ @ȴ @Ȱ      / /''''////  l `,r |㿘>#Ԁ`  >#䀢`> @ǐ >b耦b` "`" ">L  @ " @   @r`@,8 |defrouter_select: there's no default router and no default interface pH /e * & >"耤`,` `뗒 " @ L "@R  $@@``"`$`@"@""耢 $@" "`$"$``2` 耤` А@ $F 0>#Ԁ`@ $9 >#܀ > c0\ H 0㿘H /e * &      2 : .  6  & H 00=   $H 03  |)˔   H 0% @ǡ $  &  &  &  &  &  & & &>`& ""`耢BH 0 \   2㿘  |)  @j $  \ $"  \$ @p& \㿘`"  "` "@+/ |㿘>!L @2  ` `2  ݒ  " 㿘 d |)O  @ @+ d dS ` `` @ * $``$`\`( ``>`   ? @" H /e * & aLaL`$``"`#aL$`H 0 `~ 㿘H /e * &  ` "`  "H  \ " * | 2* |@prelist_update: failed to add a new address 㿘H /e * & [ g @" X 1, X H$ H L$ L T$ T P$ P X H` 8 2 < 2  @ 2 D 2  82 H ` @ޔ 8 2  H>Ւa 1[2 !`" L"  @{ ` ਀@    " L"  L" @e `:ʒ 5ϒ01 H . 8@9  X@  `@  2 >Ւa 1Z   ` * * @ H& `" L " @0 ޒ 2H 0㿘 \    g  " L "R  $㿘>!L  "4aL  -aL "7# ?#% Ԑ 2   `"  $ `@9  aL #  "   `2 @  0  #  `2 @  2 `nd6_detach_prefix: failed to delete route: %s/%d (errno = %d) Xؐ@œ    //ؔ R@ņ / (/Q    L  !>֠! `Z4  8 2 < 2  @ 2 D 2  8`` "`nd6_attach_prefix: failed to find any ifaddr to add route for a prefix(%s/%d) nd6_attach_prefix: failed to add route for a prefix(%s/%d), errno = %d x _b  !>֠#P 8 `Y * 8@  (  ,  0/ 4 /''''`@Ԛ !> `   & `# 8 `Y  8 2 < 2  @ 2 D 2 e 8  ऐ ?" `@  "in6_ifadd: wrong prefixlen for %s(prefix=%d ifid=%d) ENOBUFS in in6_ifadd %d in6_ifadd: in6_ifaddr is NULL (impossible!) in6_ifadd: failed to add an interface route for %s/%d on %s, errno = %d p-  !>ע`!` #Y@ ߰   &  >א!Z$Ұ @h `4 (`& `& & !>!< |& `& `   0 `` 2` "`>Z[!$!<  0   & & `& "%` `  &  . (P. )  0 4 @  8 <  @& 0& 4& 8& <0* @ & 04*& 48*& 8<*@& <. |P. } `8 >>  < & `@!& & $ N! !>נ! X` 0  &  0  4& 8& <&& U`4 ؐ@Ԓ  <<`0c'  7'/7ڐ'ܒ>  & H /f4`* '`  a   H 0  H 0 㿈  2V 4r?}N @0%>ՠ@Á < 0c '77'`< '/ ` @ "`  2`` ``` `@Ó  2@`"`{`  ޥ ` $````"`& ``"@` ?$` <2` $<` 2`` 2 ?  $` ?$  in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) 㿘 L>  H! >ْ`(W  @ & T& T H?@& P& P > "` `"@"@ P" ` @&"@` "`"` T `&"`㿘> !H /e * & ? ? " `0H 00>6  ( b@H p@㿘 0`" ` 2 `@»  2  4      N 0 㿘 >#@> a  "a>#.  >"#>"#>"耢`  0 8  ` `@    '" '& "S   Ր  2ѐ / ͐ 1  ɐ 8  Ő 8   8  8'''  ''''k     @ $z 2 6  1' 2`zH '` 2 4  2  4  2 4 2 4x 9 $ `   `" 0 `  0&`&`  0 `[ 7` `` 0&`R 7`? 6 (2 (c 4`4`4`B4`D <`* &   `.. @   @ߐ.& &   &  (&&&&  Y&$* `4`<c4`>p(`"(  @  c ' /'Ր"& ϐ㿘@` +>!*`   0@-$ 2@ * $㿘@! 2>!*`"  㿘 沔 h  2 H /` * !  8>aQ  H 0 7H 0W    㿘 & ` 2` `@ (  J"  2`  ` >Ra* @ ``9㿘  "ٔ  $ 8 @ H /e * &   ׯ H 0 2  >!"`  >`@ 4 R* @ 2  $_ 㿘` >Ra* @@H /e * &    m H 0 " 㿘  *`2`  >!:` `& +`0 | H /e * & 2H p@PF_KEY㿘>!  . `2  . ** *  *  J"!  '>!)>  @  !Ll 4@ 4  4?`>!` "$`#Ē J$`$` 4 J!  > !ܒLM 4>!  "$ # J$ $  㿘 > P>a" P@ "`㿘  i &   㿘  J!Ĕ  " @ >>"$ $4 "$ 㿘>""" @@@ "@ 2@@"@>b?"b>b?"b #K J `6". ` ` * ` * `" `* `  " ` "`  @" `  " `  " `  " `  "  2`" `*` 2* `"`>݄(      * `"` >݄h(        * ` "`  " ` @"`  " ` "`  " ` "`  " ` " " "tttttttttttt0t8t@tHtP㿘`{"=`0pf0m` & 4   ?& ` > @   ?& `  > X >  & ᰒ@ :C> X ?& ` >   ?&  ?;& & 8 " =& ` > H ! >& `  > ` >  & ᰒ@ :C> ` ?& ` >  $&  ; & `& <`> P`> h`> xm @  *3" I@"?<E@" 4#  " @;  " Xh `;  "-@x &` 8#  " H;  " `h `;  "@x `# P; h; x; @ #@㿘```  `` 0 JG.㿘@  ? 2 2@`&J6@`*@  ?@&㿘`%@ L* ?6!`* 6!  2 !` J& 0 L* ?6!`* 6!" 2 !` J&!㿘a  ? 2 2a 2`&`Iaaa  ? 2 2a"2`&aIaa  ?@&` ``0"2 `0" 2 㿘`  ? 2 2`*`2`&aI```  ? 2 2`*`2`&aI``  ?@&㿐  ,   *  ,   J/   I 5 4`     2 Ip*@* @  5 `"6>``0r0 @ג   5,,4$ l>"`` " @` @`2`U0A"@``  ` s@`*  `i @   5,,4$ϒ '"``  2@` I@`2`>"` ` 8@`2`@[ 6 J㿐 8  0 H L@2  P ` d@2 P  @" 4 P 4 2  @ D@2   X \@2   @" Š  ŀ   Đ  ?@     ?@ ဢ     ?@!    ?@!    ?@ J   'z &@&`Ő&`  8  H L@   @ ` d@"  4&`  4  @ D@   @ X \@" &`   &`&`  &` ! &`( ! &`, ! &` A ! &`$8  0@ ` 2  `@v@' `   DA J  㿘@` p2  >   -0# -0 > 3*@ " 2*@  " *@ " - 'H'`'P'\@ `>" 'H `8>`2@`1b ?  J  'P$ @ P -@ -`>"45`4HP%`G``P-d  '`"      d 2 rdDdP@̒P J'PH@> '` `?` >"*` €Ȑ@!@ `j /l] '`Ðp D  `ej '`  J  'P @ P'\' 'DS\`   H /` * ! ````  2 3e Ր ` S  Kz!@'P@Y!@@U  `XP ,   '` ݐb  _ $\  } y (Δ ,ʔ 0s 4o '(',pǐ '``<$ <n lP*'P$ | ( x , t 0 p 4 l 8 h   7 3 / H 0 `   H /` * ! ````  2 3eV 3  ` /   Kא!@'P@!@P@  `T ,  \ '` :   $ ޔ ڔ ֔ (+ ,' 0Д 4̔ '(',p$  '` '`PnP 'PlZPH 0'P   H /` * ! ````  2 3dے n% H 0h`   H /` * ! ````  2 3d ɔP '` 'HH 0;``> $``" P J"  'P* H ` * @$`P@ PP   *`2@*`P>"P Ea >"  E\ 0P '@'`H /` * ! > vf` H 0 ` 逢   H /` * ! >#fP`H p@`>'"'fB '`  7`'`   H /` * ! ````  2 3d  P ``d` `  2 3 c ֐ "Ԑ    `" ` ""`  `"$ ` ""`$ " H 0p` T ? d `   -`      X \H`  L H` `E A Ȱ@ 0@ 0h@  0P 2 0,  0////   # Sh /7 ' '/7 77/`''`7977/Ѝ I/7 ' ''' ' ' ' /'7 77/`'` '`'`'' '''`77/h@ 4 0Dl̐h 0 8 ?"8@ 0 2   0@ 0 2    H /` * ! u'`H 0`2T Ȓ K{   @X Ȑ 0  /h/i7j 0C'l 0C 0T `>"x*` €-,  *,  ',  $,  !,  ,  KO H /` * ! tH p@:  |C  ` |@  , } , |` `Cs  ` `@  , a , ` `    2 3 , ’ $  0 $ 0`. `4 @ **2 4 $ H /` * ! tRH p@ܐ 7 Kؐ 7 C#`4`. `4 @ **2 4 $ H /` * ! t"H p@ 7_ K 7 B`b h (E 2'` H /` * !  ` "`"8  "H  " (  ""  Kj`H /` * ! >  `$ ` "`Đ "$``$ ēH p@>`А C"`В < ?, "HWL 6'`" "``" ` @2  L iL`  ``2`@  `$`  $ $`?$ '``  7 5 73 *"@` &  -` `   *`+@ *>b(@  P># @  PH { '`P "Hu JHr J ` '`H 0`0P0<|8aes3desdesblowfishskipjackcast128hmac-sha1hmac-ripemd160hmac-md50>"` < @  ?`  ?@ p`hఀ  ਐ  ?@ഀ  ઐ  ?@ JK   @' `@#'  /`/@>7 '`7` "ࢀ`2`/` /`"@'2 2@   At`@'2 2@   Ae`ఀ ਐ  ?' 2 2ଠ2ఒ`ARഀ ઐ  ?'Đ 2 2஠2ഒ`A?'̐'  *2 ' >0 6` 6`ࢀ 2J>> T>bȐ@۔  >  @8!bА@Д  >   bؐ@Ɣ  > @ b@ >  (!b@ > P .`6` 6`c@  2 >  ( .`6`6` >+>ђ`@ >  c@  > .@6`6`c(@ >  .@6`6`>!D>+><>a@>aH>!PL;= >4=`+>a8> ==&`&`>`>` >`(>`0>`8>`@`H `@ `'`   `@ J0    34V - 26 Q -  J Đ  ?  p   '@ @ `@ `'' *@*` >*`"4"`2` #"'' .`2 $@  ' '    @ J㿘#>`@  >>>$`a8$ $ $ <㿘>N  㿐@ ``Ȩ & * 2J     >" `4 29   `0  />"h*`  `(( * @&#  * @ *`` >#̓*` €2  8 "  8  8  ̀ jh g 2  `  ( X   4` ` 2Ұ @ `@/ > 2ư   2° ` 2 `1 ( `,`?: *  2 ! (  8  vJ?`@  ?(   *  "c (  @ H @~ H @ L 8p   8l  `@ * <(`  2\    *  ˖   @ 8L `  `  6 @ 8; `  ` 2/ @8* &@* &``2   >"*` 2      0 `  0  `    x@vm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapiommu%s at %s㿘`> H p 㿘> ` `@`? unsupported cache-coherence?page-sizeiommu_attach: can't allocate memory for pagetablesbad iommu range: %d: version 0x%x/0x%x, page-size %d, range %dMB name@`>٬"!H` >GƐ 0 40@w &`0>`@&`D> `"&`D`D>!> ,"#>a@`0&`4@ 2 *@&`8 <* '' @#\#` ?NN  >c'@ >F! 0 &`@5>%>>ؐ 08P    , @`@@/`4 ,@,* @? >`<   ,`T    Ң ,@`@* @ `8@* ?@ 5 >#?`@`0& ,@%:  0$ Є&`@ :`@>`< `T  ?&`8&`< H `0" `0@* ?  "@`0 "`0" H 0 `0>@!``82`4 `2F3 4  >@`h 2'4 ''@F %>#>@$@h '`|87 @9 >̂(>>ٓ2@ H*` <b(#@0 @("@ 0 p >H`>̘(< "0@("0 4@obiovmelvmesvme㿘>    `@C`?%s at %s addr %p vec 0x%x㿘  >#& " 4> FY# 4>FU# >`  >FJ#0 㿘`> FA# interruptcountereeprom unsupported rangesobio: PROM ranges too large: %dcould not find %s amongst obio devices namezsP> `` 4>>F 0>6!@   ` >>E 0E 04  >@b 2'4 ''> 8@ @ &`< ے  &`8> @DR@ݖ@%>#N`%#+>)>@ ``ED7@:  @)A '#<7 N 4'>8->+>)>@ג@O 2@  @@` 28 $8@)  '#<6ϖ @ѐ Ԑ㿘` >> `>> b@  >>EM 0EJ 01>" 2 > $K &"@+$>5ڐ!@Z㿘` >> `>> b@  >>E  0E 01>" 2 > $ &"@$>5!@-vme: PROM ranges too large: %d: version 0x%x P> `` $`>D 0R0`4 @ &`0`@< @ >`8&`4@ $`0@ &`< ܒ  &`8> CS@ޖ`0> >" D `a4  >@b 2'a4 ''>"!>#' '6 >b''6 vmebus: no ranges㿘 < 2`4>C"x? ? -   =" @ <  8@  &`0  * * @ 2 &`0P>  ` q> `<2| > `<@"s `  '''   > $ 8. '䀢  ?@> ,@ݔ  ` '`'?'` '8` !'>@ђb  >8@Ȓb  2'>8@b 2'8 ''@'   "'耢`">@Ȑ'>5< 㿘l 㿘d 㿘\ vme: spurious interruptvme: spurious interrupt 㿘> L. >*``  8@`  >> !`4 B!>>C" "*`  `" @   2vmeintr_establish: interrupt vector not allocatedvmeintr_establish: uninitialized vecvme_addirq㿘>"`?>Aِ#2. >AԐ#@@ 2"@>>.`!> >> .`!>   2 &   >",   2  /  2>A#h@  ",&@|& 㿘> `*> ,@ &>`(>01?`?@ @ * 2@  # ֆ 2   2    @ 㿘> ,?@>#P@( auxreg㿘>!H`N>>#P`(Ho o> `>  <?8` **  <?8`** <>  <?8`**  `>  <?8` **a>X;l(2 > `0 auxiliary-ioauxioauxregmatch㿘>  "   >0>0 >">"@$`?@" 㿘?80 @ >` ?8 >  > > *`<"H>B;#>> `a0 >>#P`] no aux register㿘>!H`>@ 0H >  <@*@H* <*H 0 >  <oclockeepromclocktimer㿘> ` >`? >`@   8 8@  delay constant %d%s [TOO SMALL?] oclock: calibration failing; clamped at %d 㿘 >" Ē   @|0>!` > *`* @ *#`X@ @ > "! 9 >"!`X *  `X *   ;#  X`* >`!H>!`>!pA 0 ` >`&A!x㿘> ` V` >`? >a @3   7~ 8@  㿘>A\#X  0@%>>"`"㿘> `2>`? >aL@  "   7S 8@ >@ Ȁ`?mk48t02modelno prop: %s (eeprom) mk48t08㿘> ` >   >@X`( 2>>? 0A 8>@˒`H  0 @#>!>#P`P  `P& @ 0 @(>մ`P>#P   > >``>> "a" >  *  *`  *  >#!"`$counter-timercounter㿘>   >`? >@o ؀   6 8@  >!" >!@W`?delay calibration delay constant %d 㿐!>    ?* *   @& ?   @!0? ?>>"""" `   ?0 @ ?` ` >>"b0"!'> $!'$@9 d@`>>Ő"> :` @ d@!!@1ȁ㿘Ho o  >`    "` `?"``?H 0 `> ,>>$  P >#P  >$>g>` `* `*  `*  `*  `*  `* oclock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz statclock; using 100 Hz 㿘> Ā`!!>!X`d>?!0 d>"aВ d$!X@{"@!>>"a\ X *7  X *`7{  X h*`%>X"@@   >?!` d$X@Y>"a\#>` `X$``@ >?}! d$``>"!@?>3  `:  d@!>Д :`@4:`"   >!\>b> * "+ "@   >!\?`*`  "* " `>ّ:  #"b7  7 㿐Ho o> Ā` > X  '66 0> >"@'? 'H 0>#`@  > ` 6 06ΐ  oldclk statintr㿐> Ā`>>=p!`  > >b0 '  >" ""  "`0"  ? 'ϐ> 7>"  @ > * "  * ?"`  ;Zx0N㿘:(;`; :9 8` / /`+* *`(@ ( `.  .` . .`D @E ` ` 43   F,  * + 2!m!n >. P?@`4 * (&@& (.`& ' . (( 㿘> !Ta@ @ @* @ &  E& &    >`?"   ,R 4  6>"*`R $ `& & 4& Ta@o@’.& @g.@ <& @_ <&@ * @W & @*  @N&  @*  @E &  @* @;  &  @* @1  &  @* @& & WARNING: preposterous time in file system WARNING: bad date in battery clockWARNING: clock %s %d dayslostgained -- CHECK AND RESET THE DATE! 㿘>Y`?!`$  >=v"  ư!@ > Ā`@> ;   `@- `-,> "a !  >=I"P$!`$>@& >!, "!>@"x>">"Ta@ =$>=!"x> Ā` >  -> X`)@2> !`!> $ Ԑ  ' `,',',',',',',',' ' `,'㿈@@㿈@H'@%>ՖXH>X  *  *@`@ `X * H >ՖXH>X  *  @`*@ `X * H 㿘!T!@U!@@N..`@.@G <.`@ <.` @ .`'>2>>!m!lP`.`! "`!@   & ! "  .`.` 9 5  1 '    2mn 8  >@* (@* (* ("@㿘> Ā`5Q0=H > !!& & H 0 >       >4> & "? & ?/a `&&   "㿘> ` B  > %"@8@v 31> %%   2 #    ,     @   J @^㿘>  5 , >!`: !!>@N* :   .@>aX@  2`    @N* :  ڴ`   㿘> ` #> %>$` ! Ö $` 2$` % 㿘>> `" ""S power㿘> ` >@ΐ `? 㿘  0@  >"`> >*: Ё㿘>J!`"> `*4O"@ledleds㿘  >@!``?  `@  >  `? 㿘> `&`080 @ l &`4>>#P>"b<@>:!؁㿘 J  8@ >>P`& 8& 8>`  Ho o 8>"( ?c 4 2H 0 ` PHo o> 8"( ֪@@H 0 P  >a>X3F(2 >"D) sun4cpu㿘`@`?midsun4csun4mno%s @ %s MHz, %s FPU: %s%s, %s; %s  &`0>c@  &`LX:   @2`H &`H`H  >0} 0>0y!x>   0 >#>#>"bP@`H>`#a0`@@S>#耢`" `4`8`<@a`4!>`h@#Ж: >9ې#>>> c"X:>Jb b>#9ʒ >9ǐ ``"`H@k`H >0!xH/ /aD@{H 0㾐'p15p:   &!>ڐ "c%s: %sphysical %s%dK instruction (%d b/l), %s%dK data (%d b/l)physical %dK combined cache (%d bytes/line)%dK byte write-%s, %d bytes/line, %cw flushthroughback%s%dK external (%d b/l) 㿘>b>  9P" `"> `">"9B  $ > ,"99: >b <0> D"9.: (>   > `"c 9 :` > >`# c l :` >#P>#X  s   h9 >b T> \#`: 8`>8#xUnknown CPU type: cpu: impl %d, vers %d; mmu: impl %d, vers %d㿘> D! 8 <7e @  ""`l0= . 08" >&"`X"`"` "`"` "!X"!H"!L"!P+"!T "`l"   "` "`"`"`  ("`l"   "` "`"`"`  ("`!"!"`l"   "` "`"`"`  ("`㿘!>!`+d  "" 6y # !?00 $}0+!@  d !& & & & \!& d!0  "_^ @ !,! & & & & d& \b@ !$ @! & l& & & d& \& `& mmu-npmgmmu-nctxclock-frequency㿘@h>c@ & h& d>c @& \>c@ & vac-sizevac_hwflushvac-hwflushvac-linesizebad cache line size %dbuserr-type㿘`? >` @@a$`& >`0@[ >`@@U >`P $`@N$` `  * & * "@>6n ` * $`l$`$`>$``x@0 ! &!cache chip bug - trap page uncached㿘!  >`4 @/ >>"7acache-physical?ncachesicache-nlinesdcache-nlinesicache-line-sizebad icache line size %dicache-associativitydcache-line-sizebad dcache line size %ddcache-associativitycache-nlinescache-line-sizecache-associativityecache-nlinesecache-line-sizebad ecache line size %decache-associativitywarning: couldn't identify cache 㿘`  >a@:& >b@  2&  & >"& @) > @"b {> v@ & 4>b0 @& , `>!>%> )>`   * `2 * `"& 0>"H5& 0 @[b` 4& 8// 8& $ @P & L "x@K& D`  `   *@ `2 * `"& H>"5c& H @+& P L// P 0& < H 8  ,&  D@ 8  $& 5 >b@ & >bД @ &  `> )>`   * `2 * `"& > `5&  @b /t/r&"@o 3@ & d>c @А& \ ` >`   * `2 * `"& `># 4& ` @c8& h d/</: h& T >6M#P㿘@y Ā( Ƣ㿘@j@ [viking: PCR_TC is off]㿘 ւ>!  @ & T&!>6   T &!>"b&!H&!\ T   & [viking: turn on PCR_TC]㿘 >`T  #@2 >5 @, 㿘 &   Ң @㿘 H H:  < @&!\& 4& \& &! &!0&!,&!D&!4&!H&!L&!P&!T@&!X&ƀƠUnknownTI_4_4TI_4_3TI_MS2TMS390S10TMS390Z50 v1TMS390Z50 v0 or TMS390Z55RT620/625CY7C611CY7C601/605 (v.f)CY7C601/605 (v.c)CY7C601/605 (v.b)CY7C601/604MB86907MB86904W8601/8701 or MB86903CY7C601L64811MB86900/1A or L64801psr-implementationpsr-versionimplementationversionOut of CPUs㿘 H @>H` >c8@?`4 ` >cP@?>Б<  > ` ` >c`@~?`4 ` >?cp@r)>< % ?"?c8@d?>> 8cP@Z?>> <c`@P?>?cp@J)>>!x @2  ?2  ?2  ?2   ?2 & 8& <& @& D ` 4 2 \ & 4 \ 2   & \ 2!  & ! 2   &!  ` €`"!0 2!0  >#@ & @@ & !0 2!,  &!0!, 2!D  &!,!D 2!4  &!D!4 2!8  &!4!8 2!H  $&!8!H 2!L  (&!H!L 2!P  ,&!L!P 2!T  0&!P!T 2!X  4&!T!X 2!\  8&!X!\ 2!`  <&!\!` 2!d  @&!`!d 2!t  D&!d!t   H&!tB5010 or B5110/20 or B5210RT602 or WTL3171TMS390C602AL64814L64812 or ACT8847L64804on-chipWTL3170/2L64802 or ACT8847MB86911 or WTL1164/5MB86910 or WTL1164/5version 0x%x㿘>#`#`2``?2`` 2` `@ 2`>a4㿘>a  "aHo o>!x `  *"` H 0memregmemory-error㿘> `2    `>"0@\`?memregattach 㿘> ` > Ѐ 2">2"`2 >͒ 0 @- >" >3o"%ssync mem err: ser=%b sva=0x%x aWRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGaer=%b ava=0x%x WBINVALTIMEOUTDVMAERRparity error register = %b ERRMULTITESTENABLEBYTE0BYTE1BYTE2BYTE3memory error㿘>#( >#P>#X>`3 >>#3>`Ѐ`>>@#3>1 (memory error:sfsr=%b sfva=0x%xCSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWafsr=%b afva=0x%xSYSERR UNCORR TIMEOUT BUSERRAFOhard memory error㿘>2Ԑ >>2͐ >>!(@2ƒ`>1F!hHyperSPARC async cache memory failure at phys 0x%x%x 㿐>!8€` `>!22`>a>! " > ?"#a#!store buffer copy-back failure at 0x%x. Retrying... warning: got data fault with no faulting address. Ignoring. 㿘 + #`!>2W#>a "a>"2L> + >a ""aЂ$ Т@ a 㿐>!8€ ''Nzs㿘.3>` + ` " +{  㿘.3>` +o .` +h slave㿘``@ 2, > `2  >> `> >`@/?V`@ @      ,  '& 48@ zsattach: expected 1 interrupt, got %d pri %d, softpri %d broken zs interrupt schemeintr㿘`>-  @r$@ 2 !0 "!0>0!Ѐ>!10 >"1 >ఀ >>>b,"@">b8@א  > ">>/"`4&4b8>``L&`L&`0&h&&l"- @:& &@&@  lw>>b8l# l# # Ȁ`&@## >> # `@#  .7 >l$ >"H@ >""L&`* ( &dh`& @&@&@  l9>>b8l# l# # Ȁ`&#$# >>#  `@##  >k >"H@ >""L&`*  &dzsconsole㿘`>/]!`>>` *>`""H@ &>`"`">">"bT>""D>#&>" 㿘>   H /k * ,  '>%> )  L` ` J`<  `<, L*` >"D@ ># >"H@ >#(2 n`2 n+ *  $ l> $ @#$ $ $ i`>"8$ >`c0 a  `>#H0$  .8.:㿘  *  @㿘 @iY (& p㿘dr [א& p㿘>"  : 6 "*@ * @*`@*``L L`: "` H /e4 p* & p # cɐ   #"c %$ $ $ $ `@$ $  @i p $ p ?$ p$` H 0  p   H 0 ,`=` w `= sH 0  `=]  "$ p `= 2 @ `> ``(̐ `2 pL`6 "  p $ p  @2 `= p > `= <>ܖ【 !j"   `=    " `= p  @  p }h]$ p2,`= p =$ pH p@0#`2 p  @ p " H 0   h>ݒ`* @€ @ 㿘 * >b* .   *  L@ > h *`  €H /e * &  @ p "  @Y >!X>ܔxY   " pH /k * ,  )   . )  . H p@ p ?$ p. =H 0Zo 㿘 *>"@ .  *`@ *`@`\> h*` 㿘 *>"@ .  *`@ *`@`\> h*`   >*` *  ( (\㿘>#`q `` -` 2 8.` `\  @q  `d* "@   @  `d* "@   @  `d* "@  $`\. `p `Ā `h@C  `̑* "@   `h@  `̑* "@   @`h  `̑* "@  $`Ā "`h`?`@ "`@`h`2`` "6 > ` %В 6 % 6  㿘> ``'/ L7 > `̐ *`J`̀  *` ,  M  L  @ , ,   0.@`. '  8.@``". & .   0.@`` 8&  8.@`` &  㿘N < D  <.`. <1>   8&Ր  8.@' `2 H (.@1>   8&Ő  8.@ ` &  & D !>.`  `& H&  8.@ ` &  㿘> @` &  .@`` 8&  8.@`` &  @  @      .      ߔ.   ", N 8 ` 2  0 &] @ ` @ 0,  㿘>"P`@5zs%d%c: %s overrun 㿘> @ᰀ@ > &@ap> a+y ringfifozs%d%c: bad ZRING_TYPE (0x%x) 㿘>#ɸ `X\> h`* %@  @  >ƒP%@,$X d* @ ` 0  > y> <`` >ؐT`@<`@`@צy2`@Ԫs€n 4 "? pH /k * , > ``% ` ' ,'$" @H 0L,4 p!2 pH$D @. `t$H% 0p p `% p % pH H Pl" `@ 5<`@  4` `€ 2 ,5@,5aa *=_ A$X2<`㿘 * >b* .   *  L@ > h *`  @ 6![S & ]@ "jN 6`y@`x@ `z@<`{@  k@ "  j@\@"S  l@ѐm@" H /k * ,  )  . )  m. H p@ǰ H /k * ,  )   . )  P. H p@  #@ `2  2&!6 "    H /k* , N :  3  # ` . 6. 3  . #   3. 6 #`. 3 . #    @$   3 #    . 3. # '    . '  .  @@$  3 # ߖ   . 3. # '   ߖ . '  .  @*@$ H 0" @Y  @U  @ڒ  ) `    2@ 2 & 㿘 l> `* * *` ` *  LH /e4 p* & pM V  H   H & p?e k H /k`* ,`  p  & p % P , %  U,  >*` #  $ D $ H %   , %  <, H 0H 0l>* b(((LH4p(p" Dp"pH 㿘 l> *` * *  * `( L @`$ 2  ,@ | @, ? 4`s @& & & H /k * , <  c,`1,`%,`0"   "  @     @  `@@ ` `2 > `",`'# ,`'?,`)d D L@" @2  `4  P  ,`(,`-,`/,`2,`3 ,`.` p` `D,`4$`L $`D``$ `@?H 0 㿘` ? ?}H /k * ,  ) 4 `. )  p`  D. 4& L & D     ;. H 0㿘 0.!>  "     "     "    "`" ` `   `  `  ` `  `  `  `  ` ` ` `ޒ 㿘  H /k * ,   l@ " )4 m k@"  )  4@" ) 4* } . ) 4   p`  D. 4& L& D )   . H 0fdc360KB/x720KB/x720KB360KB/PC360KB/AT1.2MB1.44MBfdSUNW,fdtwo㿘>Д    "     2> > ""@1@ "    x ?   drive %d㿘`> (O#x 㿘@M  @  " d@> @; w@8@5 [version cmd] CFGLOCK: unexpected responseintr pri %d, softpri %d: chip 8207%c 㿈 2&`H80 @Ɣ &`H`h&`d &`h&`&`\`\&``>`x",>@a>"&`0 `0@[&`4`H 7&`x&`|&`   7 *` @ " 2 7+ `h &`h`H&``&`|&`x@ؒ   X@  X`   X>"P`" X> '  X&`tq`h  @ @ > ' 0> `y`P> 4  X' 8 8'> `> > ""@\ +>  >$" 04    >   <@ >@  >'>"'5> 'Ŗ ``' @ݒ fdprobe: %d stati: %x 㿘$ hg   * @*    & @5 @2 !>` #@"P # x @ Ѐ 2`a "@   "P@ "P "P  > #'  > %>  && > &#`   `? h   *@ 伒 : %s %d cyl, %d head, %d sec : density unknown 㿘  >  0!h  &?> &!?&`&` L&`ܓ,`" @  @ @> `0`&`&`X2&> @> #$&`@+fdstrategy: b_blkno %d b_bcount %ld blkno %d cylin %ld fdstrategy: controller inactive 㿘 D> :  6) * @ #  T  "P`& @>  <" &9H /d * %  > #$!8 2 $@0  d > &"@ʐH 00 0(& 0㿘 $  \&!8&  ` &  `"# `@ 㿘 ` $   & &  "`  "@`$  &  `&  `"@$ `&!8 ̐&`@& `$&! >!X*` > #$$ dfdc reset 㿘 h " x  *@ x *@$  x* h`  *@>"P`> %!㿘 h " L \  ߔ    L *` " ` + * ``*`*0  *` "` 2 ``*` O 0 K 㿘H /d * %   $ & H 0㿘 $H /d * %  ?& \@d @? H 0fdcresult: overrun fdcresult: timeout 㿘a " '>  x `Ѐ``$  #ǐ ? | , u 2 x>  #`(?$ ?㿘 xa ``?^  x @  ? $? | *㿘>  :` 6H * @  p: ` ` *` *  >* bL  2 ,  "  Ā " # ? h $ $ 䀢$ @7   *@" `  d d $ d $ ` d  ` $ h>2 @  ( """` dd( "d( "`d `"h㿘> >"" 㿘> >""  fdcstart: not idle 㿘 d > $I#0@J%s: %s: state %d (st0 %s cyl %d) invldabnrmlseek_cmpltequ_chckdrive_notrdytop_head (st0 %b st1 %b st2 %b cyl %d head %d sec %d) end_of_cylbad_crcdata_overrunsec_not_fndwrite_protectno_amctrl_mrkbad_crcwrong_cylscn_eqscn_not_fndbad_cylno_dam fdcstatus: weird size: %d 㿈 $>  # d #`> ``>% >! > #ؐ#0> # #є0 >  >#\ >#` >#d  @#h# p0#timeout㿘 \H /d * % > ! "& d d & d@H p@㿘H o*@ e@ H p@㿘 "&  H /d * % @mH p@ fdc: spurious interrupt: state %d, istate=%d fdcintr: spurious interrupt can't be clearedfdcintr: block %d != blkno %d fdcintr: %s drive %d track %d head %d sec %d nblks %d readwriteseek failedread failedwrite failedblkno %d nblks %d nstat %d tc %d fdc: %d -> threshold soft errorrecalibrate failedstray interruptfdcintr: impossible㿐   d>"#` d`z& >!u# \`2a & d $````"`& ```"@$a80@2H d`> Г*` €& l$`<> $`Tc$$`4`   & d, L`ܐ * @ " `  ?$ ``$` h `& d>!X> cʕ: ` ?$` h " `0@2`@C$`@@?z  $`t  o   & h    `b 2  `@=( X ? c& d$` & d& ``0B<`>!X>"w*8  $`` `@`̪`$a:` @8> ,  !: 8$`<- $`@ܒ%@ ``Ȓ@ >"#@*`H>0@ & `&  x /*"P`> #> >  `ܘ`!#\  & d& $& ڒ M _, `ߒ@ `Ґ X  ̐ R  Ɛ L   F >    怢 " `:  ŀ 25  `ߑ,@ ` ,  ` %   ` `             }  & dݐ`0>!X>"*e >"ے h `& d>aX!>"@" 2P `0  > 2 >` ( (@ @>"P`%> ($`>  <?8`* *< *0> `#>  `"<`0@"  2> 2 > D 2> t @2? l>bP  0@> 8> H >`Ԑ X`      t 4 p"P ?  & t>  ˒ ~& p p  & p & d l > `>" `!; ?  >  #& l p??& p t ?>P ?  & t>   H& p`Ѐ``Ȑ `$``Ԕ"  $` $`̀$`@H$@ \Аߐ d>!X 2& d >& & ":_ >"Ւ  & d& & X    `R  ^& d>!X*` >{"< >" h `& d>aX!>"@ f'   > >?  >"P`>' @') \$`` " h >  =H>C<HC?DD0FGTHGlGHH4hard error㿈 \a & p`耊   l   6 " h`   `耊   1& d/& d-& d "> `>" a!; ?  >  > > >  @#\#`#d#h p0 ($0$4 l & l? fdioctl: impossible㿘>`6   bA@ "@@"  `p@Jb@G 0z ">@Se e@ 0p !@"4V  `m@`q@ 0a )"=@, e g@W  !Q N L   @%f " A>  @%b: 7 @3 2. n) @4% İ &&& & &&&& & $&$(&(,&,0&0 & $ fdformat: blkno %x count %ld fdform㿘>`4`  `Đ |   2b 7  &, 2@ | $D$,$0 ```>bP* $H$T$<>  7H /d * % 3>#>0" aX*` * 2a #H 0 # :0(24&L floppy diskfictitious%s: %s 㿘>6 ` !@W@T""$ (>b$ 8Ĕ  $ 0$ , @$ 4 4 > b@ΐ !,4 HĘ  $  4$ < 84 J$ X&$ $   aW4 $ $, i4 > b@# >#(㿘>    $     0   h  ? *@w   *@Insert filesystem floppy and press return.㿘 1> > @q  # `p:```   *` ( >(L /> =%/>∬%/>, 4$ 4   93   @2 $ _$ 6@  , ,2 @$ $ +>``-?8 -0-?8 - ?$ $` --00 $ 0& @-a! Ѐ2 @ , ?$ $ @-a Ѐ 2 @`  ,` @$ $ $ +>``+?P `-`0+-?P%/> @̀sbusslave-only%s at %s %s slot %d offset 0x%x㿘`> 6#3>`\ @݆ !<: `\>)#!@>!<$#Ё 㿘> `2 2 ` D 2   & D @`? unsupported clock-frequency: clock = %s MHz burst-sizesrangessbus: PROM ranges too large: %dnameP`   ">ݐ 0i>_^@`@*!>&`0@ت ͐>`@ ?&`@ 2 4 H &`< L&`8*& D  >@}c 2'4 ''>!@ @e &`< 詔  &`8>! @ܪ@ 1>%>!0@А@  @ ' ߖ @ !0relative sbus addressing not supported㿘 < 21`0`4=#  ?*@2`&a@Q&a<> `"`0>Ր#>* `  &`4&`0 &a<=&a@ `<"@"`   0. `4&a<` (&a@`0+  *  <    `4  8@  @ ` @  #@  8@ `# `ޑ+ sbus_establish: can't find sbus parent for %s㿘`$#>   c>` >!k @z  2 $& 4& $ 4reset %s:㿘> H. @>!˒  4 #> `"  @ c  2 %s: dma card found in non-dma sbus slot %d: not supported 㿘> c@ a<: 2` >" mii_attach: phyloc and offloc specified㿀 ?> "  ` @&`$ &` P'?>#`%>#>`$䀢 `48 " 028  0.,?2( `4 '`4 '''' c8 " `$ "0`$0"`4&`$`$"4"<`( &`(  'mii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failed 㿘" > P / $ +#>!> 82 0` <2 0``  0a` " 0  X  ۀmii_detach: phyloc and offloc specified㿘" >@! ) $ % 0" 0 8@2" 0 <2 0`" 4 4"`4 4 0"@   ߀OUI 0x%06x model 0x%04x rev %d at %s phy %d㿘`"  > : *` @ "2 o >k"؁ 㿘`  "@ @`㿘 $ & 0 & , D  " 0 2 D 㿘 $   D  0 2 D㿘 $ & 0  & , D  0 2 D㿘 $   D  0 2 D!A  !mii_phy_setmedia㿘 L 2  8  4 $ "@" 0>>i `*` @  $  8  8 L 8  8 $㿘 P ` L  T 82 $  8 L 8 $  8`  L  4 8 $ 2 # !$ L  P 2?  d& P>b>!X2`@ :`?㿘 ( !H /e * &  P  ? L& P`4 $ 8 D  LH p@㿘 L 4`& 2# 4 8  $ L`4  $ 8 2  X   & X@ & Xu ?? ?㿘 P !!< L  8 $  8% `c#``c   L 4 8 $ @   P $ L 8  8 $㿘 P  ?& P d㿘 H@㿘 L \ 0@2  < ` ,@2 <`  <@ $@ 0& \ ,& `㿘 L  ,` `   B 0 ;" D, ;  D@`$ D `H /f * ' "H 0㿘 P   L @*``" A  T( @*``# A  T@  @* `#  A  T@  @*``& A  T@  @* `&  A  T @ @*``( Au  T  @*``  Ak 㿘 @BM L`  -㿘 P  d nsphy :` ( c  : %s, rev. %d DP83840 10/100 media interface㿘 >>`H  8 (>&`@>a "&`8&`H&`D&`L @ &`P`L  4`8`$> ` &`TT㿘`( `t "`"6`0d]0_``@2  Z 0^`@2   `L 4 `8`$`L$`8 `8`$0K` 4`A `L 4`8`$`L%b`8 `$`801`@2 3 0` 4`+ `L 4`8`$`L`4 `$`82 `X  $`X@$`X’ ? 0   㿘 L  $`,$`0 L `4 $ 8` L`4  $ 8 " L`, $`, L  4 8 $"`0$`,S `0 $`0H 2 L`0D   4 8 $ .  L 4 8 $ L`4  8 $ "!`0) `0    @`0 `0 @$`0 `0   L  4 8 $ @`0  $`0㿘ǐ L  4 8 $ L`4  8 $ L2  #`8 8  $qsphy :` (Q c  : %s, rev. %d QS6612 10/100 media interface㿘 >>a ! (>&`@>b|#&`8&`H&`D&`L @&`P`L  4`8`$> ` &`T㿘 ( `G "`"*`07002` @2  - 01 @2    L 4  8 $ L$`8  8 $0` 4`i0 @2   ? 0 R X\ 㿘 L  $`,$`0 L `4 $ 8` L`4  $ 8 " L`, $`, L  4 8 $"`0$`,? `0 $`04 2 L`00   4 8 $ L`4  8 $ ?`*`>!\ €`0 `0 `0 `0 @ $`0`0 `0 $`0pq@q@q@qq@q@q@q@q@q@q@q4q@q@q@qq@q@q@q㿘 L  8  8 $getxscannot allocate scsi xs 㿘H /d4 * %  1>`9 `4  !2  `` > ?4 c ` "` "H `H 0  ` `@>m!  H 0 & 㿘  ?& > cc &c" "c&   ` 2 ?# @2 0 `@could not get size p@ b  %h/#\#d#`  @W   . * *`  @># 㿀@~  ##\#d/#`   @/ 2x@~ a" @ //#\#d#`   @ 㿀@~ɒ  #  2//#\#d#`  2@ 㿀@~ c /#\/#d#`   @ 㿀@~  /`//!0 ##\#d#`   @Κ 㿘   @ ِ/ 0@  Ð09@ 2 0@ "    ' 0 0& ,  `" $ 4 0$ 4 <($ 0$ @ ($ @ `@  scsi_execute_xs: NOSLEEP and POLLscsi_scsi_cmdscsi_execute_xs: invalid return codescsi_execute_xs: impossible㿘 & , $ ?& & (. X ` "@   >0;*>08   '>#H /d* %  #> c  ` H 0 0 ?@_ ?" & ,b#scsi_scsi_cmd: buffer without nosleep㿘`d2>J!  `Y  $` \$`$`$` $`$$`$`$`0$`T  , `  * @*`  s?90 scbusyunknown error category from scsi driver 㿘 ,`;*`># €: @\?26 , 2  & ,  ?    ϐ"@    > >!   ??&  & , ?& ?  ? @ >C" zz{{{x{ z{{ DEFERRED ERROR, key = 0x%x Sense Error Code %d at block no. %d (decimal) 㿘 ``4@?  p q}@ >  `  ` i>#*` €($@"V$(U``?# @4` @%    $,c? ` ` `  7"@W?U 05!N ` K +  )2` A?``?# @4` Ӓ` π` 0 0    ?  ` @ 0@/ > ` ( `   > *`* @ @ y @>v ` ||}~~}}~T~`~~~l~`~x%s(%s:%d:%d): probe㿘 >`#H`>#X   O ReservedMiscompare ErrorVolume OverflowEqual ErrorAborted CommandCopy AbortedVendor UniqueBlank CheckWrite ProtectedUnit AttentionIllegal RequestHardware ErrorMedia ErrorNot ReadySoft ErrorNo Additional SenseP8xX(hP P ` H 0      hP8x` P 8  `H(h8`(X0pH(hP 0!!"$%&`&H&0&'0(()x*`*H*0+,,,-h/@0 00011x2P203679:;;`;8;;;;;;; p; P; 0; ; ;=>x?H?0??@ABpC`DHE(FGHIJKLXN8P PPQRSSS`T8U WXYZZ`Z@Z [[[[\\\p``aHa0a bcdIllegal Mode For This TrackEnd Of User Area Encountered On This TrackScan Head Positioning ErrorOut Of FocusUnable To Acquire VideoVideo Acquisition ErrorLamp FailureSpindles Not SynchronizedSpindles SynchronizedRPL Status ChangeLog List Codes ExhaustedLog Counter At MaximumThreshold Condition MetLog ExceptionOperator Selected Write PermitOperator Selected Write ProtectOperator Medium Removal RequestedOperator Request or State Change Input (Unspecified)Updated Block ReadGeneration Does Not ExistUnable To Recover Table-Of-ContentsSystem Resource FailureSCSI To Host System Interface FailureMedium Removal PreventedUnload Tape FailureMedia Load or Eject FailedCartridge FaultErase FailurePosition Error Related To TimingWrite Append Position ErrorWrite Append ErrorOverlapped Commands AttemptedLogical Unit Failed Self-ConfigurationData Phase ErrorCommand Phase ErrorInvalid Message ErrorINITIATOR DETECTED ERROR Message ReceivedSCSI Parity ErrorUnsuccessful Soft ResetSelect Or Reselect FailureInternal Target FailureMessage ErrorPower-On or Self-Test FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)RAM FAILURE (Should Use 40 NN)INQUIRY Data Has ChangedChanged Operating DefinitionMicrocode Has ChangedTarget Operating Conditions Have ChangedLogical Unit Has Not Self-Configured YetInvalid Bits In IDENTFY MessageMedium Source Element EmptyMedium Destination Element FullPosition Past Beginning Of MediumPosition Past End Of MediumRead Past Begining Of MediumRead Past End Of MediumReposition ErrorFailed To Sense Bottom-Of-FormFailed To Sense Top-Of-FormPaper JamSlew FailureTape or Electronic Vertical Forms Unit Not ReadyTape Position Error At End-of-MediumTape Position Error At Beginning-of-MediumPositioning ErrorMedium Not PresentSaving Parameters Not SupportedRounded ParameterRibbon, Ink, or Toner FailureTape Length ErrorDefect List Update FailureNo Defect Spare Location AvailableFormat Command FailedMedium Format CorruptedCleaning Cartridge InstalledCannot Read Medium - Incompatible FormatCannot Read Medium - Unknown FormatIncompatible Medium InstalledCommands Cleared By Another InitiatorOverwrite Error On Update In PlaceInvalid Combination of Windows SpecifiedToo Many Windows SpecifiedCommand Sequence ErrorCopy Cannot Execute Since Host Cannot DisconnectLog Parameters ChangedMode Parameters ChangedParameters ChangedPower On, Reset, or Bus Device Reset OccurredImport Or Export Element AccessedNot Ready To Ready Transition (Medium May Have Changed)Threshold Parameters Not SupportedParameter Value InvalidParameter Not SupportedInvalid Field In Parameter ListLogical Unit Not SupportedIllegal Field in CDBIllegal Function (Should 20 00, 24 00, or 26 00)Invalid Element AddressLogical Block Address Out of RangeInvalid Command Operation CodeRecovered ID with ECCMiscompare During Verify OperationGrown Defect List Not FoundPrimary Defect List Not FoundDefect List Not FoundSynchronous Data Transfer ErrorParameter List Length ErrorDefect List Error in Grown ListDefect List Error in Primary ListDefect List Not AvailableDefect List ErrorRecovered Data - Recommend RewriteRecovered Data - Recommend ReassignmentRecovered Data With LECRecovered Data With CIRCRecovered Data - Data Auto-ReallocatedRecovered Data With Error Correction & Retries AppliedRecovered Data With Error Correction AppliedRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Using Previous Sector IDRecovered Data With Retries and/or CIRC AppliedRecovered Data With Negative Head OffsetRecovered Data With Positive Head OffsetRecovered Data With RetriesRecovered Data With No Error Correction AppliedData Synchronization Mark ErrorPositioning Error Detected By Read of MediumMechanical Positioning ErrorRandom Positioning ErrorBlock Sequence ErrorEnd-Of-Data Not FoundFilemark or Setmark Not FoundRecord Not FoundRecorded Entity Not FoundAddress Mark Not Found for Data FieldAddress Mark Not Found for ID FieldUncorrected Read Error - Recommend Rewrite the DataUncorrected Read Error - Recommend ReassignmentMiscorrected ErrorNo Gap FoundIncomplete Block FoundData Resynchronization ErrorCIRC Unrecovered ErrorL-EC Uncorrectable ErrorUnrecovered Read Error - Auto Reallocate FailedMultiple Read ErrorsError Too Long To CorrectRead Retried ExhaustedUnrecovered Read ErrorID CRC Or ECC ErrorWrite Error - Auto Reallocate FailedWrite Error Recovered with Auto ReallocationWrite ErrorError Log OverflowSpindle Servo FailureFocus Servo FailureTracking Servo FailureTrack Following ErrorLogical Unit Communication Parity ErrorLogical Unit Communication TimeoutLogical Unit Communication FailureMultiple Peripheral Devices SelectedNo Reference Position FoundLogical Unit Does Not Respond To SelectionLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Initialization Command RequiredLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Cause Not ReportableExcessive Write ErrorsNo Write CurrentPeripheral Device Write FaultNo Seek CompleteNo Index/Sector SignalNo Current Audio Status To ReturnAudio Play Operation Stopped Due to ErrorAudio Play Operation Successfully CompletedAudio Play Operation PausedAudio Play Operation In ProgressI/O Process TerminatedEnd-Of-Data DetectedBeginning-Of-Partition/Medium DetectedSetmark DetectedEnd-Of-Partition/Medium DetectedFilemark DetectedNo Additional Sense InformationDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xCheck Condition on opcode %x SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %u COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d: %2d: 0x%02x㿘  >'  4 #!>'#В @ʐ ܐL`` >' ֐#L`` >'# Β  , ` @>( Ɛ  , ` ">>(  >  `` ` * *`  *  >(  HL` m` ` * *`  *  >( `  @  >(  L``>(  `@p  >(  `B    L@     L@ "  ->(  d >(! ^  ! Y ? '> `)>(%>(2 @ ! I @ F ?`   ` <`%s, Error in %s, Offset %d, bit %dCDBParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d㿘` ```  ` `> *`1>  @r06`>   > ങ(` `  @ 2 @ 2`  @  >'>'cp   >'c  @r  2`> *` !> >(c   > ങ(` `  @ 2 @ 2`   @Ζ >'>'@rP T R  N  J`F>)#Г*` € >>) `Ѐ @ >) >) (  *  ) >) 8`Ѐ @ >) >) (  *  1> * >) `P 1> * >)`hs|||㿘  B!@r"!H /d * % >aHaH &" "aH& H 0 㿘H /d * % ` "` "H ǒ H4>(>H  @2HUser command with no buf User command with no ioctl host adapter code inconsistency unknown error category from host adapter code 㿘 0`U >*!`0= 2!J >*!02 , [ X, Z ,`!*`>*# € ( $" $ $, [ , Y X 4 ( , [( >* !  , [  , [ >*!v , [x!user_strat: No ioctl physio split the request.. cannot proceed cmdlen too big scistr㿈V  >*H#8Y ` <  a >*;#PL 2 F  ( `ѐ >*+#< 2(  H #d `#\#`F !H /d * %  0" #>* c쑖  0b H 00 0& 4(& 0wscsi_do_ioctl: impossible㿈  !"Z a avau ! "g  ![v0!py `& `   &&>&&&&>*` `&& #` *ښ &L&4&8&P&D7< `h0<?# @6  6   6   @6 "'   6 @@ 'В"#\#d#`      @ /"8  2 01 0+ '    0 0 ` "`"`"` 0 " `"`"`"   scsibusscsibus at %s㿘`>,   : %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun links㿘> `2`>"!H`.&`0 2`0 6`0>,`!(*6`:2``: * ѿ  &`4>,7!8`: !>,  ѯ `4."@ `4 #!h@o `:  `?@g?㿘㿘ђ㿘 : 6 4 4, @ " :<  : & 4 44 㿘` @2 `  "@@"@ `㿘?>a(   a(.  @  a( @㿘  >(  6> (. @ 2 06     ?`&,  @6(      @4  @` @ 8: 2@@ ` @ """   """% \ @_* @ 00* @ 800* @ 0*\2** * ߒ`*1.14UJDCD87301.25CD-ROM CDR-N161.70CD-ROM CDR-S11.08SANYO CRD-S54PSANYO CRD-254PSANYO CRD-256P4.21NEC CD-ROM DRIVE:2731.0gMemorex CRW-26421.02MATSHITA CR-5741.00GCD-R580Bq01FX320SAC101CREATIVECD3630E1.07CR-2801TEVER 2.0BCD-24X 1997-06-27VER 2.2BCD-16X 1997-04-25SW03DALPS ELECTRIC CO.,LTD. DC544CSENASUN V1.9SuperVista S-12 AT3 1.60 ULTIMA V2.9Astra 1200S UMAX 1R08IS60 RICOH 02.2Model 3200 01.7Model 2600 02.4Model 1300 WangDAT 5150ES SCSI5099ES SCSIWANGTEK Python 28454-XXX2.2GVIPER 1500 21247VIPER 150 21247ARCHIVE TDC 3600 TANDBERGSDT-5200 3.SDT-5000 2.09SDT-2000 EXB-8200 EXABYTE TK50 TZ30 CP150 CALIPER 0001SD120S-200 NEC FC-1TEACG0661467ZIP 250ZIP 100IOMEGAjaz 1GBiomega6027MK538FB ST34501FC ST19171FCST296N ST296 ST157N ST125N SEAGATE RO3000S RODIME PD210S SUN0207PD1225S P105S 910-10-94xLPS525S ELS85S QUANTUM 0307D3847 SnapLink MST LXT-200S LXT-213S SUN0207LXT-213S XT-8760SXT-4170S MXT-1240S XT-4380S XT-3280 MAXTOR DFRSS2FKZ-CH3171-S20664IBM0663HIBM 0662SIBMRAID CP16CP15DK515CHITACHIA00MD21/S2 ESDIEMULEX RZ55 (C) DEC1588-15MBSUN0669MICROP 3.30MOS321 DELTIS 0800M2513AFUJITSU3.08OMD-5010 EPSON CD-ROM PX-40TSPLEXTORCyberDrv1.55R2626 JVC 1.04CD-ROM DM-3x1SShinaKen1755XM-4101TASUNSLCDTOSHIBA 1.10CD-ROM DM-XX24 KTEXEL 1.0BCD-ROM CD-56S 1.06CD-ROM TEAC CD-ROM CDU-8012 CD-ROM CDU-8003ACD-ROM CDU-561 CD-ROM CDU-55S CD-ROM CDU-541 SONY 1.01CD-ROM DR-124X PIONEER CD-ROM DRIVE:841CD-ROM DRIVE:5011.0CD-ROM DRIVE:210CD-ROM DRIVE:84 CD-ROM DRIVE:83 CD-ROM DRIVE:55 NEC 1.3CDR-H93MV MEDIAVISRENO CD-ROMX2A MEDAVIS 1.0bCD-ROM CR-5XX MATSHITA2.06CDD521/10 IMS C4324/C4325 HP VDRD-25X DENON RRD42 (C) DEC DEC CD-ROM CDS-535 CD-ROM CDS-525 Chinon CD-ROM CDS-431 CHINON %s offlinescsibusprint: impossible qualifiervendor-uniquedirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicesscsibusprint: impossible device typeunknown targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sremovablefixed`>0#      ` `@2  `  >0>0 >0 >0>0 #h>0#>0_#>0#hc؀`0 `+>1",` €>0%#>0"#>1 >1 >1 >1 >1 (>1 0>1  8>1  @>1 P>1- h>1 А    p   >1 `#\#`#d>1 >1 #h #l} Ÿ $HHH0HHHHHHHHHHHHHHHHH$@X$` $` !>$` >$`a$`$`$` !H$` $`4`4`a,`@j  2!H<  * $*  X>!] * $* X  2X   >1cp @iv >1 cx@iq X2 X>1cp @ih >1 c@ic X>aL t@       ` 4`  2 ` 4`  ` 4`쀢 X`` 4`X ` X` 2  4`X ``,@ 8 *@6 8   ,`` 4` X @5  `  `0+`0 ` X    X'>,#@'  . 4.`@>1#  $0 g >1a#) 㿘 2 '5 @ 2-`2)@h`` @id 2` @h `  @iY 2`@h@` @iN  @@'ϲ@x@i 6 U ///#\#d/.`.@#`8 x\@h 6 Z(///#\#d/#` cdNEC CD-ROM DRIVE:260㿐>`p  x 㿘>&``  `$``$` 4` > \`0`&`&`X@`"  `2`` &``"">=>>"#@&a\>3! 㿘H /d * %   $'>9)>> $ $ $0"4h"0o. $2$H 0  x*`>8>3#ܢb@x 4 x `! >9>3#ܢa|@!  ! `( 㿘 0㿘 > Hѓ2`  0}    u h ` + i ! d k! ^``4` L! 2J h`   4`@0 8   @   !&  `6+ . @ `# "  `  d d *@$ d *@$ ` d ` @ $ h0`?# @4` h   !`?# @4`p㿘 : *> H& D  0>  W05"  `  d d **@$ d **@$ ` d ` $ h Ē 輔!@ #?c 2 `!   Ĕ  Ēb 2f# 㿘> G H2` 2  ?& 4 <(@i|  6& 4  `` .& 4"0 < G !"@    @ @ $ 5   2w 㿘  0` `@ 0`<"@ 㿘> G H2`  "  ( <*`" 4& <`㿘>4>5#8#, ˑ㿘>4>5#8#, ˅ 㿘? .!!@h.@!@hO@h K.@hH K. *  ( ` (("  ?jX  : *> H"   2  ` ^ !@"Q`$c@"K` !@"E` Ec@Bc @ p@"9` c@5c@ 2`0.#  `m@"(` #@""`!  !@  # 0 @"``q@ `0!@2@2`    @"4Qc@1)c@"!\c @"!\!@_ t c @c@ k c@"G c@Ec@ ] c@' c@ ;c@c@ J c@ `p@ `s@q ;  #@"!\2 #@ "!\# e e@ "e  r @ ! @Y #@  @ "!\# @l   `m@W`q@ޒ   e`g@`f@G  h@"8  #@"t!\  !@  0#@"r 0#@0#@ ؐ 0 @2@ʒ ΐ   @ 0 5!0Β & !"@ *  @& 0   $   @   $ 0` € @` € #\@` € @ ,@@D sˑ*   8g   @P ]  d ?# @ `*`2 @7 0J#$ T # = @&  '```"  !?#?*`@  &@  `$@   * 2` 2`*`  d ?@# @ `*`2 @6@@?8>    #$   @Ӛ @ , `$`?# ` * 2` 2  d ?@# @ `*`2 @6@@  ` 8`&ǃ 0!\@ !\    @     !\@     !\@     y@     o!\@     d@  `@ [ 䫔 V  䥔 P 䠔 KV "E !A2 { < v 7 @ n / 0,2?#ϒ @&2@"!\`@R@ !"@    )ATAPI CD-ROMSCSI CD-ROMfictitious㿐@bߒ!@bܒ"`Ƞ d &(&0&,`@e d &4&8`Ĥ  ?b  >9`ؐ@bX  >9`@bQ  6>9 `@bJ` !W  &&!,&<6H6J&X&&<6 &6&.@b    @ "@``|`,    Ġ  @z l`Ĩ  d   *   *` *   * *`  *    @>  `   d    *   *` *   * *`  *   2+` +`""#` "  ` 00  ?`@$`Ā ?,  @b ? *  6 6   *  ! >4c8@p(" & & h2; ̠ @a  h %/#\#d#`     2% * *` *  aa(& * *` *    c8& "&  ́x @a Ô@6`6`6` E6////#\///#`#d   ۚ h@& 4$ А@ " 4Ҳ@ &.`.   #\  @  x\ @a_   G/#\//////#`#d   㓚 x @aD Ē K'/#\/#`#d   ~ 㿈 Ē'Д"#\#d#`    o x@a   B`/ / 7` @( //#\#d///#` M x@`  C`/ / c7 (/#\#d///#` - 㿘   ښ 2``#  +    ˚  㿘Β   ? `@` В @`@` ><!*` € a0  (//#\#d/#`  ݚ   װ 2 .`` ē*``0  (///#\#d#`    ʰ `I ` ē*``0  (///#\#d#`  ⤚   `-``* ě2`!0 2`2` ////#\(///#d#`  ⁚   Ԓ`2 2  2  .` .` .`Ք 쟰 0{` ē*``0  (///#\#d#`  Z  d װ _.`` *    ///ђ/`s  a0#\#d#`  7  A $ ` *    ///ђ/`S  a0#\#d#`     .@  .@ ` ĕ*?0 //#\#`#d       h\8| @_  T@_@ Ēa0`  T(///#\#d//#`  Tʚ  M` @_y ??(*? ?(*` +`?*   ?@?+ *? `?*? @ ? ?3    ` 3@2 2`  23   ` ` .@.`.`.`.`.`.`.`.`&` &`&`.`  ` p@_-  @_) `a0@  (///#\#d//#`  [   .`.`p@_ (@_` ē*`0@ ( (////#\/#d#` (0  `X( 㾸@^ْ ( @^Ր @a0  (///#\#d/#`     ()*  `&``*,  p@^ (@^ a0@  ((//#\#d//#` ٚ  *  &``  㿘@` >=#,*` €Ӓ=a   ` |cd_scsibus_get_mode: Mode page %02x request bad size: %d bytes 㿀 >=#XF @^. @^+ B b  (/#\#d//#` b cd_scsibus_set_mode: Set mode request bad size: %d bytes 㿀>> 8  @].@ b  //#\#d/#` , P     ``/ɔ P    ////ʖ P t   Ű .@.`.`.`P  ^  ` `/`@/////˒  l08p b #\      //// \ p b #\ ؖ k    .@.`.`.`P b #\  Q  " N #\ G  ɒ@` `/` / ͔  Ę //  x @] Ô@ /#\//#`#d   I ch02009000SPECTRA㿐>`ܔ   %s: waiting %d seconds for changer to settle... %s: offline %s: %d slot%s, %d drive%s, %d picker%s, %d portal%s s㿈>&`0` >?"2 "̐ @`d`>? `d*"@ *`" *  $* >!H@ >?!0`,`8`L>?!@`>? >?!x`T >?>? !x`H #\>? >?!x#``P #d>? >?!x#h`8&`4㿘>  " ȑ* @ 2 00`   2` 0^ 2  0@3 2 0 ? c 2 >Ȑ * @?0` 2`㿘>`Ȑ* c  # #  ^  #"Q#"?8#"+8H0 #"(HA0 # #40 #"-0@0 ,@~ (@ $4"  "?@$8   44" "H"L"P" T "@뒒x@ 4M `4I +  H`?@4A * ` ?@ X8  @ :  81   `` ` @[@  4, ,``4 4` 24 4`//////`/ / 0ab#\#`#d   ݴ x@`4l `4h ` 4d +` H`?@4\ *` ?@4U + `?@ \L  @ : "G  @ :  8@ `  `` `@ @[(  4, ,`,`4 4`4 24 4`4///////// /`  / 0ab#\#`#d   C x@ * 0  H `  '  :` @Z  4, `4  +24 ////쀋 / / 0ab#\#`#d     %s: warning, READ ELEMENT STATUS avail != count 㿘H.`  S   $8 @I$ ;` ` ` *  錐 m   @0 "` ` `*  >A!  ` -@ `@!`; `6 x @ZQ 0a6`67  7 (////#\///#d/#`  %s: could not sense element address page %s: could not sense capabilities page h@Z ؒ @Z#p 0` h//  //#\#`#d  F  >AD#ߧ, ,,`,  @  +((+`   @ % T% 8% H% <% L% @% P% D@YΒ  @Yː  0`////#\#d#`    >A#ǒ 0 X@Y  \@Y  ,@ , $  0 ` 2`㿐>a& d  I `& dsd㿐>aX  4 %s: %ldMB, %d cyl, %d head, %d sec, %d bytes/sec, %ld sec totaldrive offlineunformatted mediasdattach: unknown result from get_parms%s: WARNING: unable to establish shutdown hook 㿐>&`aH `0 .a\$`$``>D&`X`&`E@`" >H#X>I!0&a|`" >B `2>B` &`>B%"``   >!H i a]`@ af`@ aw` @    a|>aH`Ƞ`>B " ">B  >B0>B0 !>B"@[@[#\ܚ0 ِ#0>BՐ#0Z#(А">G!0 &a>B#PŒ 㿘H /d * %   $)>9+>> $ $ $0"4h"0_T $2$H 0  !x*`>8>C#`b!x`sZ !x a 6!>9>C#`a|a`sC a (!  㿘䯐 0㿘 >!02`  0  ?  h ` 5 s 7! n` 2 ` م! c``4` e! 2N h`   4`!|@  Ȁ 2 7  @  !&  `6+ . @ `# "  `  d d *@$ d *@$ ` d ` @ $ h⛐0`?# @4` h   !`?# @4`Ȑ⅐㿘 : *>!0& Y  0H 䩰 "A"  `  d d **@$ d **@$ ` d ` $$ h "  !| €  Ē ǔ!@ #?c 2 `!   ϔ  Ēb 2q. 㿘> G!02` 2  D& 4 <(@Y  ;& 4    `  1& 4 .& 4"0 < G !"@    @ @Ð $ E |  2m 㿘  ` @ ?"` 0 `0 @ <"@ 㿘> G!02`  "    ( <*`" 4& < `㿘>D>E# #L 㿘>D>E# #L { 㽘   : *>!0" ๒ 2  ` .  !@"!` !@"`8  p !   q@ "` m@ ` 0!@2`      `m@"ze e@ ";  `p@`s@$`0 r@& !@`0 !@"pV `q@c  h@`0z e`g@u`f@ r0  @ 0u@~ 0n!0j & !"@ *  @_&K 0⃢ X $   @ 2  e g@2 4 *  ! >D c @   h$ 05"4    -$ ?*$  @ ֖ " "  !22 @`   ^SCSI opticalSCSI disk%s %s㿘@U!@U"`&(`&0`&,`&4 &8 d&8 6a\` >G>G`@T a]`@T a]@Taf@T   >G` $`ؒ@Tq `ؐ.( 6H6J2` & &<&X&&&  aW6&&. 6  `6*` ! >Dc @|㿘  !| € x@T  @T 6`6`6`  //////#\#d/#`  ͚ %s: ..is spinning up...waiting %s: removable disk stopped - not restarting %s: respinning up disk %s: respin of disk failed - %d 㿘  4`?  ` 4 ? ( ;?  7 3  >G R"㺐#@%?$  ` ` >G>G">   8"  Ղ  >G"- ? 㿘> !0:  ޶ ,`0?$ h*@ 2 Đ  2? `,  `"(? ߓ2` `  ' 2?ޣ㿈'>   "b>!0:` * $& !0*@ (@U R @V.` @Q.     @ >? = !7@ @S 6` *6`6`6///////@S   @&  #  & & & & & p& (& & ,i& 0& $@€  $  _(*``  @*#%s: strange capacity descriptor byte5 0x%x @ @S< Ģb  # /#d//#\#` s  M  `  " `  >H `>H `; #`$ 6 *` `*  *+  `*  @ 3`  @ .&` &`&`&`&`&@ Ę#\  &   ѓ*`@ * ̐ &@&`&`&`&)L㿀@RҒ , @Rΐ cp   //#\/#d#`  , P"&`  ӓ  @R cp  ? ///#\#d#`  ,   ʑ* ˓*`  &` &`  @ &@&`@UY(&`&` %s: mode sense (%d) returned nonsense%s: could not mode sense (4/5); using fictitious geometry h.&`!\`Ȑ}  + ґ* ֓*`א ؕ*ӗ*ٔ   &``&@?&` < 2 Đ"&`  `&`@& @TL&` O " ґ* *`ܐ ӕ*ؐ &@ٔ &` &`  &``  &`` ' "$&`   `@` >I>I" >I" >I" Ȓ @ 6 "&`&@&`&`&`  %s: WARNING: cache synchronization failed x @  "`!@QÒ aba 5/#\#d#`     >J!  0  @& ????5150ES SCSI FA1501 AT4000s HP 263HEXB-8200 EXABYTE Model 1300 WangDAT 5525ES SCSI REV75150ES SCSI5099ES SCSIWANGTEK VIPER 150 21531VIPER 150 21247DMT780 ANRITSU CP525 SANKYO VIPER 2525 25462ARCHIVE TDC 3800 TDC 3600 TANDBERG st㿐>bX  ֘ %s: %srogue, drive empty density code 0x%x, %d-bytevariable blocks, write-%s protectedenabled㿘>&`L"H $ $ 4 @L>K (`X>K`` 0>K 8>J#  5>Hߒ`  >KH@Ӓ` "`d>Kܐ @a>Kא P```>K>KА h`0̐ p`0>K` >K >K  a&a&a&a ?# @4 㿐> La S  & X& h& 4@& @㿘 X  l  @P @ ,@ h@`" $ @ ,@   , @ ,@   %s: already open 㿘>"4  : H "4*@ 2 L0@:` ` >K#W 5   E $` 4`%  D`2 0 @֔  0(`@Z$ D`   0  $ 0 @Ô `?# @4`㿘>b46  < 0 a`  @   " L    L   L @  L  `2  L @  L @  L? c 2  %s: cannot set selected mode 㿘 >b4> * >  0 h Lf ,``@$ 0*  l@ h $ 4 @  T Ю 4`"@$ I"@l @@ ; @  *  t, < d, < 0 ?$ 0   @J  0*  p@$ 8$ 0@ >L Э!@ 0 h$ 0 4!Ph 㿐 0( L @ @ @є @ Ћ!@` @ @ 0? 7& 0  @ 4 L" P0`"0"" <T2 <0"82>MH(0`"0""8""8`"04 `20`0"0`"80"8"0 < 4 0&000"0 4444\4\4444444444\4\4\4\4%s: bad request, must be multiple of %d %s: bad request, must be between %d and %d 㿘 G>:`"4*` < @  0 " P 8@M  8>M 䢐!   T  >M 䔐!Ȓ & 4H /d * % & $ `( $& (`("@"`(H 00 0(& 0 <U& @%s: not queued 㿀 L` ?## `  4`˔0!  $` ("`(&! (" 0h"`` `` @4` 0$ 4 <$ 0T$ @n` 4`"" 0 0@  @ " 0 0 <h$ 0$ @T$ 4T`  0$ 4 < 7$ 0$ @ 0   0$ 4 <($ 0$ @ 0 T& 0:` @M  0@  0 > /& 0% /( 0   / 8@K <2  <2 2 /// H <# #\#d#`  >M#0ɒ ` 2j`㿘>b42 <`L>M!` 㿘>b42 <`L>M!`  㿐 >b4:* a: 8  <@   a@a@ 0 !@7  @i @M` 8 6 8& <& p& |& &  &$ t&( &, &0 &4 0`" 0 6 0(" H 6 H6 J64 J4 HV`o>O"*` €@9   @_ &@  @   @O   @   0 @[  @U ~ @- v Д  0*@:$ 0 0 5$ 0@e c`2 P 0 ?`@  T  @ T  T@$ 0N  0 $ 0 0$ 8 $ 0`EC  , <  =  L܀6@ >L!Pⴒ , <$ 8 0 %$ 0 0 ?!$ 0   V   ,`0,` 8*  p"@    <* * t  * ;<;<@<<<=<=<==4=㿀2 @L[  0 `/ 8 `/@J*: 22///66/// Lc #\#d#` w x`L  % @L  a0h /#\#d#`  Y   * *` *  $`T$`P0 @ L @K a0 h/#\#d/#` .  &*`** *@  @  & \& `. d 0  0 ?& 0 @ 8  40 @ 4 ` L"7 @K  /@K/   03 <//// 0 "  @ 82 2 /// @ !0#\#d#`  㿀@Kq  `/ 6/b /c  L #\#d#`  ͢ 㿀"# 0 8`0B 0"0>`4 =9`     " 0I 0""' ? =  `4 ?߀`6 0 ?& 0 0  ?& 0 0"` =& 0 ` 0   ?& 0"  ?& 0` @K  L66`6` ///#\//#d#`   =  㿀`( `  0!"! ?& 0 0 =ϐ =& 0 @Jؐ L6`6` ///#\/#d#`     㿘 0 %$"  %  & &` 2  N x`  ٖ 2" 4  `2 @  @J L6 /#\/#d#`   ̿ x   0 =& 0@Je  L /`/!06"#\#d#`   ̘ %s: block wrong size, %d blocks residual %s: %d-byte record too big %s: bad residual %d out of %d 㿘  4 4 0   7 7 * *`  *    $  p2? 0 "L $ 8 & (  @ ` 0 $ 0 ($`@  ` 0 $ 0 ($`@   ` 0 $ 0 ($`@ "  4  2 4>Q#X  4 "  (  2 ( 8>$ 8 ( $@*;  0 2T  3`2L$`@M & (  @2H  `C =`<     8 >Q"#Ò 1  `   `>Q# ߶$ & ($`@   2? 4 "  0  2 0 8>$ 8&2 ?"$ 0 $`& ($`@ ?㿘$   6 t '$$`8(`82`0`0    ?$`0   ٔ $ 0 2`8   genericFujitsu M3096GM3096Gm FUJITSU UMAX UG-630UG630 UMAX UC-630UC630 UMAX IBM 24562456-001 IBM Ricoh IS-410IS410 Ricoh IS-50IS50 RICOH Ultima A6000CA6000C PLUS Ultima AT3 AT3 1.60 ULTIMA ssC5110A C1130A C2500A C1790A C1750A HP 㿐>`ؔ  ^MUSTEK㿘>&`4`Ȑ "2 ">S b@HŔ  2@ d>S a@H  2@ d@  d$  `&`&`<.`N.`O.`L&`86`@6`B&`D&`H.`M&`&` %s: %s %s: generic scanner 㿐>b  @  >S`&  $ 2&  >S `". ^@T 0  P#!>"p@H8 , . ^& ܁%s: already open 㿘>  :` 6& ഑* @`2`4    >S#'`  !! ? # @4    4 㿘>`6  <  `" 0@   0$ P ?$ 0 4? c 2  㿘 G>`: *  4` 쀢€㿀>`6  <`0 #>T`䀢`@ "`00  @G  //`4c#\#`#d    `0 $`0>T>T"4! 㿘 G>`: *  < P 8& < < H /d * % & $ ``( $& (`( "@"`(H 00N+& @%s: not queued x 4` C?a#b`  4`ġ06 3 $` ("`(&  (" €` @G8  (/ <(2`2`/// H <#d#`#\ m >T"2 ` 2`㿘> 2 `< # : #( 5  # # *  耢` 8@ ( 8c (0# € @0 ` -@  0 ? $ 0  -   4֞0 4@F  $ 0///@F/ ` `2`// (// 2 2 2 2 2 ܳ2`55`22222`2`////////////////////`   "` / `   8 ` " ` / ` @  " `/ i4/ g // %/ " / /  a  ' `"  ` * * @* @ ' `$"` `2`// ` 0`  (`c#\#d#` N 㿈 2 4`*2##\#d#`  3< 㿈 4 *0` h" @ i g  2 2  *1 2*2#\#d #`  6 h 4@EŒ a" 4 (//#\#d/#` ؘ  >T" * *` `<  &`< %s: MFS-06000CXMustek 6000CX Flatbed 3-pass color scanner, 3 - 600 dpi MFS-12000CXMustek 12000CX Flatbed 3-pass color scanner, 6 - 1200 dpi 㿘>V . ^ۂ"`>V b @E 2` >V. ^t"0`>V bp@E > >V. ^f">hh& & &  & & & & @& 㿘 0 " ` @N "`  @Gd`$&`  @G^@$@&` @GX`$&@@GR $@ [&` #؀@U`S!@8Y `!,  @G8* 2 $` 6`!,  @G-* 2 $`* 2 "U06` *`2 26 ` @Cj?$? H!.`` @C`?$? .`` @G$? P .``   i4  g6 ^   ^.`& 8. (@ 㿘 \ӧ X`<2 @F$&`<P 4@ؐ@D   //ܐ@D  D @Gf/Ȣ H@Gb  8@G^ @ <@GZ c4`4 42 ///#\#d//В///#`  Ƶ  2 @Df  / /@D]/ @ a,/ @G) /@B֒ d / M @B&? N/@B! / O @G/㈐? p//#\#d/#`  w  2B@D(  @  /,/Đ / L " h" i g   # @ H PĐ X/##\#`#d   ?  2  <@v   㿀 P  4@C # /#\/#`#d      %s: not queued 㿀 4@C’  \  XҶ/`<2 @F`H #44(//#\#d/#`   >X!`ٳ 0 T"& T`< P" & P mtkrdymustek: lines actual(%d) != computed(%ld) mustek: win-size actual(%d) != computed(%ld) x 4@Cv   #//)>X'>X(#d#\#`  Ū  2:耢  ` >!X "8($* *` * T@  >X"@2 P !>X"p*? 0 `  㿘 L "  i   6 \4 @ g 6 \ @  8@E$ \ & X` ?` ?& X B <@EҒ$ \& T X2 & P %s: C1750AHP ScanJet IIcC1790AHP ScanJet IIpC2500AHP ScanJet IIcxC1130AHP ScanJet 4pC5110AHP ScanJet 5p set_window failed compute_sizes failed 㿘>Y . ^Ґ `>Y `@B  2` >Y. ^Đ `>Y `@Bߔ  2` >Y. ^ض `>Y a@Bє  2` >Y. ^ب!`>Y a@BÔ  2` >Y. ^ؚ! `>Y a0@B  > >Y. ^،!8>!!&  &   &  &  &  &  &  @$& >Yr!H0 @   >Y>Yh!`0e!x%s: set_window failed %s: compute_sizes failed 㿘@(`  @ #؀@8< ``@ !@82 `?* 2 !,8+ ` c !8% `   " ^  ^.`& 8· (@͒ >Y #P@ >Y #hל *f0S%s: trigger_scanner failed 㿀@ >Y#P@ ">Z>Y#h  `7'@A@9 >Z  h`%s: not queued 㿀 4@A `<a`H22b /(//#\ /#d#`   >Z!x״ 0`< P" & P 㿀 @A 4 a66 ///#\#d/#` Ț 㿀 @Ay 4a66 ///#\#d/#` í *f%ldP*f%ldQ*f%ldX*f%ldY*a%dR*a%dS*a0T*a0I*a3T*a4T*a1I*a5T*u2T*a%dG*a%dL*a%dK 8x>Zc2{ <>Zc2t D>Zc2m H>Zc 2f @>Zc(`>Z Bc0Z L`&``"   \4`"J } \6 \>Z 88 `, `,  `,  `,  `, @@, >Zc@ X c@6 \>Z#H ` #H, `,  `,  `,  `, @@, >Zc@ A c@ 6 \>Z PP `, `,  `,  `,  `, @@, >ZcX ) cX6 \>Z `` `, `,  `,  `,  `, @@s, >ZcX  cX, ,  ,  ,  , , @@b>Zch  ch, ,  ,  ,  , , @@Q \>Zcpʐ M>ZcxÐ N>Zcּx$ ݖ%s: interrogate write failed %s: interrogate read failed %s: bad data returned *s1025E*s1024E*s1026Eh`8`<` `L   ?$`8$`< 0 >[  >[0 0/?@? >OaȠ   E>OJ@  d2`J@   I ?А  >[J+  @ *`В@  `L $`X+ $`Xc@c@ ?@?/M > a_  >at`03OJ@  d2`J@   2 >a ]`0?А  J,  @*`В@ `\$`T`XΟ 2 Μ$`Puk  %s: unknown device 㿘>&`0a >\"2 " ՜">\"(՘`%s: already open 㿘>   Б* @`2`00  2>\ 2 "v` >А * @?0` 2`㿘>А `* 0{dmaledma[%s at %s] offset 0x%x㿘`"!@>\ C#!@>\?# espdma㿘``@>  >\@>#耢 "   > , `9&`48v@ cable-selectiontpeauiburst-sizes: rev 0esc11+2unknown (0x%x) nameespP "8, 2  80 @ &  >\&`D @>c 2#>>]@ `>]@>` >]@>` 2 `D`D* "`D "(" >`   @ " >]`@??&`T&`T`T &`T>]ԥ `D<@ @ &`L `>]@">]!>]$@>](@">]>]ԇ >]ԃ >]>]~ >]z  >]v >]`Lq >]n ` >@!>^>^>_#cP>a#h`&`l&`x>^>^>_>_#c&`p&`t&`|&`` I&`P 28`0S8 >\@>c耢  >\8@>c 8@= 2'8 ''@`P %>]#>\@i@   'cx @z 0>\@=ϒc  >]`@! &`<")%s: line %d: CSR = 0x%lx ../../../../arch/sparc/dev/dma.cR_PEND㿘 D@$!@耊d! ?D  Dd ?   >^ D@ >^aƔ!P>^Ð!8 D@ < "@ D Ȓ`"" D @ ?"@ D " L@  `  D " L@(@2)& H D* " T   D " D D@0 "& H D " T`  D@ 7@("@& H㿘 㿘``@=. 2 @ 㿘t  D  D %s: start %d@%p,%d dma_setup: dmasize = %d dma: cannot allocate DVMA address㿘 D@#>ր$ %>@耊d! ?̒  Dd ?   >^ D@ >^a!>^љ!8 D |` "& d& ha8  >^#@@   d?@@*" 8 & `'a8 >^ `# 2 d ``  d @& \ & X>^a# D"  L d D"` L@2 D d>@ `0 >", *@  D"  D" >! "@  D  " H%s: intr: addr %p, csr %b INTERRDR1DR2IEN WRITEENCNTTCDMAON%s: error: csr=%b dmaintr: DMA wasn't activeDRAININGdmaintr: discarded %d bytes (tcl=%d, tcm=%d) dmaintr: empty esp FIFO of %d dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d 㿘`D`<>!8` >_>_"0"P`Q>_`D>_ }"`D"` #@P ?`H 2`D>_п"@$"!`L@耊d! ?˖ `Dd ?   >^`D@ >^a">^Н!8`L @`2`D`D@ @@ "@`D`  耊` ! ?e `D`  ?   `D>^>^ a">_l" ="```($`Ha8 "%>_ l ȟ€ l@€  l * @  € l @€  ѹ   l@€  a8 >_"ѥ } 2,`` l € l@€   u * `@  l@€  * 2 ````@@2`` u @" ``,a8  >_ l@# € l @€   u @ l@€   R>`d!H> `2 `h`X "`h`\@ ```h ""`d@"@㿘 D >_ }" D>_P` " "  l@ lebuffer[%s at %s] offset 0x%x㿘`"!@>a  !@>a  㿘``@: 2 N@ burst-sizes: %dK memory nameP "8, 2  80 @ &  &`H8&`L @ " >aa @??&`D&`D`D>a`L a0&`D й: &`@ 28`08  ''@ %>a#>a@@@*  1 '` @ @qec%s at %s offset 0x%x㿘`"!@>a u"!@>aq"؁ 㿘``@:1 2 @ #channels: no channels : invalid number of channels: %d burst-sizes: %dK memory %d channel%ss nameP 0 @ &`<D&`H4&`\4 2&`L&`@@v @ " >ac`@o?&`P>a#p0X >a #0Q>ac@[??&`D&`D`D>a`H c&`D`P: >a#>a# &`@ 28`08 "' '>aܐ#@@9 #>a!>ac@@[  @c '"& @( cranges%s: PROM ranges too large: %d 㿘>b! @@   & X>b" ϝ05 @c 0 `0@6`H$  `P$```H@6̓*`$ `P *``H@6$`d$ $ `D @ 2  < $be㿘`@8`?: expected 1 interrupt, got %d board-versionchannel#burst-sizes pri %d: rev %x address %s 㿘4``H>c!P0>cap@?&a00  @k 4&a(<  @e#`&a$ H @_ &a,&a <@&a >ca@??&a4&a4>ca@??&a8 D&a8 D>da8cL &a8&`<`<&`@@`@oa>j>jȐ{ @ ?( #  ! # y  #&a ! # n  #&a & d ! & ^  &&a ! & S  &&a  ( I  (&a   @  &aaj``\Ą >d&`H! >e>d?c|"$$$44ܐܐa0!>c!׾`p  8 >ca(@7 `@"&㿘 4 $@ @7\"# @L8  ,`" ( `"a" T  $T 4$6 4    & & $  ?& 2 ($\㿘!$"" !$b " !$  !$" `?"# !$c    !$# `?㿘H /e * & ѐ@H 0%s: device timeout 㿘>dc   `$ 㿘!   !(``!$!`@}`@2``@` @%s:%s qstat=%b unexpectedRXSRXPRXLRXSMALLRXDROPRXTXSTXPTXLTXDTX BE%s: resetting 㿘2      `  `>d  #耦  >d#>e >e  >e Hj%s:%s stat=%b RXRCNTACNTCCNTLCNTRFIFOCVCNT TX TFIFO TMAXPKT NCNT ECNTLCCNTECNTDTIME㿘 @ >e!  >d#>e >e!ɐ >e Ő H6㿐!$ H@DH L  X @$ X"@"D"H"L!T %!X!L*( '   4 P { 4 4$ P !T?  &!T!L*( ' " 4&!X!T "4 2 㿘!`!L, @ # @ @t !L` ! ?"@*   "!`  !L@ &!` 㿘 H /e * &  a2a1;a a H0!5=0 !69 = 4 6 4 ` @H He0; 4@  2 4f 4 ?/6 4  @[@.0$ H H`4@ M! H $  H 00H 0㿘!$ H!(!H /f * ' !L &!@!L@ʔ &!P!D  !D@ &!H @!L*(  ?"!H*  @# !L(" !L  *  : * !H" *`  #@ !L" " $!L&!T&!\&!X@u&!`@А ( *  $c  * $c  *`@ $c $c @xՐ  $b  $bP $@!P$ !P($ `B!4$ $ $>$  $_d  $ , ,$ ($a$ $ $ $ $b,$ 0b  $b c `$c 4 @ ;44H p@!,    ?#d ?#d#%s: rev %d PAL not supported. %s: no internal or external transceiver found. 㿐!,ؐ!0`>g H 0# $   '$   'd   &!<?$'0  ?&!<$'0>g h %s: invalid tcvr type 㿘!<      >g̐!`M1? @ @ݒ @ڒ @ג ` < `@ѐ?< >@ `@ɐ?>@!< @U@S @P *?@@I@G@E@@ @ *?@@ @@㿐!< !, $   '$   '  2  >g $   '$   '  2 !`S 㿐!< !, $   'ï  $   `2`'0 >g $   'Ý  $   `2`'0!`' 㿘!<     >g!` 00@. @+ @( @% `. <@ `@?<@ >@ `@?>@@ @  6 > `@?>< `,( ,,( ,  #d" ,#d#㿘  >"8>ݦ`#p%>-> +> 2PH /f * ' V* ?4 H p@  "/V$`@'VH /f * '  a "@2` ?*  *  H"`  `$H$` H 0 V* 8``` ?&@* D@ @@ H /f * ' V* ?4 H p@  "/V$`@'VH /f * '  a "@2` ?*  *  H"`  `$H$` H 0 V* 2Q %s: invalid packet size %d; dropping 㿘 H% >i \  L`$ L@ 2 H L $ L $ H (  : ]㿐>ݮ#p  H ה  "  4`H /f * ' >8 2H p@ `  $`4`$@$`$`  `2$`ܰ $``F `H /f  !> 0̐* ' !>!H !H ْ !H$` > !>"  2` > * 8 ?" ` @$!HH 0`  (` $`4`$`($`$$`,$`0` 2(` $`'􀦠>"8 +p  Q  4`H /f * '   5 H p@ `$`$@$`4`  ` l ?`>H /f!>͐* '!>!H   _ !H$` > !>" a 2  *  % ` $!HH 0`  (` $`4`$`($`$$`,$`0` 2(8$` `` &@ !D*`  `2&%@{㿘 a !"  0 2  & & #&`͒  `   ?&`%s: bmcr reset failed %s: selecting 100baseT4%s: selecting 100baseTX%s: selecting 10baseT full-duplex half-duplex %s: bmcr unisolate failed 㿘!` r  B >  % ǐ ?    >j U"xt` `` >j" >? `  2 `>j "4 `  2 `>j, ") `   !$>j "ؒb" ! ?>j " }"  >?,   t ? , $ >j  " 㿐!$ H 4!c  @$c 0Sc ?$c  4b?#$c@$cD$cH$cL0F?c$c@$cD$cH$cL 4=" 7777& @0  ?;n #       @2?2 $ 22*  * @0 2  ؐ$c@$cD$cH$cL 4 =6 4qe㿘`@0X`?: no interrupt found on parent mace-versionchannel# pri %d: rev %x address %s 㿘 L `H>kn"0]>kb@?&a0  @ 8&a <  @ &a&a <@&a>k?@b&a D>l"&a&`<`<&`@@`E``\ >l&`H >n>l?c8"$$$44a!>k"ސ%`p  8 >kb@/ `@"&㿘 4 $@ @5"4 @$8 ' ,`"   `"a" ,  $, 4$6 4    & & $  ?& 2 ($4㿘! ! ,    3   ?$@@`  % @ ?㿘H /e * & Ґ@H 0%s: device timeout 㿘>lbx A  `$ 㿘! ! *`2 2!  `#߀ @  @ @ "@8@㿐!, H %!0!$*( '   4 P { 4 4$ P !,?  &!,!$*( ' " 4#&!0!, "4 2 㿘!8!$, @  # @ @ !$` ! ?"@*  "!`  !$@ &!8 %s: excessive tx defers. %s: no carrier, link down? %s: excessive tx retries %s: late tx transmission %s: tx fifo underflow %s: jabber seen %s: babble seen %s: tx descriptor is bad %s: tx late error %s: tx dma parity error %s: tx dma sbus error ack %s: rx fifo overflow %s: rx late collision %s: rx packet dropped %s: rx buffer too small %s: rx late error %s: rx dma parity error %s: rx dma sbus error ack %s: unexpected interrupt error: %08x %s: resetting... 㿘`H@   >m`f  T `$ T@ >m`[  T `$ T@ >m`P! T `$ T @ >m`D!8 T `$ T @@ >m`8!X T `$ T  @>m!p,` @>m!$` @  X  Ta!$ X$ T@>m!`  @ >m`! T `$ T @ >m`! T `$ T @@ >m`! T `$ T @ h X  La!$ X$ Ld L !$ Lb L !$ L `>mϐ" L `$ La >m`Ő"0 L  X` $ L$ X``@ L !$ L` L !$ L `>mì"H L `$ L` `>mâ"` L `$ L ` `>m×" L `$ L ` `>mÌ" L `$ L ` `>mÁ" L `$ L  >m"ؔt`>m`n#?㿘 H /e * &  a"  4a  B Ha2<a1 9 &!1 4 6 4 ` @H H\06@  2 4] 4 ?+6 4  @R@/0 / H H`4@Ӑ  H $  H 00H 0%s: no carrier 㿘! H! !H /f4!$* '!$  !$@ &!(!  @!@ڔ &!   !$+ (    ?#! *  @" !$ (" $!$ # !$+     : * ! # *`  #@ !$"  "   $!$!($ !(h$ &!,&!4&!0&!8$ $ $ $$ `t!$ $ $ $ d  $ " $ , , `$ ($ 0$ 4,`,`,`,` ,`  \,` ,` ,`  ,`  ,` ,` ,` ,` ,`,`,`?0#P,` ` >o V  `@ 4 @ ;5 4H p@㿘  >"8>ݦ`#p%>-> +> 2PH /f * ' V* ?4 H p@  "/V$`@'VH /f * '  a "@2` ?*  *  H"`  `$H$` H 0 V* ``` ?&@*   @@ <H /f * ' V* ?4 H p@  "/V$`@'VH /f * '  a "@2` ?*  *  H"`  `$H$` H 0 V* U2Q %s: invalid packet size %d; dropping 㿘 H% >p \p" L`$ L@ 2 H L $ L $ H (  t  ٔ㿐>ݮ#p  H S  "  4`H /f * ' >8 2H p@ `  $`4`$@$`$`   `2$`ܰ $``F `H /f  !> q 0̐* ' !>!H !H U !H$` > !>"  2` > * 8 ?" ` @$!HH 0`  (` $`4`$`($`$$`,$`0` 2(` $`'􀦠>"8 +p  ͐  4`H /f * '   5 H p@ `$`$@$`4` ^ ` l ?`>H /f!>͐* '!>!H   ے !H$` > !>" a 2  *  % ` $!HH 0`  (` $`4`$`($`$$`,$`0` 2(8$` `` &@ !*`  `&%@{㿐! H 4!Z "  ,`  ,`?0L 7777   9  @*=   ,`  ,`?,` 4"$6 4;n # ?    @22  $ 22*  * @4   ΐ ,`  ,` $ ,` ,` hmeSUNW,hmeSUNW,qfe㿘``@) >r@)!p  >r@)!  @ : expected 1 interrupt, got %d : expected 5 registers, got %d hm-revburst-sizeslocal-mac-address pri %d: address %s rev %d 㿘4``>r"0`>r" 08  @60&aDD  @0<&aHP  @*H&aL\  @$T&aPh  @`&aT>r&`Hb@@? &a\ &a\a\  `!&a`>rbH@??&aX @&aX @aX @ @l&aX`0K>v &`<&`@@`<a4>rbX@F  !>r+!>r"pڐa\!>y>x!c>y`L"&`&`>y>y&`&`h<??? `p   "  C "`? ``Y >s!h>s>s?cd"$`$`$`4`4$@ȱ`( і 㿘 4 $@ @7x"# @d8  ,`" H `"` " |  $| 4$6 4    & & $  ?& 2 ($x%s: stop failed 㿘!D "@!D    !D`  2 x>s"`  x ?& x㿘H /e * & Ր@ܐH 0%s: device timeout 㿘>scP    `$ 㿘H /f * '  E   H 00[a2@a1@9a @a@"4F 0!5@;0 !6@7 0;4 44 ` @W͒0-@  24j4 ?"44  @_@f0Ւ 4 @  L8H 0㿘!h 2!p!d@Ҕ &!h!p 2 !dp!@!l@Ȕ &!p!d&!|((&!x&!t @ !p #@  `&!  ! !p*  #@ # %s: burst size unknown %s: setting rxreg->cfg failed. 㿘!T!P !D!H@}!L?#$!``"  ?$@@!8!9*` @  $bP!4 !5*`@$c !6 !7*$c!8!9*  $c$b,$b$b!h%`!h(% !X @  $  $ >t"`B $!$ % ,   %  %@@">t"x, $c @F b  $$b !``2"$@b  L`$b c $c 452`@ {54㿘!`  !T?#"`` Ȕ "`!` g&!`%s: reset tx failed 㿘!P $b0W ?? b  >u ߒ %s: reset rx failed 㿘!P $c0; ?? c  >u!hÒ %s: link status changed 㿘>u ! 㿐!P HLD @ `X @$`X"H"L"D"@!t `P { 4`4 $`P !|?&!|!|  , !d(@  6`4&!t!| "4`2 㿐! @L $L@`!d, ! 'ǔ   " !d, @ `2 &! %s: stat=%b, resetting. RXRCNTACNTCCNTLCNTRFIFOCVCNTSTST TX TFIFO MAXPKT NCNT ECNTLCCNTFCNTDTIMERXHOSTNORXDRXEEXLATERXPRXTEOPMIFTXHOSTTXALLTXETXLTXPTXTSLV SLVP㿘?? ؐ & ??" >u>u㸐#   㿘aD?a" ߒ >@@@o㿐>ݮ#p     "  4 H /f * ' >8 2H p@   $ 4 $$ $    2$ װ $ `F `H /f  #> 0ǐ* ' #>aH aH  aH$ > !>"  2` > * 8 ?"  @$aHH 0  (  $ 4 $ ($ $$ ,$ 0  2(  $ '􀦠>"8 +p  `  4 H /f * '   5 H p@  $ $$ 4     l ?`>H /f#>͐* '#>aH   n aH$ > !>" a 2  *  %  $aHH 0  (  $ 4 $ ($ $$ ,$ 0  2(8 $ !l.`    F%@&㿘  >"8>ݦ`#p%>-> +> P.`H /f * ' V* ?4 H p@  "/V$`@'VH /f * '  a "@2` ?*  *  H"`  `$H$` H 0 V* F_* * * l@ @@ϔH /f * ' V* ?4 H p@  "/V$`@'VH /f * '  a "@2` ?*  *  H"`  `$H$` H 0 V* 2R %s: invalid packet size %d; dropping 㿘 % >x   L`$ L 2 H L $ L $ H (  H k㿐!P  4!c  @$c 0]c ?$c  4b?c$c@$cD$cH$cLc ($c 0M?#$c@$cD$cH$cLc h$c  4"A6 4 7777& @#Ӕ  ;n # ?      @2?2 $ 22*  * @0 2  ؐ$c@$cD$cH$cLc ($c  4 }6 4!T ` !T  !T 㿘!T"א ``!T  a2!T!T  b   &@ %s: mii_write failed 㿘!`  #!T*? .`c   $` ` @@  ` ?  3>x#) 0. $`       >@ `>@ > `> > `>$`%s: mii_read failed 㿘!` !T % *`@ .` $` ` @@ H ` ?  >y А B ` 1?#=  $` J ?E B ? <  >@ `7?>@ > `/?>$`2 .*? &# 㿘 4  㿘S L |&` x&` |!P" " "" 㿘``@", "  > , `p&`48@ dma: expected 1 interrupt, got %d pri %dinitiator-idclock-frequency espattach: no dma foundintresp㿘>y c @!” >cx&`l4`?`>y#0 >y#Ȓ &i 2&i80 @Ɣ &i&i  [ >yc@xW &h>yi c@xQ?&hԐ" &h&hhԀ 6`$ 0&hh@b@ &h&i& <`@{c &i" <>yڐ#>y_#h۔  `l .`t.`u.`v   `l@€ _ "`l-&hܐ .`u`  `l.`v   `l .`v`  `l@€   `u.`v @`l.`u`   &hhԐ#@Yh܀`&h``>a!D>a!D@&h &h@&h@A$&h@&h>a!D&h` >n h`$uh>nq>n`Xi&hh@&h>z`&`0 "8 6>>z`@! /> <@   #> `@2> @q > >>z`@  > ? > `@2> @q >>cXǔh>֐ "at@q )*` )*`( 㿘) t@㿘) l@㿘) x@㿘) |@㿘) @)D")Haudioamd|QEB;632*+,%#"""-+2LCBCA;;=43422$1*{*+#+,B.#%$+$#""A"#"3J!2,b2q"4R#z5& *c  # 3   > L!|"3"B2'"R:31,#"bQB;32*,%#"!  C3@DA1U BA` Br!" audio㿘> `>{@ #`? : expected 1 interrupt, got %d pri %d, softpri %d intr㿘!0`>| 05 >|  ( 2  N 0 @Ė  N.`| .`&`.`~.`.`@ `> " >~@cp>~"X&`<`<&`@@X >|``@>#D@X !* *  E** *  C*  *  H2   " H" " L" " " " "  㿘@ʐ@& H?    @" mulaw@ >|@@"`  2`"`"`"`   ~>{ᒅ(@P2 (@2& * ((0 >{(a2$2"(@>{2"2$  -*-H( i+ , c+ + ! f+   d0+ + ' e+ & j0+ + #+ "0+ + %+ $0+ + -+ H  `L @ ` !* *  #`L@ #`#`#`#` `L @ ` !* *  #`L@ #`#`#`#`   !*@ *`" L   !*@ *`" L 㿘>cO 0 @``& `" @>}( ` *~ ` * ` *`    `  ` * @`` ` @>}( ~ *`  *` *` "` "` htt micvolumespeakerheadphonesmonitorsourceoutputinputsoutputsrecord  >~0( # ? # $# # >}Ȑ # 8# < # ? # # $# >}(؄ # ? # # $# >} # >}# b3  # <+ b# (3 , + . # ? # # # $>}#  # # <>}Є# (3 ,m+ . # ? # $# # >}>}# 3 # (+ b# @X# , # ? # $# # >} # >}3 >}+ # (؆# ,# @# 0""# D # H 3 L # X4+ N # ?# # # $>} ?# # # # $>} # ?# # # $>}# 3 +  ?# # # # $>}# #   H|x\㿘  H /d * %   @(  H 0  @ H /d * %     H 0  @ 0H 0 />%p/>∬%/>   %   ,%+>``+?P `-`0+-?P%  ,% +>``+?P `-`0+-?P%/>p@̀audiocsSUNW,CS4231㿘``@ >@̐   : expected 1 interrupt, got %d : expected 1 register set, got %d burst-sizes pri %d, softpri %d intr㿘4`>ڐ 0? >!ђ068  @0&`T>&`pa(@s??&`t @&`t @`0`t &`t>"x&`<&`@@~`<> !8>`XuaP> x  .`.`.`.`㿘 T     * ` * * ***("2   Ĕ  `  &  8    & "8"< ` @    ` @ `  T *  * *   *  * * * %s: can't find speed 㿘>@!D!D ? `p8  `@@    "@ " ? `  &@!D>#  !D*  & &  &@ %s: waited too long to reset iar %s: waited too long to reset errinit 㿘 TL d ,@ @W` #?B d @  ??  > Ȓ  ,@ `W`  #?) d `  ?? >!  %s: unknown CS version: %d %s: unknown CS chip/version: %d/%d 㿘 x  TU  & x& |& & & & $`  $`` ` $`` $` @`@,@ L,@ @,` ,@ `` `    `>"( ^   `> `"H  T  ,@l I,@ `,@ `,`,@b@ T *@ ` *`*@ `@*` "J  0 J" *@ `J  *@0 *@ `*` *@ ` *` `0?*`*@ `*` `0?*`㿘@@p& xmulawalawslinear_leulinearslinear_beslinearulinear_leulinear_beadpcm e >$(>"R >"  K*>   >00"  =">8 8" "2  "*"2">H H"  """%">P P>` `" "2   "*"">pp"  2"""  \㿘 ` ` `"" >"  >#0  >#0 `> *` €     "        ? 8  2 &' $  $ $$ 88$@P %s: timeout committing fspb %s: timeout committing cdf 㿐 a TH /d * %    *  @ ` H,,  a/ /  "  \>  H p@0*,,  a/ /  ">I H 0 & ! H p@ T?`"` *@ ` *@*`"|T?ۄ"` *@ ` *`"|㿘>aƔ 0 㿘@`ݘ >"ܓ*` €`2԰ `   T *(` 2ɰ  T*@`  T * T*@` ` 2 `   T *` 2  T *`   T `*  T*`  T *` `  `   ` 2 `   T *`   T `*  2  T *`   T `*  T *`  T *`q ` 2m ` 2i  T *`   T*`* _ ` 2[ `  ` . ` 2Q ` . ` . G`? (` D =. ` 2= ` @ 6. ` 23 ` @ ,. ` 2) ` @ ". ` 2 ` @ . ` 2 ` @ . ` 2  ` @ . F   |  \   ` (Px Invalid kind! 㿘@`ؠ >"*` €``` ` T * T ` 9.`  T* T ` .`  T*@ T  *.` ` `   T * T ` .`   T*@ T   .`  T*@ T   .` ` `  ` `   T *@ T  {.` y  T*@ T   .`  T*@ T  j.` ` f` b  T*@ T 2 Z.` ` V`   .` M .`  .` ` DN ` >N ` 8N ` 2 N ` ,N ` &N  @  &`` `  .` .` ` &``    &`>#TPx@(\tmicvolumedaclinecdmonitoroutputmuteonoffrecordsourcespeakerheadphonesinputsoutputs G >( #  ? # $# # > # @# < #  ? # $# # > # 2# < #  ? # # $# >#  !+  #  ? # # $# >3  +  #  ? # # $# >#  # # <># (3 ,+ . #  ? # # # $> # H  ?# # $# #   ?# # # # $              ?# # # $# >  #  + # (>((3 ,>+ .# @0 # X# D #  ? # # # $>8 # 83 >+ # <""# ( 3 , + . #   ?# $# # >@ # @>3 # (+ >3 ,# @+ .b># D# X" # \# p># t# a+ x # ? # # $# > # >3 # (+ H # ,H># @# 0 # D># X+ HP P# \# `3 d # p3+ f # ?# # # $>`"` ?# # # # $>h h ?# # # # $># #  # ?# # # $>88# 3 +    L(Hhx x \(㿘 w @  $ ` $ $$`̐y %s: attempt to free rogue pointer 㿘 ̀   2 @ @ $@y0 @ 2 >!`   cs4231_trigger_output: already running cs4231_trigger_output: bad addr: %x 㿘 |  T>"=  ̐ & |& &  2& >"0) & & Ѐ@& Ȳ&  "8"<  ?# @"D " * * ** * * *  bwtwo㿘> `V` 25 ``@  2. ` &``2 % P ?  2  2 @S)  E"`4 @" `4  ?倢  `@ &` bwtwo/p4model: %s, %d x %d (console) cgfourcgeightunknown%s: %s overlay plane 㿘>`<! $`$`$$`(` @     $`,0  @| $`0 &`Р0 @| &`Ь$`0 &`   64> />:02/>60> `+`,@@  `0>2  E`2   E @ E"  &`&`&`&`> ##  />>`@jא0 &`4$&`8#&`&`$`@Q6 ` a`>` ` $`r$``>`,` * J  >#D @ ?  > "  >#D @   $` `@{ $`@ג  ">>= `,@@`耢  `@Q`. ``07`,@@`耢   > > > > ` > " `,@@ `耢 @P 0@P>a 6  a؇*     㿘>!ذ . "@@"@ 0 "@ 0@&D&H&L& P&T &@: &@P   㿘@G bwtwommap㿘>!ذ >б. 0@@>)"`?T@> 䀢ؒ@ ԑ* @ Ԑ@ 㿘> `2  2  h@@"1@Q <@6  6  㿘> `` ` h@@ <@Q~0`Њ@@ Ъ@@0 Њ@@ ?Ъ@@0  ` ` ` *`cgtwo㿘` &`` ``@  > `V` fN> , 0@z?@; 8@ cgtwoattach: impossible bustype: %s, %d x %d (console) 㿘>", ` &`T&`4&`X&`\` >#> h &`@`0 #$@O !&`D>b, A"* &`H>`<`8ސ >`  > ">J   >#D @ 0 &`4&`8&`&`&` ` &`L``Ē @zo &`L0  $ @zh&`Ԑ  @@zb#` &`> @P> > > "  @N>b 6  b*     㿘>" . "@+@ "@F"@ 0O "@ "8 " "@: 0B@( 0>4&8&<&@& D&H1&4?&&4&8& <&@&D&H& &4&(&$4&L&H @@h `  &  `  *   (㼘@` $ B , @  @+  ` ؐb@  @+  ` ؐd@  @+  `` `   `w  㼘@`aC `\ 2< ` @S 23`K " ), @ 2@ ` ؐ" @ 2@ ` ؐ$@ 2@ ` cgtwommap㿘>" >б. 0@@>#`?H@> Ȁ`đ*  Đ cgthreecgRDI㿘` `&``@   >@# "   > ,  H& 48@  model: %s, %d x %d setting video ctrl (console) 㿘>"l` &``&`d` &`h&`@     6>    &`L  &`L> ` >>`8@g8  #  >`8@g, &`L`< $#@M>#@ 2`D &``D `\>b,! * &`P>`H @&`T> b >#D @  0  &`X  @x` &`X @xZ ``耢 )&` ` 2&0> "  >  p  P> "  @*    , 0`  0&`4 &`8&``&`$* " @  $ s$  $ $   >>R h@Mɐ`L x`U`0@L[>bX 6  bX*     㿘>"X . "@+@ "@O"@ 0S "@ "9" "@B 0F@( 0B @& D& H& L&  P& T5& @?&& @& D&  H& L& P& T& & @&(&$ @&L&H @ s! @ ! @&  @&@   㿘@ ` @( 2  @ :`:(* ܆ * # #  cgthreemmap㿘>"X >б. 0@@> "`#@? @#@?@ T@ >?` Ԑ@@Б* @ А@ cgfour㿘``@ 2 `>` &` 2  \ ?"  @M<  @"` @ &` %s: ignoring; not a pfour : cgfour/p4, %d x %d 㿘>`0"̤ $`$$`($``  $`, >@@0>  `0P   @v$`0$`$# @K !$`` >`$` 0> ` > ">J   >#D @  ? @v&`0 &`4&`8&`&`"2 *`"""?"> H@Jג>b 6  b*     㿘>" . "@+@ "@O"@ 0S "@ "9" "@B 0F@( 0B 4& 8& <& @&  D& H5& 4?&& 4& 8&  <& @& D& H& & 4&(&$ 4&L&H @ ! @ ! @l  @]&@]  cgfourmap㿘>" >б. 0@@>#`'#@'>?@`<``8`&@@@#@ #@ `H@ ?`IJ@`'> @,@ @ 㿘@  㿘@L 0㿘 0@L@ :`:(* В  *`* # # (# (# (# cgsix㿘``@  * ` &`>!  ` `> , 0@u[?@ ?"  @K ` `@ &` cgsix/p4modelcgsix on mainbus? : %s, %d x %d, rev %d (console) 㿘>`<#  $`($`$$`` 0 $`,0 &`4 &`8 &`@u&`ܤ&`   @u&`  *@u &` @u &`  `* >"`*` €`,@@  >">!> `2 >!Ȧ   >b@ci>"0| $`$`0$#@Iʒ ` `!$`>` `"$`>`  `,@> `  `>J`  >#D @  ? 8 `> "  >#D @ `>@"ؕ:  6`@$ 2 *b `耥 h$"h">>">c  0 @tp &`X@J.`<"`0  > " `<@H<\;<,<,<@>b 6  b*    㿘> ". @@6 㿐>" . @ b@""@"0 @ b@^b@ 0"@-b@"V   @";"  b@@8  "@0 "@S  & D& H& L&  P& T& @?&& @& D&  H& L& P& T& & @&(&$ @&L&H@!ʰ" @ޔ! 2İ@ V & "V @8 2  6  >>#T` " 6 6 6 6 6 6  6 !$6"V! * ! 2(~! 2   "@^  w0v &r& V   "'"'@  2e  8^ "* 2 ` : V ${ ({  G    6  6 6 6  6 @T &"@&"`&! 6 "6!V"!@ Y*(̔$Ȓ!@L  6  66 @*6   66 ?? "" " R 4 @ @"@" " R􀠠R?R#RR (??#(R ?28 !!  @ # @#@ `@ :`:(*  *`* # # (# (# (#  @"@""` *"` *"` "@*"` "*"` "` R 򀠠 2  cgsixmmap㿘>" >б. 0@@>;!>#$` ">  @* `&@ T ` Ԑ@ Б* @   А@  *?cgeight㿘``@ H 2 `>` &` 2   ?"  @Hh  E"` @ &` %s: ignoring; not a pfour : cgeight/p4, %d x %d 㿘>`0# $`$$`$`(`  $`, >@@0>#`9`0Q   @q $`0$` $@F#!&`D&`H` >`!#> ` > ">J  >#D @  ?@q– &`0`&`4`0&`8 &`&`"*#  " s" " ">#@F>c 6  c*     㿘># . "@+@ "@O"@ 0S "@ "9" "@B 0F@( 0B 4& 8& <& @&  D& H5& 4?&& 4& 8&  <& @& D& H& & 4&(&$ 4&L&H @! @I! @  @&@  cgeightmap㿘># >б. 0@@>#0`c?#@?@<'>8/* @&@ )* @@ >@#@4@#@ ,@H@%@#@  @ >? , @ *  @ @?!@@&@ "  Ē '>  ,@ @ 㿘@  㿘@G 0㿘 0@G@ :`:(* І * ؒ # #  tcxSUNW,tcx㿘>@a   ` &`` `?tcx: oopsTCX on bus 0x%x? tcx-24-bittcx-8-bit: %s, %d x %d, id %d, rev %d, sense %d (console) 㿘>`<#$ $$ (`   $ $ , >" 0?"4"8"ؖ  a( a@""p&a(&a@  @p &ap  @p*&at  >>Q" 0\>b8@_4 2 >bH@_- $ $#@D   $  ! >>$ a/"X> b@ >#D @ at>"h2`22  @Ð$ 2  "*a|ath$"h">>" "  `0 "@`<@D>c 6  c*    㿘> #. @@ 㿘># . "@+@ "@Q"@ 0l "@ ";" "@C 0_@* 0[ @& D& H& L&  P& TN& @?&& @ & D&  H& L& P& T& & @&(&$ @&P&H4&L!|@!/!|@L! )@0# T!x& "T!x@D  !t 4!x ;"!t@ "!th "h  !p"@`"`@ :`:(*!p  *`* |# # (# (# (# Rxt2xh("ht@(("(t tcxmmap㿘># >б. 0@@> x`*>  %>  @ *  &@  T`* @*`@ ` `Б*   `А  *?cgfourteen㿘`` &``@   > `   warning: can't find all cgfourteen registers... cgfourteen with only one register set; can't find framebuffer: cgthree emulated at %dx%dx8bpp (console) 㿘>`  &`T&`X` &`\&`4 &`@`0$#@C8 `Pc`8>b,! * &`D&`H8?#@48>m!@&88  @n0 <    "0&j&j&j&j&k&k&k&j 4<>Ґ">&`@"P&`D#> `<&`?`8 @ j`В  @ "@ `b >#D @ ">>%"xb!"b`0@B5㿘> Ȱ   .   ` H > `"H 0   @  㿘>  ȱ. @H >? "" H 0 `@  㿐> Ȱ . @ b@""@"0 4 b@^b@ 0"@-b@"W  @";  b@@8  "@v0 "@A  & 8& <& @&  D& H& && 4?& 8&  <& @& D& H& & 4&(&$ 4&L&H@X! @! 2@ @C&@$ 6$6$6$6$6$6 $6 $$6"V$ܒ * %` 2($ 2   %@  {0z &v& V   %'%'@9  2i  8b "* 2 ` : Z $uG (uA  K    6$ 6$6$6$ 6$@F &%@g&%䀤`*$ 6$"6$V" @*%`@ (*$&@6 $6$ 66$@6$  66 㿘@v cgfourteenmmap㿘> Ȱ >б. 0@@>"H`#@? @#@?@  Hf @ & : @ >?  Ȁ` đ*   Đ *  * @ @ + `` A(*) *% A** * *a**@ # @ *  ` *  A  @   **2  㿘@ @( ( tK  tE  t? ,`  @` * ` * ` *  ` 㿘@ @( ) t  t  t  ,`  @  .` .`  .@.` ` *`*`В "@ `R$Ѐ*` *a$$* 2a$$* 0R$ڀ?38*%`$  @ " @#@ `%* %* 㿘@ @( ) s  s  s ,`  @@ * ` * ` *  ` 㿘@ @( ) sp  sj  sd ,`  @  .@ .`  .` ` pnozzp9100㿘>@Ð Ѐ`?cmsize: rev %x, %d x %d, depth %d (console) 㿘>` !$&``&`d`  &`h&`@H0&`L &`P &`8@j &`D <@j &`> b@ >#D @ ,  &`X" ``X 2 `PH @jg &`X` &c <  ``"   ``"    &`L`<`L"X# @?I|`0>!a@Xސ&`P`\k`D&`T>`H `D!`L| `*`*``P.`䀤 ` *`*`*@`P ` @ǔ!@ "!>>^!(`T  `XJ`*"*`T &`X @ @?@!8@@>T>a 6  a*     㿘>! . "@+@ "@O"@ 0S "@ "9" "@B 0F@( 0B @& D& H& L&  P& T5& @?&& @& D&  H& L& P& T& & @&(&$ @&L&H l! ! @+  @"&@   㿘@ 㿘 `a&#a8" ߔ  "a8@{ 82  `*`ᄐ #cᄅ*#c *`#c  "@` !#c!#c"#c @(""`p9100mmap㿘>! >б. 0@@>"耦`?@ #> Ԁ` Б* ?㿘!D > "a8 0>!8`     ?! D@ E>!2 23f#!0㿘 #%! D@"|! D@?2!㿘?# %#! D @"d! D@?2!㿘! `  `1  " >  >' >#  `2 -! " -  `2 -!    - `2  ! "  !>! 2  %D # %"`㿘> `!!``D `l@ !?!D "` ! p@! D@ @" "㿘> `! !  `` ``0 Z0A0>%s: lost carrier on UTP port, switching to AUI portAUI port, switching to UTP port %s: lost carrier 㿘> `2>! -> )#!D@ ">>#!``2>>#>#!``>>#>#0># 㿘``@ " "` 8z@@ sbuslebufferledma: expected 1 interrupt, got %d pri %dbusmaster-regvalif_le: Lance buffer crosses 16MB boundary㿐 >aX @P> a``? @H>`?ap@A 4`? ">!x0 '>!&a&a0  @gH  &a`;>a7>a| `;>a7>a| 4 ``@  2 `P 2   H&a8L>&a@&a<$Pa@U 6a4a8 @_ ?*  * >א!&a<&a@`6a4&a& @&a '8>u" &axapyI yDap &>!@   <@    ` >!@ߐ ` @$ U>zcx>z> T>z>Ȕ` >">&`&``&a&a>>b\! b&`&`&a &a&`&`   #  ) #0# a   #  %      0  % ږ  %״>y$` &a|a ">#&a|@`&a Unknown3e/vmeonboardmultibus/vmeie㿘``@_ 2 4 6  2   ? 0 ?  㿘 H 4(@ d4(@ Hh@?Ȅ2h@h@(2h@ Hh@2h@㿘 H d, , H ( ( H(ie_mapie kmem_allocunaligned dvmamalloc breaksie pmap_extractunknown : RAM CONFIG FAILED! pri %d address %s, type %s 㿘`L􀠠"r>>>>>>(#Xcd> @&a&a&a &a  &a&a&`D0@e `D>cP&`H!?w– > "#>w#`D sm &`@>m#> (  `D'>@2@ ,`@  @ "`D>[#&`<a`@> &a, &a( >>H#>", 88    ,?`@&a$`D@ " &a0&a4K`>>>"c<>0 t@&a&a&a &a  &a&`D&a(H@eK&`Hh@?4  @ * " `D@e= &`<&`@hD?! 4hD`* 4@ * 4ga`@€`D`@`D$|# &a$&a,&a0&a4&a(b 0ZS`@ `>W 0O >!>>?cܖ"$$$$44!> 0a>aX*@ 5( "   >!`&`0&`4@^`08 4 8>!`&`0&`4O`08  >b`@א ` @"$ %s: device timeout 㿘>`Ȑ   `@$ %s: parity error (ctrl 0x%x @ 0x%02x%04x) %s: receiver not ready 㿘!,!` ` H(@""!,(D>(D (F!˖ (Da4(D!, ` @ @ `P``@``@` > !H `@_& !, `` ` 㿘"!, (@ `!8,` @ ; >ᔒ`?& -# $ 2` ( @ 2 +    2 +` *`*2(2`2* 2 @ @* 2@  & 4  4  4  4 #ᔐ@ @ B%" *!8*2 3 !:  B #@+`3 +` 4 @2ietint: command still busy! %s: send aborted %s: no carrier %s: lost CTS %s: DMA underrun %s: too many collisions 㿘# b< {b6 6 ~*    >  4   @& +& >  >   8 >  H  >  X `&  > ѐ p  ` & & !  "< "(* @t&!< 4` 2`@ ?"@& 0& & @ L%s: receive descriptors out of sync at %d !8.`)'d'`2" +  2?*` `( 2 "@ &`@ ^&"`,d` %*@@@>,`@` 2*` @Τ ` 1?b8  @?"c* @ ! ! ""  t#!"0 t t" t t@ $耊`є  @  @  @  @   @ 퀢   @   x "$ $ @  @  @  @   @ 퀢       x  $耊q  $ 6q "@    @  @  @  @   @  @   " 2@$D  ؔ?    x "$ $耊`2  @  @  @  @   @ 퀢      x   $   @ $ >@^ ??/& #p  \T  `'% 2`H /f * ' >8 2H p@  "@"  "2`"   %  0v\@? L$ `$ $>"8'\\\ ,p  \  4H /f * '  4H p@ $$$4 י Ő l$ ``(B H /f!>͐* '!>!H    !H$ > !>" a 2  *  $  $!HH 0  ( $4$($$$,$0 (8$ @ \ 2 $ >!ܒ@ @ 8$  $$  %&@`{\ `U # `,- @  2 *`  !"" @!&@ 1 !@&@ @@!&@  2@ `2@"&*` ?c 2@ &`-  `d  #& d !>" "`t$"`    td'h't'ph` dd$" L㿘 ?"`,"%+>*@`@b8  @0  `2 * @2@@H &*`@  2@=  &%s: tbuf overflow 㿐 4`@%4 8 d6 40 <t`( *  2*` *@ }2* <# 2*` 2 $* < "@ '(  8܀ I   $$$ ?$䀤 = *  e    @  *  2  %(  >!Jת,2  @*+ *` 3  2`2`@ ?"@$$%4`h0 d<t`( *  2*` *@ 2* <# 2*` 2 $* < "@ ' +  ( ( +  3`+  3`+  3@( B#+ + 3`@ 0+  B#@+`3 +`, 0@  $4~㿐H /e * & !$ !€!( !€!, !€, <$@' ,  * *,@ B`$ , 2 , 4` < @"@ ' `,` `* `*!@!€ d @ !,  @l `H p@  H 0 %s: reset %s: abort commands timed out %s: disable commands timed out 㿘H /e * &  ><#X  L ;6 '  @` @& >#h' ` @ ># `6 @ H p@ "㿐!,`' 4 2 !"!!€>aX @* !>|*  |\ 0@   %s: TDR command failed %s: transceiver problem %s: TDR detected an open %d clocks away %s: TDR detected a short %d clocks away %s: TDR returned unknown status 0x%x 㿘<%6`6`6@ B&@ *!,*2`@ 26`  23@@ 2`3@!,  ~ ``$@@>!x`@>!w 0` ?>@ !`>@ !f 0>" `ie: bogus buffer calc㿐!0# !4!€`(!4 3@#< &>ː#h!,!,&*@ `,"&  !8%, "     ( 6  , "    ?  ( 6 ,  @*   B" *2 * 4` ,   (*`@    2 , "      , 6  , "    ?  , 6 ,  @>*   B" *2 * 4` ,   ,*` (  2 , "     ,b4 & b<b8& b0 & & /#  2` < $' `* `* `*    B ,!: (" !,b &b?&*b&*b2&  3 B%"@ *`2 *`!8 2%s: multicast address setup command failed 㿘6@#6`<#! 6` $*` !"@`** ** 2`@ 6` B &@ **2!, 3  >@ 2 > # %s: configure command failed %s: individual address setup command failed 㿘!0< B#$ *`!,*`2  4`4"4 4 !  ,  ,  @,  ., ,  `, ,  , @ , , ,  ,  ϖ > 2 B> ː 0J!$ *`*`2  4`44 4 !     > >  0*!,   `J B!: " * @*!,2 6 3`  !, ` ! `@ 㿘  r 㿘 H /e * &  a@" 4a @"  4C a2@>a1@ ; (!1 6 4 ` L L$ 0,@ #$!  4 @ @2 4 4 ?6 4  @00@< L L`4@   H 0㿘   $&   +"@  4   @  "   "6 a L~  *@ *`@ M   &  2 &!xdcxdxddummystrat㿘 <"">>S!b "+ H 0"& 0 0 & 0%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) 㿘`>"" ""(`>* ` `a@K >!`+ `6"@`4`>!`>`F"`6 *2w4``  64` F4` 3,` / P,`4`Ґ"$ (㿘``@& 2# 2   l` ?  .` ` Ѐ` "@ ? $  `     pri %dxdc malloc: couldn't read controller params : %s: : doesn't identify as a 753/7053 : Xylogics 753/7053, PROM=0x%x.%02x.%02x %s: controller config error: %s intrx  0@Z & &`T> L*` &`h>#&`l `d"??`t @#&`x&`t@В#`t &`x&L T  &`p>] @&L`` =  `t+ `p "@ ( `t  `4 *`t @ *``t`o * $`t .a6&`.a7.a8.a;.a:.a9&`&` 0#\#`    @ `2`t> 0˓,` S,,`* `p* @` " >!>@ޠ 8> @a9 ` .a9oa9a6`.a6 `, `p" a6`oa60>  h ca9 ` .a9oa9a6,`.a6 , * `p* @"`a6 2#`oa6#`#\    @ `2a9 ? `.a9ooa9,`@*``p@*`a6  .a6 , `p " a6`oYa6 !> `@l0A>"<&`0&`4`0D>`<|Ғ`  @"8 0 ?耦'?2 '`@2' @Bq ' yJ ``'@" @B^ >aX>*! w `    xdattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: write format parameters failed: %s %s: read drive parameters failed: %s %s: write drive parameters failed: %s %s: reading disk label failed: %s %s: <%s>, pcyl %d, hw_spt %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: write real drive parameters failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! 㿐`0@4 >!`&`&`X  6`6`&` X&` * "`2$`ȑH /d4`Ɛ* %`ƀ  !>`ƒ !l  `ƀ ``>!``Ȑ 6`#\#`   @E   ! !9? `.!9n2!9, @*` p@*`!6 .!6 +  p " !6``Bn!6`B`>א!6`!>">̐"(`Ȑ#\#`   @  2!9  ? `.!9m!9, @*` p@*`!6 .!6 +  p " !6``mܐ!6`!>"@`Ȑ#\#`   @Қ  ,  t  2!9  ? `.!9m!9, @*` p@*`!6 .!6 +  p " !6``m!6`!>z"h 6`6`6`.`.`Ր<#6`Ζ``  }2 2 ? `Ȑ#\#`   @  2!9  ? `.!9mu!9, @*` p@*`!6 .!6 +  p " !6``m^!6`!>5"`Ȓ #` #\ @S  2!9  ? `.!9mA!9, @*` p@*`!6 .!6 +  p " !6``m*!6` !>"`@ <6`Ɛ`0{.`2  `>`И ͐"``~`Ԓ~ &`̒"`>`Օ: #\#`Ȑ#\#`   @  2!9  ? `.!9l!9, @*` p@*`!6 .!6 +  p " !6``lɐ!6`!>F#8`ή ``Ԡ`ՠ?~c~`~\`Ȓ #\#` @  2!9  ? `.!9l!9, @*` p@*`!6 .!6 +  p " !6``l!6` !>#h@ =O6`?#   2 " `̀@ ~`ԑ2  `Հ  ~  } ~>#H 00)`{j"  @?  >!x@ ` @"$ @K6`  l%`ƑH 0  >: ܇* * @"" `` `d`d (("`d (("```d ``"`h%s%c: crash dump not supported (yet) 㿘 >! :  !ܑ**& >!`a 㿘 ` > :  ܑ*@  e`f@"O  m@"Xe e@3 0  h@3 0  n@"`g@P 00 e@q 0zy H /d4 * %  z"H 0b  z!\  *# & *`` &!  @X I ƀ E C4 A  "  Đ 4 ?# @4 Ā2 /  @7 ( ƀ 2 h 4  h4` `* $ h ` ! > c@_  d `@ $ h !6X< @㿀 > : 6L ܑ*@-*ƀ`&Ȣ' @Ӑ" ?'~@"ƀ  )  `6! . @ ` " ` dd *@$d *@$`d ` $h㿘>>#ؘ" R㿘>>#ؘ" Rɖ 㿘  >! : 61?!ܑ*@ *"  h*@ 2   x " ?,` `?( |62` 2  i ?㿀 G> : 6 ܑ* @   T &   (@M <  v& 4ƀ  Ȣ' @" ?'ɒ@;"ƀ  "  < G !"@ " < O& 4 O @w $H ` > ` .` 0t.` 0r 02 .`  k.`  `Ր?.``.` .`  `А?6`   `Ԑ?.` 0Y 02 .`  k.` .` .`  .`  .` "6` .` .`0B` .`  ``0   k` `  .` &6`   2 6` .` ` .`  (@.`  @ @.`  @ Դ6`  (@`  &` $@`*   = .`xdnfreexdsubwaitxdcmd nfree㿘` \ 02p !6 ; @~  2e !6 / `!6  ` 2!9!>!6 !g1 2P !6 !6!9 (!6!>!9 !g  2? !9 !9!6  `ِ ` ` >!.!6 ` J , *  p* @@. X     #`#` #`$#`(#`#` #`#`,#`#`#`#`0@xdc_startbuf freexdc_startbuf bp%s: warning: out of DVMA space 㿘!6 2?>#.!6 J@  ,`*  p* @@ 2$>#؀("(& ("G: *  X@G !"T`*    H @< 2#<> #!6,`.!6 , *  p* @"`!6  |h!6 |&$($&(( "@%"(&:   $ $ $$ $ $ ($ $ $ $ $ $ ,$ 00@   +w"`0@  xdc_submit_iorq addingxdc_submit_iorq wrap upxdc_submit_iorq㿘.` T*  p * `)P2!;[ !* !; @ !8.!;`  .!805>0?>0 g  `@; ~"  * T2 *` T2 * T2 *` T =*  T * !7  .!70>0P> f  `@  @ ~"8㿘!8 @ T B B  ay ?  B   `  ? @Ҙ ? ``?  @Ø 2!8- @ʐ!7 8!8" @{ !8 !7 .`*  p* @`!6 "    "!6%s: off-line: %s xdc_resetx t v&  t@鬒  t @@  *@ t =  `ː ` * x T*  T2`* T2`*  T2`* T*  T*`   Ty ? $  t T `  t @ "% T `!>!@ޢ  T *`  T ` "@x ?  T ` 4 t>}! *`  tuǔ %s: soft reset %s: diag: xdc_reset miscount (%d should be %d)! %s: diag: lots of done jobs (%d) RESET DONE 㿘!6` >#X9  T *`  T ` "@x ` T `` ? V   p` ``0` `2j !7?.!7"V!:&` t/   + 2`*`  +  p  `` 8`0`"`0G "2!9C  "`4`00("0`$`0*` " @`0`,<@H p@`0`@ 0<uc"@ }`0!6 `.!6 `*  p" !6`2 e!6 e!9 .!9` `@ &` ?  .!:!*@ !8 .!8   4@+ `2 !8!6 "!8eՐ!6!8!7!6 !9  ` >#h ~  > >#~ >~}#ȁxdc_start㿘`)!8 % T ` #>!:!J@ @ؐ !8.!:.!8 P "|b !8  T `"!:%s: fatal error 0x%02x: %s %s: soft reset failed! xdc_remove_iorq: controller DEAD㿘 T ` @ ` !> #@~# ?ݘ >#~>|# `  *`     p  Đ @-  t @ !7?.!7 2  ` `$ $  @ "   "    @  N2M  H  $  (`"$ $ ($ <$ $,`$ $  @ ,@ @ @*` `  ,@ &$ 4`  @z 4`   @u  @ ,`  ` a >"@,`  (@$`!: ?  `.!:!*@!8.!8 J   ` "6 ?`0`> 6 ?:   0`0 ($`4$`0 $*` $`@$`@ ,`H@9`<`< `@ 0s" !6 `.!6 `*  p" !6`d!6  @$ !9`d.!9  @$ !9`.!9 4 5`4 %s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries] 㿘 > `#`  }  0` > `G# a" }`a@  @  @>  c> > `  ` ` |@A|c耦 !> @8 |ސ >  2>> |Ԑ 8>|ѐ X㿘` ``?` ?`@&`!9 .!9`?|&`!9?.!9? X` V `$ + ` `("  @ &`$&` &`(``   @g զ@b@ Ԡ@@?- ` &`  `.2 *  `@.2  .6```̐ ?6 ` Ԡ" @4. `@ . !: 0?. `  `` 6 `&`@2( ``4$ `&` .2`*`  .2  .&`!: ? .!: !* !8`.!8  %s: diag: IOPB miscount (got w/f/r/d %d/%d/%d/%d, wanted %d) FREE: %d WAIT: MARK: running %d: mode %d done %d errs %d errno 0x%x ttl %d buf %p %s: watchdog timeout 0  H /d4 * % !8!7!!6 rE!9 rA H 0@ Zؒ #\> {Ɛ H@寒 >{ `7>5>Т?)>  { - ?>{ `)>  @{ @- @ ? >{ X  %>  2  t,  @@ @2 p   3 #\0#`{}  `40 7>5>>#{o H /d * %    p `  @" ?` ?"`  p@ ` " ?4` > {G  ?  H 0X*` jo㿈 ` {'> h*` €     Q Ѱ  ͑* R  ư     `ְ 6?`!?>#*` € ` @ `Հ   * @ %6   @ `Հ 2   0 ~ @ `Հ x  2r  @} ``  oD @}Ɣ0X `H /d * % `Ȑ #`#\`,`0 *  p* @ `. p . !9? `,!9a!9 !6 `,!6 `*  p"  !6`2a!6   nH 0 @}n0݌D܌܌ܸSoftware fatal errorSuccessful completionIllegal cylinder addressIllegal head addressIllgal sector addressCount zeroUnimplemented commandIllegal field length 1Illegal field length 2Illegal field length 3Illegal field length 4Illegal field length 5Illegal field length 6Illegal field length 7Illegal scatter/gather lengthNot enough sectors per trackNext IOPB address alignment errorScatter/gather address alignment errorScatter/gather with auto-ECCSoft ECC correctedECC ignoredAuto-seek retry recoveredSoft retry recoveredHard data ECCHeader not foundDrive not readyOperation timeoutVMEDMA timeoutDisk sequencer errorHeader ECC errorRead verifyFatail VMEDMA errorVMEbus errorDrive faultedHeader error/cylinerHeader error/headDrive not on-cylinderSeek errorIllegal sector sizeSoft ECCWrite-protect errorIRAM self test failureMaintenance test 3 failure (DSKCEL RAM)Maintenance test 4 failure (header shift reg)Maintenance test 5 failure (VMEDMA regs)Maintenance test 6 failure (REGCEL chip)Maintenance test 7 failure (buffer parity)Maintenance test 8 failure (disk FIFO)IOPB checksum miscompareIOPB DMA fatalIOPB address alignment errorFirmware errorIllegal maintenance mode test numberACFAIL assertedUnknown error >* > > > > > >!>! >!8>!P>!h>!>!>!>|!>y!>v">s" >p"H>m"p>j">g">d">a">^">[#>X#>U#(>R#@>O#P>L#h>I#>F#>C#>@#>=#>:#>7#>4 >1 >. 8>+ H>( `>% x>" > >!>!0>!`>!>!> !> !>!>">" \ht(4@LXdp| $0<HT`lxP㿘\ `& & 0& & & & & $& (& & & & ,xycxyxydummystrat㿘 <"">>uc!@b("m; H 0"& 0 0 & 0%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) 㿘`>""(""(`>* ` `aP@|[ >!v`+ `6"@`4`>v!`>`F!`6 *2v4``  64` F4` 3,` / o`,`4`֐"$ (㿘``@6 2 2   l| ? А@b@ @   pri %d%s: can't alloc IOPB mem in 64K xyc malloc: %s: : doesn't identify as a 450/451 : Xylogics 450/451 [OLS disabled] %s: error: %s %s: 24 bit addressing turned off please set hardware jumpers JM1-JM2=in, JM3-JM4=out to enable 24 bit mode and this driver intrp  0@G & &`T> L*` &``>#u&`d&` `\"?? @x H#?ܒ H @  'ؒ @xߐ H H@yؐ H  @>#u̒`0@ߵ H&`p&`l  Aʔ  &`h>tB#@ߥ `   +  `l `h@ " `l`4  * `l @  *@ `l  * `l@ ` *``l  @*`l@ `  *`ڑ+ `h&`|`l`h 0&`t&`x 0 #\#`   @7 `x `2  `t " \`t !>#@ Quc>u`#0h>u\#``">>uU >uR  `!> @ 6uG0O`T ` >>`u= 0>u: X>u7 0?!&`0&`4`01>`<i` "@x* 8''쀦'?2 '`@2' @/ ' fr ``'@x0" @/ >aX>ƕ*"Д d2`    xyattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: reading disk label failed: %s (drive type %d) %s: <%s>, pcyl %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: %s and %s must be the same size! xy drive size mismatch%s: write drive size failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! 㿐`0@h >"P`&`&`X  a&a6`6`&`&a&a* *  h * @&` X&` * "`# H /d4`Ɛ* %`ƀ  !>`ƒ !8Yږ :`ƀ ``>!Ht6``Ƞ 6`#\#`   @   t " [` t``>t!X76`"!>!p8>t!<#adaf6`6`6`6`.`.`ِ  }2 2 ? &`̐ &``̀  `#` #\ @  2` t " [$ t`2`̀` !>!`@ sؒ6``>sҐ!Ȑ`0i.`  `>`Ԧ s!``l`ؒl &`ؒ"`>`ٕ: #\!s> + @`Ԁ``ـ" `̀@2  ـ 0Ԁ@0 ؀ 0 `s>r"X  ݑ+  lf,`2?l_l]`Ș@#\#`  @+  t " Z t`!>)"p`Ҭ ``٠`ؠ?l=l:l6 `Ȕ #\#`@   t"` tZ{`` !>"@ #s4O6`?#   2 " `Ѐ@ ~`ؑ2  `ـ  ~  } ~>"s H 00)a\ia"  @-}  >!8@ܸ ` @"$ @xB6`  Z`ƑH 0  >: <* * @"" `` `d`d (("`d (("```d ``"`h%s%c: crash dump not supported (yet) 㿘 >"< :  "<**& >"`ra 㿘 ` >< :  <*@  e`f@"O  m@"Xe e@3 0  h@3 0  n@"`g@P 00 e@q 0zy H /d4 * % !\h"H 0b  h!\  *# & *`` &!  @xP I ƀ E C4 A  "  Đ 4 ?# @4 Ā2 /  @x/ ( ƀ 2 h 4  h4` `* $ h ` ! > c@xW  d `@ $ h !6F4 @㿀 >< : 6L <*@-*ƀ`&Ȣ' @tː" ?'B@t"ƀ  )  `6! . @ ` " ` dd *@$d *@$`d ` $h㿘>>#" @㿘>>#" @ 㿘  >"< : 61?"<*@ *"  h*@ 2   x " ?,` `?( j.2` 2  j ?㿀 G>< : 6 <* @   T &   (@E <  L& 4ƀ  Ȣ' @t" ?'@t3"ƀ  "  < G !"@ " < %& 4 % @wo $  U˖ ` *  i"@>#$ p% . X   $ $ $ $ $$ ($ $ ,$ $ $ $ O$ 0@ xyc_startbuf null buf%s: warning: out of DVMA space 㿘`܀>nw G !"T`*    H @r< 2<>’ o֐ ! &:   $ $ $$ $ $ $ ($ $ $ $ $ ,$ 00@   f"`0 xyc_submit_iorq: stuck xyc%s: stole controller xyc_submit_iorq addingxyc_submit_iorq: xyc_chain failed!xyc_submit_iorq wrap upxyc_submit_iorq㿘 T  ,P d "@0K>0 >0V @ `P` А  b@ >>m""0o_ m"H@= 2  T#P"3 >mՐ"`@* T2 *` T2 * T2 *@ T * "@0>0P> UВ @ ` `@dm"㿘 @ ` hx 0 ` l 3`"h`"  |& @ ` *`>@ @o & |  ?, *@ h*`  !  l*  ,` "@ `  *" @@ ` *2    ` @> Ѡ` @㿘@ `4  TBXa     ? @ '   ?  @ 2@ @;@ ` 2@@@ `" T`@ %s: off-line: %s xyc_reset㿀 x d֔  x @ *  2`  *   `*` ߐ * x ` *` x   * x`   `@* x T *` T2 * T2 *` T2 * T*`  Tg ? $ x T ` $ x x `" T x!> ` @"ؔn  T b@ 2 x>l" *` xds %s: soft reset 㿘` >Đ n  T b@  ? }     h` ``0` `2J4"E4&` l  *  2`  *` `` -`0`"`0-4"'`)4 "`4`00("0`$`0*` " @`0`,<@qH`0` $"a h0@ 0<d:"@ T`0&`Tސ` ? @&`4`? 4@ 㿘`  X, @" "   `2    ,  P%s: DOUBLE ERROR! %s: soft reset failed! xyc_remove_iorq: controller DEAD㿘 T `  >ĒmR# ? E >Đ#0mF>kː#H ` @ @*` `  *`  ``  @" @  "   2`  $`$` @ " ` " `` @ `B2A` < `$` `(`"$` $`($`0$`$, $`$`  ,    `*`  , `&$`4 ` @ԧ` 4 ` @Ԣ` `@I , ` ` a >"@, `(2 `4 4 9 ` ` "+ ?`0`- ( ?)  `0 0 ($ 4$ 0`$*` $ @$ @`, H@pr <` $"a` < 0 @c." $`G   @$`Sϐ  @$`  - @`2V` %s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries]㿘 > `"`  lZ  0` > `G"ؒ a" lO`a`  `  `>Ő  b>">Œ"` ``l4@l/bЀ !> @#l& >  2>> l# >l 㿘`@^``` ?`@&`` ?&` R` P  `$ + ` `("  @ &`$&` &`(`` !\ @ӳ ٦@Ӯ@V ؠ@R@t7?' ` &`  `. 2  `@. .6 ```А ?6` ؠ" @Ӂ.`@& .0'`  ``` @ ``&``@ `` `&` .2 `@ . .&`%s: watchdog timeout 㿘 H /d * %    h `  @" ` ?"`  h@ ` " 4  >ƒ kY" ? L H 0>!X*`>Ɣ "Z㿈  ' 6  0z&  u q  i  0c a  ]*  Y  S  @n  `  _ @n&0= H /d * % Ȑ #`#\ 2 t   . t . t" R  t  _tH 0@mSoftware fatal errorDOUBLE ERRORSuccessful completionInterrupt pendingBusy conflictOperation timeoutHeader not foundHard ECC errorIllegal cylinder addressIllegal sector addressLast sector too smallSlave ACK error (non-existent memory)Cylinder and head/header errorAuto-seek retry successfulWrite-protect errorUnimplemented commandDrive not readySector count zeroDrive faultedIllegal sector sizeSelf test ASelf test BSelf test CSoft ECC errorSoft ECC error recoveredIllegal headDisk sequencer errorSeek errorUnknown error [>Ȅ* >U!>R">O" >L"8>I"P>F"`>C"x>@">=">:">7">4">1#>.#8>+#X>(#p>%#>"#>#>#>#>#>#> >  >  8> H> `>Ȑ p  !    !!!! !!!!$!!!!0!<!H!T!`!l!x!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!  "F   "A   "< 4: @ 4 5   &/ . ", 04* " 0%"$ @ ! " `    " ` %   "  @ $   @ 0 㿘\ `& & 0& & & & & $& (& & & & ,sisw㿘``@ 2E > `2@  ?2 &   24 >@cp 2- > `2 & >@cx 2 > `2   ^8 ?2` >@ޒcp 2    ^((?   si_attach: impossible bus type 0x%xsi: dma handle malloc failed pri %d %s: options=%b RESELECTDMA_INTRDMAsi: Set TheSoftC=%p TheRegs=%p 㿘` `   2>>"d"`&d   (@9 ,>>>>>>>̒b|"l$⌘ 0aX  6`6&`L&`D6`:&`X&`\&``&`d&`h&`l&`p&`t&`x&`|&`&`&`P&`T``'>>>>d#P`L&`&`&`&`>>̐# c0&`&`>>>>>Θ !ؒb`&`&`&`&`&`&`e d &` &`d  ` &` &`&c!@&d 3j  &d>e `0  d" &c>ː!&d&c&c  "    @2c  c#  !@&d >g2!d>>ʐ! g)`>"X`>ʐ!8g >"\ `>@ @6`>א!4 >,@Ԑ >, ?  `@2 @! >,X^  @!{ si_minphys len = 0x%x. 㿘 "X`>˒f!@o& <7bsi_intr: DMA conflict si_intr: DMA bus error si_intr: spurious from SBC 㿘$ #  `` ">ˢ f!x >ˢ@ f!` #  & ! # 㣐  >f!>bX @o3si_reset_adapter 㿘>"X`#>f"$``2" p 4 _ 4 _ސ 4 4 4 4 4 $4 4  p $ _$ $  $ _  $  p si_dma_alloc: already have DMA handlesi_dma_alloc: misaligned. si_dma_alloc: xlen=0x%xsi: no free DMA handles.si_dma_alloc: can't remap %p/0x%x, doing PIO 㿘  >d#$ ? `  >f#034$>ː#d   @  `>d# &  $ $ $ /@   &   @h  $  > e &$ si_dma_free: no DMA handlesi_dma_free: free while in progress㿘 ` 2 >dM!` ">dG! " $`   @i $$ $` %s: DMA timeout (while polling) si_dma_poll: done, csr=0x%x 㿘  '#0#cP+>^ d$ `` bX>̒ e"`$bX >̐"8ev㿘@#  4 #? 0#?`#2``#2``2`` 2`2`2` 2` 2`2` 2`si_dma_start: bad pa=0x%lxsi_dma_start: dh=%p, pa=0x%lx, xlen=%d si_dma_start: Fifo_count=0x%x, xlen=0x%x si_dma_start: started, flags=0x%x 㿘 `  #>̐#c> "X `&$ >̐#Вe  ? @4   4 `    4   4 4 ?#ߒ @4 44 4 <`4 4 4 4  "  >̔dؐ#@mx   `*@ p X *@ \  * h ` * p X @* \  * p*@  4  "X` & >d (si_dma_stop: dma not running si: DMA error, csr=0x%x, reset si_dma_stop: resid=0x%x ntrans=0x%x si: fifo count: 0x%x si_dma_stop: excess transfersi_dma_stop: ntrans=0x%x si: Got Left-over bytes! 㿘   #>dh"80 ?& `?# @4``" `>dW"X ", `&  o``$  & '>X ">͐"xd64  >͒d/" `O& $ >b""@X& & >͐"d :` 5> d"`` `'?`  @0`? 2 ,?`,?` 2 ,?`?c 2 ,?`,?`?# @2`,?4`4` 4` 4`4` 4` \ `* X*㿘@ #  $ # #   si_dma_start: adjusted up %d bytes %s: bad outgoing adj, %d != %d %s: bad incoming adj, %d != %d 㿘 `  #>̐#b> "X `&$ >̐#Вc     ?%   bX  >ΐ!co <$ % $% `` `* p >ΐ" cT  p  @ X* \  * h ` *@` ߭ >ΐ"@c7  p X *@ \  * p*@  %  bX` & >c! (sw: DMA error, csr=0x%x, reset sw: short transfer 㿘   ` `#>c"80 &   ?$  @ "  >b h@ ", `f&  W)>"X  $@ >͐"b4  >bڐ  `C& $ >aX""& &  5 `   ">)b&> ?2 + 2+` > @ 2`+` " >2`+ 2 +`` " >2 +`"b "b$ $  \ * X*@"X >͐"bstates=> GOT_BUS GOT_TGT SENT_CDB XFRD_DATA GOT_STS GOT_SNS XFR_CMPLT status=> Disconnect Sync_xfr Parity Bus_Reset Device_Reset Aborted Timeout Negotiation%s Config WaitWaiting for AL_PAWait LoginReadyLoss Of SyncErrorRe-InitNonparticipating0x%xPort DiscoveryWaiting Port Discovery ACKPort LoginWait Port Login ACKProcess LoginWait Process Login ACKLogged InPort UnavailableProcess LogoutWait Process Logout ACKPort LogoutWait Port Logout ACK%s %s index %d: %02x PTI,ptispptispSUNW,ispQLGC,isp㿘`` @ˊ >@˄! >@~! >@x! >@r! ` `2  > ,  W& 48@  : expected 1 interrupt, got %d clock-frequencyispPTI,isp㿘4` >a{"0>aw!x>&a&a&a&a &a&a&a&a&b &b$&b(&b ,&b 2&a80 @3  &a>&a @!b ! А@ b@6b8 *> <@%> @@ >>А"@ " >А!@ " >А"@ "  >А!@ 2>Т >@ؐ! >@Ґ! 2`&b`@aa &`&`.`Ɛ &`@ >@` "$&aa6b6b6b6b6b&a@,PȃH /d * % \,`ё2    H 00B_`ё2   " `(H 001  ``   ``   ` >А"W   @+ t`ё2   `` @ H 02` "P `!ؔ  2` "P `!ؖ 0 %s: cannot malloc xflist array %s: cannot malloc sbus_kdma_allocs %s: cannot allocate request queue %s: could not mapin request queue %s: cannot allocate result queue %s: could not mapin result queue 㿘 2O  Ē * ,A & >ђ @"@ Ē * ,2 &" >ђ 1#@ ! ,$  & >ђ ##8@c  & >ђ #`! ,  & >ђ  #@b &  >ђ #_ %s: kdma handle already allocated %s: Request Queue Overflow++ 㿘`$``  h6>   @b` 2&`,q d` " ?* `"`>Ґ!(^@  /   `2* @ 6>Ғ _!P` ` @cm`$ &`,G e " ?* "`h   @ 6   @6&$@q&  , ,`$$ $  ̑2  2 ,  ,, , `$ &$& 6 ̑2  "  .... ̑2   f .. %s: kdma handle not already allocated 㿘`(>!H`$`(` " " * >>Ґ#]  `"`$ @b` 㿘&   &++ & @ 㿘 , firm_event㿘` e (H /e * & @`  %>Ӏ9,`!D 9@` ` !`" H 0` 2 4`*@.=\@@ ``$#$@  `0H 0 #H 00 4`=5.$@㿘H /e`* &` `0 @ H 0 sS 0 H 0  H 0 >#`stdin-pathconsinit: increase buffer size and recompile consinit: bogus stdin path %s. keyboarddevice_typeserialstdout-pathconsinit: bogus stdout path %s. displayunknown console input source %d; using rom unknown console output sink %d; using rom >#`>>B# > >9c"!%%%l%` (`L`@1?>Ӧc  € ?`>^#0.'>Ӥx  @ " >`@ >>Ӑ#`]'> c€ >  c@!>@Ǟc Ox?'>5> '>5>`J@ 2`J@ :J` ` z$?@ݤ㨠 € >]#0Jx  @ " >@ >>Ӑ#]0ݤ#@ڐ>@Wc > ""$ @ΐ>@Kc ?Ox `J@ 2`J@ :?J` ` z$?5>`HJ@J > >    ,x  `@`>"c#]G` ``>>P P ,W 0>>֐"c>%&P "D]% >֒ac%&Pscreen-#rowsscreen-#columns㿘>#H>yc`$  $  ($ ܐ H>#D` >@>@"cL>"cP>`? B >#L`%>>a>@)`h  J  *` + :`* J ?Б*`2 $cLP >a>@ `x  J  *` + :`* J ?Б*`2 $P 2%#H> `>L 2> `Q"L>P 2%#H `P"P%#H p  $"% h`" h%  #"c %˘ ( $ $ $ $  $ p@Đ>>#NcR4 4 h>ݒ`* @€㿘!>#` h>ݐ *`   €,㿘>#` h>ݒ`*`@ 㿘>#@  p ( (" h>#` h>ݒ`* ` @ 㿘  b@>1>#@    0g 2 &#@ >#` h>ݐ *`  @ 6   㿘6  * 㿐 H /e4 p* & p!  H 00;>#`$`T`` H    HHo o /@ 0@ H 0 H  p  ?& pB HpH 0㿘>"P€ 㿘H /%4 p*& p H 00*V  H   & pB HpZ  H   p  & pH 0!@)0>֐#J H 0H( p" pH  㿘H /e4 p* & p   ?& pH 0 0 h ?& pH p@  P H ?  @  *@`># `    `€ h` >ݐ  *` €0U㿐>cT  ># `      0  X  &#T 㿘H /i * * >T?"TH 0  ,>#`` c">@@ >ܐ# J `@   ?# J `@  ?> `h *`   € 㿐>#` Ho o c    cH 0% H/` /1>  c>8"`$ *c`P `>8"`$*H 0 " 㿐  Ho o># ` /   0 T@H 0㿘>"`  $@ (%s: /dev/fb already full %s: forcefully replacing %s %s: replacing %s %s: attached to /dev/fb 㿘>"\`!>"` 20 ($b\ , "` "   ( (>ؐ `YΔ >$b\$"`,"bX` " > ( (>ؐ!`Y> "bX>bX  "` ""bX (>ؐ Y`0"` " $"` ( (>ؐ!`Y$"`"`>(! Y`㿘>"```$` 㿘>"``$㿘>"``$ @㿘>"``$ ?widthheightlinebytesfb_setsize: inappropriate bustype㿐```s>>> `k`& &  (\ `2Y > @ , 4 0`"N @'2  E"G 2  E"A 2  E2  `"6 2  `/>ِ"*` €$!##$%$"!" J "$   $   %  #&@%& & %& &  Q & : & >ؒcp@"& >ؔcx@& >ش# Q &@:& >W=#eTdddehdJ   J* (J А 㿘   @- screen-#columnsscreen-#rows㿘  4$` $`   & 4$` $`Qa 4Ԓc 4>2>!ؐ!$`\`\@@6$` @2`>` $`> 􀢠 P P 2` 8 $` " Q 2` 8 $`  !>>!@b P` 8 !>ْb@z$` "` 8 $`  " $`$` @H`$ ">$`$$` >ِ"t$`@n>G#>"bT>` H>` L@#``#dd"@@d`?"@0 d0E Ed0# 02   0`#dd2 #>ʄ   "! mouse input parity or framing error (0x%x) ms_rint㿘#>ʠa   >ڐ aVc?4a? 2   4a4a * : `1*`>ې!P €8  8  , 4 . : @ $ 4 . : @ $ 4 . :  4 $  . : ?4$ >U!   4*L @L ) >7>#> !aa  ?"FI*`@ `@ 3# a#  #   4     "   ?"!#3 > # !# ! #   4  $     ?"#3 > # !!#  #   $  $, $ kL 0 "L 1, 0>) L 1  ,24 mHjjjjjk 㿘>ʠ! ,`  $ ,> `2  $"`"`  @  $ 㿘!>ʠ! $   @ $ ,㿘>ʐ!, - ~@-  @}@" "  v@ @ 0>ʀ@ *!A ><  @  "  㿘>ʐ!,Δ> keyboard-click?true㿘> >b$ $ $ >a>@c0 >@c@  , ,kbdattachkbd: reset failed kbd: type = %d, layout = 0x%x 㿘%>X @>"aؒ @>>բ$"bx``@  & >T#@X`>;! >V #@> `2#V `1Unknown keyboard type %d 㿘 2 >7>7>7>7"c& & & & &. 6   " N   >  > Ѐ 2.  N   @f . UȒ `. kbd_translate`2  - >݄(*`*`2`*` *` *` *`*`?<2`R`"@`"`J`"J`` }?`"`2 `u?& '>8? 2  ? 2  耠 ?*``F?>8      2    2`! ?   2 "2` 2  2 `2` rTr r(rHr0r@rPrPrPrPrPrPr\㿘H /e4 T* & T   P ` >bx>ݐ DH 0keyboard input parity or framing error (0x%x) keyboard event queue overflow 㿘#>b T >ݐ $ TD3>ݒT!p   0   , 0, 1      ğ@d;ڐ0W?, 2 ;, 00P 8 L, 0  ˒  Cb`@k>aؖ >$ T$ P C032 8 L*@ ? 4" 6 >ݒaS 0 `3@ `# > !!#  #  <$ 8i:L H "L I, H; 4L I  D/ (0 > *`05 ~1 (0, ' #     * 0       * 2 * 01#-!)!%!!#! $$$ $$$"# * 2 㿘>"D`: "D @ H /e* &`$   ğ@>!X>`9-! #" H 0 >_" " D㿘!>" 4a& " 2& D @ & D 㿘>"[ -㿘 ~>@ R" c @" 1 Z#@Ԑc@A 0 Z#@" 1c@ 0Ԑ}@Ű 0  v@" D #@ "s8# #@ 0@m 00#@" # @ 00# @8 0  -  & v - . ">7 0  0 "  0>7 "">7#>7#?c 6 s.@ ">7 0  0h "  0c>7 "">7#>7# @ T6@\ P  L$  2 H& ", 3 H /e4 H* & H x  > >ܐ! 83 H 0   6  ., 3:  &  @ 3 . @ , Ia @ 㿘>"Ɣ㿘>"`  E " `1 4>  `0" `16     *`, ". *`,* `H /e4 H* & H x  > >ܐ! 7Ö H 0   ğ@ fpu_cleanup 1 fpu ieee trap, but no exceptionfpu_cleanup 2fpu sequence errorfpu hardware error (%s[%d]) %s[%d]: fpu hardware error fsr=0x%x fpu errorbogus fpu queuefpu_cleanup 3 `!(: ``> >#*` €>QҐ x:`2>8>PR !>8 "' ,(`` % >P? >P< !  4> `Pa 4> Q4' ? ,N&`>!Q >P !  @B'>8>8!b,``@2`>2` ??̀ >P !0'@5 " `  >0>0 ?*  ' ,d `'  ,[ `O!@``@Ǒ,`&` 㿈@>2 ! #J228   ` ? <  @ &  4& >#X,  €, ,  , * - $  $ @9@} @1 ,@, @& ,@! 0`& 0@a @ ,@@+T @ ,@@G @ ,@@H   @ ,@@:   `  p. $O "K$`G  @˔@ƒ ,@ ` @ @ ` >  @ >8!J p. @ $ *`@$- `$ * ` $ * $ *`$  4@T4444444|44444Dx4444((444444444444444444444ppppfpu_add㿘  ,@,``2   @@t ` 2    z&   v&  r "L   L$`$` 6  $`  @" $`  $`  @2    $`  @$`   $`  B #@$` @``9$`?  @    @  b #   `?$`$@  @>` `" N! 0$`@ @ @ b@ #$`$`$`$`@` ` `,`,` #`< 2"7 2 - ) &`` b`     `   `( #`㿘  `,, `,@80`2  @@   $ ,  " 2  " "        @`    " $     ?" $  @ @@`&1  @1  $  @ @@`&1  @1  $  @ @@`&1  @1  $  @ @@`&1  @1     $ $ 㿘`   &  & & & @&  㿘?.@6`2 `*  ?  & & & & @x&  `2  2&  & & &  ?& & & & &  㿘?.@*626`@.g<  & & & & @G&  g 2&  & & &  ?|& & & & &  㿘?#@#6*@6/ 6`..7 @ ?#  & & & & & @  @ ?2&  & & &  ? @ & & & & &  fpu_explode㿘.2`&`&` >0 >0:Hp  L9!`2 &@` 2&@  &`& ?&@㿘````) `+` (`1 36`@20```0+"`"` "  ` `'`  '``2'` @ @@'`'`'`'` '`'`'`'`  0    `?㿘@ ` "`` 4` r"@@ "`` $``  2 0`1 ? #$`fpu_ftos㿘@`* @ǒ [N E2`M`4 Y Z"@@V  `@2 9   @& `,@`@2>K] 4 @`@"` ` & q "11 #`,`1?*@㿘@`* @h >M'@2`&J  ="@@S  `@2 @ 5&  @& ! @8 <ؒ `@"' ` &  ?1@&1 & 4@`, &`1?@*㿘@`*  @Qc@2`&<#@  "@@ @`@2 %@   @& $ y `@" # ` &  1@&& &?1 &4@& &`?&`, &`& `@ fpu_implode㿘 >>& &&u&JJ!8㿘   ,@ ,    2 @   " 2  $          `   *`2` (`) 30` @ 1 @@A*`   *`2` (`) 30` @ 1 @@A*`    *`2` (`) 30` @ 1 @@A*` *`2` (`) 30` @ 1 @@A(*`#*`2` (`) 30` @ 1 `$ $ $ $ $ $ $ 㿘 `   `@]       B : "! 1 B  (" @ B 0!    b`    B @ b`(  @@ B 0@!    b`  ` B  b`(  @ B 0!    b B `&    b`(  @ B 0  ! ! fpu_rightshift 1fpu_rightshift 2㿘`  & >H# `r     >H#! ! ! ! ! 1 `_  @   `?@   `$`  ` "2@+(@*@0@(0  3! ! ! ! ! 㿘`      8"  @ 0`  6` (@+32*@@(` .   132+*@)"@"""""?   LL     WARNING: matchbyname not valid on sun4!%s 㿘> ` >`@= `?Iq"`>Il"ذ    9F (fɀ  ( 4("@/obio/interruptinterruptbootstrap: could not get interrupt node from prombootstrap: could not get interrupt propertiesbootstrap: less than 2 interrupt regs. availablebootstrap: cannot support capability of > 4 CPUsbootstrap: PROM has invalid mapping for processor interrupt register %dbootstrap: PROM has invalid mapping for system interrupt register/obio/countercounterbootstrap: could not find counter in OPENPROMbootstrap: could not find counter properties`>` ) !>#0@!>8">("c$ H,$ L$ T\$ `$ X$ $ P`$ d$ l$! $ $ tऀ`>А#4"@>@!x!> $ HC  \ d@)d `@Qm v >@ V#  !>@@# 2>G#Ȑ@# 2>F  >F 0$?>F h )>'>#?P,  p҂@` ` Fܒ@`? @ ,  p҂@` ` `>FȐ @?p@ ?p ">@ !0  @U@!@ 2>F!H@!@ 2>F!x>͐?* >"""` > 8=@>#P?P   ?P*㿘!>!@!>#` `@ @@M# @ |L -x#> V ` @aL /<a'>  L @`  L` @ / 2*@*@L @? W`L , : O`L :  L?$` $`  $L /ˠ a@,@# @ ` (L - #>  L b"a d  a a  sa  $a $a@P L $atwas brillig.. vmelvmesx%cc%c%cobiosiswespbootpath_fake: unknown system type %dfdsbuslecd㿀> `>G=#00N`' (''̐`J@ , `ĒJ@ , `  N@ x>@N` d2>>#@> &#@#H> &#H  . ?& & & `" N`>cPG+@?& & &  $N@>N` cXG@& & & .  i l&`sN` e"`s>#`#> &#` ?. a& & &  $aN`>N@ cXF@ua& & `& $aN` d t r> ">  >U 7 2P>>#H> &#H ?. >& & & #h`" 6#h>#`> &#` ?. >& & & #p`" 6#p  . &  & & "! >#`> &#` ?. !>& & & #x#! && & & #!   >DӐ#>8"`LJ 1 :  : N`>N@cXFf@& & & |  f@N` d`l>#> 6# . ! & & & e#!`l#`sN` e`s>#> &# ?. >& & & c " 6c `. & `& & A"?N` d t r7>#> &# ?. !>& & & #x#! && & & #!N` r  >cE N@>cXE@q& &  & $bootpath: /%s%x/%s@%x,%x:%c 㿘>E"N`>%>#>!> 2  (E b0E ``aE"@ N 2 >E~"H> h hWARNING: %s map is bogus, using default 㿘> `,>#`'>a@ ">@  >#EP `"?@` &` &@L *?Ѐ &@ $L 0` &@sd-targets㿘#>8b !>> "l $b"l. @st-targets㿘#>8b !>> h" $b ". @configure: no memreg found!configure: ROM hasn't mapped memreg!device_typecpuPROM root device type = %s (need CPU)mainbusmainbus not configured@ >"!X> ->Հ`)>+>[/>>њ ,` `=>!!<`/`$` *> @$ @`$``$R >> 0c*: * @*` " R    2`2 >C ' >`,' k'>̀ "`>B   @>@a>@0a >!B @ $ xa@"@'5' 2>BԐ!H <  < H o@@@%PROM sync command㿘>B %d㿘#@>>"`8#@DF@#耢  #@D9 .,%s at %s %saddr 0x%xio㿘`> C  4  0>` > > C  no PROM root device㿘>" 2 &"@? 2&">BW!Pname㿘 " !>!@ @ @& ! reghierarchical%s "reg" %s = %d (need multiple of %d) warning: %s "reg" %s %d > %d, excess ignored address%s "address" %s = %d (need multiple of 4) intr%s "intr" %s = %d (need multiple of 8) WARNING: %s interrupt %d has nonzero vector 㾘@[!>b@!?>!@F  @>@b " @s  >>8" (CF ]  >8>"H(C: & &@ &  ,9>bx @A ? &   >>8"(C <  & (>b@( @?"  >>8"(C <  &!0>> ,   2? " ? @ bB 㿘`@`?@Hxled80 virtual-memorypackagesoptionsopenprommemoryinterrupt-enablealiasesauxiliary-iocounter-timereeprommemory-error`xeccmemctlSUNW,sxSUN-4/%d series: %s obio missingfbno options in OPENPROMcould not find %s in OPENPROM audiozsP> ` > !> >bB! >>@a!> @8!>"B[! 8 @@!D!>>!'  3@2!D>>!c`'''3 >@">!d !d''3  2'0>>"H!| )@v 9>->1>77>>!)>'>!@N@̒  @!D''''3] @_ ! 9>->1>7>@Ӓ!D>!>''''3@  ` >b@% > "b@-!Ѐ &>@K"!'L &)>'> "A@6'8  3 2@%L `Q'> >>!@s  @͐>@Ja 8>a@Ð @; 2 & >b@+>c@' >8b8 "b8b8  H 0+'2 @ findzs: unknown zs device %dfindzs: no obio nodeslavefindzs: cannot find zs%d㿈> `$ "<  "<@ >"8> '''#?> , ' '耢 26 ? )>!@\ ` >+c` >?w#@N #>`@;?>@Kc >   ?]bx@& pre_panic: makememarrmakememarrmakememarr: hope version %d PROM is like version 2 makememarr: limited to %d makememarr: cannot find "memory" nodeavailablemakememarr: no memory foundmakememarr: WARNING: lost some memory 8> `>0 >8"$>8"$$ @s!r >#  " & 4%> !`0$" > >ސ!M O> $$  @ >!@A`>"@; Ȳ \@>ja蔒 >>"(>0>"P>">! )`@3@ے   >  $$   >>"`@"WARNING: getprop not valid on sun4! %s node 0x%x property %s length %d > %d 㿘> `> ? >#` €> 0!?Ș 㿘>#`€㿘>"ʖ ?" ,㿈  㿘>#`€㿘>#@€search_prom: null nodeiommu㿘 >!>"aÐ@@  Ր >>="!'>%>@- #>!@G @  @ ƒ 2 ے WARNING: opennode not valid on sun4! %s 㿘!>#` >?*# `@ #@ 㿘>#`€8@ 㿘>#  8 |@ |€0@' line# >body >user %lx ! ' column# >body >user %lx !stdout @ is my-self addr line# %lx ! addr column# %lx !0>#` `  @ >`> >a(>&@&  @  PROM exit failed㿘>`? > x"@ t@PROM boot failed㿘>`? > x"@`d€>="X㿘>#`l€㿘>L#T$#T>8" *`" * @`@?" > `@$>$ > ( :@ *@ $  ?2 @rdstxdsdxy㿘'>8  h@@h@ې ``?use one of: %s[a-h] %s㿘@(  >># > `Ȁ >5>3>  >  2 ` >   2>>"Hparsedisk㿘`5 @? , : ?.>   3> 2  @  ?  ",  @  2  <<!@ $ $ >aXaX $" $ "aXroot device (default %s%c): swap device root on %s%c can't figure root, hope your kernel is right > !? 'p>*!` @ 'p/>L1>L)>L   >L#H`>  " "H>=^"H>>`"X  a =O >=K"hx@  @@ t?L *  ,  t    > />L 1>L<)>L#> p @ /?-'p=bp >`"X  b<<bh@ ߒݐ`>#l*` €?v* w ! @'pt%Lp&#P (%#T #/>L ,` ,  >L2 `"#L*` 1>L ! @&#P'p>L?'p "cPp>L"#TD>  >>G"0>%HI"`>LL>) `"p2`%H `  : , ">`a"<?<"01@0.#T>2` @2 `: 2#T%#T"?#P!X#T&#P!X  2L2` `  @ ``D<`` %c㿘 '> "+  @   #@ @"   #  @ @<&H, >#?<0Ҥ<H0> >><#0Ő#< ,config_attach: device name too longx>  Ȥ>`8:o  @@```@ 2`㿐gcache enabled 㿘> <x>""@>   > "cؐ Т@ Њ@@ Ъ@@ >">;!㿘> >`0?* >>"b"ؐ Ԃ Ң  Ң Ң> >"!;}"㿘!> @? Ģ @; ܖ*> 0* >"">"ؐ ւ   Ң  Ԣ   Ң  Ԣ Ң>T "`"  pК@ `к@>  "">;6!cache_enable: can't handle 4M with hw-flush cache㿘>   @> 0?*@ >>>?""""c@!#> @   ֢A@ ֢AЂA   @\ :>! `!$ >` "`>9z   :a㿘!> @ Ģ @ ܖ*> 0* >"">"ؐ ԂԢ>`Ā` > @ 6>ТA@ @ > ܀  @   آA@ آAЂA    >"`:㿘> > 0>*@ >"""ؐ ւ  > @6 آA@ آAЂA    ֢ >"`:~ᰁDVMA coherent 㿘%>@:@6*> 0* >"">"ؐ Ԃ̘ !> @ 6>ТA@ @> ܄  @   ֢A@ ֢AЂA    Ģ&҂@@" >:1" >"`:,!>ڄx >`  >`(>Ѕ: `, Т0 ``8 ` Т>ڒcx`>"`* * 8>8  Ģ@@ >ڔx>"* *`* 8*`>`"`>`(>Ѕ: `, Т0 `8 ` Т>x>ਆ x` Ģ0 >,఑:? ଆ Ƣ?㿘#>a >> 0>ڠ x '>%>( `2 ,@R"@`  . #, Ң0(`" .@ ` Ң0c  2 `6 6 y `?06>>#xఖ  ࠄଓ:@  "  Ģ` >ڒcx`>"`* * 8>8  ĢB@@ >ڔx>"* *`* 8*`>8  ĢB @ >Ж,>>`x:`? "x Ģ? 㿘㿘> 0 >> (#x  >#>``,2@# @`.$.@ "` ԢB@0c  2 `?6 6  `?0c  2 `t6 0]  Ơ  Ơ Р㿘L0>>ࠇ8   >耠2> o ??  Ģ>>2` `$ >>2` ` `?>>*  >>2`6?o >>(( `?>9x2@?0 >> * @"*   n* ?㿘@2  ?`" ` @&0&` <* & 2` fp align without being the FP owning process㿀`,   2` 2`>> ?bА  @` , 2  ' 4`H*   '* ?@ ,o  2` *`: '2`  ` '쀢 4`H*   '* ?@ ,L   4   '>! >6 ЀW/!,`2 !, * ='* 8$  2  ' 4`H*   '* ?@,   `` 2    $  4`H*   $ * ?@ +  m`  +a`+֔  W"7 *  6 7?7+Ŕ E`2 !, | "2    * !,"@.!,002   * *  " `H  + ` 2    * *   " `H  +  㿈 +v  2 2  2| +2   ' 4`H*   '* ?@ +V` 2` *`: '2` `  '쀢 4`H*   '* ?@ +1  `7 2  ?`; *> H€( % H  2   * *  " `H  * `  㿘    `? @ &@6   . ??'  $(,048< ?ݶ@        6 .  `2j ?6 . ?6 8&stray interrupt ipl 0x%x pc=0x%x npc=0x%x psr=%b EC EFSPSETcrazy interrupts㿘 > > "5tb> >"  >b   "b>3" >""㿘>#` > o > ڋ> ` 9 L / H >`h"`hH 0 ,  @<@j  ! J` #*` Async registers (mid %d): afsr=%b; afva=0x%x%x SYSERR UNCORR TIMEOUT BUSERRAFONMI: system interrupts: %b fVMEfSBUSbKbSbEbAbSCbTbVIbMIbFbVbMbIbMEbMAnmi㿐!>!8''€ 2  H>>  L 4ə3  H  ?p>> 4>3D!`intr_establish: level %d interrupt tied to fast vectorintr_establish(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%x㿈H >b:  >!3  >> `6>`4. !`>"!,>"!X" : ?.) 2   @2  (R@">> ?) .   >(R#\#`#d"02Ք>>. "@@2"&`H 0 intr_fasttrap: already handling level %d interruptsintr_fasttrap(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%xx>`4. !6` cH >b:  >>>".  > 2> `2>">"!,!X" : # )@ 2   @2  (R"  ?) .   >(R#\#`#d 82T  q8  '''  N@.^   `H 0setrunqueue㿘! `2 >2-"> * >Ւb+ " & & " "@remrunqueue㿘!>2 8 2 >2 ">b"  +` "&   * ( vm_map_lock: failed to get lockvm_map_lock_read: intrsafe mapreal mem = %d startup: no room for tablesstartup: table size inconsistencycpu_startup: cannot allocate VM for bufferscpu_startup: not enough RAM for buffer cacheunable to create DVMA mapunable to allocate from DVMA mapdvmamapunable to allocate extent for dvmaavail mem = %ld using %d buffers containing %d bytes of memory 㿀>`8>#P?H    > `?H?L0#> >>L"a2">b'>(>* 2#X>̤b(@ >@  *@ V >1W#h@"">>>1N##H>* *  ㈒b ?њ ">1:#>>'cLcH@u>`0@( : + >>"cL>>L cH@a@'쀤+>1>13>լ ,@`,`,+d cH'>     /_ 0> 0 `8  >b(@cH*㈚ #\ >>>`"c8??&!X??>P &aP  >>`"#@>0  aP!XN" !X@aP>0 0> X#\  *h >Հ "aX>0 ``, &':   "`,>`"! g:`  @b>  #\ a>> 1"c<>̔b(> 1*@ >>`,!>L*֠ cH1 >`@В(p@+=㿘>!x>a* > "!|*+ >Жᘠ "@ >""*` > "!*+   > "`* >  *">a ?a`> ` "!` > " ؕ*+` > +  " *@  >>*`"@ >L" P*`  >b@] $L>>cH  L $H $HH  $HH ̓*`#3@(H$3$HH>`,* @<L@@6$L>>D  H2  :  ?!"D!"DH>* &. "bD㿘!0!( ?&!0!,` `%>(ڐ$  *&!,@* P$`D= #$ H$ $ $ $ ,&㿘`    ->>#T3>>cPcP  cP = >gb<>"$(  `H @` *@   $  'H'L>H?Pb   'P'L'T'X'\'`` 'd`*'h@'l`'p`0't @   0'L'DxD%?@. H%c ?&   , *@ >&>&`TT=" #" $``$`H$`$`㿘%V@.͐  В @`23   ˔ ", ` ` !($ `< @ * #` # `# `# `# 0`# H@  $a  a ?"a `?" @& ?halted WARNING: not updating battery clock attempting to power down... WARNING: powerdown failed! rebooting 㿘> `>0.#~>  "!>>\ >b >ڐ h"b"\(>0#H/` /! !" >>/# @>/#>/#E@>/#  > s*`  @ d*@  -**@ *8㿘>L#P"2 >8* "@*` `@ @)\>`(> *@  * $ $>>>>"ch"d>   dumping to dev(%d,%d), at offset %ld blocks dump area unavailable mmu memory @%p:%d device bad device not ready area improper i/o error succeeded error %d 㿘>%`@>LcP?>>#d`%>>h>L#P>2 ` /R"P>LcP>82  *⠒"@ *`` >/A"?>L>/;"0P`2` `*`" * h>/."@(@(Ȫ>(>* /!>a>? H"`F`` > ,< >/ "? /#->7>5>"@ 8>,  .4@ @Ԕ>LP@P@@`2 4  ڨ `>"-` €>.ʐ"0>.Ɛ"0>."0 >."0 >.#0>#.                       Frame pointer is at %p Call traceback: pc = 0x%x args = (0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp = %p 㿈">.u"p>.r"`'>%> 0 <  $ ( ,#\ 4#` 8#d 8.^#h 8 (4@4 " 0mapdev: zero sizemapiodev㿘> >?x" b(`8 `>,# @ ? ">,#> 0( >   * . #>3>`8cP   (&㿘@n  curproc = %p, pid %d no curproc uvm: swtch %d, trap %d, sys %d, intr %d, soft %d, faults %d stack trace with sp = 0x%lx stop at 0x%lx 0x%x(0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp %p end of stack trace 㿈>"`">>`4- !>- !>̤"( \> l! `#> h X d-#\"i>-!H > *@ !h-(  * @> 0ax <  $ ( ,#\ 4#` 8#d 8-#h 8 2(>-!g0 panicw: case 4 w: unknown case %ld w: arg not allowed 㿘N@  t>0``>0>+">-U"0 -R#0 0-L# warning: ldcontrolb called in sun4m 㿘> `>-7# H/` />b`2a$> ` #]$` H p@` * ( 22$  *@ `   `" *`0*@2@  `  *@㿘!(#< P 㿘!(!<@ P*#2@<!( " `  !( !(`  㿘!,>># #! 㿘!,`# !     4      mmrwmmrw: out of space in kernel_map㿘, >c  #>##`$#!b # #!>#  `$>c> y,$# # 2`>*ߐ" `    ` ?&@ &`>*̐">", €` @, >",#>, >`#Pc >   8   > 0>` , @ `" @   c   c ,@”@ g`` ?G#@> ,?H@ @   8 %>"Ѐ@ `>!@  2   "@ @8  @ 8  @?  B (` ; &`8 > `" ` #>a  %>, Ô ,@$a  ,@8a  8 `  "S@ !># #֐ $#00000000ȁ - ->   㿘># `"  @ " @  㿘#  a &, ?㿐#@2>! &`>c@ >!@ >ՓHo oPH p@  $>#0`''@   #@N@ܰ 0c@c@m 0Ҁ` Ho o€H 0 @` &   'Ho o H p@Um`o^  W xHo o H 0 @2_ ^A`C2 2SHo o€H 0@) @ $&  2"< Ho o€H 0>`% ! Ho o€H 0>"#& "   vm_map_lock: failed to get lockvm_map_lock_read: intrsafe map㿘> !\@㿘>c> 㐠і >!`@!>"0 @")4 㿘>c VA2PA: Asked to translate unmapped VA %p㿘 `#҂@   ?.  %$Ң` ` `? 1?` `?1?** ` `>?.  !((8  2( $(@2  ?(:  㿘>#P0 Ҧ`z㿘 @*`   `  6"@ @:"@  * >$ @$>>"ā"@pmap_page_upload: no memory?㿘!>> " "  ǐ>ڒ" "  >'͐#P>@ ">>Є   0`( ,` ` 2 @  ᰢ @>>̤"(b* @  2@2$n ᰢ`@ > @ 7 >0>2@#Жd >`08*`@* 0@ " "`080?>  *`d (  #mmu_reservemon4_4c called on Sun4M machine㿘>   > '?!>%?>/?"b"!2 >%?>/?"b"!K>#P1>4*` $* ``⌀`@Д`>>ct @&> \?  +>)>#a? 4#c @2 4  ,  2 @ *` ? > ,Є Ф? *4&'mmu_reservemon4m: no existing L0 mapping! (How are we running?mmu_reservemon4m: can't handle ROM 4G page sizemmu_reservemon4m: unknown pagetable entry type㿘 !Ђ* >`<  `T   Т@Ђ ```> 0 > 0> p> "@&#> &#@>&#`< `T  mmu_setup4m_L1: unknown pagetable entry type㿘?. # , `$* @҆ ` (  .  )> ? @ ` `*@*    * ` `+` {?  ?*  @  &0! Ǒ, mmu_setup4m_L2: unknown pagetable entry type㿘?.  #> @,  ҆ `   "  ? @ ` `*   `+  z?  @&   %bX ?$@mmu_setup4m_L3: PTD found in L3 page tablemmu_setup4m_L3: unknown pagetable entry type㿘?.  > > ֆ     + `@`.`z %`%c  ? me_alloc: all pmegs goneme_alloc: LRU entry has no pmapme_alloc: stealing from kernelme_alloc: LRU entry's pmap has no segmentsme_alloc: LRU entry's pmap has no ptes㿈>!P!P 8'P` "`" "@$ $  "@& $ ` $ `"&`>#,>Ւ"",0 "04 "4.`$* P*  @ 2`P$ )4 >!0 !0> %: H 2>> %3 h#P2> %, ` "`" "@$ $  "@>Ր" & ># 4 0`" 0" 4 * @$*` `2 > % * @'@`1 > $ @ ) >)>` 2"Ң>Ю@>!P € > 2   *`* #@ * : *` >>`   "Ң>Ю@>   Ҫ`  Ҳ` >c?? c>P!.*` ''/>+>Ɔ#  7`>#И` > 2`@: * *2`@`# #@  2`@: `2`??*  *` 8 @" $@,  >    * : *` c Ԫ`c c   *`* @  * : *` Բ`c  2  ` "` $  "@ 誀@$ `$ `"@&``$@*  @ 2`P$ 4 4 me_free: no segments in pmap㿐>.`"* @ *  $* `> `2  ** @*: *` > `  Ҫ`  Ҳ` > ,>>c!%>->ހ@#  7>#К ` > `2`@: *@@ *2`@#@   2`@: `2`??*  *` ; @" Â@ ` "` &   "@@2>> #"#   *`> #P2``"  "`>"" "@0?"0`"  "`>"!4 "@4?"4# #P# "@"`, "`,㿘 0 6`+   $* 6` `?*> `>#  `6 І@ "1?0/?@H /f * ' > !0 > `Ԯ@`>Զ@`>> ,`Ц@`@ H 0 㿘> `   0 4H /f>* '>x`  t @#@"x+: |@\@"|??""|`> ""|>`|`t,` "a  @ `   `0&`44#@& F&  @@H 0 >!X@>   $  >Є   ?>`    Ъ`   в``? 12 >Ѐ,,: $*` *  Ӱ0 !>!`@ ,,` p:   z"@ >!X@ "Ԣ@`H 0ctx_free㿘2>>":! `&"> @>a )`a` >Z`  ">@>!X@` "Ң` "Ң.> Ҫ@*>  a`  0`  " @ "Ң` >`  "Ң> Ҫ@>`x$"`xpv_changepte: pm == NULLpv_changepte: no segmentspv_changepte: pte == NULL㿘H /f4 * '    H 00 @  ->Ш 2>!#4`*` $* 4`  `?>!#ȗ*` ># `@  2>!}#耢 2<` <`  | *e$ % > #( \@ * `@ T2 ?#@?#@(I Ҫ@@>!L@  @ >`Э```е`` >Г<`  ( `<`  ( `?*@ @  <  @& *@  2<` <`  | "@    $ " ?$ 2m @@H 0pv_syncflags: no segments㿘.H /f4* '   H 0b  @@ S??#  +>4`*` $* 4` `?> Ő#*  >c "4 Э@@@>!L@歀@>`  Ԭ`Դ` 2<` <` `( `( ?* @ 6<   @2%  @@H 0pv_unlink0pv_unlink㿘  > n!, )>c   " &  # &   & &   & )  "&  " &  ??& !>#`  "` > 5! 2  2  "k #     >"    2 #`"`  & I㿘 ` ` >c` "` & & B& ?& > c` "` 2%! " " ! ## `&   #>b # # "! # > "`"@"` "` "` &pv_changepte4m: pmap == NULLpv_changepte: invalid PTE for 0x%x㿘H /f4 * '    H 00[" O??#c``>u H>  > #( \ ` `*/@`((@"Ԣ>aL€ 0Ң`  " > hH: ` & *|``  $` "@` ?$` @`2`"@H 0㿘^H /f4* '   H 0< " - ϒ "!" Т@ pꢀ`  2 `<    @>!L@ p` ?|2% "@H 0㿘  >ː!, )>c   " &  # &   & &   & )  "&  " &  ??& !>#`  "` >! 2  2  "Ȓ #     >"    2 #`"`  & Ȕ pv_link4m: pv changed during sleep! 㿘` %>   ` "` & & H& E&  #뾔   2 >!t #  `"  ` 2" `  $ `&  ~ >b " 2 $ $$  $ $ &㿘0H /f4 * ' * >`  "" @"' %>  ` ХLЬ@L@  2 `  "0@H 0㿘> ,>"b(> (>`: >"`@Ԟ@pmap_bootstrap: unsuitable number of segments (%d) 㿈> 'D'H`'L`2 L> " |> `>ѐ "`|L>>"ct>&`d1>&#%>>"b'>(>"`)>#>"`P+>a> "`4-><> L"c>X>&>(> >%>&!>&#>>"cX"ta؆Ḟ`#pc|3>5> 7>9>;>> >>?&b&&8' 'b a!""  " 'L " ">ؔ >D`P `kHL*+>->/>3>"$ ,` ,`@* @ # ?2 ,` ƒ> >  cܦL>*" * "`@c!>$ t>"PaP" %aP0" %0" %>̐"( >А * `, &cPcP'"`>"b>?"!>#P% \  @  $ x  % \`@ & c? >Ւ @ #>%>?""|a'@ 2`<  < ? >>ࠐcP $>ղ b'>   `? D4   D @  `'D`@$ $ "@& $`$ `"@&`>`0> "`0P$44``? ?%@4* @ 2` >  *  ` - >`(>ࠑ*L  >Д"@  , Ҥ@ >>>!Pc4$$"@",L ", > \ @ 60 > | + @@ >>c   ` <   '8   ?Ь` д`  怠 @  Ԫ@>>Жb 4+  c> , Є Ф rp->rg_segmap == NULL! 㿐>'b/>%>#X>#`8>'3>&`8 ->%>'a7>>%&5>͐#&>"cX>'9>͐#>)>!>#>)%> '>)>>'!8"|#> >>> > `h;>ڒc+>1> 'b b#c& ! P 4 `P " "$","( `@!> @>ڔ ` ;>)>9>5>Ց* * * @#%@a ?"?*> >  cܮ#>`\$`t* 'cP%@Đ>̦"($ `\* >cP "!@ , @$`p <%"@%'"ܮ@%& @% * " > "`' $(: $,``pz(  $`"ܓ-@-*``$k`(-@ 2 @ cz@% @ 2 ->|#>- @$@-  , -  2 ,@  z@$@?a"ܠcP/>`,>"PP"`쨐>"b?>"!>&\  "x  &\ & &>?#>"`@>"`|>>#Pb4`* `$@*` 4` ! >`*@2 ` >a@@ > `Ѐ@ >Д> 4@ @ >Д> `<`  |<` z>,@@ ˑ4`#>a  >!@> `В>!@ʔ" @㿘 "Ң!,   $Ң` p2  ?!Т@ $Ԣ`㿘> `  >#t>`$+ +א 2   #  !ΐ 2   @  !Ő 2  ,"@  & & ppmap_init: no memory for pv_listL1 pagetableL2/L3 pagetable㿈>#Р`  >  "@  >̐"( >+ @ *@   #>"p > "" *  >  >>"#p!>#> a>>#8b$$  #\;`8w#h>>;`#b#\#h!! 8k 㿘> `>!@ Ԃ@`>!`  >  >0"@ 2@ @P 㿘>̀@"(%>#>8cP  @@ 㿘     "  @@ @@㿘  "++J& >  & & $&  & & > 9P#8& ( ( & ,   z@`> c @z` & 4㿘   ? & @ "pmap_release: segment list not emptypmap_release: releasing kernel㿘H /f * ' >`    ">"    >"@ĐH 0 "`; "`   >  >"@> (9#8& ,& (  " 㿘 V>#P>  4> #>`  "0 @H /f@* '@'  6` ?`6` * ** :`* @ **  $* @ ` @@  H 0   "0@㿐. $* @@ ` / ` ` ' Ԫ@>`(&2  >!P €@>a  @ @]>#a@ >P ,)>G 2>>!L@>#Ф  `)>> 2`@: * *2``# #@  2`@: `2`??*  *`  <  @"   Ц@ ,@ @ `(,> `../ @: /  > \ > >c  Ԫ@@Ю@`ж@`Ő ` ?-` 㿐. $* @@ / `   "Ԣ>`(&2  >a   aP€@a  @ @g>! >`  ?* `>U ,<+>Т?Fp>!L@>#Т?6 `+>p> 2`@: * *2``# #@  2`@: `2`??*  *`  > @"  z` ?* z`,@ @ >` ,pmap_rmu: no segmentspmap_rmu: no pages㿈. $*  ` T /`>" `H >>"(c 2h> `2>` >`  | @K>#a =>7>#И ` > 2`@: * *2``# #@  2`@: `2`??*  *` 'M$`,@@ `- "% ` ? -` @ "%@ > (&2@   ֪@` >!P €>a  @   Ԫ@>`  `>`>` > (>`  ` (>` `?*@ e ^>L  2>>!L@>#?,  >> 2: * *2`# #@  2: 2??> * *`  <  @"  ' Ф> `2< <  | "`,@@ `9-> `./`.: /`   >` >> Ю@`c ж@`1 "%ݒ ` ? -` @% "%@>   0@"& 0 4"& 4㿐'P.$*  ɺ / >" ` `2>"( "Т@> > ('@2@ ` PP€@  @f` >`  ?* @  V/><G  >!L@>#Ф4  `/>> 2`@: * *2``# #@  2`@: `2`??> * *`  <  @"  s p` ?* z,@@ >` `4.> `/ /  P* ! Ң`/   z>5& ? ,  " Ң`P(*@z@F "5$pmap_remove_all: empty vregpmap_remove_all: empty vsegpmap_page_protect !PG_V: ctx %d, va 0x%x, pte 0x%x㿈>>"0cЙ6 ` > 2`@: * * 2`` #  #@2`@: `2`?>  `*`@ *    ` ` 0H /f4'* ''   H 0쁊 0Ԋ@' 7>А ? '4- $*  4  `?>o#*`@ ``2>e#(,`>` @2`  @< O |L< @㓒 "&@ ? - ㊒ "$    Ԫ@>aL€0@ >`Я@```з@`` > (<  ` (< `?*@ ֆ> #H: @`'@`W 2> >  | @M">#P2> \ `> >c  Ԫ@@Ь`д`ے ?,-   >> Ю`@c ж`@ "`$@ ? -   "%   0@"$ 0 4"$ 4 # 3  ' ' 'Ъ@@H 0쁊 pmap_protect: last segment㿘 0  @H /f@* '@ +>Ю -/6`+ @  $*``6`  ?`+ + `:`* @ >_ 8 "p+` ` 2`g>c `  >`  |>` @V> ",@ @K@ #  Ҫ@@B@>#'%@`$ @ $`$`(>aL $`(€Ц@> ,@ @쀦@0%@``+`2 Э``2 е`` > (>`  ` (>` `?@ *@ > ,Ђ@ Т@@ @@ @ s6`H 0 @pmap_changeprot: no segments in %d pmap_changeprot: no segments in %d! 㿘>",>cP .@  !!`  @6` ?6`H /f * ' +   $*  `2 >#>>#  0y +` " >c    > ` >`  |>` @ R*G"@@@   Ъ@@@ @> 2,>!L@&Ъ@@>`    Ҫ`  Ҳ` >Г>`  ( `>`  ( `?*@ @ @.@ @H 00  `" H pmap_page_protect4m: empty vregpmap_page_protect4m: empty vsegpmap_page_protect4m: !TEPTE㿈>"0>6 К `> 2`@: @** 2` # "2`@: `2`?>  `*`@ * `` ( 0H /f4'* ''` "H 0 0҂'쀦u  6 -``$*  6 ` ?>",`  2?>", @` "`Ԣ>aL€0`>    ":>q"ؐ @@ z@ 1>#P@,@ -`,` !`,` z>c1 % ? , @ "`("``(-`@z@ "%1ސw # 2` ?& &&"Т@H 0 㿘 }@0vK"H /f@* '@^ >#>Й6``+   $* 6`@ ?+ + :`* @ > 8 ` *@ 21 " Ң> ($:@ @%' $<> c >`  @ >( $(`>!L@p`@z> ,@ @>` @ >БH 0"㿘>",>cP .@     >` "`H /f * ' C " Ң<  2p>!L@p Ң`"⢀  ?` "`~H 0㿐 q> |`>`  i>>cp*   =: >̐b(>  Й6  `#>> 2`@: * * 2`@` #  #@2`@: `2`?> `*`@ *  !>̈#>"( ?6 *@   @cP   @  @ך @㿐6`, $* 6` `?-  H /f * ' > # ^@`6[ #@ @  H 0ڔ0@I >#?,@ 􀢠 > 2: * * 2` #  #@2: 2?>  `*`@ *  @   Ԫ@>aL€  ,  @ N@   (>Ւǐ" >4  ` >А -` \ `?Ԫ@` Ю@`ж@`> ,?> @  Ң @H 0pmap_enter: segment filled during sleep pmap_enter: pte filled during sleep 㿐96`+  $ * 6` `?H /f * ' > *`-> 0 4" 2  :  & & 4    & 0 2  ""L ` >!;" ""># $,  ?4  2 >  "*& ` >!"Ȑݒ "h , $  ,      2>` >`  | '    Ҫ@@>a  @   Ъ@@ 2 ֪` ֲ`  > (>`  ` (>` `?*@ `6b #@ @ H 0~ < & <?& <@L >#?,@ 􀢠 > 2: * * 2` #  #@2: 2?>  `*`@ *  폔@ >!L@  ,  < & < @ @  "    Ҫ@0  Ъ@@ 2 ֪` ֲ`  >Г>`  ( `>`  ( `?*@ @  2>` >`  | $H 0㿐 v@?x*  `@` <@=>>#p`8>̐b(>  Й6  `#>> 2`@: * * 2` #  2`@: `2`?> `*`@ *  >̂#>"(``6* @`"cP  `@> @  ``  $ "  $ "pmap_enk4m: can't enter va 0x%lx below KERNBASEpmap_enk4m: missing region table for va 0x%lxpmap_enk4m: missing segment table for va 0x%lx㿐=#@6`>#"  * @ $*` 6` ! H /f4 * '   >#"P `>` >#"  ?* @ `2W  <H 030_Fp>#Й2 ` > 2`@: * * 2`` #  #@2`@: `2`?>  `*`@ *  Ô  "Ԣ>aL€ p ,   7`* /@ Ц` ?*`@z@H 0pmap_enu4m: segment filled during sleep 㿐6`, $* 6` `?H /f * ' - >` @ 2` ""Ŕ @` >$ !H| "@"$@,` $`` 2!@># ,` ",,Ő`$`   ? z㬐  (2   z@@ 2+ ?># +` >! u"Ȑ, ,$ ` -  ,`   ? z@``2   z@l *  `2^  ?<H 0/ < m& <?j& <J >#Й2` > 2`@: * * 2`` #  #@2`@: `2`?>  `*`@ *  츔  >!L@  , < & <  7` /@ " Ңp Т` ?*`@z@H 0>  㿘 o6`*`  $* 6`f `?*` >#  @ C# @@  j> `2  "Ң0Ь@@؆@( 1>Y    "Ң Ь@@    Ҫ`  Ҳ`  > (>`  ` (>` `?*@ ؂ @  > `2>` >`  |  6  >>`(?0+ +@    $ 2((  2:  > 0> 2( ?* > $Ơ`㿐>>"0cЙ6 ` > 2`@: * * 2`` #  #@2`@: `2`?>  `*`@ *   v $ 㿐>>"0cЙ6 ` > 2`@: * * 2`` #  #@2`@: `2`?>  `*`@ *  2 "    2   㿐>>"0cЙ6 ` > 2`@: * * 2`` #  #@2`@: `2`?>  `*`@ *    $ 㿐>>"0cЙ6 ` > 2`@: * * 2`` #  #@2`@: `2`?>  `*`@ *  2 "    讐   㿐>>"0cЙ6 ` > 2`@: * * 2`` #  #@2`@: `2`?>  `*`@ *  { > $ 㿐>>"0cЙ6 ` > 2`@: * * 2`` #  #@2`@: `2`?>  `*`@ *  {2 "       㿐>>"0cЙ6 ` > 2`@: * * 2`` #  #@2`@: `2`?>  `*`@ *  { 麐 $ 㿐>>"0cЙ6 ` > 2`@: * * 2`` #  #@2`@: `2`?>  `*`@ *  {2 "    v   㿐>̠"(> cЙ6 ` > 2`@: * * 2`` #  #@2`@: `2`?>  `*`@ *   "(" `>>#p`"(Z "(`?6* <>ٔ #PԤ> , Ф㿐>> "( Й6  %>> 2: * * 2` #  #@2: 2?>  `*`@ * >! `( ( ?6@ 6 *@ c(  > 3 : *@ * 3 @  #@  $?3 :  3 ?>  `*`@ *  (>! `(Ȑ (`?6@* <P  PԤ@> ,z>!L@ Ф Ҥ@㿐># ` #>>#P>#P c$c$$ >̤"(> cЙ6  ` {> 2`@: * * 2`` #  #@2`@: `2`?>  `*`@ *  ( >! `>>#p`(Y (`>6* `  c$ 0Ԣ` z@!>#$(#$ 0Ԣ`>c  z㿐>#(`%>+>'>!>#P#>cP$0#P %( $4%c,>̢"( >6 Ш  `> 2`@: * * 2`` #  #@2`@: `2`?>  `*`@ * >! `b( b(` 6@6#Б*  > `2: *@ * 2  #  $2: 2?>  `*`@ * >! `b(襐 b(`>6@* `  0 0Ԣ`(z@4 0Ԣ`c,z@>#4!>b(K#0>!L@#0#0 0Ԣ`>c( z>c4 0Ԣ`>c, zkvm_uncache: table entry not ptekvm_uncache !pg_v㿐> `2j" Ң `>!>#P@  ">>*=!`#в4  `0'>> 2`@: * *2``# #@  2`@: `2`??*  @*`   l  g " ?  Ф`|@<2,>!L@,`"0^ ]>#a# &>>*ݐ!#в  `'>> 2`@: * *2``# #@  2`@: `2`??*  *`     ,2,>!L@,`kvm_iocache: 4m iocache not implementedkvm_iocache !pg_v㿘> `2>+s  >+ >І  h Ц`,>P2$$  ` *` (`"8>|@:88>؀" "@㿘>   > 0 >Ң㿘 H /f * ' >" B > 0!`@> ` "Ң0 Ҫ@H 0㿘>!>` * >c >8 * > 0>`(>㽀> `  "Ң"  Ҫ@"#ʠ'>`(>ڑ* >`?$ ᰴ ' # # ># `  * # # > #'>L$  P" ``4  ?'>L' @$  `P" `4@  ?2' (>>"/>L   ?? @$  `P" Y`4@ >` A>#  1>`  `>`> 7>LЄ' @$  `P" &`4@> ,?  c >>` c  Ҫ` Ҳ`>LcP"㿘H /f * ' > 0>. H >`  " @  "Ң Ҫ@ >#Pۆ   H 00/ 0Ң`{. 0Ң`{ 8>ք H 00Ф.֤>!H €  "0@H 0 svr4 gethrestimesvr4 gethrvtimesvr4 gethrtimesvr4 setpsrsvr4 getpsrsvr4 setccsvr4 getcckgdb exec4.4 syscallsvr4 syscallinteger overflowfix alignrange checkclean windowsflush windowszero dividebreakpointsyscallv8 store errorv8 idiv by zerov8 data errorv8 cp exceptionv8 unimp flushv8 cp disabledv8 text errorv8 r-reg errorlevel 15 intlevel 14 intlevel 13 intlevel 12 intlevel 11 intlevel 10 intlevel 9 intlevel 8 intlevel 7 intlevel 6 intlevel 5 intlevel 4 intlevel 3 intlevel 2 intlevel 1 inttag overflowdata faultfp exceptionalignment faultwindow underflowwindow overflowfp disabledprivileged instructionillegal instructiontext faultasttrap type 0x%x: pc=0x%x npc=0x%x psr=%b EC EFSPSET%s[%d]: unimplemented software trap 0x%x trap T_RWRET 1trap T_RWRET 2trap T_WINUFfpe without being the FP usercoprocessor instruction T_CLEANWIN T_RANGECHECK T_INTOF 㿐>̒b(`\`@ 3"`\  D @ ߒ   : 2 > `"`&&>.>. h` >? .  >? )>" 2 >ڠ h $!( !$#  "t' e 0; q  05 "' ؀ 倦 0+ $ * 0% (>. >.   0   0 0  0(??"q` 8 4>?#0`>.>. h?`'   4>.! 3 ' ږ @Cj #>?1>N Ԑ'  Ȗ   Ö !,  >ڒ * !>>cj!$!,>#耢`2 '    q#>a !,$a &@! $ #>? >.` >._ H` x @  ` "$`>.O @  H` a @  `X``X @  ` ?>./ k$`!0 ʪ "Q'  C #>a>.!"!,$a!,N#>?  / >. !('  & '     `'&&  (!H>.!X `'&&  Q#>?!0 $!0`&&Ӑ!h `'&&  :#>?1>3> 耢`  ,( @ 2  ! ,!c4`   ,@ $c4*@ $ ,Ԑ", "2 ,H /m * . U  D`" DH 0 ޡ 耢`  ,( @   ,  Ԕ" !.c >!@*&㿘!$` ` 2 x  xd @ 2??  @$` 㿘l!$" text fault: pc=0x%x ser=%b WRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGkernel faultdata fault: pc=0x%x addr=0x%x ser=%b 㿐>̔"(\>"` "\>ڠ h  д> |`>  p @ @   @.1 2!$H/` />0>0"@N`>0Ӑ" "> >'#܀@M> `2J!$=# >cո ;!$$!(  @   ] &*`Q`՞  耧   > 0>> (@ "@ ܓ2@ @8&  "   `5 ,`` !$   ``H/` />0>0""`>0f"'`'`@'    Ϙ`s1>?#>%>x 耢`  ,( @ Ő  ! ,!#4`   ,@ *@ $ ,Ԑ[b, "2 ,H /m * .   D`k" DH 0 4 耢`  ,( @ ܁  ,  Ԕ"  !,@ >!@*'@text fault: pc=0x%x sfsr=%b sfva=0x%x CSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWdata fault: pc=0x%x sfva=0x%x sfsr=%b 㿐>̖"( \>` " \>ڠ h Ѐ + `` `>!t @ @`  `  {` (>?c8q @"c8$Ђ`  j`#Ђ` `@.  @`  @`2[!$`3 2!$H/` />1>1#pԘ>0Y" "> >'#܀@9> `26!$=# >c> '!$$!(  2 耤   > 0>> (@ "@ ܓ2@ @8&  "  (``"'!$   ``H/` />1>1#В{#>0"&|&  m`s#>?%>'> 耢`  ,( @ c  ! ,!c4`   ,@ $c4*@ $ ,Ԑ, "2 ,H /m * . ˆ  D` " DH 0  耢`  ,( @   ,  Ԕ" !, >!@*&syscall cpcb/ppcbsyscall trapframesyscall nargsp>̒b(`l>ِ "`l@ @>-b"0> !$ ">3Y #@" >3Q!$!(, `0 Ъ 3   0`0`4  >ِ"h  `8  .  `* )T2`؀$`H>3!!("-`@  \8*    @`2D T = *ɒ   @`2`4 T`4''Ш??, 2 Ѐ&`0 &`4  `    @*@`&@&`  `- @`@@&@&`&`0&`#>?%>'> 耢`  ,( @ 0  ! ,!c4`   ,@ $c4*@ $ ,Ԑ, "2 ,H /m * . S  D`" DH 0 ڟ 耢`  ,( @   ,  Ԕ" !, ` 2@ @>!@*&@㿘!( !>?#>'>` 耢`  ,( @ ٭ ! .!#4`   ,@ $#4*@ & ,ԐCb, "2 ,H /m * . А  D`S" DH 0  耢`  ,( @ i  ,   !, `    ,   B  pagemove 1pagemove 2㿘> , >4 @ #!>#P)>%>'>4 € ( ɐ> 8   (@㿘>c@M㿘>̢"(` .   >#耢`2&@`4  &@>c @- "ʣ  㿘>̢"(`@ .@ @>#耢``6@  ʈ dvma_mapin: null page frame㿀>?#@`+>b(#c@b(  @ >0 8 >д ( @ :@ Ho o>!Xc@? @ #\ #`#`#d 4H p@ 9 ??+)>'>7>5>5%> € b(> `+    8P   ?(? '޲@ >a 2aH€dvma_mapout: extent_free failed 㿘> 0>b,.  >а  `. {0>#PДH/` />aX >5 #H 0>a aH€vmapbufvallocwaitvmapbuf: null page frame㿐 0@2 ,>6m >`  H& L",8 @ "@ %> h  ,c''  >6`"& H1>'>%>6#>> € >9!`"cP 8   (  @ 'vunmapbuf㿘 0@ H>6"h>", 8 @ " >c@     L>& H& L   @ <H"@ cpu_fork: curproc㿘>"!$ a$(H $`>ڐ h" >6#" !,>!  *  * T!&a,!,!%&a,% @ &a( P& H $  & >4& 4& 0P!$  " >'#| $ $ $$ !$P" >'#|  """"㿘!,  #>a2$aʒ *̐"!G 8 !X&66&(!( PL!,>! 2!,v !,>!@dŒ!"(H ''   '#\#`#d#h#l G !X #\ #`#d#l#h6   &sdcd㿘 ( ?`>7"8@d3   >7"@@d,  0> `$```N` s  4@     2 4N` s24C 4*,   "$`disk label read errordisk label corruptedno disk label㿘< 2 #&< 6   " "    #" @&& K&ia(' D' T' @( ' 0' <@j 2 Hz" ' 0h "1>7+#`6"@2@@ڒ! !W@@- 1>7#xR! ה @cӒ"1>7# 㿘`8 "; `( !25 @, !W@2- ` 2)  "  `* @ .*  @   2  @    ?! 㿘@ h( H"$ D$ T$ @($ <$ 0@igw㿘 G !"@<*   a@c`8 ):` `( Q4 T @`2 0@22 #$44 ;6`$@ ,`  $4$<`(  %2` T`8@e$@0?($0SunOS disk label, bad checksum㿘"  @`@ *  1>9 !W&`&@"&`  &` &`  &`(&`$!&`,!&`0!&`4!!&`8!&`<!6`B! &`D!>?6`H!H6`J6`&`&`!`ϒ$ @ $ ,  , $  $ , 4 ` a " "*   gG#ꀢ@216`   @  @`@  2#6`>?#H  a?$  $,  @ `, $  $ , 4   6`Ɛ6` 㿘 ("2  , "  0 x  &@ &` &` $&`  H6a F 6 6a B6a J6a 66a F6a 26a .*`*2 2`I6aa `@d O@e$@$`6"6a    `     `@ @ "4(&`gG#&`! ` @dI @d$@$` ```Ȗ @ b@`@ &` b``  " "  &` @ 6a@`@ 6a 㿘 @- @"+ >?  @29?@aȒ &  66  F6  26  .6   J6   B6  H6 F6 6@a   8 . ` @cՐ " 8 "@dl&& **`@ @   }4??(@  ?`   * 㿘`=>#b :N .   i7i6i5i4i3i2i1i0l7l6l5l4l3l2l1l0o7o6o5o4o3o2o1o0g7g6g5g4g3g2g1g0wimynpcpcpsr kernel: keyboard interrupt 㿘>@!` > !`@>; @?kernel: %s trapFaulted in DDB; continuing... 㿘? #> >"L` 3 >? * >;א >b #> >;GŐ!#> b P*`H`P `%!>@! `$!T  !`H$! ` P 㿘>#`l€prom㿘>@GT!?%s(0x%x, 0x%x) at 㿐N `?#> "H ? <=#9 85>;"p+>; SS.  "'Vbx #>; %>;)>;.``Kb`.`E S7@"  <=# 8Ҕi7fpi5i4i3i2i1i0l7l6l5l4l3l2l1l0o7spo5o4o3o2o1o0g7g6g5g4g3g2g1g0fqwstateotherwincleanwincanrestorecansavecwppiltlpstatetbaticktttstatetnpctpcillegalasrfprspcasiccryxcciccfcc3fcc2fcc1fcc0pageone_writen_writesone_readn_readsfqtoifdtoifstoifdtoqfstoqfitoqfqtodfstodfitodfqtosfdtosfitosfxtoqfxtodfxtosfqtoxfdtoxfstoxfdmulqfsmuldfdivqfdivdfdivsfmulqfmuldfmulsfsubqfsubdfsubsfaddqfaddd34efaddsfsqrtqfsqrtdfsqrtsfabsqfabsdfabssfnegqfnegdfnegsfmovqfmovd4efmovsswapaswapcasxastwa8r7rprefetchaqrprprefetchldstubaldstubt2ds2dcasaldxaldshaldshldsbaldsbldswaldswstdastdstqastqsthasth6q6pstx5q5pstbastbe8e7eqepd8d7stadqdpstlddalddldqaldqlduhalduhq6p6ldxq5p5ldubaldub8e7eldfaqepeldf8d7dldaldmovrgezmovrgzmovrnzmovrlzmovrlez1jdmovrzsdivccsdivretrydoneid2dpopcudivccudivrestoresdivxudivxsavemovomovulemovugemovuemovlgmovulmovugmovuojdmovvsmovvcmovnegmovposmovcsmovccmovleumovgumovlmovgemovlemovgmovemovnemovn0jdmovasubcccsubcflushTdsmulccsmultvstvctnegtpostcstcctleutgutgetletgtetnetn0F12FtaWdumulccumulqpreturnPdUNDEFINEDmulxqdpdjmplYdrdaddcccaddcimpdep2sraxsraxornccxornimpdep1srlxsrlornccornFPop21Edsllx1DdsllandnccandnFPop1mulsccsubccsub1iT12Ttsubcctvxorccxor1iW12Wtaddcctvorccor1iP12Ptsubccandccand1iY12Ywrtaddccaddcc1id12daddfbofbulefblefbugefbgefbuefbefbnefblgfbulfblfbugfbgfbufbnap,mfbabrgezbrgzbrnzbrlzbrlexap,1lbrzap,ubvsbvcbnegbposbcsbccbleubgublbgeblebgbebnebna,mbaCdsethimilltrapncallnop undefined %s,a,pt,pn %%%s%%f%ld0x%lx%%asi0x%-2.2lx%%fcc%ld[%%%s + %%%s] %ld[%%%s + 0x%lx] %%asi%%fsr0x%lxl#%s%%hi(0x%lx)%%psr%%tbr%%wim%%y(UNKNOWN), 㿘>@" >Ĕ @ >>#h` ` , 0~#0p70~@2 8   2  2 @  @ 2 @ 2 ? 42 @ @  2` @" ` ` 2@2`>>*#p>>#`L .L@ ,2&`!/->>+)>>'>>L a p " #㘤*LL@ ؀ ,>>#L` Б* : `Eٓ*`>@"@ €>@4 !@>@ !@*>@4 !@>>4 >>#>>4 #g `>>?#`, >>#Z '?4 , >>@ P#??,* O; , O5 >>;#>>4 #>>4 #0 `>@ @* 4 | >>##L`72x>>4 # `q>@4 @ |>?? , L`82c>? ^>? Y4  `>?   P>@4 "- >@4 " | >? (A>@4 !>@4 >? 0ݓ, 4>>#ג .>>#ђ ?(>@4 !>@4 "@ | >>Ð#>? @>? H>? P >? X>? `L >? pL  >? xD 8PPhx,DlDt㿈\`d @>E `"@*` 66  4"@ 4"@`    @ 4"@  4"@& $#\#`#d@&"`?  @ 4"@  4"@  @J㿀\` ` d  ; А  * @ ʐ & : *   * @ 黐``` `;`+` ; ":`+ *`" "" #\#d#h#`#l#p ?` " ,`,`@,` @@ 錐  * @ 醐  : * | * v * @p & : * ˦>E9>F ``0` `?K?k/`b +`? 8+ ` * @  `   +`H G/`b +`  + ` * @  `   +`$ $/`b +`  + ` * @  `   +`  /`,  F   " @?ِ  * @ Ӑ & : *  ʐ * @ Đ &``.( *`;`+` ; ":`+ *`" "" #\#d#h#`#l#p @ 㿘  Ǣ` 蓐 * @ 荐   `@ : /`"@"@< ,  `{ * `.>E#.` >E.c@ e8 `"``"\?" X?  *   $ * 値`F >E>E.`c.@ 898 /```"``"(?" $?  *   $ `"@``@?@ ?#@`@2#@@8#@`@2@  ?#@`@2#@`"@``"@?" @߰?  + @#@ #@ * /`̰  ͒ * @ ǐ & : * ?``" `..`  : , , /` " , "  窒* `->E#.` >E.c@ 8 `"``"?" ?  *   * 怤`u >E>E.`c.@ 8h8 /``"``"W?" S?  *  `"@``@??@;?#@`@2#@@8#@`@2@`@2#@`"@``"@?" @?  #@ + @#@ * /` 㿘`'L &l \'Pdp` * @*   / @ @@ h*@ @%h/ *? ?@   @@ @ @,?&@* @漒*   `Bh 3>E#-` >Ec.@ @޸8 --" ?0?0@ / @  @ @$@   $@ @  >E#c-`. @ 8 8@ h*`?`!" "@?"@? / @  @ @$   $` "@ @w?@s?8#@`@@ #@`@ #@`@2"@ ?0J?0G@ ,    @ #@@  @#@-@-@ . @+ h*$` !" "@?"@? , @   @ $  @$?"@ @?@?`8#@@``@ #@@ `#@@2`"@ ?0?0@ /   @ @#@@   #@-@-@   c"h `>E>Ec-`@>E. L@*8 @--" ?0?0@* @  /@ *@* @ @$@ @ q @m--" ?0c?0`@2 @  /@ 2@2 @ @$@ @ I >E>E#c-`. @ 8 8@: h*L@`* 2?`)" "?"?0 @  /0  @ @ $0  $( "@ @?(@?'08#@`(@@0 #@`(@ 0#@`(@2$" ?0?0@2, @ #@@2 @2  @ #@-@-@i  @ hP*`$@2 `2 +" "?"|?(, @ $(   @  $(  $0?"@ @V?(@R?'`(8#@0@``@( #@0@ `(#@0@2`"" ?0 ?0@* @ /@* @* @ @#@-@-@i  㿐@T#\@㿈   \%`@ 8%`,= ` 㥐 45    0 .  +@*` *   `, `,  4    $`  ` `  ܦ 0@*` *    ``  #\#` #d 6`? #\#`f#d & ?` `  Ԧ  㿐 >` >G@bc0`/@\ 0H /e * &  pa `H 00=& pH 0 H*| d>`@1H /e * &  p H ?`& p & p b V  H   p  ?& p1ؐ H 0㿈 (   P   #\#`#dz ?< PH/` / 0`` & 0` & 0H 0 0& ,H 0  € >aX!>H"4@Qy 㿘H/` / ,`  0& , & 0H 0  @  >aX!>H"4@QR ؿ0& ,H 0  € >aX!>H"4@Q= تrcons_init: linebytes assumption botched (0x%x) 㿘>& P" >" "" `:`>HM#(0d"  " \& X @Q   @4&  \@Q @4& >#D `2` 2 2 2 \  $2  :  ?& H   "@2`@:`& L & @  ?@$& @ \   `& D $ 2 (>>& & $""@ @#D & (#D>G#"`ā㿘 ( 2.    @ "   "? `   &  ( @ې@`,H (@   ( # 3& (& 88& < @Ő2` ?@? ^ $ $ "@ @4  6` 6 @ ^( 8 @?&@@M`<@ ( @㿐 $ \@G H  A    (  L2   "  P " P  P  \q#\ $@"@ $  & " @ "@   @Ӓ 㿘`;>J!<*` € $3" $ .?,&  '?%&  $"@@f"0  "  @@ 00  $` "  $ &((p)((((d㿘`[`; ( 73$2 ( ;-(   ($! >& (& 8 8*` * ?А& 8(" =& (& < <*` * ?А & < @ΐ@ ( ?& (㿘`3>K *` €@ 80  8" "  $ 8 "  $ $ 8" " $ &i&0g $"  8 "   [Y& < $?"@ $@6 "@?"@ 8 ?"@ @6 ?"@<?:"@@06@֐03@ 80/@Y 80+@ 80' (!2& 8 8  ( & ( ?& (@l 0@h 0 (!2& 8 8 & 4 (& 4 `& (@W *p*****,,+$,++++,,+,,,,,,,,,,,,,,,,,,,,,+$,,,,,,+,,, ,0,@,\㿈 \ $@ H   ߹ L P  #\#`#dh  (` & (㿈 ( `2 P0` P   #\#`#dM  X (8 ` & (& X㿈 $` `   P  X #\#`/#d0@  \@k  L D  X  P H @#\#`#d㿈 $ \@V@ ` HM P L  @ X"#\#`#d㿈 @4 "@" @ &"@ \- L P  H  @ D#d##\#` D L#\ X" P H @#`#d㿈 $ @" @4 \@@ $@ `@ H L  P@ @#` " #d#\ \ @ H"@ L@ X@  P#\#`#d㿈  @" @4 \`Ē @޿޻ L H  P@  @ D #d##`f#\ D L" X P H @#\#`Y#d㿈 $ @" @4 \@@ޏ $@ފ `@ބ H L  P@ @#`"  #\.#d H \ L@ j P \` X#\#`#d㿈  @" @4 \`P @K L P  H@  @#d D ##\#` \ L  P H2 @ X#\#`#d㿘  㿐N >FX @[ $ٯ  >F!d&`T&   / >M*            ?444444555555554 ` ` ` ``  @2 `@2 `2 @2 a2"b2$d2(h2  ` `2 @2 2!2"2$ 2(R "  "2@?? 2@ 2` "` "` "` "`S  " 2 ??2  2 2  ::  :: "R "  "2@?? 2@ 2` "` 2` "` 2`S  " 2 ??2  2 2  ::  ::S "( `@.`@@ 2T <  (t 2 3  @֒ 2+V    "  "    B@ B  B4 2?@ (? '|В㿀@[ '`" '>F@X@Z4  `>F@X@Z* `@''tʔ " @2 ! `2  , 2  @* R `2   `a   㿘㿀@Z '@>FX@Y `&@'''t㿘㿀``  8`  @ @ '?'xA㿈@Z| '@>FX@Y `@''x㿀` ``: @'?''/㿀```@'?'' 㿀` ``: @'?'']㿀```@'?''N@`' ` '>O#*` €`''`'T  & 'DL L` `@'LL'''L3` $@Y'HH@Y `O  oi@ ?'谒 bC`0 @Y'DD@Yƒ `', $ L (  B谒 <쀢 9  3ڒ` $*`   N0"`@''  &h` $  P̒@" N?T=8=8=8=P=??=>>㿐  `b{&& bbb 0:" 5 b~1b| .  @ '*@ @ ?"*@ ֠  2 "| "{  ֎  㿘 @`@ `@+`@"F  ?@ # b@ +>P@"">n<#@>f, @  0&"@ ">S!@>_ @2 >o" " #L (" "0 `@ "`"` "`  "@ "` 2` 2` "` "@ "`"` "`  "` "`㿘 &`, 6`0 &`4 $&`8 (&`< ,&`@㿘Β 06` 4&`  8&`$ <&`( @&`,@Xv ` 'L``` 'r'>Q!*` €` `"b'``]`XU'` "O'` "H'` "A' ' @@XDL"@耢 9P @բ 20`՝ T& ''L@X! @"`Շ T 2PՁ @ 2 u DDDD`DDDD|E(ED㿈` `'`''̒㿈` `'`''d㿘@ 0  0 M 㿘  &`, &`0 &`4 $&`8 (&`< ,&`@ 0&`D 4&`H 8&`L <&`P @&`T D&`X H&`\ L6`` N6`b㿘ڒ ,&` 0&` 4&`  8&`$ <&`( @&`, D&`0 H&`4 L&`8 P&`< T&`@ X&`D \&`H `6`L b6`N㿈``'`'` ''㿀``'`'` '`''J㿐``''3㾰@WC `'`'' \@WC`` *'C` ` 2@  '{耢 7Ԙ \ 2/xe` ԓ p%`  x' p`  px'} 2nx \ 2 F 㿘@ 0 o z 㿘# 6`4&`, &`8 &`< 4&`0V $&`D&`@ (&`L&`H ,&`T&`P 0&`\&`X㿘 ,&` 8&` <&`  0&`4 B6`$ H&`( P&`, X&`0㿈` `'`''D㿐`'㿈` `'`'' @Vx `'<` &' 8@Vw<`` '`` 4`` &`@` Ӕ p 2RΔ 8 "`E'`?` >>S!x*` € 'w耢 0` * Ӥ 8 #@[` ӟ p '쀢" ' "'  2  'I M M MlMlMlMlMlM ML㿘@ N0   N0O X ]f㿈 "``h耢 //77:  㿀@'` '@U '@U ''?'  㿀@U '@>FX@Tњ `@'''Β㿀@U @'>FX@T `'`@''㿐.@` ݔ &svr4_getdents: bad reclen8'D'H @'L'yC' ` 2`(  t  H @8  D`|Дؐ'''''  '''D'''''?` SD  HH H<`3 `"@>TH (2 `@   ?@6 ʮ ''7@G]`M &@@%@`4`H`: HL""@D-  "L I svr4_getdents64: bad reclen0'D'H @'L'x' ` 2`(  t  H @8  \D`|3Дؐ'''''  '''D'''''?`/ SD  HH H`<``3 `"@>Tۖ"`2 `@   ?@6  ?  ?7Ȑ@F`љ &@@%@`4`H: H`L""D{  "  x`2) `2`#  `  `: ( @>,?'''''`@*@ `@*'ؐذx`?2' ``2` ! >  `( `@'",'''?'`@*@ *'ؐذ㿐 !6  *@w $ (`{@`t`   @| @~  ]` "$` ^$`  x @Sg'L'>FLܔXL@R < @ L'''oV0''oȒ㿘`?* `@֒㿘` ?2`*@+ ``Ȓ @!<>V( 6">l2">t."„*">,&" #" < " ">">">""  ">4"><"  YYYY,Y<YLYhY\YYhYtYtYYYYYYYYYYYYYYYYYYYYYYԝ㿐@   2@ &@@ 2` &@`@''@Oݒ㿐@   2@ &@@ 2` &@`@''@Osbrk: grow failed, return = %d sbrk: shrink failed, return = %d 㿐>̘ b(` @   * #@  >  7'3>$<  ؘ"(`(*    * #@ 'c :? ">>V#` 0`(  ؓ:@  6  P >V#ړ  > 0`(  ؓ:@ " $ ذ (@R' '@R+ H''K [ω H T#>'aXaX@B@@B'ӷaXaX@B@@B?''" 2a H ,ӜaXaX@B{@@Bx'ӐaXaX@Bo@@Bl'ӂaXaX@Ba@@B^&@: x@    0D7 = 0?   . aF . 6`  &3 @Q 'ܒ @Q`*   :? ?  2 ''   `&   $` &  `&㿘[ >"䀦 "   4  2 4 㿈@`B>X!`*` €''M "&!3` "! "* !   `4#& ` " ! 2! !`  &``'' a`h```a,㿀` "`   N0!2  NА"@&  ` `@'''\  N㿘@ 0   0 Nx@C{  'x 'N 1 4`'!8  ''``>` ''|2 >F>`>Fa* @'    !*` `'  '| svr4_wait㿘@ " !  " T ? ` &`&` T  `" L 1 4  ! @ 2x LL 1 U 1` Q&!4` 2` 2  X "4!48 2q4!4 !8 H!8֒  ? `? "` _@ ƒ * 쀢 [@ `"  "`   "@ L`" P P"`P P L"@ )>c ?H"c*`:  2 L , 2 L(` ` " L`2& $ ,&!4*``+`* 2}`2` " @2&>Xx! @ "h T$ X ِ  `   㿘  D&@ &` `$&`  &`  &` &` &` &` &` &`4  &`4  `4 &`4&`8`<ʔ `\@BP @㿘  D&@ &` `<  >`    >`  :>`   >`   >`(   >`0 Ρ&`8&`L  &`L  `L &`L&`P`TΏ `t@B @@@OS '!@OV@>F X@N@''gÒ H̫!  r`̧ @@O' '!@O+@''gђ Ḧ!  O`̄ (@O '!@O@''g He!  [`a p@N 'Ԓ @N@N @''''H  2'ܐ'', 1     ' &㿐@   j@ 㿘"` N 0  0`  㿘 㿈`'`@''㿈@'''L 2   㿘㿘 0  f 㿈\  J ?倢` >[!ԓ*` €                   ' -  )A찒 2 2` 2 >F!"` "(@&&\>mlm0m0m0m0m0m0lllmm m 㿘 (@K w 1㿘  R` "`(0 >F!"` 1   ?`" "" $ 㿘@@r >F "8 ?: *` + +@   `+@@ &@ ?㿘@@S >F ! ?+ +@@   :` `* +@ @  &@ ?㿘 `&@ &`  &`  ` &` "` &`@"` &`@@"` &` "` &` ` @&`㿘`&` &@   &@   @ &@  " @ &@  " @ &@  @ &@  @@ &@  @@ &@"@ "`"`  "` `"`"@ "`"`  "` `"`P@ P @L `` '@Lڒ  @LҒ آ9 25ȐD4 "@( @>Fb8* @''' 2 Ȑ ؐW   h@L `@ '̐@L  `@L  2/ؐe "'" 'А'Ѐ 2ؐǔ W”  H@L> @  '! ?& >F,"8 b"Q  h`a"` NVdFv N@"i q N   *@';' @L @L `'А'''@> 'ؐl 2N  ?&D U = а 9&*@'' *@ '')@Kϒ  ''''@>z '3 2      *@* '㿀`  ``  :` 4   .˒H/` /@`"```  ?`b  $`*@$`?" @$`H o@㿀@   0'` 2 "   '`@=   : * +@& `Ȥ 㿀@ ȕ  d'㿐``>F"8*` @''Ғ  &@   N $a  @`d!x`X!x "@Ғ㿐 'Msvr4 socket cookie mismatch㿘`(>F   > " "` ""> " >^ 2 | t2 | x2  |   "& `&   2 㿘`(>F  > " "` "  2| 2||`"`"|"@   02㿐>F   > " "` "  3 $ x$ t$$   hǁ  0 ` , , >  `$ | |"` |"$ " 㿘`?`>_!h*` € &`  &`  &` &` &` 4C}}}D} },}8 2 2 2  2 @2 @2 2!2" 2(H 0 a G&!W  0P0!J > #'  2``2 ' & 2*ؒ @;@ W7Ȑ   2 @  unknown㿘@<:  < *  &@ 0&`  @  &` >_&` &` &`   *  &`$ 4&`0 &`8 &`< &`@ $&`D (&`H ,&`L @&`P <&`T&`X &`\㿘@<  < *&@ 0 >`  &` >_&` &`  &`$  *&`( 0>`8 &`@ &`D &`H $&`L (&`P ,&`T @&`X 8>``#>`h㿈` @'''@㿈` @'''@M㿈` @'''@|㾠@H ' `@H`>F' ` X@H`'g# 2" ? ` C< 0 2``P`.  㾠@H ' `@H`>F' ` X@Gݐ`'g  2"  ` < 0 2```  㾠@Hn `''@Hp `'   Д ` 2Ւ`˔  㾐@HG @''@HI `'f 2"ũ ` < 0 2`@`Ř  㾐@H @''@H `'f 2"v ` < 0 2`@`e  㾐@G @''@G `' C ` 2`>  㿀@:u `/   㺐%@:f>Lb!@9>`@/@9!>Lb!/@9>LJ"/">J(2  J J* ) * JJ#2 J J* :  b@*@9!@/Ӕ%0unsupported㿈@ 2`! "'>L  +  N0n"!>4>>L"<  ! ">!"! \ N">bE" N0T>9 @7"5"3"@>b0 H>L-"+">("P& P!6$ 29` '#\   -!6 2'` '#\   @9g `& ( ``Ŷ 6` M㿐` N@' `@'' Np@F 'Ԓ @F'>F@X@E `@`'ؐ    ''''  "0'ܐg\؁㿐@F} '@>F @EXgJ? >cd(             ? (08@HPPP㿐@F? '@>F X@Ew`?&` & & d㿘`?&` & &  @F '@8 @F' `@F'r $dd 2 \ ` 2 <  2 2  'c_    `2`2`" ` ` 2  (*  2 㿘` @@8i .`. `6 `& 㿘` i@@8X j` `. @* *``2@".㿘  (&@R@ "      &`   &` &`&` &`&`&`h  0   ̔ 2(˒Ȁ   N '؀ 'ܐ  '' @''' ' '''ª'㿈 ž 㾈I "8   ‰ 2.  ( ''/u쀢 " &  '   N  ( ''x'|'td  h ,0   M , 2)L耢    N ''̀'Ȑ '' 'В @''''' '''* ,㿈     2'2㿘?"@` &>d#*` €"ՔZI  x؝hȐ@7 ,,8(  ǒ "  2   ?  ?'' ,''''&''''' ,  U   x  2Ux "O   J N耢 1 Z0x ( jaOz !z 20'@C'dd@Cf  'h'l'ph.:` `2 @6!  '|'  'xI  㿘``  `` T ϐ    'p z@  t N'Pؐ j'Ph@C`T'TP@C@C P  2Z`"'X`" 'XN N`I`F N0E'\'`2X  P;'\'`2X  2-  2&@    NhlP 'hnhP 'pP    㿐 `b'    &&~ `) 2 % ?  f $ 2 ''̒| 2 'Ē 2?& & 㿈''_J㿐'`O㿈 1  2%?c @ @    0 ؔ  㿀? `]&>g *` €fQJ ' '|䀢 2?` @ ?'@ ` ''| 2)`  `4''|  &Ag j t| @`*@@ 2`   "`z?'`   m?'< ܀a { 2[  2U N܀ 2Q NȒE ܀ &C @@  2 jX> j@@ '$$@@ߒM 2'؀ $ "`  N@'L'H'P+HH '0'4'L@?('H'8'@(,ݘ&㽨@ *@`@3U!@ *@`2`c  "`0Y?''`  0L?'' C ?Ȁ?= N@  7  j@@Z ' @@]@@Y 'Ŕ  ``"@4 ``  @ P @B߰   ? '''''$`'''/       '''''@  2ݰ N'6 ('8 (?'''$`   ?'''''$`@''ؐ'ܒ*_ $`M    ( ''''''@  2 N' '=6@" '''''Ȑ (?''̒`']$` $ #! $'!!' o@  i NÒАǒДȐ ''''@'''',ؘ L F '@  2? N' '0 N''$`)$`` "`Ð ` ``  ` `  &!,"^ ! n"Z  2"V  S`Q K< L` "H  5 C` 2 >`)`": $"6 "X' 1`'$ ,` "&  `% `           * `2`` 2``2  (>j\(# ! 2 K n   !,"X$' )` "#%" ! (L4@㿘  " .`  " .`  " .`  " .` !   " .`  " .`.`  .`!  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`"  " .` @  ?&@ @  ?&@ @  ?&@ @  ?&@ @  ?&@ @ ?&@ @@ @ ?&@ @ ?&@!@! >&@$@" =&@(@( 7&@@@$ ;&@ "@@ *@&@  `  ?&`  `  ?&`  `  ?&`  `&`( |&`  0 " a  0c b&`  @`$ ;&`  `( 7&` !` `*@&` "` `*@&` $` `*@&` ("``   *@&` n&`$ `  ?&`  ` ! >&`  `   ?&`  `   ?&`  `   ?&`  @`   ?&`   `  `  *@&`  !`  ` *@&`  "`  @ ?&`  $`  ?&`  (`   ?&`  @ `  `  *@&`  @`  ` *@&`   @` $ ;&` 㿘  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.` !"   ` 2.`.`  ` 2.`.`.` !.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.` @  ?&@ @  ?&@ @  ?&@ @  ?&@ @  ?&@ @ ?&@ @@ @ ?&@ @ ?&@!@! >&@"@$ ;&@(@( 7&@$@ @*@&@ "@@ *@&@  `  ?&`  `  ?&`  ` `*@&``  ?&` (`@ &`  #!" ` "#`0 ` &` $` @ ?&` (` ?&` @`! >&` @`" =&` @`$ ;&`  @`( 7&``*@&` $H`@&` `   ?&`  !`   ?&`  `   ?&`  `   ?&`  `  ?&`  `  @ ?&`  `  ?&`  @` ! >&`  @` " =&`  ` $ ;&`  ` ( 7&`   @`  ` *@&`  @`  ` *@&`  $ `  `  *@&`  "@ `"`  ("` "` * $   2@ ` 2`  2` *`2` * $   ` " ` ` `gx`,Ȑ`hx `@ @-O $   { $v  `@ 2m` %``` ֔ $ 2X ̔  2Na C Ȓ?#`>o!*` €      @&`h@    2 `g@d *@ *` *` *` *` *` *@ *` *` *` *` *` *@ *` *` *` 2` *@ *` *` *`R "` *@ *` *` *` *` *` *@ *` *` *` *` *`  ?`#`w&>p"X*` €`w@ 2ð   2  2 `vu`c`@ l ؐٔ  2     {`@ vȐ[B   2f> `X`t@ Sh   2CK `u5@ 1 x* k  ~ " 8  }    }   ~@ LLLLLLXL$hLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL,LLLLLLp㿘!(`(`'L[ ^ @+!x?&`( $` L$` `$`  $` $` $` $` $$`  ($`$ ,$`( 0$`, 4$`0 8$`4 <$`8 @$`< D$`@ H$`D L $`H&`$$ &@pc or npc are not multiples of 4! 㿐 $`(!`  @ 9!(   >qÐ!H@ `(< @ * # #  #  #  #  #  #  #  # $ $# ( (# , ,# 0 0# 4 4# 8 8# < <# @ @# D D# H H# L@ 긒@  `?" @& ?>F*` "@"` "`"`@"`>r(*5 "` . "`  0%   0 "`"`>r (   "` "`    "`"`|\ǤH$㽐>"`$a(a aH @  a*@ aa#a  = ?xՖx! ?'''l, ?"  ?˒ >&! >&>&!TX="c"@ `$H$$$T_SVR4_GETCC T_SVR4_SETCC T_SVR4_SETPSR 㿈>F`!d@a(5 ?``81 >r"ȓ*` €>r9!" >r4! $ 0>r,! $ 0*`" *  * $ 4$ 0$ 4  `$ $ 0DPddʔ(sparc) svr4_sysarch(%d) 㿘@>rq" 㿘Ԕ㿘` `   `!" ! ! 0  aʒ bJ b >H"&`T       @  " $ "@  2 "` 0"! @0 0@0 "#@2$2(  @ >J"`X("`$"`( (!   2 @2 2 2 @2 2  "` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` ! " ` *`"  `*`   `*`!㿘       @     &@  &`  !"   0 "#0   02@2222 2@ &` 2  2 2@&2@2 22 &` >J ( `Ȓ & ` &`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`.`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  " `   .`! !2.` .` !.`.`㿘 6@  6` ` 6`  6` .`㿘&@  &` `&`  &`  .`X`@` @*@  2 '  ` -v!!">`Q`a "a` a5A0e >`$0]`d"` !% 0O "*`0D  0># `%"Ƞ  # ` "l  !0"`0(`e"``!g0`Ԑ0` ``&010! ,, -"Ӡ x0)( `  `  21  -0 !ۀ#0a"aҐ a $a50Ȑa"R8a0a[0a/ a-aa00 !0!!0 &``ǔ  ܀ "'܀  ` '  ' `bw`h n`  h77`g^`hఒ U'`'~ L`vE&`̒`w  >(`;`t 7`x `"2 00`] +%&`'  ` L` @2 `hO`<  7 $h`*  8 ` #>3`` ` $ ٠``  ̰`  Ű`f`  `_`Ӕ  `̔ x`  ` X` ~x` qa~ j` e` ]a# V` Q`v IC`i <a 5`b 0`V )#`H a `A x`4 `'   `  a  'h'l'p't'x '|''' '$'(','0'4'8''X'<'D''HL'P''`h\''//'''''''ה `˔ ?'h'l'p't'x'|'''' ''''' ''$''(','0''4'8'<'''@`D'H'L'' `/2   /H`O `/2   /0"ah O"09a 3` '] +`` '``"' 2 ' `   ' - b})R "  "2@?? 2@ 2` "` "` 2`2` S  " 2 ??2  2 2  ::  ::S "X`?` O>y!X*` €>J!` 0 @ ?*@ @9&`@0]'`@''@0] `'ȒÔ  :А  0j *Ā '  !}`  -jk``>J! 0  ?.    㿘@ ?"@ul㿀@/ '@>H@/0 `&@'''IΒ㿐@/ '@>H @/M㿐@/ '@>H @/@&㿐@/ '@>H @.@' 㿀@/ @'>H@. `'`@''pޒ㿀@/ '@>H@.ʚ `@'''pǒ㿐@''F4.2ffsnfs`@/j '4    ` @@&`@  2~>ycА@!  >y4@/N  &@>y#  "egc@!  \`  8 2Y  2Q8 S 4/8 X@/!&`  'H @/  >JaИ  ?P'L'X'\'``p'd d 'd'hd`'l@'d'pĐ't'xL'_  2` HX X 2D㿐 ''[㿐    @;'sunos_getdents: bad reclen8'H'D @'LR' ` 2`( `t  H`!  @8  k'D`VBА''''  ''''D''''?`Y> RD`HK @7 `"@>z"@ # `&@  ?6 `7ʪ''7Ȑ@ ` `&@%4`H`: HL""@DY  "  x`?2H ` ` B @*@'䀊`'؀  >b, @*@ *'` :``?`' ''`+ @@`R` `(`t `x~2`  ?''ذ㿘`  㿐 @ A`2` ܒ #  "$ (`+ 2 ``>J"H*` &`` l `   2`  7 ` "`F0 $ `(``㿐 !6 s *@QK $ (`U`t`   @UĒ @X  7` "$` 8L$`   10@ e>L"T > @O >L/"I >| D >"@? @ e㿘`  @ 40㿐@, '>H@@,% `    K`2`2` 2`&`F  ! ` ,  @* R `  `a   N㿀@a `    㿘!  ` ` `|`x  ;    " & U   "& 7&  X @@* $ ' ' ' ' '  @' ''В'H@,S '@>H @+@ @'''''0 7V H  D    <>*@$ D`㿐 P@ `( H  D`   <>*@& D` 㿐@, '>H@@+> `< @@ G0Hm@>}(">l" <" ">t " "„"  ,8DTT`㿘@   "@@(㿘@   "@@(㿈@>J" 6 >J"\* " ` '`'`''Y 㿘 !6 >Jb @  b@@"```@ @ 㿈@`> $` ;`"B ` ',`  '@ $ $  !* 2$ ! "!  $ ! "   $  * `$  2`  " ?!   $   @ % * @,`@@,`@*` ,  ', @ '`H* , `H`@, '`* , ` @w, @'S Magma P2 SpMAGMA,P2_SpMagma P1 SpMAGMA,P1_SpMagma 8+2 SpMAGMA,82_SpMagma 4+1 SpMAGMA,41_SpMagma 2+1 SpMAGMA,21HS_SpMagma LC 2+1 SpMAGMA,21_SpMagma Fast 16 SpMAGMA,16HS_SpMAGMA,16_Sp_2Magma 16 SpMAGMA,16_SpMagma 12 SpMAGMA,12_SpMagma 8 Sp - 422MAGMA,_8SP_422Magma Fast 8 SpMAGMA,_8HS_SpMagma 8 SpMAGMA,8_SpMagma 4 SpMAGMA,4_Spmagmamttymbpp㿘!?΀@.`  && "@*`" * *   2 @@А ,`h H( h(  * H MAGMA_Sp㿘>@a0`?magma_prom pri %d softpri %d: %s (unsupported) %s 㿘>J>s a`%>@`"@ 2`<p @`2`>!0>!&``,&`0`0 &`4X ` &`t` &`x`` &`|`I` @ K ~` +  + 4 &@ @  $ @   `@$ @ *@@Ò    @  `@  *"@ *`" *  *  &!: !@%#,` " ``0 2` * $ `` `0 >`4`+   "`0>c  >b  >`h&`&`}>!4&`&`} 㿘0    4 g@ ` `b `t #3 *` 4 `??P `? b?*`?"@" 2  8"*` *  4@ @  b? ? `$ `  `* `b* " 2 ?"  " `  "$  `*@ `! | 2`*` *  4 `m    "" "  `*@  x `&2`*`4    c *@  "`b"  ] *   T"* *  4@ 8@   c*  *    ?#     c*  *  ` ?#  ,` 4 , c (   # ,`# (`*`* ,` $ ( , "  "     *   ? #  `*@  > `  0А %s%x: fifo overflow %s%x: ring buffer overflow 㿘  u 0q >ݲ ,*  4 `p _  $@)>ݪ )>     @    $ @   !f `h*`@ €  $@ݖ Ho o ?$ H 0   `h*`@ €   >a ;  `H (`Pj" `p `h $`p* @ 0,$ 0 4  "0Ho o ?$ H 0  "0 0  >    `? : %d tty%s s㿘&    +>$>>!c$ $ $`$ |*  &$`$$``  ?@"    ,- * 4 4 &@ `@" ($` &`0c> >  mttydcd㿘>K☪  `2`  `☑* @` `0, *  4@` p b$ l"$ pĐ#  c"$ $ $ `  $ ` @  $ `   $  !%$ $ $ `$`$$` H /e * & @ h `,`*  @Ԓ   @ђ  *@@=̐  * ` `2 p`  p &$ p ?#$ p$`I H /e `H 0 p =8$ p* & ``   p " #>$ p !a0   p "H 0 h>ݐ *` €㿘>K" *`6   *  4@ > h *`  €H /e * &  @ p  @4 H 0ں 㿘 >K"6  *@ *`@`<> h*` 㿘 >K"6  *@ *`@`<> h*`  >K 2  *` (<㿘>K" *`6   *  4 > `h *`  @ i a ]@ P `y@3`x@0P `z@!`{@" G  k@ "+  j@*\@"0 8 l@m@"/    $ D 0%    @ 0@ 0@ 0 @| &  &!6s "  $ l>K* 0 @(4H4p(p 2 "p " H 㿘 l>K" `*2` `  *  4H /e4 p* & p V  H   & p Hµ  H   f H$ , P$ ( p & p H 0 H(  h(";`"' 0TDQ l2 m2`@2` 2` "a`@6 "2`@00@22` m*2` l(0! @ ` m *` l *0` @ ` m(` l(H  㿈 l>K" `*2` `  *  4`(      2 `$   耢  H /e * & `(    S`(`  v r* * `$   | x* * @8   @5 `@ @ @ @ "`$2 #!"  " "" *@`@  " *@  * @   @ N *@ *`@@2  "`` *@ * ! * H 0 >    `? : %d port%s 㿘 &   > 4`4  """    >&`0 "> >  Q 㿘>K   6  _ đ* @ "Y  06U * 4H /e4 * &    H 0<  & H p@$& @B?& @?  '& H /e * &  h*@@G    @C  * H 0 &  >Ką2  @ * " < 㿘@c㿘@]㿘>K6 bĐ  .  4 @@#  @&=   @28 #83  &/ $$ + @$ @$$  &@ &@ &H /e * &  h@* @ o&H 0  mbppdelay㿘>K6 "İ  ` .   4`   @ 8  wi 2   `$ `>$ "   T5> @@` 2   QL  H  $%`H /e * &  >` $ "@L! H 0 "` 2 `% ` @8` u   2`H /e4 * &    >" H  ?$   >"@>  ?$ H 0`  %` &`x| 㿘  & 㿘  & mbpp_send㿘& & H /e * & 3> h*@ r * @ɒ   @Ɣ   * b`!  h*@ *@   @ @   @ H 0 &mbpp_recv㿐& & H /e * & 13> h*@a"  | x* `  * *@ @c   @` H@Y   @V   * c!  h*@ *@>   @; H 0 &㿘  . "* >АX@* 㿘  1>!X@#耢 !X@#㿘@   `@  ( spifsttysbppSUNW,spif㿘``@j >@d"0   : expected 2 interrupts, got %d : expected %d registers, got %d revlevverosc: rev %x chiprev %x osc %sMhz stcpri %d ppcpri %d softpri %d 㿐4`>h"0􀢠>"^ 080 { &`x>&`h bi &``>`hbi &`d 2%&%"%&`d`x  &`p&`l k &`t*@`x@(`x`H`t`<`T`0 h@  hk  *p`x *hq`x *(a`x *hb`x*(c`x*h@`x*(A`x*hB`x*(Cd`d`` `t#\>">ah c >  ]c@>c&`H&`LtU>#&`<tN&`@> &`T tG&`X>h |`?: %d tty%s s㿘& | )>㼐>>#b$ $ &@$`$`$ t  $` $$` l,* *  4@,`0 x $* &`0!>!>! sttycd㿘>K  2`  >Kb  6 *b @ 0+   *  *  4 p W$ l"$ p]#  c"$ $ $ `$  $ `$ @  $ `$   $  !%$ $ $ ` $`$`H /e * & x ` *dx@( `  x*d@ox P*`$`2 p`(  p %$ p ?"$ p$`H H /e `H 0 p =7$ p* & `   p " #>$ p !bⷘ   p "H 0 h>ݐ *` €㿘 , >Kc* 6  *  4@@ h>ݐ *`  `€H /e * &  @  p   @x *hdx*(H 0X 㿘 * >Kc* 6   *  4@@ `h>ݐ *`   @ e ] ]@ L `y@4`x@1L `z@`{@" ,C  `\@ "4  j@'7 `k@`l@".   , $ ,x *(dx  *0   @ 0@ 0 @ & $ &!6{L "  $ $ H(x (d"5``0O?LK 0  x(2a@2`@ 2` 29`07  + 0x ( `+ 0x  (`#x("`+ 0x (`@ x(` + 0x (`x(((H  㿐 l>K `* * 2` `  *  4`(    d@ 2 `$   d@  H /e * & `(    Y x  *hd`@ @ @ @ "`$2 #!"  "  x"" x B*( x@(`@@  " x D*( x@( x *h x H@( x *(  x *h  x *(  x G*h  x @* x*( x*h x*(`(` x*h9 x*:`$ "  x x*h1 x*2 x @Ő( x h( @$ (H p@ 㿘 *@ >K#*`6 @  *``4 > h*` 㿘 *@ >K#*`6 @  *``4 > h*`   *`>K (2  (4l>K* c(0 (4H4p(p 2 ,"p , " ,H 㿘 l>K `* * 2` `  *  4 H /e4 p* & p" V  H   & p H+  H  ܐ H$  P$  p & px *(dx  *H 0 x A0(( |( z4* xx*" 2  x ",", x`( "@" `x A0(((`|46`x*`xzx*" 2  ",",`x ( "@"  x (A0(( |(4, .  *({ x *({, ",,  x({ x({,",? `" " x({ x({ $ " x, "  x x  (*(,߆",#@ x (x A0(( (|4 @ , " ,"@x (x(㿐'   x ,w ```P@2?@?< x  x lv  2?o@? x  lu  2?@?< x  > `  0 %s-%x: ring overflow 㿘`|   0 >ݮ ,* *  4`p` n  @!>ݤ     @ $  $  @  `h *` €  @ Ho o , $ ,H 0  H /e * & `x*(d`x (H 0  `@$ ( `h* € >` O  `H `P~" `p `h $`p*@ @  0,CCR: timeout 㿘.`@<. 2 2?#@2..  >@ `?: %d port%s 㿘 p @& >&`0`#p>!>!@    㿘@ 㿘@   㿘a"  ``>". bppSUNW,bpp㿘>@ В``?: Zebra : DMA2 : Unknown type 㿘8 0t &`@@% `@< @ @ (@>0 > 0>ސ 0ې @;%s: draining still active (0x%08x) 㿐 @'  +  @`@'   >! !` @ " @@ ?"@ @ ( @ *`㿘>Kx   x* @ 2N <  2  $& 4 . <& 0 㿘>K#x . @ 0 @ΐՐ d А dŐ 4T , <㿘 0 "B   @ `  ` #   @ ` 2-  ` " 8'   & 8*` @ ` *` @ `2  @#  $ @ @ ` "  `` *`2 0? & 0㿘>K #x. @ H $ 8$ 0 ` 0@&` $ 0`$8$ 2 4  xboxSUNW,xbox㿘>@ ! 2 ;@ model: model %schild-presentfalse: no devices write0-key P>ahb>p>ab>@ }a 0>!0  sc &`P<  s] &`TH  sW &`XT  sQ &`\`  sK &``l  sE &`dx  s? &`h  s9 &`l  s3 &`p  s- &`t  s' &`x  s! &`|  s &`a4 " '>@ "a 2'8 '>?aa@`P* `&`@&`< "`<@`P`8*  " d@)`0G>6!!D8 `'` ''> ranges%s: PROM ranges too large: %d 㿘> ` @aL m  & L> h 05 @ & H L @a H (`< * *    L`8  @2 `   " `8 L@ ` "   H&`<%s at %s㿘`> ! external battery discharginginternal battery dischargingexternal battery charginginternal battery charginglid downexternal mouse attachedexternal keyboard attachedexternal VGA attachedexternal battery attachedinternal battery attachedmain power availabletctrluctrl㿘>@ /# `?: expected 1 interrupt, got %d : expected 1 register, got %d pri %d intr%s: %s%s, 㿘4`>=#P0m >#p40d8  q0&`0>&`@'#`0.`u  `4`|#`    * >`0  >"@&`4 kn&`8>cӔ`L &`L@Z`P``H `>#`H># >K#%>#>"6, c6 >ې#`L &`L@1`P` D`0*@%s: (op=0x%02x): unexpected data (0x%02x) %s: (op=0x%02x): unexpected ack value (0x%02x) %s: (op=0x%02x): unexpected data (0x%02x) in state %d 㿘  0 *  w x@  ? ?   L " P  H @  P "  >5 v ">0 v> L & L v!p  0" z> v!g  z. y? . z  & P y d . y * y z@2 0& P@ 0" PI  0 P 28 w L. w  . x ? & L. T. x!. z   ?    ? & L. T. z. x   ?& L@@   x ?& L@8  x "  w 0 `"* 0  w x `:f 0 b`. w T @  w x2 P z ` & P T. v 0 @ *@J 0 2G 0 T . vA& P`  !   *z*T*U*x*VH@  u2*V *V !   *z*T*U*x%s: SHUTDOWN REQUEST! %s: VERY LOW POWER WARNING! %s: LOW POWER WARNING! %s: main power %s removedrestored㿘 v "  d ! "  d0="7 d0: e*  6& H e*  >!  >!  >"z > L H b(& L >"@>"Hg   L & L U V @. t㿘>L #   `Ho oL  c"L` ?H 0㿘>L 1   -) Ho o u  "H  H @ *uH 00 L `\"LH 0 0 c 0" 0(㿘 0a b   K   0 `  * >Ё  %c㿘 '>CC    &&@"  @ @.$>!?٤!>!?0Р @> >>!0Ő!. H;j&. cv" "" " " " 㿘 . 2  ?&   &  6 @"@   & @@7  ?@3 @ ? @  &@l@㿐 @6``2  ?7 x 8" >La`   @   @V XP    @'@"'5ک/@ @  x@@ 0`(` @/@:1@ #V@@ 7`/`  @)@@   ے@  7 /  Ĕ(@0os@ "@ 1 )  /@ @ =_#@ @ 0`(` @̔/@@ "*@@ 7`/`  @Д)@* @ "@ 7 /  Ԕ(@?Q@ !@ 1 )  ؔ/@ `&@  ؐ@@ 0`(` @ܔ/@"=@ #@@ 7`/`  @)@?֒@ #@ 7 /  (@"W5@ #@ 1 )  /@ @ !"@@ 0`(` @/@?f@ !@@ 7`/`  @8 @)P@ #@  7 /  8 m@  !@ 1 )    =@ !b@@ 0`(` @ @0,@ #@@@ 7`/`  @(@@ @ "Q@ 7 /  /@:m@ #@ 1 )  / 5Ē@  ]@@ 0`(` @)@@  S@@ 7`/`  @(@@6(y@ "@ 7 /  /@@ 9#Ȓ@  1 )  / xs@ !@@ 0`(` @)@0@ #֐@@  7`/`  @(@@=5C@ !@ 7 /  /@V@  @ 1 )  / *x@ !@@ 0`(` @)@@ ?;#@ @ 7`/`  @(@@@ "ِ@ 7 /  /@#J@  @ 1 )  ?@!B@@ 0`(` @@!}@"@@ 7`/`  @@gX@!"@ 7 /  ?yN@ @  1 )  )/@"D@@ 0`(` @Ȓ@@#@ @ 7`/`  @@=Ғ@#`@ 7 /  /@ p@ 1 )   &ߒ@"Ɛ@@ 0`(` @@:I@#@@ 7`/`  @@5;̒@ @ 7 /  "@!@ 1 )  6u4@ 9@@ 0`(` @@9@!@@ 7`/`  @@蟒@ @ 7 /  1+@"e@  1 )  1= H "D@@ 0`(` @0@ʿ #@@ 7`/`  @7@*@ #@  7 /  7?$@  9@ 1 )  1V֒ !Ð@@ 0`(` @0@#3  @@ 7`/`  @7@?@  }@ 7 /  7!a@ !ѐ@ 1 )  1 "O@@ 0`(` @0@?9 "@@ 7`/`  @7@(P@ #@ 7 /  7@ !@ 1 )  Ȓ1=ߒ "@ @ 0`(` @0@/N "5@@ 7`/`  @7@ "@ @  7 /  :ᴐ7c@ @1 )     @& & & & @> @  `*@ 0* @*  @* `      +` *`  (*  ! `   @* * @ * ** 㿐@u㿘@k  *  @    "@ @b  88 b   㿘  `  `  @/# @*   & &@&&`C?`"   ` 㿘?#@6 6`! ` @ & $ @$@&@  2   *  , "@@ 4 "  "  , @@ 4    -`@@ 5`  @@*  㿐  `   ` @` ?2    *2@ 2  ?*@    2@* *@  㿘  `   `  @P  ` &  4 @     ?: :  *2@ :  ?*@    2@* *@    B 'D'H'L'P'T'X@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  + @ @ ` ``z  @Z( 2 "" 2 @     " @@ @   `@ @ "`" ?* ?*  @(*`  *02 @2J@ "J`  2J@  J " @( *` @ (* J@   J@J`  J" @ J2  @(*`   `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*2J  J@ `2J   $*0 ` + +    "* 2"*" @ ` ?  2  "  `  ?2   8 * 8 * 4 & 4 &H 'T>L!@ T ;9?T2 7耦(7耢 2: - 4`44`44`4`ؤ45 5 ȕ4'5 5  A'7' `@’`@ `*  @@`*  @@ `*  @T  @T :-`-2 ,`- ֓2`    `" ` '``? '8  đ. ?2@ Đ"  * c'Ā@ '.` @ '   @ @?  7 /`@  `7@', @=@`'*V2 -2, @  ?#   * ?9@#.  ?:$$6`6'  @"6``4@  * . ?  @26`@4@2@@ /`T$   . " @?* :@ @2. 4@*  *`@ T:@̑* Τ Г*`@  +    ?( 8 2 + ( 2@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" h@``` 0& 0#``'`'` ''0` `'`'' ` `'`''0`@``` 0-`  0(` `'`''9` `'`''`' ` `'`''X@``` 05`$ 00` `'`''&``''1``'`'` ''``'`'` '`''!>( "x`>L! `J `@'` ''''`  '`   '` ! '` ( '``: '?2؁ 2@ "` 2` 2`  2`  2` 2` 0? 4"`"` "` "`  ("`( @"`0 <"`4 D"`8 H"`<㾰@ D'8''4''<   /j  X’`" @㾰@ '8''4''<   /H  X` @ofstat@`*@@ 2R + " (> >/T  ( (#Xe `Ô @㿈`@: '?*㿈`@: '?)x`ؖ`: @?''%ݔ &㿈`&@'''! N+@ 'x` 2`( '|| t  `` '''`' '''/' |?H`@ 't ؖ 2 'x=: ؚ?`'??''?  \ ' | 2 'x :` `Ț "@    * 'xn'x^. | 3x E`@ > d`ؐ????|@x 2||x (`@2` | 0 "`  H`< "` ` '| | "(n:` [| ɐt`'x"@ &㿈 `    `7   㿈 `  2 `7   㿈: `r  2 `7o   p` ` `'''@''Ԙ''': 㿘`  "` є8` ;  7#3 (`*` [ ` @'*  `@'쀢`   `` ]) p`` ` ''@''Ԙ''''؁8`   (#$ (`*` [= Ε*  ` '@~'\ CLGET: returning %x 0 t@ ݔ )c@ "O |  b@ ":  @"? N?@ "" hI?@ .!>L |@ >?@ 9? ` @` @5 `@"  (`@%`}@*%? `@y`u@"?  !?" . !?" .`.`@.6  ' ' ' ' ' ' ' ' ' N'쀢'>L"L* 'N4 '>L"L* '/@/V?c?  & t@;  @     . . . . . . ** * * . *N  * * * **** . . . . . y. ' ' ' ' ' ' ' ' ' '@i'  ~@ "8  }@ @ ?# *` * * *& t@4 `#@=: &>L!`/> Ԓ +  $& '`& `bK &     2 40&? getflags: %x 㿘` @ ````  "  @ ! 2  $2 "   " `t # ` 2@@` 2 `2, @ @  @(0(0>L a >"@1 t@``` ` `" ? `"  l" `@ @** ߀` * , :`$ >! `@"    * * @?  @#  @" <" @ "`"@"`"`  t@`` ` " "*@*" " @2 wh @@` (0*   `  @`*  `` ` @@"`"@"`"` H ?"@  " H H ?"@" H 㿐 $!'! ` `'ǔ  @    !  $!$!$!! @$! 㿈@` $` `2`C  .,`  '@ $ $  !* 2$ ! "!  $ ! " ,  $  , "   $  * `$ r 2` c "  `$ dP 㿘``@eܖ  㿐@`$  *`  '#'@ * @` '#'`/ 㿀`!    : :`?@?a㿐@ `  '`?'_$'_J㿐@ `  '`?'^'^ >t8" >  "㿈` ''@#\  k p`   @?# @c"?`ea"` b`+ -0% -0"4`fd, -07!@? -03`` ` ` ''''#\' ܘ c o` ` `` ?'#\  `  '#\ ܘ ~Z R` '#\ ܘ k F#>ڰc `>ڤ" P `& >LbQG  `& $>LbG= $ `$c>b@<2 `$` `' ܀8'ܐ ܀ ````?  &`` 㿘 @^!6 @> "! 㿈 @^!6   ` '@#\ k 㿈` ''@#\  j 㿈 @^l!6   ` '@#\ j sparcX>Lb >`@x >Lb >LJ"ז">J(2  J J* ) * JJ#2 J J* :  `*J @~p 㿀@ '?'''@ 'FR ~R 㿈@ '''㿈` @'''~@  U$'*`  , `*` ,@$@$`" ~}В |L@ /w `@J?`/?N /2 @ '''. '' ] /3. @ '''''ϐ N''l'h''Őh A( 7(x /@ `@`$ `'@ "@@B  ' ?} 'VŒ  C`  >x0 ;x 9V    @ 2  *@  22"  0= 4g >`=0 4     sun4c compatible0 0 f8000000 15c6a0 map-pages spurlev1lev2lev3lev4lev5lev6lev7lev8lev9clocklev11lev12lev13profd'(H  <<d d@@((1v@E@HFGHID @-|5wu  0 0   xph`XD<=>?@mnoABCDefgh&'(234#$&'jk2367+;68w5ps^d^|AC < TAC׈נADXpAD״ADADؐبADؐبBpC0HAD0HBpC0HBCC CBhC\tAD\tBpC\tBxCBCBCBpCADBpCTlADADBpCBCBCADBpCBCBCADBpCBCBCBCTlADTlBpCAC0HAD0HAD0HAD`xC$DC$D(AC0HBpCBpC0BpC4BpCBpCBpCBCBpC BpC $<BpC PhBpC PhBpC BpC AD AD (BpC @Y<BC@Y<BpC @Y<AC@Y<BpC @Y<ACADBpCBpC BpC BpC BCBCCCBpC AD@XBpC @XBpC BCCCBpC CCCCBpC BCCCBpC BpC  BpC BpC <YAD <YAD <YBpC <YBC <YAC <YBpC  h BC h BC h B\D h AD h BPD h BDD  B,D   AD   BD   BD   C$C  AD  B D $ <C$C"  B8D  CC (YBpC !.T!.lBpC !.!.AD$%!.!.AD$%!.!.BpC !/!/AD(%!/0!/HAD(%!/`!/xBpC !/!/BpC !0!0BpC h q px p0 @,X $ xoPv`h`H@ ?????OOOO?/!OO1OOLLLLLLg{x{p{`{H0(  $s# hn( ` Y 2, t E\     x L p  l x   D    A4 xF pF h, `, XH PE HE @5@ 85@ (6T 6T 5 5 5    n( ` Z Z   Npxx$;P$;PP$s?X]X?P]l?@]T?0]L?(]P]$ h 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-|2QQPQ QQ@Q0QUUQ(-PaXPXTF$%PN%RR&<CE&|ST'$NM!x#CL#0PL#0RE$@RR&<CE&|ST'$SL4RR&<CE&|ST'$ER'\CE&|ST'$0d:$:,:::;l;;tAl A|P| } }0 }\B}B}B}C ~ A~8D~d ~~G~G`@Ghl Gp O0 \  O@I\M<h8OhO ($ODP|PpQ $ x   L#&`|P|Š}T}0T}\Ű}҈}B}C ~ A~8p~d~ ~~@TllTTT0T\TTTTT<Th8OhO$$DP|PpdTTxT  L#a|P|p}x}0x}\p}w}B}C ~ A~8s~dt~ ~ut~v@xl xxx0x\xxxxx<xh8OhOv$xDP|PpxDxxxxx  L#kcX@e Q4_4native fh@XXcTTCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2000 OpenBSD. All rights reserved. http://www.OpenBSD.org #hhnative fhTTvHv8v(B    p  88P8xB    #< $ 7 H@h0 Z  UY O c< bh!"(t0$ 4!x8D ).@xy/h/ X4  T 4 $`,B B @H 8  B B  P 8 {80yLB  B - , N` R\ l| N_<OTB  /8 h B vD&TaB   8 w '$<0.$U0_S01(B xD 8xPT@l tB B B B t67 B B B B B B B B B B B B 8: B B B B B B B B xl | d#X2 B +,ID*lLB U a0 cB  @ E@H@Mp lX v$k sr|rsB B B B B t B B B B B B B B B  P  &@ [l n B  la9:@o ph`XPH@80 xhXH@0 p`XH8(p`PH8( p`XPH80 xh`XPH?? 0 rrB@D,hP@_ xph`PH@80((A#',-p/86X668x:ttyclsttyopnttybgttyinttyout@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@w`xxp      w`xxpt,` ۄp s u8  v  y4 ( ` d T @      @ Hph H`XPHt(@8 @`0PH x`0PH @(  x(   xLf,xLf, ̜ ̴ XrHwHwxLPnetionetconnetclsffsȘmfs,ʈext2fs`Pcd9660/,msdosnfs0procfs null  unionumap portalfdesckernfs x|TŘȈx(xX\ acPdx2lockf@` PH@80(  |P} l h D<|$#1|?@lBDDDEE |Eh| E| FH}( F}T G0} G} H} Hh~ I~0I~\J0~ J~J~K( Kp8 KdLXL M N NT OP P  P Q` Q4R@`RS S` S T@<ThTU U VXWDWpX XY`Y Z@H|$L||}}0}\}}}~ ~8~d~~~@l0\<hDp Lx|P|Z}\}0\}\Z} }\}\~ \~8Z~d[~[,~[t@\l  \\0\\\\\\\<\h  [\P$[|D\|$p\\\\x\  L #40]8^ ^(^ ^_   _  |P|b} }0 }\e} } }h@~ j~8m~dn4~np~n@ l   p,0 \  pTjm<hnop$pDp |$poX   xp$  L #4a a a ba|P|p}x}0x}\p}w}x}x~ x~8s~dt~ ~ut~v@xl xxx0x\xxxxx<xhv v$xDw|$pxDxxxxx  L #5T`fifoyzz{$ {d    x   a L}m}m}#P$ |$ |eP$|/ |_|AX$|5$|@$|"nX$|Y$|$|!2$ |x!2$|p$|`#2($|X"$|P$|H!3LG$|8G$|0$|([$| !2$|k$|P|p} }0 }\d} }l}~ ~8~dt~ ~ @ l   0 \    <hp$Dx|$p   x  L #5PHd  |}hD0}\,|(|0$pL#5T \       |P|0} }0 }\D} } }t~ X~8 ~d ~ ~ @ l   0 \   <h@$@D|$p   x  L #%|xph ` X P H @80( $x     (  xph` X P |P|H}}0}\}t}}~ ~8~d~~@l0\ļ<h@  $Dl| px  "|devopndeviodevwaitdevindevoutdeviocdevcls|P|Š}T}0T}\Ű}҈}4}4~ 4~8p~d~ ~~@TllTTT0T\TTTTT<Th˄ $$D8|$pdTTxT  L#4Pݐޜޤh  |}th4D0$L#%x \dT X    P  |P|} p}0}\}}}~ (~8$~d~L~~@l\x0\x ` '<!h"L"#$%d$(D&l|'p'0(8#@X!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~q~~t ` 7@ 4. .. |P|[}}0x}\}}} ~ ~8~d0~~ ~(@0l8xl0\pDT<hBdAL$DL|0pLL"x@ 20123456789abcdef^^3333h4#$%&'()*+;,-.;/;0;1B@C= D$E= F$cdeB@LK@B@`0123456789abcdef#2F$We6tHZl~3"VG,ud>ɍ@ۮRdv!0g&vD4UJÎXn|1 wf.TE<ˬBُPftBSap '26L^׈hzRC q`(7&:DV`rcr@Q%"40N\թjxsbPA5$*8FTbp,ӥ>@+R:Nd_mv|ҭ$6 H;*Z^Ol}l~ .<ѵ)B8 Pof~Lt]&н49(J Xnn\M| ׅ(:JD[iVx `/r>֍ 2ZKLyh^ h?.zՕ*8kFzHTY-b<pԝ"0{jNXI\=,jxiiiiiiiiiiiiiiii0123456789abcdef < T Ԥ  l T T    ( H ( H d     ( H ( H d             !L & 7 8t 2 M \ X \  tl X \ ~0 X \ w4) X  8 X \ 7P @ B3  X \ 2 P X \ a w X \ |8/ j X \ n 7 kL X \ nX \ X \ @ q t }E#(D<8Q @X,2(@AAA==(A* 8@8@ @@@@@@@@@$@(#)ip_fil.c 2.41 6/5/96 (C) 1993-1995 Darren Reed@(#)$IPFilter: ip_fil.c,v 2.4.2.22 2000/07/08 02:43:47 darrenr Exp $ @(#)fil.c 1.36 6/5/96 (C) 1993-1996 Darren Reed@(#)$IPFilter: fil.c,v 2.3.2.22 2000/07/08 02:13:28 darrenr Exp $IP Filter: v3.3.18    D@R @=Zf @@(#)ip_nat.c 1.11 6/5/96 (C) 1995 Darren Reed@(#)$IPFilter: ip_nat.c,v 2.2.2.21 2000/08/08 16:00:33 darrenr Exp $@(#)ip_frag.c 1.11 3/24/96 (C) 1993-1995 Darren Reed@(#)$IPFilter: ip_frag.c,v 2.4.2.5 2000/06/06 15:50:48 darrenr Exp $x@(#)ip_state.c 1.8 6/5/96 (C) 1993-1995 Darren Reed@(#)$IPFilter: ip_state.c,v 2.3.2.28 2000/08/08 16:00:35 darrenr Exp $ /xi@(#)$IPFilter: ip_proxy.c,v 2.2.2.4 2000/03/15 13:57:53 darrenr Exp $ftp D rcmd ` raudio   t@(#)$IPFilter: ip_auth.c,v 2.1.2.4 2000/05/22 06:57:45 darrenr Exp $ X  v v v w p    P X H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||6666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\P<tXҜD`8lӈӤp0LԌр Դ$ ѐ Ռը Ѩ XRhSѸ \( ֈ), ` H XRhS \( ֈ),<' @dPFL8[4@HenP~<LpD -RYH^tL (|ee@      ?BEFF'' EF''' ?F''F'' F''' F'' EF'' ?EF''' ?EF''' ?EF''' ?EF'''' ?F'' ?BF''' ?BEF''' ?EF''' F'''' F'''''F''FF''FF''F''4Pl2>HR@'.+p,.--..0-.|P|Z}$}0}\5 }7d}/X}8~ <~8h~d~ ~ ~@WlW <P0|\, 'Di<h  V$VD_<|$p^^__L x___L_#4 |P|Š}T}0T}\Ű}c}bd}8~ <~8b~dch~ ~~@TlWTTT0T\TTTTT<Th  $$D_<|$pdTTLTxT _L#j|P|p}x}0x}\p}e}bd}8~ <~8d~de~ ~ut~v@xlWxxx0x\xxxxx<xh  v$xD_<|$pxDxxxLxxx _L#j?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@455<ްd6|P|}7G}07}\8}8}9}:~ <~8~d~~D~D@DlDDET0I\SlVX@Y4[<h[[x$\ D]||[pab0u 4Lox`L" |P|Š}T}0T}\Ű}^}9}:~ <~8^~d^L~ ~~@TlTTT0T\TTTTT<Th[[$$D]||[pdxTTLTx L"PŠ|P|p}x}0x}\p}`T}9}:~ <~8_~d`~ ~ut~v@xlxxx0x\xxxxx<xh[[v$xD]||[pxDxxxxLxx L"n455<ްdl  |P|\}\}0\}\<}|}\}\~ \~8\~d\~d~\@\ll\\\0\\\\\\\<\h|$D|$p\\\\x\\ L#1 ... ...x4t55<ìx6|P|}Ƹ}0}\DŽ}8}}~ ɘ~8~d~~D~D@DlDϨ0\ޔߴ|<h [[{($\ D]||[paXhTxrL#5L|P|Š}T}0T}\Ű}^}}~ ɘ~8^~d^L~ ~~@TlTTT0T\TTTTT<Th [[$$D]||[pdTTxr L#& |P|p}x}0x}\p}`T}}~ ɘ~8_~d`~ ~ut~v@xlxxx0x\xxxxx<xh [[v$xD]||[pxDxxxxr L"̀X(  8L h,d;H\"%&,l4633|L*pH 0123456789abcdefӨ)V4ttӨ N Z$ b h4Ө 2 E > 2 MӨ\b`o`rӨ: xbo`rATxӨ<Ө+ސӨ,Ө3 Ө2 4 Ө)tӨ)tӨgPbo`rӨ\bo`r\Ө t@@2Xx Xd$`2(@AAA==(A*g $$ p t0հ l ̜o8@@@@@(@(@PP@`bb3,`b? `?B`bBBbb;;Bb b3,`@ ? `?BbbbBf@b;;BHhDDDTD0 00\0ØP0 0ܘܐ<hX߿sparcsparc߀xߌ߈Hh\44XXX\44XXXt`@xXXXXXXt,((lXXt,x(lXt8xXXXXXXXP<tlDH(l8(t8H(lXTttx(lX   ,  xܔxܔXHHH8d0۰(H HڀpX8 plg,{,PjPpy`0@(ޭޭ@X&(|&P$lP @&TP `& #P(& *P(&p *PP&h #PP&` *P(&Xx+-&.DTTU8SS|ghhggg|mhmggm`p`P@0 < 0ÈphX@hÈ(hh¨h˜€xhPH8 hhhhx`hHh8 hhhhhh`H@0h`0xhhp`P80( @@P80( @@hhx!ph`phXH@h0(h h0h0hhhhhhhxh`hHh0h hhhhxh`hP8h(h(h(h(h(h@(h@xphHh`h@hXh@ PH@@8h0hhhx`hH@(  hhhp`hpPh@( @@pXh@8 ( hhhhhhhxhh`PhHPh`0h(hhHhHhhhhx `tͤph@8ԨppppppHpph|K    L x             ++++++ ++++p+X++H+0++ +++p*+ +p*+ **+**+**+**h+*X*@*8*(*+EEEE*))\+,+G7@+++K M8M MMM8LMLLLML@ XYdLLML@ XYdLpLXMLH@ XYdL8L ML.XL8KMK. XKKMKMNMHSMMMMMMMMMMMMMMMMMhMMMPM[]]ap`ghinno4rr<rsus{,usTHxh (d,<Ɍʌh 0 @\xHamd7930xaudioamdH,| , lxH $   0 P(pXxXSUNW,CS4231aonboard1@%+>IV"k}3 3 D " !8!@"$#$#(x&&&+ +,|+1/0 0(2@+ + + + 3p4L3h9560687 9:9E>t>>Ep`ppppp p@0pP 0p`$FGFMIDIIK<|MNMT QQPQxT (08pp p@ p p p U|VUp^,XxYY^Xde<digh<hDjpqvPvHv@v8(0vdxPv`<Hpx0`8-('|)X'p'|)X'xFFGIpK$AB  X pp   PPP  p   <@`@@  pppHpPH  p@`@@   ``  l   @@@x  P   P      <   4 <         d      H <       ,   x    @   @  @  \PPP     0H@   @       $PPP  pPPPPP  pp((p   HP @P  T@@h  0 @   @@@   8@  @   p      0 @  h   p    @@  L PP    `   p @  0 pp  |0PP  p  pp  ` @@@  ppp  pxp  D p p    p 0 @   @@   (  t@  @  p    px  X P  HHHpHHH  pp  <HHHHHHH       pp  l  p p  8`  P      4  pp    pp  d  ppp     Hp  PPP     ,PP PP  xPP    @@  p@@@@@@@p  \@@   pp   P  @  0  pxx  $  ppp  xx  !pp  !T0H@@@@@@  !pxp  !  "8 ` p  "0`  "  #` p  #h  #  $pp  $L  $xx  $  %0p`p  %|@@@@@H0  %h  &PP   &`P  &P P  &hp  'D @  '   '   ((    (tH  (PPPPPP  )   )X   ) pp   )0H@@@@  *<PP  *PP   *   + pppp  +lP  +pp  ,`p  ,P(PP(  ,  ,x  -4pp  -p  -``  .   .d` @  .` `  .`  /H  /xh(((((  / p   0,0  0x ` p  0pp  1P(P  1\@@H88h  1@@H8$H  1` p88h  2@ @p  20p  2`p  3$ Pp  3ph P  3P P  4 P p  4T<P  4pp0  40  58`  5 P  5P  60p p  6h`p p  6 Pp p  7Pp p  7LHHHHHH  7h  70pp  80`pp  8| Ppp  8hpp  9Ppp  9`P P  9xp  90p  :D`p  : Pp  :Pp  ;(`PP   ;t  ;`  < 0pxx  pp0  >l0pp  >`pp  ? Ppp  ?PPpp  ?0` p  ?0` p  @4 P` p  @P` p  @ xp  Ah  Ad0pp  A`pp  A Ppp  BHhpp  BPpp  B   C,xp  Cx0h  C`h  D Ph  D\Ph  D`hp  D  E@Php  E    $ p   T   8    h   L   0 |   `   D   ( t   X   <     l   P   4    d   H   , x   \   @   $ p   T   8    h   L   0 |   `   D   ( t   X   !< ! ! "  "l " # #P # # $4 $ $ % %d % % &H & & ', 'x ' ( (\ ( ( )@ ) ) *$ *p * + +T + + ,8 , , - -h - . .L . . /0 /| / 0 0` 0 0 1D 1 1 2( 2t 2 3  3X 3 3 4< 4 4 5  5l 5 6 6P 6 6 74 7 7 8 8d 8 8 9H 9 9 :, :x : ; ;\ ; ; <@ < < =$ =p = > >T > > ?8 ? ? @ @h @ A AL A A B0 B| B C C` C C DD D D E( Et E  Y??  ZXU@*U@*U@*U@*U@*U@  ZDDD|DDD  [8|@@x@@@  [8D@@@D8  @  \@@@@@@|  \#aaq:  \  ]hDddTLLD  ]DDD((  ^H  ^  _(  _  `  `x  `  aX  a  b8  b  c  c  c  dh  dxx  eHpp  e?111`  f(@ 0`@  f 000>|? ?1  g  gx  g  hX  h000` 3ff  i8?ff`f>``f`?  i8`DDE9  2 2 a  j>wc`aaa?`  j    j  kh0  0  kf`vvf`  lH  l    m(  m   n` 00`  nx00000000  n6?  oX?a@ 0   o @````@``@?  p8 !?  p ?1```@```0  q 00`gop``````p@?  q?`@@  q000  000  rh ``````p?```<  r    sH     s`xx`  t(  t`88`  u9   ux?0```g ollg`0?  u ? @@`@`  vX````a``````````  v` `````` 0 @  w8a``````````````````@a  w0@0@000?00000 0   x0@0@000?000000x  x` ````a`` `0``  x``````````````````````  yh  y80  zHacflxx|ngca`p  zx00000000000 0   {(p`pppY`Y`Y`M`N`N`D`D`  {p` p x X L F G C A@@@`0  | ````````````` @0@  |x00`0`0`07000000x  | `````````````0@8@#  }Xa````|ngca`p  }0`` ` p<@`@``  ~8F   ~p` ` ` ` ` ` ` ` ` ` p@?  `@000   f f f v w@3@7@;;  p` 0@8   @`  hp` 0@   ?   ?  H  ``00   (|| ||  1`    x  0009  X ```gop````````p`xO  1 ````p@0  8`````1 ````````p9`p  0``````0`       1```1?`? `@ @ ?  0p00790000000y  h   08  H````acf|x|ngc    (nf`f`f`f`f`f`f`p  'y0000000y   ````````p@8  xq``````````@p````    ````````p`8````  Xs48000000x  00@8 0?  8  @  y00000009`  p` 0@0@   pf f f 7@;@;@  p@8   h` 0@0@  xp  `A8 p`  H    (8    8   >`6gC  UPUPUPUPUPUPUPUPUPUPUP  x   X   8       h   H   (     x   X   8       h   H   (     x    X7%dlhx90   000>|? ?1  8` w@;008.@`  p` 0@ ??    `0 8 1`p`8A@a    h @/@YYX X YY/@ @  1??  H @3 `  ````  (   @?@YY_[ [ Y9 @  ??  x#aaq:    X     8  y00000009>`0000`  >~~~>       h   008?  Hf3 "D  88 `?@ 2dG  (0pp0 0`013`2``A  8|L  `L};@ 2dG   000@9  x ? @@`@`   ? @@`@`  X ? @@`@`  3 ? @@`@`  8 ? @@`@`   ? @@`@`    @'&@>&FFF  ` `````` 0 @   0@0@000?00000 0   h0@0@000?00000 0   0@0@000?00000 0   H0@0@000?00000 0     (      xa````````````````@a  3p` p x X L F G C A@@@`0  X ````````````` @0@   ````````````` @0@  8 ````````````` @0@  3 ````````````` @0@   ````````````` @0@  ``00``  `!!c`c`f`l`l`x`8@0@8o  hp` ` ` ` ` ` ` ` ` ` p@?  p` ` ` ` ` ` ` ` ` ` p@?  Hp` ` ` ` ` ` ` ` ` ` p@?  p` ` ` ` ` ` ` ` ` ` p@?  (p` 0@   x00?00`0`0`0`0?00x  1136663104`6`w  x0009  0009  X0009  30009  80009  0009  6@&``?fffg`?  1 ````p@0   0``````0`  h0``````0`  0``````0`  H0``````0`    (      x01 ``````p@8  3'y0000000y  X ````````p@8   ````````p@8  8 ````````p@8  Ĩ 3 ````````p@8   ````````p@8  ň  !c`f`f`l`x@8  hy00000009`  y00000009`  Hy00000009`  Ǹy00000009`  (` 0@0@  xp  Ș````oq``````````@p````  ` 0@0@  xp  x  Z@ Z [ [ \ \p \ ]P ] ^0 ^ _ _ _ `` ` a@ a b b c cp c dP d e0 e f f f g` g h@ h i i j jp j kP k l0 l m m m n` n o@ o p p q qp q rP r s0 s t t t u` u v@ v w w x xp x yP y z0 z { { { |` | }@ } ~ ~  p  P 0  ` @ p P 0  ` @ p P 0  ` @ p P 0  ` @ p P 0  ` @ p P 0  ` @ p P 0  ` @ p P 0  ` @ p P 0  ` @ p P 0  ` @ ð Đ p P 0 Ǡ  Ȁ ` 1234567890-=` qwertyuiop[]asdfghjkl;'\ zxcvbnm,./ !@#$%^&*()_+~ QWERTYUIOP{}ASDFGHJKL:"| ZXCVBNM<>?   13457890=   ;'  ,. AEIOUaeiouy ^AEIOUaeiou ~ANOano Cc AEIOUYaeiouy `AEIOUaeiou !!""+-,,-,-:Aa|/u0Xx12434<<>>??A"*E^`~ôC,/OD-E"^`ȴI"^`̴L-N~O"/X^`~մP!|ROSOTHU"^`ٴY-\\^*-.0123_Ooa"*^`e~c,/od-e"^`i"^`l-n~o"/^`x~p!|rososthu"^`xxy"-||property length0@@ϠϘϐ ψ π               T0               ` $!8 @tXtt4\d/0\5:`K                    5T6.JJlJd0X`8،$    $    $    $    $    $         TWPWWX,Z`X         |l  X                         <           T                 <P mlmn n,n4 n               Dl    `$  /0\9::`        (H@   @  ` bb  b  c,X                        !8  !@  "$       yz{{8{@         &&  &  +                                                  560  68  7              4\d  l                                                                             5T67$7TJ  /0   0(  2              ל،   ~ ~ ~ q                               IDI  I  K<              >t>  >  E       \l]`]^_ `l                                                                                                                                                                                                          XxY  Y  ^X 8 | \ DX Dp  &)1l1*2l24 ;;;<<< <4 >|> @A  x X \ 0h                QQP  Qx  Tt   q q y } wl  ި  (   $      $      $      $      $      $      d T , rs  sD   OPQ` T,                     } h trap`P8  xhXH8( x hXH8 0  xhXH8( ޭ$R$Rx$Rp$R h$R`"lX$RP$RH$R@$R 8$R$0$R(($R, $R0$R4$R8$R<$R@$RD$RH$RL$RP$RT$RX$R\$R`$Rd$Rh$Rl$Rp$Rt$Rx$R|$Rx$Rp$Rh$R!P0xph`XPH@80( xph`XPH@80(X @`XPH@80( (((((((((( (( (((@0@ @@@@@@@@@ @@ @@@$  xp@h`@X`@P` @H` @@` @8`@0`@(`@ `@`@`@`@`@`@`@`h(X(P( H( @( 8(0((( ((((((((؀ Ѐ؀ Ё؁ Ё ؀ Ѐ؀ Ё؁ Ё x؀ xЀp؀ pЁ`؁ `ЁX PH؀ HЀ@؀ @Ё0؁ 0Ё(  ؀ Ѐ؀ Ё ؁ Ё (؀( Ѐ؀ Ё(؁( (؁( Ё 0؀0 Ѐ؀ Ё0؁0 0؁0 Ё 8؀8 Ѐ؀ Ё8؁8 8؁8 Ё x@p؀@ pЀh؀ hЁ@`XPH P@H8؀H 8Ѐ(H`  P؀P Ѐ؀ ЁP` ؁ ؓ ؃ ؕ ؅ ؗ ؇@ @ؙ ؉ ؛ ؋ ؝ ؍x x؟p p؏h h؀X`؀X `ЀX؀ XЁX`PH H`@؀` @Ѐ8؀ 8Б` 0(`  (` (` (` (` (` (` (` (` (` (` (` (` (` (` (` 0`  ` ` ` ` ` ` ` ` ` ` ` x` ` p` h`؁ `ЀhX؀h XЀ(hP؁h PЁH؁ HЀp@؀p @Ѐ8؀ 8Ёp0(p 0  x؀x Ѐ؀ Ёx$x؁x(x؁x,x ؁x4x؁x8x؁x<x؁(H @   xpH p@h h` XPH P@8H 8@0 0( (   xH @   x      ((  (( (( 00 x x0p0 ph h8`8 `X X8`8 `X X@PH@ P@H HH@HH @@8 8P0HP 0@( (XPHX P@    hh H @hh  pp   xHx @  󈁠@󈁠`x󈁠p󈁠h󈁠`󈁠 X󈁠@P󈁠`H󈁠 @󈁠@8󈁠`0󈁠 ( @ `     @ `       󈁠@󈁠`󈁠󈁠󈁠󈁠󈁠x󈁠p󈁠h󈁠 `󈁠`X󈁠P󈁠H󈁠@󈁠 8󈁠@0󈁠`(@ @ @ @ ???? -  !" _`abcxyz{|}~ZN]Y^YBYYYYY.YYYY/emul/svr4svr4!H!3cTX6X668xn   B    p 98N:xO, O X|#< $[\ B B @B B j z8B B ;kB tyPB  `@B 4!x\B B tIB MFD AhB B `- O4 $ <^B B B B B B B B B B B B lTB B 10 PDB B B    T $ ' wysl rxDyB B hDhB B cB b,B B B  PU 8,   8    XB ZZ &@kB B .$l8XxD \B B B B B B B B B B B B W Xjy {8B B B B B B B B B B B B B B ;?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzK%  `   X,nK22Kn,X `%KOpenBSD2.8GENERIC#84 @(#)OpenBSD 2.8-beta (GENERIC) #84: Fri Oct 13 08:49:44 MDT 2000 deraadt@sun4m.openbsd.org:/usr/src/sys/arch/sparc/compile/GENERIC !1oHi8! 4ä9hA$JyYj hrz@ "lH $J@P "m "mP{'0!.9GYf4n`P} Ds0 Np "n0 "n44GP!. Y@<& 5 8dAr0GMXn_!p "n8z9tb  rdsp]h xP$7xE T 7Lb "n<k}PGx "n@ ՠxP(|\c҈hh "nD#.(9'B ~K<S)X^iь "nH4 "nL%4 b `, "nP  (8A^MnT "nTcjrrx <!1 X،4 "nXy`t "n#o4 "nDIdM 'Wt` wo&h]|7 ~D lx4"Y)8wH iY_ ,k~  "nXHS- Y (B "nPƸpG$Fdl(( "nx^ "oH UD ]< "4 1` EI O_ WG( d x  y "oL     "oP  " Ȝ  4  "oX . "o` 48 A Ke T \z j 8 u l   wh  "pX  } ~ Q .T  "p\ z| 1y C "p` Q( ] f6 ql  Z` T D O x   j j  "px N )\ 9sD Bs\ P Yw k "x P   \  ^X    Ld z "| c E\ #A$ 2hD > " LI U[ e nd n`\ } " Vx   g `   y4  " 8 "n!1YP=J^g~P}<, Py` " " Tc"-{87LF`T ``IqfLԬ\R22,״ "D C   08@@O:,_thCqzD00|H1| "d Q+|;Cq<MP[fLn ˜| ü(3 8v\ ",t ;EdSm|}\0 "d0  h# <+7Co NY\e "q v|/8 "\!W7TU "\d "T$'0:CLTgwF "0ΜSlp "8  T3 |>L]ehxnxD} "P "X "o "j't'L0h@tS "c "t ҈ frLpQ!tUPUhD/k;Qt_\m {ngA \fP#X ,!S$+ X4> Sb khDvQ " _\M,8(x,l !2G<  "T/ $> $XM\\!lw,0 %  "D  !L!-+l: M$I9[ " e\m Pyqф7{{XG_Gx4 M Uƨbpf$p KLڨ[,`X5  ""(0B]XL`]hy\xπh  `yp "Pq "b Lt$t6L\ <lzn|4D @n,lX9W7$  )2OCo|Z lPv " "l$pQp t&l: !' T9sDRdR?l\4hx xk1wx -X8<  L xx  $ 28 D^ R \ " g r "h }Ű }  D d   p  n K|!! n!!$[!0!=!MJd!UD!`x@!jl!wd!D,!X!X!I!! "x! "|! "!X@!P,"V|"0("*P"=d"MD"]n "e4"w;""@"="""""S"y"l"r# #/#&yD#8#AN#KH#V`#h#v<# #sx## "##,## "# 4$## $ $$Ȝ$/$>F$H p$S&$i "$v~$ $ 3$ޤ$ $$-$ l$T$ "%%  %%)7%6%>\%M 1(%[Y%i%vF%% "%A% "%%%`%8% Y(& @&x&#S&/&Fk&Y&b<`&sk&&&P&&&h& @&l&Y'l' ','  '+ E': 'H'S "'c8'q 8'{ "' T' "'{'<<'''' "''x((($D(/^(: (H (V"(e(v((3(((:T(c((D( "(()&)d) \)) 2)77 )Ex)V[)d)q h) [) "))Pd)g)ܔ)h)*  3*s**,z8*<*N3(*ZP*g ******d+ +!@+&+2 t`+=t+M+\\P+g;+r$+{G+ " + `+ ++d+q+J+ "$+ $, "(,8,*o,8,NZ,\,i2,{,,H,\, ,=,,t, "0, "8- v4--$-0-At-O "@-Y'-m- "@--.--Z--4-h- ќ. "D. ....<.Ld.Z.d<.|. "H...r|.rX..x.8./  ~/ w/$ "L///< P/H "P/V &/d$/z/ "T/4/9////6T//mh0J0c@0 A0, "X06L80?0Gl0U "\0i0v "`00t0P0 0@000 0011gP1' "d1;j@1LQ`1TL1f1xh1t1 )1 "h1&@1 11|11S2a2 "l2$24T2BL2Q g2c,2n@2{2Ռ22 2 "p2R2ܤ2 "2'$2p33]3  3. "3<3G "3Vd3dՌ3y[3s3̨3w3 "3c33{3 "3 "3l4 #$P44 4.,49<4F4Sq 4`4n 4y4~04~4}4}(4|5s@5Ҁ5!ʠ53}5D .5O 5Zψ5f5zh545 %5p5585 '5 5 #$T566_06&j6436AP6R6[6l[6`66 6l6d6F66D6965<6H87F7/ΰ78 7B7V7e7vw7>7 #$h7x|7t7h77 7778  [8W$8'>T82P8O8[8gX88Vp8x8'D8 #$p88 8D8s8\9 D9(|9& #$x91 @T9B9R #%x9b #%|9th<9 P99L9 #%9[9Z9 9 v9ۄ99:P: <@::$|:.p8:6:?@0:H;:U:_y:mS:we|: H::(: #%:@:bp:l:$: T;;2;#;.;=0;H #%;Ul;\;o K8;y`;=;X;{;; ; "; e0; #%;X; #%<@<<"0<.lL>0>$Ll>-fh>C/X>O@>\>s0>H>>>>>? ~\?#}?:|?Q #%?a`?m;?l? #%?8? \? p?$??ޜ?@*l@>@N@$ ̘@4 #&@<6X@F<@X\@a $@y@@ @ @V@d@=(@x@0AAA!A/ iA>klAM,A^ (AkLAu\AA*AAA AApAgHA A 4BB3DBC,B#ǜB2OTB>BP @Ba\Bs #&BB B(B|B #&B,BoB(lB!CCLC3 4C?mCIXCXCkoCsC~ #&C YCoPCzC`CC+HC #&CA`C #&CnD 0DD #&D(,D4ϜD>.DH*4DX DeDr XD.8DD #(xD)DDhD hDÔD,E \EDE$|E5EG`EY nXEj Et E30E #(|EE |EE E EWELFpF pFHF&VF0 #(F= FK FVFqFF~gFeF@F F"LFtF FF F #(GhG24G:G&G9 GAHGQG` #(Gi #(Gu #)GG #)HGTGGG,G\GlG.G \HʌH 4H #1H%5 H/THA #1HQȘH]HkHv0H@HH #1HXH #1HxHH #1HHkHII)TI?~IUIi<II #1IǬI4tIII8I YJ #2 J #2$J hJ,`J5J@+pJMJZ JeJuJ]JEJ ?J`JEJATJ5JHKKXDK!K*TKA #2(KI1lKSjKdLjK{ #38KKKKK (K ZDK5KKLLL' L7 `LELOnL\ ?HLe LokL{]<LL(L DL #3@LLDL LLXMTMsM@M*_M<MH #4MXMg<M0MوM!00MXMpMȐM #4MM!2M #4 N ,N;0N+N=NH #4NUlNdDNqY8NNNvN@NNpNNZOtO O 7O,#O;POTOaɌOjO~ OOOO OOOOPP #4P#0P7P?\PKP\Ph PtHP `PP POPP ԔPQPPP@PaQQQ<Q ,Q/\Q@ #4QJQT0 Qb QmDQ~ Q" Q.Q #4QQ XQNHQQR ̀R!R5RBcXRYRbظRkR{ R #4R #4R RR=R R NR #4R #4RmHR #4S >|SeSS,BS6PSJ }STfhS\KDSmS`S #4SpS S~S}S T;XT lT'4TB4TN TV Tg Txp`TT TT `T dT #4TtT4<T #4UU #4U #4U,pU8gULjU^7dUi-U|HU 5UsUUy`UU|UU4U #4UUVIV V IV(ҘV18V=VJVZAVkV{V #4VVEV tV #5V VnVRV%8WtWW#W2:WJ|WUWbPW,W @W0W #5WW]WYWX  X4XxxX&"X8XIXWXiDXvhX7XlXX{XdXXO@XX۰XoLY cY \Y/XYA YS~Yd$YtYY`YtY #5YPYYPY(ZwZ9Z%Z3.ZD4ZPPZciDZwZ ZZ ZRlZ #5ZDZDpZ@ZZ[ #5 [[*Q[>׈[G[U[k [} [[[[g[7@[f[B[f[ #5(\ ]d\'Vx\5נ\>x\UH\mɌ\w|\ \\\Š\ \]]0]G `]T@]mX]]]]]T]^`^$^;0^Q|^g^rҬ^|a^`^ #5H^ ^^X^^^ #5L__"<_/Jh_< #5P_N #5T_^W|_i_|_D_ #5X__ |__h_`4`8`2~`I|`` `oD``` $```,` 2` #5\`;t` d`\a!a o8a a% #5`a/~a; #5aE #6paTPa` #6xainauXaa a ma #6aaI<a<aa IabDb Pb6bCbIb[Tbd3$brGbZ@b=bTbbKbbhb]bXb#Xc cc-dc8cEcUcccr &c|֠c2lc d,c (c\cfc@cclc #:cd  (dd&/<d8dB #:dK #:dWmtdgldrL8d{,d dddĜdϜdd qdbeWe e'e?o`eOgxeZ #;eeex \eoeie4eƸe #;e!2ee4e ff4f'f=DfHIfVmfgfs_<ffpfJf\f"|f:fdf yfg Bg@g*Utg9PgCgP #<gc{go $g{gPgY4gggg #<gWghgDg 4hnhhh&0h1 h; @hE!hRh] .hghsØhDhhh`hhiiti$i,iAZiU1i`iri<i~i p\i #< iXiieHi5ilj 5hj4j+ kLj= T0jMj]!3Pjf |jvzj~j j{,j jjwj #<(j&j j֨k  I kXk)(<k6>k@68kMckYXTkhݐky{k@kek `kTTkPDk<k k # #M$}M}W (}`~ }q^`}}} #M8}}} 2T}PD} d} #M<}]8}~~l~{(~' ~0h~> #M@~H>~Q~\ ʨ~l ~xL~~P~~4@~~~ ~~p~@~ W$x= GYdZ Je 8q \}|=DDŽhq4 #T@#: 2l&09o8BxL8Y g 6t ~hS(  0  B  "1/BhIXРdhp #THy<D k_8$["P.YB(XLU@Wbv ƨ #TL:  v@\ a #TP,AO$Yb{kx$$ #TT <\]P< #TX| $%V6C,Wk ~ 9b, Pj|-=HhPhZ`m} mxx,Mp8E|PZ^ jlAduG4 Ä  LI0ӈ h '0 CQ]<ot-h #T\8  l(а'  X'7vXCJUr8f.hv E4H@]4 u$0,@L@]h #T`( #Tdo~ #Th q :$ٔKP !"*1< #U<HXZYfkxA"$(t #U@EH @ #UD /I@HK`j g| #UH0T\ #UL X #UP @  ( \$ #UT.Sl: GzPHZ #UXj),u 4qx `:( Z  c<̀rl*o>F(P@^ tl xu T`x&T #U\0xx!)<DXT 8tb xo'zn #U` L|t$+ #Ut5xAVXQ Ixb԰j(4 #Uxr7Ű 2'tD)S<cLnO~ T8hxx/,d 4)'!83 #U|F'0V #V@f_rk\Xm _Y#0D! #VD+ pD %\Ph\ #VHk?{ #V`-_ '` Tļh <yP $&|`10;~8J<]n1{ ZY #Vh?n\P T)l6@R0n(}%d eP 60n #Vl =|D/ H YU$]ePh{B(.l Q{^ x$l#T0t>tI #VpT`\AX` #Vtjs ax #VxH8  5 [!p1E@=<GLU]i] zkϨ48x`Ȉ'dBTAx#,6DITo<]`fn #V|{ #V`lr @4 #V #V;@, , #V' 4<xRxDg`w1/hpTְPc !0o4+>7K^`l 881 st_-D9 #VHhU^hʴxuB bl NO%*H2<ECI0S b:$pz 0e| #V #VD #V   % .5KAdOY jxBCT #W463C <% #W3\=UL:`Uj`ect~6 #W0pn "^t2~<? PO Z kXwH `X #W!.T b0 Z % #W)F\9 H #WYhds!.lMTYHO8 :-pX,Tx:tFS #W^r,pL̘ eJLD #WZ0  #W!2 :]HvXS(h_l!/u%h( r`_ @ 948 lxx %94KCDM8\ 8fa8o #W~ h!/Ap #X,8a4k$ ,\$, k7 GQXPfpi](  B  h  ۰3pBR\Xd #XlujA'` |89 #X n E@^u%1H@ xM\m y N t $  #X81p ,Y  > zި(4$@!.I #XRA|_"$jpy`ب` #]ɘ >\l\A4  U%N/B!.KlUg],x #]8(LLhR #]  lD"/H= wlG #](OYal wQX? #a( #l[|x4Le ~\Xx+(AxXoŘ|T#cPa,jT)7 CpMlTVi<v #ay^ #a 0ŀ'3B 0T f{wt<L@ F13DX)[1VX9XEN<QH[ #afPoP|wTp p ( #a@x #a 6(g,;mG!8OH\[$j+zdx #bؐ|\ PܤLL0%,-;Q`mz Dب`+<x]Fh  ָ]0( #b460D0OW:cPn -D˨'< #bx.h   G #bI=)=Mvt[dmu<~}6IdqZ4 Q #b #b x&;,Q #eH[`i d0}PP`K4;.P #ePrh&3x@gKhUYx]xoi}# Bd0*!@+ # ,rx=LhY 8kr5_t #eX(# #e``$6 H' ;yDOxVg ]Ohjь|@<(g #e( 0\'ߠ6@ #eIZOgz X/\_}\Q0w!L7UC4OU\Z iq 1p #e \( #e< DH9) #e8@dMt]pp {8u8$X =ވt% #e1< #fHRx\ tTpppPX #f8|g  .sX6F,Tx a |o #f} X #g #g8mYX  #g"8,C4EK<Px` lnr\(YPDX #g  8@4!x.>wpG_xeY w4y88$k84EUapjR qPp,Pbx3 Mu..= phLS@^ \o ~ X Itt #gHGh$ p$m ,<HUg0n\ #gP  #gX. =dhf #g\ #g`@lH%T3&>LXXO m<wwHȔ$4Tp(10X.,5DB \Z gft{‚!"“œ¥ fº  lX\o  #gd0h<D(O@[)LmÁ\ÌÓnâõ0;l`< 5!x 1>|C K #ghTgʈv} Ċ`ěĩĸTL #hh,#786MsX{he =s8 #iŐŜrhŪ]lŵt l X`g X #i #i- H@ XN %<[)8i #jxrƄH$ƑYƘ #j|ƣƭ #jƷe~@ sl1!:hhG\R fxuhǀ&LJ/ǘǢ #jǭpǶ-<@ #j{DP #j_<$t2; B $Q drkȅ 4ȏOxȢȬ>ȸV T}b9#2G NT\k #jɐɝ ɨɵl@s$]p@x #j# #j7'GjM #j[hsAl| ʄypʍ^ʤLʮY<ʶ hʾ< #jxD)9 3@G #jS!3H^AfՈq{ˊ-˕(ˣ #kˬq˶`Tu D*:NI[ePqx́8̋3 ̜̔@ ̷̤ #k` #kte #kx3P0\ &49@|SH_ot~=͋\͚ ͣMͭY͸ #kp @E} `0: #kJlWLar|tf΁ΉpΗ<Σ (ήRλso|``  #k) 7FKSe .wϋϕϨj@ϴ'@H #k7  td* #k2d?IDZ_dn #k|O,ЌЗtОб:м \p  h! 3bA #kKX #kir #k|ѕѝѨ8ѷ{H #k #lP$ #lT2 #lh=0H((V|b #lj\{ v҅T,ҎXҟҵ  $ BD #| n8@'X9 #}D #}K|WkclqtӅ(Ӗ,Ө9Ӵ[4 P9I|~T2<  6' 6H7l@KWfchuԂ #}ԍԙAԥԸND d #Hxl<S\^ i ̴u ւP֑֧֜ #}ֲ #־` #5@O9  YX` #0 $7>LL #YtdX|thׂלק (״?\@ q m $ <+ <;"E[Or_[o} ؋ ؙLاعa: #h0ET  #P. 8OdYvdb&l δx,هٖ #٠~`٫dٺ #BY|  @$!"2 #D #P^j$w08چ ,ڔE0ڢDڴblڿ  h&i/۰;XD UPjLۀ`ێ@@۟ #۴*ql # Y*;dG #U l$aj |d(܆ # ܗܠ #HܨPܹo01d /0)5}`=Q^4Lp݁ݍ #Hݖp ݣ!/ݷ #L] dP |+x6X>hL Xqg.|HޏAhޟlްp ((Xl &4C0><Q` j8$tߊ SߙrHߣ߯<߻ #P!.@ { d|-,AKuUG4kjz4j(!.l$<40@pN_Di #Xtݰ}9ƨ@5{2)f>EtJ U_'kr@z #` #ɀ0 n  ^`YtP_ 0'l0F #ʀR d{<qPD{%@X #ʨ E   m0hx&/7D; nF UDac`hls>L|v  #ʬ րtzd P Z$ 5T@llT#1 #ʰ:CO ` @o|H0tG< #ʸ T 6 ( ,5+ @:`S\g 8vd@ D <B$t #8 #FK Pt` |q #z \  A<Al_) #1P@}NWYhvlXbD XD|)?t;D8Q ,X #a p}04 #k H D 7 #'[5ΤA@(JRdtAt~{r|28 #L  jtLn4 O4OFpT\@e |J4VH_w  # 5"o1@CNT[phq #z #(ؘA8hX h4T #0 #8 #LX q)B 4 #;EIDR^Vi(s #(yX t;lC #,Y #0 #Θ"r`3A!dLV p_i #μv^(3~t #a0 O/`#(/Y<J SYdvhh:4 :D yn o #*3ThB M \T fn ZӨxL\  #eP,2p #, #=HPZ{fOO0m Y*  bp4| l&?06 WF|dUu`Hm|3LX(W{  4  p #)Dc<U8j)r8r;  P8 x !X @|(6 B O^xlqy+2XXlHX fh@"!4.=:FE NrUPcvL (h #hT >4"|h)Ř=GN [Xem]H0l}$tDO\7p$h@Lb!*9J `ltwHn< # i/+Tސ # Lo n/{7_DNXVk #s\{Af84L lX## /r= <FMvZxf\uC0I f8-4 # Gp $4e]@,; #JaU aHp]LF  G F\SX`glTx^ $ @ $ $^:@l $ G&:|dPcsPHD ^ L0x V +z:BbKT cxmz u8,T`l w $(N ( $0l#W 5tFxXf<xM8{8l4 $4HL $8#Jl+ $<9 $@A(P[!q9d,^  $JLH6 $2 $;I$UMg t $ $0 $ %9CO`kx{ ?Hml dKp  $ | ) $ 6| E( L{ S ? b l $ u  $      ?      $! $!  H!M!" $!.Ш!=!N $!Si !bj!}~d!A! D! ! f@!!! ! $!ɼ!L!-"H" "#"1uP":P"W"a."t $""j""j""a" "k# # `#%#6,#BvD#T $#b@#i@#o## ##@#)#X# $) # #H$;d$rt$#rp$5$?`$Jd$Y$i $)$p<${$\ $ !($$@$$$;X$ $)$<$!0%@,%I%% %,H%2;%;8x%G $)%XP%o $)%|%%%%%D% & % ?%&ut&^&+&<!0&FL&V&c&q &}& &Ŝ&`& ?(&0&y& $)&$' $)''%'1'> $9'J H'`@'l'| $9'f'b''' 6,''ql'8'sP's'(( $:((!(5 $;P(A(P(Y(mԔ(}(l(V4(oX((%( $J(((ל( $J(f,)H)J))! $J)/!)G)TQ)_Ĩ)x`){d))) $K)7)Z))sp)"<)t***) $K(*. *9 $K*CP*M~*U{L*a(*k*z v** $K*ֈ**L(**o*!8*m*+.+ + $K+$X+,<+7 +C h+J+Q @+[D+gu+s 8 +x+bd++rH+8+H+ $K+ը+ p,8,  ,At, $K,*{$,7A,E $K,Lml,T,\,e ,x, ,,c,, $K,x, R`,,Q,,'<, $K,3--`-' -7np-D0-Y(-iK-x-- $K- --T-`@--<-D.u.J<.$.-,.5.A C`.P.Z x.h l<.u .c.X.H.zX. $K.~|..H. \/ $K/\/s/!g/1\/=4/M/`/k<//(// 8/z/Xx/\/@/ q/ Z0sX00%^0-t07X0EVx0Q0a0o0 $K0Q00 }0 $K00s0 x0T05T00 >0s11$N0151>E1R1a 1o1y1x1,1q1Ѽ1P1ߌ11 1 7T1 2!2 2 x2- 6292B 2I!32P2X2^2r2{$2 42?022n2 2 2 $K2 =2h2\2 $K22>t3 d33#32G3>l83Pn3\3i 3uE33WP363|383D3333t3^4&44 74'4AyT4L 4Yn4h<4Z4(4cX4@44x444G`5 $s5t55"qX5(`555Ct5R5d5u5}5 $K59X5L5P5r5`$5p5h5Ф56 $L6  Ԍ6 X6) <67 $P6G6V $P6_6k@6w6d666b@6e6d66 $P(6 $Q(77s7 7(L73 $Q079 7FX7P̬7Y~ 7k ~07x M77 m7!277v$77f7]T7l78  8 $Q@8# $QP8.8>b8I]`8V8[T8d<8y08 (888u8Vt8 8X8ZT8 88p89 ,9 93\9F $Q9W09d9nw9 $Q99 $Q9`99T99 9Z9j,9:a:0::/8:: :FL:TS:d:,:t:::,:p:: ::v:8;;W@;)4;9;G;V,;n;|D;H;C(;<;|;(;H;;; $Q< e<N`<'\<2hL= $R>z>>@>l>!s>&>6ߴ>F $q>O $s >YiL>f>n_kbd_serial_nfs_readlinkrpc_bridge_filterrule_log_copyin_sdioctl_scsi_scsi_cmd_swcr_newsession_ipllog_addlog_ccdlock_proc_trampoline_dmmax_isbad_ffs_oldfscompat_nfs_niothreads_ipintr_ncr5380_pio_out_tctrl_intr_nv3tov_type_nfsm_srvpostopattr_nfs_iodwant_iplcrc_doforce_vndread_mtty_ca_iommu_attach_icmperrpps_count_remrunqueue_cdevvp_cd9660_vfsops_nswbuf_max_sw_3_leftover_getproplen_db_hangman_timerok_ffs_fifoop_p_ipf_rdrrules_sz_spec_ebadf_ttychars_doshutdownhooks_mtty_cd_isp_cd_cold_nd6_rtrequest_rt_timer_init_rti_delete_msgs_cd9660_readlink_htonl_bsd_to_svr4_sig_reginval_ctx_free_kbd_repeat_dayyr_nfsspec_read_nfs_getnickauth_fix_outcksum_nd6_ifattach_userconf_maxlocnames_sys_shmget_spec_read_db_lastsym_spppattach_lebuffer_ca_write_all_windows_cd_get_parms_esp4_input_cb_sppp_ipcp_TO_devctty_sunos_sys_reboot_union_write_devopn_sys_rfork_iso_uiodir_isohash_dvma_mapin_xdc_error_ieattach_fdcattach_rip6_input_nfsspec_close_spec_close_isp_attach_lebuffer_cd_buf_bootstrap_getidprom_fdprint_iplopen_bgetvp_rcons_esc_fsrtoname_uvm_pager_dropcluster_nfsd_head_flag_sys_revoke_db_cmd_loop_done_qecprint_sd_scsibus_get_optparms_crypto_freereq_in_pcbdetach_in_pcbconnect_zeroin_addr_bridgeintr_msdosfs_symlink_procfs_symlink_vndsize_audiowrite_htons_arp_allocated_fdesc_setattr_ccpu_le_ca_ttydebug_si_debug_cdioctl_fr_running_cpu_model_uvm_map_protect_getfp_scsi_test_unit_ready_eeprom_uio_ip6_auto_flowlabel_in6_purgemkludge_vmi_list_slock_ffs_reallocblks_nfsnodehashtbl_blf_dec_tdb_walk_fr_pass_rt_timer_queue_create_msdosfs_reallocblks_nprocs_cgtwoclose_scanjet_trigger_scanner_mustek_trigger_scanner_mfs_close_nfs_readdirplusrpc_send_reset_if_attachsetup_unp_detach_ttyclose_le_cd_scsibusattach_uvm_map_submap_ipsp_acquire_sa_catq_dofileread_uvm_doswapencrypt_ffree_fork1_sw_1_leftover_timerreg_4m_userconf_common_dev_iso_shipdir_MD5Update_bootlshldi3.o_sunos_sys_uname_rcons_invert_cs4231_halt_output_sbus_establish_mountroot_hook_establish_nd_defrouter_softdep_setup_directory_change_powerhook_establish_vmapbuf_shutdownhook_establish_mbpp_recv_mbpp_send_mmu_reservemon4m_ahstat_kernfs_print_fdesc_statfs_needbuffer_spec_strategy_VOP_BLKATOFF_cnrom_uvm_map_clean_auth_hash_key_sha1_VOP_READ_cnputc_tctrl_match_viking_cache_flush_srmmu_cache_flush_ms1_cache_flush_import_address_mfs_rootsize_esp6_input_cb_fr_findgroup_vnode_free_list_m_copym_pipeinit_vattr_null_sys_setgid_sys_umask_db_last_symtab_cons_swcr_encdec_fr_check_getsock_bdevsw_acct_process_sys_readv_vop_symlink_desc_vop_fsync_descmax.o_tcptv_keep_init_unp_scan_intstack_cons_ocount_cd_scsibus_getvol_encode_comp_t_vop_ioctl_desc_getsn_isofntrans_ccd_softc_svr4_find_socket_svr4_sys_context_sparc_led_to_getpropint_regyear_soo_write_compat_43_sys_quota_vop_lock_desc_cnstop_ipsec_expire_acquire_sys_munlock_cd9660_unlock_db_boot_crash_cmd_bootpath_store_RMD160Final.rem_ffs_realloccg_il_tab_change_sign8_writedisklabel_ukioctl_scsi_free_xs_tab_gen_sys_settimeofday_cd9660_ihash_slock_am7990_shutdownmin.o_mttyread_fpu_compare_cgfourteenmmap_softdep_setup_allocdirect_gettdb_VOP_SEEK_maxvfsconf_randompid_exec_elf_fixup_db_listwatch_cmd_pv_unlink4_4c_p9100ioctl_vndxfer_pool_blf_enc_msdosfs_lookup_adler32_fdesc_allocvp_kinfo_vgetfailed_sysctl_file_sys_getgroups_bdevvp___adddi3_ufsfifo_write_rtrequest_slstart_tablefull_tickdelta_cd9660_reclaim_region_freelist_msselect_vfs_unmountall_fill_eproc_sys_seteuid_compat_43_sys_stat_ccdinit_compat_10_sys_semsys_fr_tcptimeout_ips_num_net_sysctl_sys_wait4.urem_db_put_value_mmusegments_umapfs_vptofh_devin_groupmember_frag6_doing_reass_devio_VOP_ADVLOCK_sys_semop_eintstack_kbdwrite_uvm_shareprot_nfs_mknodrpc_ip_natsync_blf_ecb_encrypt_mii_phy_add_media_am7990_config_svr4_sys_times_nfsrv_statfs_sorflush_db_show_regs_vmel_ca_nptesg_zsabort_enosys_sys_ntp_adjtime_cd9660_getattr_cgfourteen_ca_in6_ifindex2scopeid_tcp_do_rfc1323_vop_mmap_desc_cd9660_unmount_ccddump_uiomove_copystr_fpu_implode_si_dma_alloc_crypto_queue_max_arpt_down_vmel_cd_si_dma_free_beioctl_nfsbootdevname_ippr_ftp_pasvonly_spec_pathconf_cgfourteen_cdmemset.o_in6_pcbsetport_nfsrv_slpderef_devioc_addrmask_db_mult_expr_ptyattach_beintr_ip_natexpire_ipfr_nat_newfrag_bpf_allocbufs_userconf_common_attr_stty_start_ttymalloc_sys_getfsstat_compat_43_sys_gethostid_check_console_mii_activate_ipauth_encif_null_reclaim_sys_nanosleep_ccdstart_mii_phy_down_uvm_page_lookup_freelist_uvm_map_advice_uvm_deviceops_audio_free_ring_cache_alias_dist_cddump_cd_read_subchannel_findroot_getprop_pmap_pageable_nqnfsrv_getlease_fae_list_umapfs_init_reassignbuf_mb_map_pfctlinput_inetdomain_kthread_q_db_strcpy_cddkdriver_nd6_defifp_ipe4_init_pipe_close_acctp_svr4_sys_systeminfo_ccodes_cnwrite_fdwrite_prelist_update_rawin6pcbtable_amap_cow_now_bcopy_pmap_stats_ipaddr_lf_findoverlap_sysctl__string_sendsig_db_unary_copyout_xyc_cmd_ipopts_ipport_hilastauto_kernfs_symlink_sbflush_ccddevs_switchexit_espattach_sys_obreak_swcr_init_cddone_ufs_mkdir_umap_bug_bypass_fdesc_badop_ttyflush_fdremove_rnd_timeoutmuldi3.o_be_tcvr_idle_ncr53c9x_readregs_mttyclose_in_gif_input_kernfs_pathconf_donice_semexit_fifo_pathconf_msqids_multicast_register_if_ft_tab_time_adj_pager_map_wanted_lock_doscheckpath_union_revoke_spec_advlock_vndclose_rdioctl_bsd_to_svr4_termios_svr4_sys_uname_ev_read_intr_establish_vmeintr_establish_nd6_defifindex_ext2fs_fifoop_p_ipfr_nat_knownfrag_ipfr_knownfrag_compat_43_sys_wait_emul_native_db_panic.mul_chainlength_union_abortop_kernfs_write_sysctl_struct_sys_mincore_audioactivate_svr4_sys_statvfs_pmap_rmu4m_pfkeyv2_flush_walker_in6_ifattach_pmap_collect_mbufchainlen_acctresume.div_seminfo_cs4231_device_ffs_clusteracct_union_start_ttylclose___divdi3_extent_free_calcrulshrdi3.o_xformswNXFORMSW_iplinit_procfs_dostatus_VOP_LOCK_safepri_vndclear_db_malloc_print_cmd_stackgap_init_sdmatch_mi_switch_seminit_mclrefcnt_kbdselect_ufsfifo_read_dead_badop_VOP_LINK_isochar_arc4_stirnotdi2.o_scsi_execute_xs_fr_flags_bdirty_ostype_VOP_CLOSE_xywrite_swap_key_in6_pcbconnect_sppp_lcp_open_sppp_lcp_down_portal_statfs_uvm_deallocate_finishdup_sys_nfssvc_sys_vfork_db_examinesaveregs.o_in6ifa_ifpwithaddr_sppp_lcp_close_unp_gcing_uvm_swpkeysdeleted_ipsec_soft_timeout_dosdirtemplate_enodev_mbpp_hztoms_me_alloc_doreallocblks_sppp_chap_scr_si_obio_intr_off_ipipstat_ipacct_esp4_input_unp_shutdown_xycattach_hme_meminit_be_tcvr_init_ufs_mknod_process_read_fpregs_stat_rush_requests_iftovt_tab_pv_unlink4m_nfs_update_fc_lookup_sys_setlogin_amd7930_halt_output_cd_scsibus_set_pa_immed_ipflog_bpf_m_xword_sys_ovadvise_audio_init_play_sunos_sys_exportfs_sppp_chap_tlu_link_rtrequest_dead_ioctl_config_deactivate_sc_print_addr_sunos_sys_stat_ststrategy_frag6_drain_gen_tabs_in6addr_any_sys_fchflags_extent_print_all_db_radix_write_user_windows_cnrint_export_address_readbuffers_MD5Update_int_nat_outlookup_union_readdir_start_reaper_kernel_pmap_store_pfkeyv2_create_ipintrq___muldi3_kthread_create_db_extent_print_cmd_cdmatch_getcacheinfo_obp_compat_10_sys_shmsys_amap_wiperange_ipfr_fastroute_evcnt_attach_pmap_is_referenced4m_qsphy_service_iommu_remove_ext2fs_access_ufs_remove_igmp_fasttimo_mswrite_sys_shmat_db_value_of_name_cnread_fdread_null_getattr_mbpp_timeout_timeout_svr4_sys_execve_pmap_page_protect4_4c_ippr_ftp_portmsg_getdevvp_unp_defer_logsoftc_compat_43_sys_recv_compat_43_sys_send_sys_execve_spec_bmap_kbd_reset_tcxopen_prtrealloc_rn_inithead_union_print_ipcperm_db_map_addr_mbpp_mstohz_sparc_vsyncblank_export_sa_VOP_INACTIVE_sbappend_trapsignal_scsibuszeroref_countbits_union_remove_sys_shmdt_sys_rmdir_in_gif_output_gif_output_crypto_queue_num_rtable_init_rcons_cursor_qeioctl_zsioctl_sppp_chap_tld_ttyinput_vsprintf_ienab_bic_4m_pmap_copy_page4m_ufsspec_read_icmpmask_bridgectl_null_lock_filedesc0_spec_open_vop_getattr_desc_bpfilterattach_scsidebug_level_oclk_set_secs_ip_sysctl_in6_pcbhashlookup_in_pcbhashlookup_VOP_MMAP_getblk_time_offset_stackdump_roundrobin_cpu_startup_svr4_sys_xstat_fdsize_ufs_ioctl_unp_mark_sys_fstatfs_sys_swapctl_cfdata_mttystop_cnselect_ufs_rename_des_ecb_encrypt_msdosfs_vnodeop_p_procfs_vnodeop_p_rootvnode_ufs_symlink_linear8_to_linear16_le_pdevinit_cgthreeioctl_fd_mountroot_hook_union_vn_close_xbox_fix_range_msread_in6_addr2scopeid_postsig_svr4_sys_sysarch_ifa_ifwithdstaddr_socantrcvmore_pipespace_sys_sysarch_sched_sync_VOP_BMAP_svr4_sys_sigsuspend_beeint_ip6_nexthdr_ptcwrite_sys_sigsuspend_start_pagedaemon_ccdopen_ssattach_sd_switch_mii_phy_setmedia_union_rename_sbppwrite_ipfr_newfrag_ttclosgetsn.o_cache_alias_bits_xdc_startbuf_findzs_mld6_fasttimeo_ipfgroups_sppp_lcp_scr_ttyunblock_sys_setgroups_bounds_check_with_label_db_printf_process_sstep_VOP_OPEN_pppattach_sd_scsibus_get_parms_zshardscope_uvm_map_pageable_ah_sysctl_sppp_lcp_tls_umapfs_vget_ptytty_uvm_map_checkprot_execsigs_checkreplaywindow32_vfs_getvfs_pidhashtbl_mixer_open_db_map_print_cmd_eeprom_ca_spifstcintr_cdopen_scsi_do_ioctl_sppp_lcp_tlu_sys_recvfrom_matchbyname_nfs_sillyrename_procfs_vfsops_tk_nin_icmp6_fasttimo_nfssvc_sockhead_flag_sys_mkfifo_eeprom_cd_cd_scsibus_setchan_uao_dropswap_in_pcbinit_intrnames_cs4231_hwintr_sbus_print_enc_xform_rijndael128_svr4_sys_auditsys_mttytty_si_obio_dma_eop_ip6_unknown_opt_amap_wipeout_union_rmdir_null_bug_bypass_vflushbuf_selscan_mustek_special_fr_addstate_extent_find_elf_load_psection.umul_pgt_page_alloc_vmeintr_nd6_delay_tcp_ctloutput_ip_ctloutput_if_detach_spechash_slock_spifsoftintr_mttyopen_vmeints_fr_newauth_physmem.udiv_svr4_sys_pread64_crypto_getreq_vndopenucmpdi2.o_kbd_softc_pmap_prefer_compat_43_sys_sethostid_svr4_termio_to_termios_qe_put_qec_reset_mii_print_encrtrequest_bridge_input_union_reclaim_config_activate_vop_valloc_desc_pagemove_rcons_insertline_timermatch_nullfs_fhtovp_soo_stat_bt_getcmap_ufs_select_region_lru_uvm_pagerealloc_ttymodem_cgtwoioctl_mfs_ioctl_rip_input_sppp_lcp_tld_sys_ofstatfs_cs4231_sa_hw_if_ufs_islocked_nfsrv_dorec_sppp_strnlen_sppp_get_ip_addrs_sppp_lcp_init_vop_readdir_desc_linear8_to_linear16_be___anddi3_module_hypersparc_skipjack_backwards_udbhashsize_sppp_lcp_tlf_ttopen__mulreplace_svr4_sys_pause_skipjack_decrypt_winChkName_umapfs_root_vop_strategy_vp_offsets_vop_reclaim_vp_offsets_vop_readlink_vp_offsets_vop_symlink_vp_offsets_vop_rename_vp_offsets_vop_link_vp_offsets_vop_fsync_vp_offsets_db_read_bytes_state_regs_pmtu_probe_tun_ioctl_ifa_ifwithaddr_union_getattr_dead_bmap_soqinsque_vfsinit_cd9660_ioctl_seginval_si_options_ip_setmoptions_union_select_union_unmount_unp_drop_defrouter_addreq_nfs_cltpsock_bridge_rtlookup_dehashtbl_compat_43_sys_sigstack_qsphy_status_vfs_opv_init_default_db_show_cmds_endtrapcode_rcons_insertchar_xdread_amd7930_set_params_st_switch_eeprom_attach_rtalloc2_detrunc_sys_getpriority_pmap_clear_reference4_4c_promvecdat_pmap_enter_p_ext2fs_balloc_fragtbl124_ffs_update_nfsrvw_coalesce_des1_zerokey_hostname_db_check_interrupt_compat_09_sys_uname_pagetables_start_dvd_auth_nfs_quotactl_nullfs_quotactl_dead_open_scsibusactivate_nd6_output_ip6_process_hopopts_rtalloc1_exec_maxhdrsz_sdstrategy_ext2fs_fhtovp_nfs_invaldir_ether_ifattach_am7990_ioctlstrncpy.o_svr4_termios_to_termio_sdclose_auxio_reg_ip6_log_interval_ufs_ihashlookup_userconf_cmds_userconf_base_findnode_getnewvnode_get_random_bytes_atapi_mode_sense_iplread_etherip_input_numvnodes_lkmdispatch_xydkdriver_ffs_specop_p_sppp_lcp_RCR_vop_generic_islocked_cluster_collectbufs_schedhz_ienab_bic_si_obio_intr_on_nd6_option_umapfs_start_au_set_port_db_continue_cmd_vmes_ca_qsphymatch_sbdroprecord_audio_calcwater_eintrnames_mrh_list_ev_init_xdsize_nfsrv_fhtovp_rttimer_queue_head_lease_check_shm_committed_vmes_cd_pmap_protect4_4c_pmap_dumpsize_nfs_getset_niothreads_nfssvc_addsock_eeprom_va_krpc_call_cs4231_getdev_cd_play_msf_ipsec_acquire_head___ashldi3_shutdownhooks_done_p9100_get_video_ssread_ext2fs_checkpath_nfs_getattrcache_nfs_getreq_nfs_loadattrcache_tcp_respond_selwait_sys_lchown_xyc_startbuf_in6_setmaxmtu_softdep_setup_remove_getnewbuf_sysctl_string_sys_getsockopt_rnd_attached_ncr5380_pio_in_db_inputchar_tcp_keepintvl_sppp_print_bytes_vndattach_kernel_text_cdclose_oclk_get_dt_ip6_dad_count_xdr_string_encode_udpstat_semundo_adjust_cpu_exit_rnd_event_free_xyc_rqinit_uvm_page_init_sunos_sys_fstatfs_mii_detach_bridge_ioctl_timeout_todo_ccdunlock_ffs_vnodeop_p_nfsfifo_read_rijndael128_encrypt_dead_lock_fifo_read_rominterpret_kbd_cnv_entry_optionsnode_fb_setsize_lebufprint_pfkeyv2_sendmessage_tcp_saveti6_tcp_debug_msdosfs_remove_domains_geteblk__umulreplace_ienab_bis_magma_match_oclockmatch_nfs_receive_des3_decrypt_nat_rules_vop_whiteout_vp_offsets_vop_read_vp_offsets_vop_setattr_vp_offsets_vop_getattr_vp_offsets_vop_mknod_vp_offsets_vop_islocked_vp_offsets_socketops_ktrsetchildren_ktrsettracevnode_vop_create_desc_tcp_close_ip_rtaddr_kernel_map_uvm_swap_initcrypt_crypto_drivers_pfkeyv2_acquire_tcp_setpersist_vop_pathconf_desc_qematch_bt2pmt_tcp_template_sppp_increasing_timeout_rtstat_ccdmakedisklabel_audiosetinfo_tsleep_nsphy_status_fd_motor_on_ip6_mrouter_set_seltrue_svr4_term_ioctl_mustek_set_params_cd_switch_frag6_input_union_vfsops_cluster_callback_vndiodone_uvm_km_alloc1bcd.o_qec_translate_stread_ufs_quotactl_powerhook_disestablish_shutdownhook_disestablish_callrom_sddetach_uvm_pagedeactivate_umap_inactive_portal_inactive_fifo_print_vn_writechk_allevents_sominconn_vunmapbuf_vop_inactive_desc_vop_seek_desc_xdc_ca_sunos_sys_sigvec_xdattach_uvm_swpkeyscreated_in_pcbbind_VOP_REALLOCBLKS_soreserve_nd6_recalc_reachtm_interval_in6mask128_cttyselect_userconf_common_attr_val_hypersparc_pure_vcache_flush_svr4_sys_mmap64_cpu_conf_nfs_readdir_nfsrvhashtbl_db_get_value_xdc_cd_mttyioctl_ukclose_nfs_removeit_ureadc_nqnfsrv_vacated_ip_protox_igmp_leavegroup_msdosfs_rename_umap_vnodeop_p_portal_vnodeop_p_p9100close_cs4231_set_port_amd7930_get_port_sdzeroref_nat_stats_in6_setsockaddr_dead_lookup_m_apply_sltioctl_tbtioctl_vndioctl_ccdread_cpu_class_puttdb_in_cksum_chrtoblk_strcat_dkcksum_pgofset_spifppcintr_cpu_fork_start_crypto_MD5Final_mii_phy_statusmsg_rtalloc_noclone_userconf_help_proc_zap_hostnamelen_cgthree_ca___subdi3_ip6_mrouter_ver_netaddr_match_rt_timer_timer_sunos_sys_sysconf_me_free_mfs_mount_ip6_ctloutput_uvm_meter_averunnable__umul_scsi_do_safeioctl_tdb_init_in6_control_sowakeup_cgthree_cd__udiv_uvm_page_physget_rt_missmsg_sppp_cp_change_state_sppp_state_name_tk_cancc_vndencrypt_iplused_sys_quotactl_cache_enter_db_command_svr4_setcontext_vop_balloc_desc_cd9660_mount_svr4_sys_llseek_mmu_reservemon4_4c_ms_serial_ufs_unlock_rpc_msgdenied_userconf_number_db_cmd_search_rwindow_save_union_diruncache_kmemlimit_ccdsize_intrhandmoddi3.o_svr4_sys_fstat64_in6_rr_timer_Blowfish_decipher_icmpbmcastecho_in_rtchange_nullfs_inithtonl.o_svr4_sys_getdents64_uvm_object_print_pmap_change_wiring_ufsspec_close_ap_proxies_clrbits_kthread_exit_vnddump_strcmp_ffs_isfreeblock_nfsrv_commit_msdosfs_islocked_ev_fini_uvm_map_lookup_entry_nfs_access_sbinsertoob_ncr5380_reset_scsibus_cast5_decrypt_vop_bwrite_vp_offsets_vop_update_vp_offsets_vop_truncate_vp_offsets_vop_advlock_vp_offsets_vop_unlock_vp_offsets_vop_lock_vp_offsets_vop_write_vp_offsets_vop_access_vp_offsets_vop_create_vp_offsets_deadproc_slock_sys_omsync_db_symbol_values_X_db_symbol_values_nswitchexit_pmap_enter4m_fr_auth_ioctl_bridge_ifdetach_union_unlock_union_freevp_umapfs_sync_ptsclose_sys_futimes_vn_close_pool_drain_ip_getmoptions_MPFail_soo_read_vop_abortop_desc_m_freem_cs4231_commit_settings_amd7930_commit_settings_chquirks_ipfr_fragstats_cpu_sysctl_exec_aout_prep_omagic_mii_phy_status_deupdat_cs4231_trigger_input_espmatch_pfkeyv2_init_in6mask96_nfsd_waiting_in_pcbrtentry_resetpriority_sys_setpriority_isp_sbus_ca_ipfilter_bpfselect_m_inject_cd9660_rrip_analyze_xyc_start_ipf_natrules_sz_tcp_mss_updatescanc.o_cddetach_udp6_output_tcp_output_rt_maskedcopy_devwait_sosetopt_uextraloc_scsi_probedev_sys_listen_raster_op_noclip_dvma_cachealign_sun4_cache_flush_ip6_sourcecheck_interval_uvm_vnodeops_ipf_ftp_atoi_msdosfs_select_ext2fs_readdir_gre_softc_null_open_strlen_db_flush_line_pgt_page_free_ch_usergetelemstatus_pool_page_alloc_nointr_esp6_input_unp_bind_userconf_more_config_rootsearch_strcpy_parsedisk_ext2fs_specop_p_in_pcballoc_uniqdosname_vfsconf_userconf_list_userconf_init_setsigvec_cd9660_vnodeop_p_tickadj_unp_ino_time_phase_rdclose_amap_alloc_tunctl_dos2unixfn_hmeioctl_nfs_null_nfs_readdirrpc_reserve_spi_ip6_defhlim_sppp_cisco_input_unix2dosfn_dosetrlimit_filehead_db_flush_lex_ether_sprintf_svr4_sys_fstatvfs_si_dma_intr_timo_qe_get_module_turbosparc_tcp_sack_partialack_ktrcanset_vop_lookup_desc_ext2fs_dirremove_in6_recoverscope_ipmobile_sysctl_encstart_pppasyncstart_si_vme_intr_off_ufs_ihash_slock_cs4231_close_ipsec_common_input_fr_authstart_arptimer_pppfcs_au_check_ports_ddb_init_in6mask32_ufs_checkpath_pool_head_nfs_bmap_nfs_udpsock_route_usrreq_ppptioctl_compat_43_sys_getkerninfo_isp_restart_mii_phy_activate_nfsfifo_write_ipsec_exp_bytes_sl_compress_tcp_union_inactive_fifo_write_nfs_reclaim_enterpgrp_inferior_whichqs_magma_hard_sttytty_stwrite_scsi_probe_busses_swread_fr_icmptimeout_userconf_attr_tickfix_rnd_states_ms_softc_bewatchdog_fr_auth_msdosfs_readdir_procfs_readdir_module_sun4_nd6_is_addr_neighbor_pfslowtimo_suword_stty_param_waittime_hmeattach_qe_rint_mfs_vnodeop_p_nfs_open_freeclusterchain_sync_vnodeop_p_mfs_vfsops_filedescopen_amap_copy_nfsrv_initcache_nfsrv3_access_ipfr_stats_bpf_reset_d__timeout_lock_sb_max_dupfdopen_savacctp_sunos_sys_nfssvc_svr4_sys_acl_vop_readdir_vp_offsets_vop_rmdir_vp_offsets_vop_mkdir_vp_offsets_vop_ioctl_vp_offsets_etherbroadcastaddr_compat_09_sys_setdomainname_compat_09_sys_getdomainname_fr_authstats_tprintf_close_pgsignal_ncr53c9x_scsi_reset_ienab_bis_4m_nfs_getattr_inet_ntoa4_needqueuedrain_nwindows_soft01intr_cnpollc_in6mask64_nfs_unmount_nfs_realign_inet_ntoa_nullfs_unmount_cs4231_alloc_uvm_map_clip_start_Blowfish_expand0state_igmp_joingroup_socreate_db_watchpoint_cmd_eintrcnt_mmu_pagein_cs4231_set_params_ch_get_params_VOP_TRUNCATE_fdshare_exec_aout_prep_nmagic_uvmexp_sttyread_p9100_set_video_softdep_sync_metadata_nqtimerhead_umap_lock_memreg_ca_xyc_rqtopb_nfs_renameit_ppppktin_sppp_keepalive_statfs_to_ostatfs_scsibusprint_mfs_reclaim_ipf_nattable_sz_compat_43_sys_sigvec_ncr53c9x_msgin_pcache_flush_fragtbl8_nfs_readrpc_inflate_ktrwrite_schedclock_db_look_token_memreg_cd_cgtwogetcmap_fbconstty_uvm_amap_pool_fr_authused_db_print_cmd_db_object_print_cmd_cgfour_ca_svr4_esigcode_esigcode_dmaprint_st_mode_sense_uvm_map_clip_end_nfssvc_iod_pmap_extract_p_proc_reparent_compat_43_sys_recvfrom_vop_rename_desc_timerblurb___bcd2bin_sd_patterns_cd_patterns_doclusterread_dead_vnodeop_p_msdosfs_vfsops_osversion_nfsv2_vnodeop_p_timeout_set_svr4_sys_creat64_cs4231_get_props_cdzeroref_vndbuf_pool_kernfs_access_pffindproto_ncr53c9x_debug_cgfour_cd_fpu_execute_scsi_start_cpu_spinup_userconf_change_audio_silence_copyout_sunos_sys_getrlimit_svr4_sys_getrlimit_cast_decrypt_rn_delete_sppp_ipcp_close_sys_getrlimit_compat_43_sys_getrlimit_randomclose_sprintf_sunos_sys_auditsys_qec_fix_range_srmmu_vcache_flush_page_sun4_vcache_flush_page_fragtbl_sppp_pick_ttyrub_sys_lkmnosys_sunos_sys_execve_pmap_writetext_igmp_timers_are_running_db_find_breakpoint_subyte_xdc_perror_in6_savemkludge_mbuf2pages_ip_forward_nullfs_mount_pppread_cgtwo_ca_xyc_piodriver_ssopen_ip6_keepfaith_rtredirect_audioattach_linear16_to_linear8_le_db_putnchars___xordi3_mtty_start_fd_dev_to_type_ufs_bmaparray_db_last_command_extraloc_cgtwo_cd_cgthreeclose_nd6_ioctl_ip6_mrouter_get_ext2fs_reclaim_nfs_decode_args_nfs_fhtovp_bufqueues_userconf_pnum_ie_hardware_names_defrtrlist_del_union_mkwhiteout_uvm_pglistfree_ext2fs_fifoop_entries_ffs_fifoop_entries_nullfs_vget_cd9660_fifoop_entries_iereset_hmeintr_expclusterlist_frflush_tcp_debx_stathz_isp_reset_ss_switch_pool_init_nfs_getauth_udp6_input_ipq_locked_fdesc_vnodeop_p_strncasecmp_spec_vnodeop_p_bppopen_rt6_flush_in6_len2mask_pool_get_tcp_maxpersistidle_tunwrite_sysent_blf_cbc_encrypt_softdep_freefile_nqsrv_waitfor_expiry_lastdtime_vop_vfree_vp_offsets_vop_revoke_vp_offsets_vop_lease_vp_offsets_vop_close_vp_offsets_ptsopen_vn_open_srmmu_vcache_flush_context_sun4_vcache_flush_context_chiptotime_rtinit_sppp_open_event_sppp_down_event_unp_connect2_cd9660_tstamp_conv7_ttcompatsetflags_ext2fs_getattr_sppp_ioctl_rtfree_par_err_reg_ext2fs_unmount_fdcresult_power_reg_sys_minherit_rnd_event_q_nswitchdiff_fpu_newnan_scanjet_set_params_uvm_unmap_detach_nfs_close_nfsrv_readdirplus_nfs_doio_tdb_rehash_char_type_qe_read__urem_timetochip_cttyread_config_attach_xdopen_counterreg_4m_userconf_pdev_vprint_fdcretry_module_swift_sppp_chap_open_hmeinit_cdstrategy_bpf_m_xhalf_msdosfs_unlock_msdosfs_reclaim_procfs_reclaim_printf_userconf_cmdbufbcmp.o_pool_put_fr_tcp_age_fc_largedistance_kernfs_readdir_time_maxerror_MD5Init_sd_scsibus_mode_sense_scsi_change_def_nqnfsstarttime_userconf_show_db_symbol_is_ambiguous_db_disasm_ch_patterns_in6addr_linklocal_allrouters_ipl_frouteok_tcp_seq_subtract_ipsec_require_pfs_null_vnodeop_p_ttread_db_watchpoints_inserted_db_breakpoints_inserted_cpu_switch_ip_flush_b_to_q_somaxconn_cd1400_write_reg_svr4_sys_fxstat_cs4231_match_nqsrv_writeslack_portal_open_tprintf_open_spifstcintr_mx_qe_tint_ledmaintr_espdma_reset_nullfs_root_vfs_busy_cd9660_symlink_aobj_pager_vfinddev_scanjet_compute_sizes_mustek_compute_sizes_ufs_dirremove_nfsrv_cleancache_nat_icmpinlookup_msdosfs_unmount_procfs_unmount_db_next_free_breakpoint_mii_media_table_node_has_property_pmap_is_referenced_p_amap_add_nqsrv_clockskew_linear16_to_linear8_be_savefpstate_svr4_sys_sigprocmask_uvm_io_sys_undelete_sys_sigprocmask_magma_soft_tadpole_set_video_fb_pfour_get_video_uvmspace_fork_nfs_adv_fr_defnatage_raw_attach_clusteralloc_profhz_vop_print_desc_vn_lock_sunos_exec_aout_makecmds_nfs_nget_routedomain_tk_nout_cpu_exec_aout_makecmds_exec_aout_makecmds_obio_ca_ip6_rr_prune_uvm_swap_needdecrypt_ippr_raudio_init_sl_uncompress_tcp_config_defer_cd9660_inactiveulmax.o___builtin_saveregs_ststart_nfs_connect_cd9660_close_curproc_swap_syscall_lock_db_qualify_ambiguous_names_cfroots_size_obio_cd_cs4231_query_encoding_amd7930_query_encoding_hmematch_cd_scsibus_load_unload_ext2fs_specop_entries_ext2fs_vnodeop_entries_mfs_vnodeop_entries_ffs_specop_entries_ffs_vnodeop_entries_fifo_nfsv2nodeop_entries_spec_nfsv2nodeop_entries_nfsv2_vnodeop_entries_appr_unload_msdosfs_vnodeop_entries_union_vnodeop_entries_umap_vnodeop_entries_spec_vnodeop_entries_procfs_vnodeop_entries_portal_vnodeop_entries_null_vnodeop_entries_kernfs_vnodeop_entries_fifo_vnodeop_entries_fdesc_vnodeop_entries_dead_vnodeop_entries_sync_vnodeop_entries_ttyretype_nfs_init_cd9660_specop_entries_cd9660_vnodeop_entries_mclfree_initfpstate_scsi_decode_sense_procfs_docmdline_extent_create_nd6_init_ext2fs_vnodeop_p_nfsrv_getstream_des1_setkey_clusterfree_kernfs_vnodeop_p_fifo_vnodeop_p_au_portof_amd7930_get_props_nd6_free_msdosfs_rmdir_nextvnodeidxordi3.o_tcp_del_sackholes_vop_blkatoff_vp_offsets_vop_pathconf_vp_offsets_vop_bmap_vp_offsets_vop_abortop_vp_offsets_vop_mmap_vp_offsets_vop_select_vp_offsets_vop_lookup_vp_offsets_cd9660_lookup_ncr53c9x_msgout_ncr53c9x_get_ecbulmin.o_dumpsys_amd7930_close_ledattach_nfs_msg_tcp_drain_swapdev_vp_cd9660_fhtovp_dumpsize_bpf_filter_db_active_kmem_map_ip6_mforward_nchstats_itimerdecr_vmspace0_region_locked_nfs_commit_frcache_time_state_pfkeyv2_cleanup_nfsrv_mkdir_ipfr_forget_gre_lookup_mf6ctable_portal_link_uvm_km_valloc_wait_clockfreq_mrt6_ioctl_tcp_disconnect_procfs_statfs_userconf_disable_cd9660_tstamp_conv17_ccdstrategymd5.o_cs4231_set_speed_msf2lba_fd_motor_off_ufs_whiteout_audio_attach_mi_db_symtablen_X_db_symtablen_susword_stdump_ffs_init_process_read_regs_mustek_minphys_umax_uc630_sw_sd_atapibus_ops_cd_atapibus_ops_crp_req_queue_ip_defttl_au_set_gain_oldmon_w_trace_swift_hotfix_nfsrv_setcred_tcp_init_am7990_reset_sttystop_in_setsockaddr_sysctl_rtable_vop_mkdir_desc___ashrdi3_fuibyte_esp_write_reg_scsi_inqmatch_nqfhhash_procfs_start_user_config_sys_fhopen_uvm_fault_unwire_nfs_hash_rttrash_domainname_vmcmd_map_zero_db_delete_nfsrv_setattr_nfs_request_msdosfs_getattr_procfs_getattr_ether_ioctl_bpfattach_ncr53c9x_abort_tbattach_slattach_mii_phy_auto_timeout_nfs_flush_db_delete_temp_breakpoint_db_set_temp_breakpoint_rip6_ctloutput_ffs_alloc_nfs_false_xdr_string_decode_rip_ctloutput_time_reftime_rqinit_spifstcintr_rx_ext2fs_create_deferred_config_queue_osrelease_vndshutdown_ffs_balloc_fr_checkstate_timeout_del_sunos_sys_quotactl_sunos_sys_setsockopt_mbppclose_cgeightclose_uvm_map_replace_lf_advlock_sys_setsockopt_pmap_extract4m_pmap_is_referenced4_4c_icmp6_redirect_output_timeout_add_setpte4m_fdcpseudointr_ffs_fhtovp_tunread_kernfs_reclaim_vn_ioctl_db_write_variable_ss_set_window_nfs_link_nfsrv_mknod_ipfr_slowtimer_to_vttoif_tab_sys_chroot_sys_getpid_pool_inactive_time_ufs_readdir_nfssvc_nfsd_fdcloseexec_uvm_fault_numdquot_nfs_fsync_domaininit_cd9660_ihashrem_reserve_dumppages_lehwinit_ledmatch_amap_init_rt_ifmsg_pppstart_svr4_sysent_amap_free_tcp_drop_sys_getsid_clockmatch_vop_reallocblks_vp_offsets_vop_balloc_vp_offsets_vop_valloc_vp_offsets_vop_inactive_vp_offsets_vop_remove_vp_offsets_vop_seek_vp_offsets_tty_init_am7990_gethtons.o_sunos_sys_setrlimit_svr4_sys_setrlimit_fdc_reset_ip6_accept_rtadv_ip6_ecn_ingress_swwrite_ip_ecn_ingress_ipldetach_nfs_bufq_sys_setrlimit_compat_43_sys_setrlimit_elf_check_brand_spifstcintr_tx_dvd_read_disckey_nd6_ifptomac_fr_tcpclosewait_gre_mobile_input_sppp_pap_close_kernfs_getattr_dumpdev_fr_stateunload_kernfs_unmount_vop_select_desc_nchrdev_ledmamatch_in6_restoremkludge_procfs_rw_ip6_forward_nfs_asyncdaemon_sttyopen_bwtwoopen_krpc_portmap_sppp_chap_init_ksymsattach_rcons_pctrl_bppclose_cgfourioctl_bt_putcmap_uvm_map_setup_umapfs_quotactl_suid_clear_sys_getuid_exec_script_makecmds_dumpmag_sbus_match_fd_do_eject_ipsec_soft_bytes_ip_output_ppp_softc_socantsendmore_ttcompat_nfs_disconnect_m_copyback_procfs_print_uvm_map_reserve_nfs_savenickauth_autoconf_nzs_fdesc_select_st_check_eod_ch_getelemstatus_uvmspace_init_am7990_put_xddump_ip_init_icmp_send_union_vnodeop_p_uvmspace_free_portal_badop_uvn_attach_vop_rmdir_desc_audio_alloc_ringimax.o_cypress_cache_flush_all_hypersparc_cache_flush_all_srmmu_cache_flush_all_ms1_cache_flush_all_in_ifscrubbpendsleep_sys_ftruncate_compat_43_sys_ftruncate_db_end_line_if_attachhead_config_detach_children_nd6_ra_input_ippr_ftp_init_nullfs_sync_session0_db_show_all_procs_ccdattach_clockintr_nfs_mkdir_union_dircache_db_delete_breakpoint_uvm_swapout_threads_ttspeedtab_process_set_pc_uihashtbl_cd9660_blkatoff_clockreg_fr_authsize_zeroin6_addr_VOP_UPDATE_xdc_piodriver_qecattach_nfsv3_procid_arp_intimer_cd1400_write_ccr_priv_regs_cd_scsibus_set_mode_nfs_mmapimin.o_svr4_getcontext_pmap_pa_exists_nfs_advlock_ah_output_vnd_softc_hypersparc_get_asyncflt_cypress_get_asyncflt_srmmu_get_asyncflt_svr4_fil_ioctl_be_mcreset_sdactivate_swap_key_delete_ffs_reclaim_userconf_add_read_rndstats_mustek_read_si_get_uvm_pglistalloc_ipflog_read_unpdg_recvspace_unpdg_sendspace_sb_lock_ttyout_compat_43_sys_getsockname_sys_getsockname_cd9660_ihashinsstrncmp.o_atapi_mode_select_in6_ifawithscope_softdep_change_directoryentry_offset_nfs_vgetashrdi3.o_xdc_rqinit_esp_dev_ffs_fsync_checkdirs_sys_madvise_svr4_sys_getdents_pfkey_unregister_crypto_unregister_kinfo_vdebug_vfs_unregister_ccdiodone_ttcompatsetlflags_scsi_probe_bus_dos2unixtime_m_copydata_sys_accept_strncpy_svr4_sys_access_ss_gen_quirks_fr_authpkts_sppp_null_arcbroadcastaddr_vop_print_vp_offsets_vop_open_vp_offsets_uvm_vnp_sync_sys_access_disk_init_db_line_at_pc_db_map_equal_X_db_line_at_pc_rijndael_decrypt_revarpwhoarewe_if_mark_unignore_nfs_reqq_rcons_scroll_Blowfish_stream2word_icmp_error_ip_drain_svr4_to_bsd_sigset_dt_to_gmt_nd6_options_amap_share_protect_ffs_unmount_ip_freemoptions_ip6_freemoptions_ppp_deflate_draft_dead_select_userconf_device_sysctl_clockrate_svr4_to_bsd_sigaction_pmap_changeprot4m_console_font_cs4231_mute_monitor_module_sun4c_amap_ref_disk_busy_db_print_loc_and_inst_isp_control_prom_vstart_fb_pfour_set_video_pim6_input_uvmpagerops_nfs_mknod_sppp_input_cttyopen_greattach_nfs_removerpc_nfsrv_access___hex2ascii_pmap_map_sttywrite_fpu_add_ufs_reclaim_umapfs_fhtovp_m_reclaim_randomioctl_ccdbuffer_pmap_redzone_scsistrategy_udp6_recvspace_udp6_sendspace_tcp_recvspace_tcp_sendspace_ifaof_ifpforaddr_ffs_vget_nfsrv_rmdir_db_boot_sync_cmd_max_hdr_in6_purgeaddr_union_create_vn_read_ptsread_stopen_st_patterns_sun4_hotfix_swdevt_nuidhash_max_sbrelease_audiodetach_stty_ca_bwtwo_ca_xddkdriver_pmap_is_modified_p_mfs_pri_tcp_attach_fdesc_vfsops_kernel_segtable_store_lematch_ipflog_init_msdosfs_start_m_pulldown_arc4_reinit_initproc_nfs_root_ippr_raudio_in_union_symlink_ttycheckoutq_stty_cd_bwtwo_cd_ffs_isblock_in_iawithaddr_portal_setattr_ppsratecheck_zombproc_db_delete_cmd_spifstcintr_rxexception_st_erase_tcp_dooptions_ip_dooptions_union_lock_cd9660_ihashget_speclisth_trapbase_has_iocache_sadb_exts_required_in_uvm_page_physdump_baddynamicports_lastddate_union_link_xyattach_nfsrvhash_sppp_params_masterpaddr_mii_phy_update_fr_defnaticmpage_bpf_detachd_pppopen_machine_suswintrntohl.oadddi3.o_ext2fs_advlock_encoutput_null_inactive_rminit_db_console_setuse_extendfile_sofree_rmfree_ktrsysret_nd6_option_init_nfs_readlink_nullmodem_userconf_enable_uvmspace_exec_mmu_has_hole_nfs_bioread_nat_log_raw_ctlinput_sysctl_rdstring_db_run_modeumoddi3.o_ip6_mrouter_disk_lock_svr4_sys_getmsg_srmmu_vcache_flush_region_sun4_vcache_flush_region_nqsrv_locklease_icmp_input_tcp_input_config_detach_sys_dup_ip6_use_deprecated_nfs_boot_init_des1_encrypt_vfs_mountedon_db_store_count_db_boot_dump_cmd_snapshot_mmu_install_tables_ssstart_nfs_send_VOP_READLINK_svr4_sys_open64_xydump_hmestop_mld6_start_listening_explist_ipsec_def_auth_ktrinitheader_psratio_rnd_event_space_module_cypress_ipsp_process_packet_vwakeup_gmt_to_dt_mountnfs_log_tab_get_sa_require_ifmedia_baudrate_descriptions_bsd_to_svr4_sigaction_ihashtbl_ipsec_in_use_appr_ok_ip_freef_fpu_mul_zsread_map_forwmerge_ip_frags_pppgetm_svr4_sock_ioctl_pmap_release_nfs_sndunlock_portal_pathconf_unp_rights_timeout_init_fpu_div_tcp_notify_VOP_SYMLINK_pppwrite_fdexpand_db_look_chariordi3.o_cd_size_zsconsole_ext2fs_bmap_nat_new_arpinit_done_pt_softc_vn_rdwr_xyc_reset_raw_disconnect_rn_addmask_msdosfs_print_vgonel_sodisconnect_solisten_gsignal_nfs_rcvlock_ah_enable_fr_checkauth_umap_strategy_vfs_op_descs__randseed_fr_authnext_fillinusemap_ttywflush_am7990_copytobuf_contig_opennode_get_buffer_status_tcp_ident_igmp_input_raw_detach_speedup_syncer_sbwait_ext2fs_open_nfs_read_ext2fs_blkfree_nfsd_head_qe_eint_viscpy_rdr_rules_portal_mount_ufs_getattr_union_mmap_uvm_vsunlock_child_return_uvm_page_physload_strncmp_esp_glue_nfs_sigintr_nat_inlookup_tcp_mtudisc_icmp_mtudisc_ip_mtudisc_sysctl_tstring_sys_getgid_swap_key_createntohs.o_SHA1Init_fr_makefrip_vfs_findname_db_fncall_ether_input_pv_link4_4c_vme_ca_ufs_getlbns_uvm_useracc_uvm_km_pgremove_intrsafe_ext2fs_lookup_in6_ifstat_getnulldev_tregion_search_prom_busprint_uao_set_swslot_mfs_statfs_swcr_sessions_db_find_breakpoint_here_pnozz_ca_scanjet_set_window_mii_submatch_vme_cd_ufs_readlink_bpf_movein_union_init_db_breakpoint_list_setquota_semid_n2o_untimeout_db_breakpoint_free_ffs_clrblock_rn_walktree_nselcoll_sys_pwritev_pnozz_cd_procfs_domem_ksymsclose_scsiprint_ffs_read_nfs_namei_ipe4_attachstart_esp_dma_stopbpendtsleep_pmap_changeprot_p_mld6_stop_listening_uvm_coredump_ledma_ca_fuiword_rushjob_audioamd_ca_procfs_doctl_portal_root_nchinit_lkmenodev_ip6_forward_srcrt_inittodr_deflateEnd_soqremque_db_max_line_ledma_cd_i7_softdep_initialize_nfs_create_crypto_invoke_sysctl_rdstruct_audioamd_cd_stty_modem_control_mtty_modem_control_cs4231_halt_input_vfs_shutdown_xdwrite_rijndael128_zerokey_soisconnected_svr4_sys_hrtsys_cd_play_obio_scan_fr_tcpsum_msdosfs_advlock_xdc_rqtopb_scanjet_ctl_read_uvm_anon_lockloanpg_msdosfs_statfs_cttywrite_vcount_vrecyclerem.o_timerattach_rip6_recvspace_rip6_sendspace_rip_recvspace_rip_sendspace_bridge_addrule_fdesc_readlink_unpst_recvspace_unpst_sendspace_ispscsicmd_viking_pcache_flush_line_srmmu_pcache_flush_line_sys_msgrcv_spec_select_ccdlookup_db_boot_cmds_in_selectsrc_vn_stat_mtty_param_nfs_lookitup_rijndael_set_key_sppp_close_event_uvmspace_unshare_mbppioctl_cgeightioctl_pmap_copy_lf_setlock_blf_decrypt_ipsp_acquire_expirations_handle_expirations_tcp_pulloutofband_nullfs_start_initmsgbuf_pv_changepte4_4c_cpumatch_turbosparc_nfs_sync_ttyprintf_lo_microtime_fc_bmapcalls_db_set_breakpoint_u0_fpu_shr_ifmedia_init_icmp6errratelim_in6_maxmtu_nfs_mount_ptsstop_config_make_softc_db_write_bytes_isp_uninitlmax.o_xyc_error_pfkeyv2_release_uvm_fault_wire_rijndael128_setkey_nqsrv_cmpnam_timeout_hardclock_update_db_deletewatch_cmdcmpdi2.o_sdread_device_lookup_sys_msgsnd_db_history_prev_openpromopen_tun_output_msdosfs_write_pmap_is_modified4m_lebufmatch_scsibussubmatch_vmel_scan_uvm_pglistalloc_npages_ext2fs_readlink_union_strategy_rootvp_kbdattach_cg3_videoctrl_ip_ecn_egress_ap_sess_tab_tunopen_tcp_canceltimers_hexatoi_pool_setlowat_appr_check_emul_sunoslmin.o_xdcattach_in6_ifaddr_des_ecb3_encrypt_rddkdriver_svr4_sys_memcntl_bppioctl_bwtwommap_uvm_vnp_terminate_nullioctl_ttioctl_dvd_read_copyright_scsibusmatch_nfs_prog_Blowfish_initstate_gre_output_max_keylen__umulreplace_end__mulreplace_end_svr4_sys_msgsys_nd_ifinfo_in6_prefix_add_ifid_ffs_sync_ipsec_add_policy_MCFail_clock_ca_xyopen_xyc_unbusy_nfs_ticks_ip_optcopy_umapfs_unmount_cluster_rbuild_dvma_end_sdsize_ext2fs_makeinode_ip_natin_sppp_cisco_send_rn_refines_deadproc_VOP_UNLOCK_kvm_iocache_sc_err1_clock_cd_dvmamap_extent_SHA1Final_esp_init_extent_print_vndsetcred_svr4_to_bsd_sigaltstack_kdb_kbd_trap_sppp_cp_type_name_soisdisconnected_sppp_qflush_sppp_flush_sppp_lcp_opt_name_ndflush_userconf_lines_audio_calc_blksize_setjmp_kdb_trap_nd6_rs_input_ip_statesync_pppintr_sys_readlink_copywords_bus_untmp_ip_mtudisc_timeout_q_procfs_badop_sys_getrusage_db_load_count_am7990_zerobuf_contig_sparc_interrupt4m_ext2fs_init_in6_selectsrc_qestop_dvd_read_manufact_zsstop_uvm_map_create_tcp_slowtimo_ip_slowtimo_cansignal_acctsuspend_nfs_sndlock_swcr_sesnum_tcbtable_rt_timer_queue_destroy_vdevgone_cd_play_tracks_ip_nhops_union_lookup_vop_default_desc_swap_decrypt_uvm_swap_markdecrypt_numcache_doingcache_uvm_unloananon_sppp_chap_close_vflush_srmmu_vcache_flush_segment_sun4_vcache_flush_segment_syncerproc_svr4_sys_sigaction_iestart_fdcstart_in6_delmulti_softdep_setup_freeblocks_in6_selecthlim_sobind_sys_getdirentries_compat_43_sys_getdirentries_sys_sigaction_xdgetdisklabel_sdminphys_fdgetdisklabel_ffs_mount_nfsrv_updatecache_ippr_ftp_complete_fr_tcplastack_z_errmsg_pmap_count_ptes_vop_vfree_desc_cd9660_mountroot_vndgetdisklabel_rdgetdisklabel_sttyclose_bwtwoclose_ext2fs_inode_pool_union_pathconf_umap_node_hash_fdesc_sync_kill_vmcmds_cs4231_attach_qsphyattach_m_zero_unputc_compat_43_sys_killpg_exec_elf_makecmds_db_show_all_cmds_pmap_virtual_space_ext2fs_checkoverlap_ffs_checkoverlap_nfs_true_ifmedia_delete_instance_arpresolve_cdactivate_map_backmerge_sbappendrecord_mountlist_fdattach_nfs_vfree_arpintr_ppp_bsd_compress_sppp_pap_TO_msdosfs_readlink_procfs_readlink_rdread_mainbus_ca_svr4_sys_kill_xdc_cmd_icmp6_redirtimeout_usermount_sys_kill_vop_read_desc_ncr53c9x_reselect_svr4_sys_lxstat_uvm_kernacc_ipsp_address_union_mkshadow_VOP_WHITEOUT_bufhashtbl_sunos_sys_getdents_pv_syncflags4_4c_lehwreset_nfs_nhinit_msdosfs_vptofh_vop_generic_lock_disk_find_mainbus_cd_fpu_explode_in6addr_linklocal_allnodes_in6addr_nodelocal_allnodes_nfs_renamerpc_nfsv2_procid_union_bmap_sys_fchdir_wakeup_sunos_sys_ostime_dumpconf_cgfourclose_amap_pp_adjref_cast_encrypt_rootfs_vfs_export_lookup_db_sym_numargs_X_db_sym_numargs_cgsix_use_rasterconsole_tdb_add_inp_vclean_copyright_nqsrv_maxnumlease_db_set_watchpoint_be_read_uvm_anon_init_bpf_validate_pipe_stat_disk_unbusy_hw_sysctl_audio_mmap_audio_blk_ms_tcx_ca_union_open_sys_munmap_nblkdev_quotaon_tcp_backoff_procfs_close_vsnprintf_timedelta_rdsize_hz_rpc_vers_xformsw_sppp_auth_type_name_sys_link_tcx_cd_mtty_match_kbd_repeat_step_fpu_init_amap_unref_nfs_timer_fr_delgroup_ifqmaxlen_fpu_ftoi_dvd_read_struct_ufs_root_udp_output_unp_disconnect_sys_msgget_fdcstate_pool_reclaim_db_watchpoint_list_db_print_format_svr4_sys_nice_ext2fs_link_dqflush_ipip_allow_bpf_tap_ext2fs_fifoop_opv_desc_ffs_fifoop_opv_desc_sys_fchown_cd9660_fifoop_opv_desc_db_watchpoint_free_ntimeout_suibyte_fpu_ftod_be_tcvr_write_bit_nd6_timer_memname_ttywait_qec_ca_mask_rnhead_segm_locked_mii_down_import_sa_getphysbuf_vfs_register_kernel_pagtable_store_kernel_regtable_store_sbppopen_in6_mask2len_pool_destroy_ffs_blkfree_numnfsrvcache_bridge_stop_qec_cd_sunos_sys_sigpending_svr4_sys_sigpending_uvm_pageunwire_config_process_deferred_children_killpg1_sys_sigpending_in6_ifawithifp_nfs_rephead_nfsm_reqh_fdesc_symlink_lockmgr_fr_statesize_audio_open___bin2bcd_bsd_to_svr4_sigset_cgsixioctl_sd_reassign_blocks_procfs_findtextvp_uvm_pagezero_uvm_pagealloc_strat_amap_extend_kern_targets_viking_hotfix_in6_ifinit_vfs_opv_init_explicit_soshutdown_slopen_tbopen_sys_shutdown_magma_attach_oclockattach_swap_encrypt_initalized_sys_ktrace_db_call_depth_db_add_expr__main.o_fpu_norm_uvm_pagermapin_tbconf_cd9660_access_fpu_ftox_nqnfs_piggy_in_pcbdisconnect_ienab_bic_4_4c_ffs_vfree_udp_init_raw_recvspace_raw_sendspace_disk_unlock_initclocks_cd9660_strategy_rcons_doesc_fpu_dtof_statvar_pv_fdfinish_nfsrv_readdir_cd9660_start_cd_reset_pppdealloc_xdc_tick_scanjet_attach_ah_attach_icmperrppslim_last_invalhash_logopen_qs_sunos_sys_access_ipf_rcmd_atoi_fr_authunload_tunselect_vfs_hang_addrlist_swapdev_db_trace_until_matching_cmd_tz_fpu_ftos_xyc_submit_iorq_cpu_coredump_sys_msgctl_locnamp_mmclose_rom_console_input_uvm_anon_dropswap_nfs_vinvalbuf_winSlotCnt_sys_symlink_uvm_init_limits_db_delete_watchpoint_nfs_setattr_icmp6_error_free_msghdrs_Debugger_svr4_sys_mmap_stioctl_ext2fs_blkpref_ufs_makeinode_sys_mmap_sys_exit_nd6_dad_start_esp_output_cb_in_interfaces_nfs_mountroot_ffs_mountroot_dk_mountroot_time_status_vfs_mountroot_am7990_start_cpumatch_ms_chkdqchg_nfsrv_pathconf_nfsrv_write_fr_state_ioctl_ah4_input_bridge_rtdelete_uvm_anfree_softdep_setup_allocindir_page_ippr_rcmd_init_vn_initialize_syncerd_userconf_parse_curpriority_magma_ca_fusword_sw_2_leftover_ufs_advlock_nfs_lookup_icmp_ratelimit_tb_pv_syncflags4m_nonidempotent_rpc_msgaccepted_copyinstr_udp_recvspace_udp_sendspace_magma_cd_tctrl_setup_bitport_nfsrv_fsinfo_ip6_setpktoptions_in6_pcbbind_rt_timer_add_sonewconn1_pipe_select_checkalias_am7990_copyfrombuf_contig_amd7930swintr_icmp6_sysctl_ip6_sysctl_ext2fs_vget_fdhashtbl_autoconf_verbose_pool_page_free_nointr_swcr_process_des_encrypt2_in_pcbnotifyall_VOP_SELECT_pollscan_ncr53c9x_reset_promvec_pmap_init_tcp_mssdflt_sppp_to_event_lastday_randomattach_ncr53c9x_attach_xyc_ca_pmap_destroy_nfs_reply_SHA1Update_umap_bwrite_xbox_ca_sttymatch_nd6_lookup_in6_are_prefix_equal_rip6_usrreq_ffs_truncate_nfs_truncate_rip_usrreq_ptcopen_sys_omsgctl_db_eqname_memerr4_4c_in_pcbrehash_ratecheck_xyc_cd_svr4_sys_open_pool_sethiwat_ufs_seek_nqnfs_clientd_sys_open_uvm_map_db_tok_number_loopattach_xbox_cd_desiredvnodes_uvm_pagealloc_contig_timeout_static_fs_sysctl_sys_mprotect_audiommap_svr4_sys_facl_xygetdisklabel_cdminphys_setdisklabel_ip6_id_ip4_input_bridge_bifconf_cd9660_pathconf_cd9660_print_if_index_svr4_sys_fstatvfs64_nqsrv_addhost_union_removed_upper_db_history_size_sw_0_leftover_igmp_sendpkt_bridgeintr_frame_pgfind_disksort_ext2fs_dirrewrite_ufs_dirbadentry_tcpdropoldhalfopen_null_strategy_cpu_initclocks_sys_fork_rddump_semmap__insque_p9100mmap_st_mode_select_statclock_limfree_vfs_export_fb_unblank_etherip_sysctl_soisconnecting_free_msgmaps_time_esterror_reaper_in_socktrim_fdesc_root_dmaattach_fddkdriver_module_viking_icmp6_input_uvm_map_print_skipjack_setkey_tcp6_input_sppp_pap_input_sppp_cp_input_soaccept_bridgeattach_encattach_nfs_rmdir_tty_count_bpf_mtap_st_mount_tape_ch_get_quirks_uvm_unmap_tcp6_usrreq_icmp_reflect_lkmopen_sys_fhstat_sys_fchmod_spif_ca_utsname_nmbclusters_getptep4m_cryptop_queue_ttypend_vop_advlock_desc_microtime_configure_zsshortcuts_ext2fs_setattr_tcp_reass_sbreserve_audioopen_db_examine_format_db_set_cmd_ip6_log_time_sppp_pap_my_TO_sys_bind_ncr53c9x_scsi_cmd_spif_cd_cd_pause_ip6_mrouter_done_db_history_curr_mmuregions_uvm_pagewire_ufs_makedirentry_msdosfs_close_union_updatevp_VOP_REMOVE_sbcreatecontrol_ccdinterleave_sysctl_int_zeropage_sppp_cp_send_union_newsize_nfsm_srvwcc_tcp_keepidle_tunioctl_slpque_fixalign_zsopen_nd6_prune_ipf_cksum_srandom_iommu_ca_st_read_block_limits_uvm_vmspace_pool_sppp_lcp_up_dead_strategy_sys_statfs_enc_xform_des_ext2fs_specop_opv_desc_ext2fs_vnodeop_opv_desc_msdosfs_vnodeop_opv_desc_union_vnodeop_opv_desc_procfs_vnodeop_opv_desc_kernfs_vnodeop_opv_desc_umap_vnodeop_opv_desc_null_vnodeop_opv_desc_portal_vnodeop_opv_desc_fdesc_vnodeop_opv_desc_fifo_nfsv2nodeop_opv_desc_spec_nfsv2nodeop_opv_desc_nfsv2_vnodeop_opv_desc_mfs_vnodeop_opv_desc_spec_vnodeop_opv_desc_fifo_vnodeop_opv_desc_dead_vnodeop_opv_desc_ffs_specop_opv_desc_ffs_vnodeop_opv_desc_sync_vnodeop_opv_desc_pipe_read_cd9660_specop_opv_desc_cd9660_vnodeop_opv_desc_db_clear_breakpoints_p9100loadcmap_esp_dma_intr_esp_sysctl_iommu_cd_lerdcsr_ip6_sendredirects_pool_create_mem_access_fault_des3_setkey_arp_inuse_lockmgr_printinfo_sys_acct_vnddkdriver_max_datalen_ignore_bogus_traps_in6_prefixlen2mask_softdep_setup_allocindir_metasubdi3.o_amap_unadd_ext2fs_remove_bridge_flushrule_sl_compress_init_svr4_add_socket_softdep_mount_enc_xform_3des_m_pullup_blf_cbc_decrypt_Lfsbail_clk_wenable_nfsrv_getattr_msdosfs_setattr_unix2winfn_procfs_setattr_st_unmount_scsi_strvis_oclk_set_dt_recvit_sendit_sparc_noop_VOP_RENAME_ktrnamei_profprocs_ssclose_clockattach_unixsw_nd6_purge_nfsrv_rcv_rn_insert_kernfs_lookup_pppclose_uihash_sys_getlogin_fifo_advlock_ncr53c9x_sense_pmap_activate_tk_rawcc_sys_ostatfs_ip6_ecn_egress_uvm_map_findspace_fdesc_read_sddump_pool_prime_nqnfs_serverd_nqnfs_getlease_in6_localaddr_portal_readdir_maxdmap_lastpid_ncr53c9x_sched_auxreg_ca_nextsibling_pmap_create_ifafree_if_slowtimo_sys_getpgid_svr4_stream_ioctl_nqnfs_vacated_secopt_portal_vfree_compat_43_sys_accept_ext2fs_rename_ext2fs_read_DES_version_sppp_attach_vfs_free_addrlist_sys_dup2_auxreg_cd_tbread_sys_truncate_xdcintr_softdep_fsync_db_next_free_watchpoint_db_write_cmd_random_tcp_trace_db_history_last_db_recover_si_vme_dma_eop_xdc_e2str_sddone_fdctimeout_fdc_debug_sppp_lcp_RCN_rej_insmntque_limcopy_ncr5380_cmd_timeout_db_line_ether_delmulti_st_loadquirks_ah_output_cb_bridge_init_bridge_rtfind_sbdrop_shm_nused_sys___sysctl_db_symatoff_amd7930_halt_input_nfsrv_wakenfsd_nfs_writerpc_count_lock_queue_m_free_vprintf_vop_close_desc_psignal_db_hang_am7990_setladrf_qe_ca_zs_ca_bsd_to_svr4_sigaltstack_mii_attach_nqnfs_callback_pppalloc_chainalloc_db_next_bpf_dtab_rtioctl_svr4_to_bsd_termios_amd7930_start_output_iommu_sc_nfs_numasync_sppp_ipcp_opt_name_procfs_allocvp_qe_cd_zs_cd_in6_prefix_ioctl_enc_xform_blf_vop_generic_unlock_VOP_REVOKE_sbppattach_rcons_clear2eop_segm_freelist_ukopen_sadb_exts_allowed_in_umap_bypass_lf_wakelock_p9100open_hmestart_sdebug_esp_dma_isactive_scanjet_read_nd6_maxndopt_chkdquot_nfsrv_create_igmp_slowtimo_useloopback_sys_swapon_ncr53c9x_dequeue_sttyioctl_bwtwoioctl_stmatch_hmac_ipad_buffer_nat_list_nat_init_rn_init_userconf_histsz_ext2fs_reload_doasyncfree_rijndael_encrypt_suser_icmp6_reflect_ext2fs_truncate_fdesc_init_unp_gc_dvma_base_scsi_print_sense_nd6_ns_output_uvn_sync_lock_crypto_get_driverid_union_read_sogetopt_sys_sstk_vop_unlock_desc_nfs_mount_diskless_kbdopen_defrouter_select_yield_cd9660_lock_ncr53c9x_timeout_svr4_sys_lstat64_xyc_perror_sdgetdisklabel_cdgetdisklabel_mii_phy_delete_media_pager_map_wanted_ips_table_deflateInit_uvm_sysctl_cd9660_defattr_ccdgetdisklabel_readdisklabel_memerr4m_espstat_vop_revoke_desc_cd9660_link_ncr53c9x_free_ecb_xdc_remove_iorq_compat_43_sys_getdtablesize_svr4_sys_sysconfig_rcons_clear2eol_xdclose_nfs_bwrite_vop_open_desc_tctrl_read_data_pmap_changeprot4_4c_fpu_itof_vop_reallocblks_desc_VOP_VALLOC_uvm_swapin_sys_sendmsg_sys_recvmsg_qeintr_revarprequest_bridge_hash_nbigpipe_crypto_done_ripsrc_ip_stripoptions_union_newupper_vfs_opv_numops_be_ifmedia_upd_oclk_get_secs_fr_ipfrttl_in_localaddr_soisdisconnecting_nfree_msgmaps_rdopen_hmewatchdog_frag6_slowtimo_xdr_inaddr_decode_ip_natout_msdosfs_fsync_union_seek_nlinesw_sys_getpgrp_vop_readlink_desc_vop_strategy_desc_mld6_init_des_set_odd_parity_ah_init_procfs_ioctl_killproc_lkminit_sys_sync_ip6_protox_route_src_disk_count_xycmatch_ufs_bmap_auth_hash_hmac_sha1_96_fr_state_doflush_dofilewritev__mul__uremreplace_end__remreplace_end_sunos_sys_otimes_statmin_syscallqdivrem.o_chattach__div_ext2fs_sync_nat_icmpin_ip_reass_kernfs_setattr_semtot_be_ifmedia_sts_uvm_pagefree_ffs_blkpref_RMD160Update_arc4_timeout_appr_match_umap_node_hashtbl_null_node_hashtbl_sosend_sys_profil_getinoquota_bpf_attachd_readde_olf_check_header_elf_check_header_qeinit_zslist_bus_map_ufs_open_pcbmap_procfs_dofpregs_db_hangon_uvm_pageremove_uvm_swap_get_userconf_maxdev_dequeue_randomness_enqueue_randomness_ncr53c9x_variant_names_pv_changepte4m_db_machine_init_tcp_saveti_oldpvec_uvm_pageactivate_bpf_ifname_umap_reclaim_procfs_root_portal_reclaim_mbtypes_cs4231_round_blocksize_amd7930_round_blocksize_nfs_clearcommit_emul_elf_db_free_breakpoints_ipip_sysctl_qewatchdog_replacemul_import_identity_union_vn_create_cluster_wbuild_userconf_modify_iso_disklabelspoof_pfkey_register_crypto_register_tcp_totbackoff_umap_print_ttstart_exec_aout_prep_zmagic_getdevunit_ifmedia_baudrate_fdesc_link_blktochr_softclock_audio_initbufs_kbd_cnv_out_si_vme_intr_on_ssmatch_scsi_prevent_mfs_bmap_nfs_start_nqsrv_send_eviction_des_check_key_ifmedia_match_sd_ca_vinvalbuf_RMD160Transform_bridge_rttrim_deflateReset_sppp_chap_TO_umap_getattr_portal_getattr_time_precision_cd9660_mmap_am7990_intr_xyread_uvmcnt_dump_nfs_fsinfo_subkey_table_gen_msdosfs_mkdir_readep_portal_unmount_pffindtype_addupc_intr_ncr5380_scsi_cmd_sd_cd_sparc_interrupt44c_vpage_uvm_swap_put_dqhashtbl_nfs_checkexp_inflateEnd_cd9660_deftstamp_uvmspace_alloc_ext2fs_alloc_bpf_iflist_bpfopen_null_node_hash_vn_write_ptswrite_userconf_add_cgtwoopen_amd7930match_esp_switch_ss_identify_scanner_mfs_open_leapyear_ttyopen_sunos_sys_execv_doclusterwrite_skipjack_zerokey_ip_mobile_allow_msdosfs_update_union_root_fifo_lookup_db_unread_token_rcons_delline_cs4231_trigger_output_qsync_nfsrvw_sort_sl_uncompress_tcp_core_ppp_restart_md_diskconf_uk_caudiv.o_sunos_emul_path_mmioctl_ieioctl_ipsec_delete_policy_sysctl_dumpentry_loioctl_svr4_sys_stat_xdstrategy_uvm_map_extract_sys_stat_cd9660_init_arc4random_initialized_audio_rint_physio_m_clalloc_proc0paddr_sd_scsibus_flush_uvm_swap_freepages_chkvnlock_uk_cd_lemediastatus_be_tcvr_read_bit1_nfs_vfs_init_ptcread_sbppread_svr4_netopen_be_tcvr_read_bit2_sdopen_uvm_page_printit_sppp_ncp_check_fifo_printinfo_xldcontrolbidle_xysize_nexpire_desirednfsrvcache_ext2fs_vfsops_vrele_am7990_init_xdc_submit_iorq_eeprom_match_procfs_access_VOP_PRINT_proc0__udivreplace_end__divreplace_end_compat_10_sys_msgsys_ffs_freefile_procfs_validregs_db_del_symbol_table_db_add_symbol_table___qdivrem_ledma_reset_inflateReset_spec_print_vnode_hold_list_soconnect2_userconf_cnt_db_maxoff_swift_mmu_enable_nfs_boot_getfh_ip_pcbopts_in_delmulti_preempt_db_regs_npmemarr_uvm_aobj_pool_swcr_freesession_ippr_rcmd_portmsg_fr_stateinit_sppp_lcp_TO_unix2dostime_bufhash_ext2fs_mountroot_VOP_GETATTR_rd_cd_semu_list_hmereset_rpc_call_nfsrv_errmap_null_node_create_elf_probes_vop_lease_desc_db_examine_cmd_qzero_sunos_sys_creat_svr4_sys_sigaltstack_sparc_i_nsphyattach_rip6_init_ah_massage_headers_msdosfs_mknod_uvm_total_ruadd_sys_sigaltstack_fpu_sqrt_mono_time_db_term_m_retryhdr_dqinit_cpumod_bsdi_strings_svr4_delete_socket_uvm_page_print_pmap_page_protect_p_nfs_print_msdosfs_root_uprintf_si_ca_p9100fbdriver_icmp6_rediraccept_union_copyup_vmcmd_map_pagedvn_want_ast_tadpole_powerdown_fpu_stof_cgsixclose_in6_purgeprefix_uvm_unloanpage_uvm_pagecopy_pppinput_audio_pint_be_get_mustek_get_status_fdcstatus_nfs_getcookie_umap_reverse_findid_si_cd_svr4_sigcode_scsibusdetach_getcacheinfo_sun4c_ip6_sourcecheck_dest6_input_ah6_input_ppp_deflate_cluster_write_cttyioctl_ptyioctl_ttybg_sys_getppid_db_vars_esp_ca_sunos_sys_mknod_spec_nfsv2nodeop_p_fifo_nfsv2nodeop_p_union_islocked__rem_swapbuf_pool_amap_lookup_rdr_masks_maxproc_memstr_bufinit_ncr5380_wait_nrq_timo_arpintrq_esp_cd_dumplo_xdmatch_vm_nphysseg_ufs_setattr_softdep_increase_linkcnt_nd6_setmtu_kmembase_sys_mlock_sys_adjtime_nqsrv_maxlease_revarpwhoami_isohashtbl_mountroot_fscale_dvma_free_procfs_mount_syncdelay_sys_fsync_db_read_char_bsdi_si_leattach_ufsfifo_close_nfsrv3_procs_nfs_rcvunlock_nd6_nud_hint_null_vfsops_audio_ioctl_des3_zerokey_ipsec_last_added_startprofclock_svr4_sys_wait_userconf_pdevnam_ktrgenio_espdmaintr_ufs_dirrewrite_issignal_csignal_mbinit_mmumod_nfsrv_writegather_udbtable_rn_mkfreelist_fdesc_open_cachestats_si_vme_dma_setup_stclose_powerdown_in6_prefix_remove_ifid_kernfs_badop_sys_preadv_vop_islocked_desc_ddb_sysctl_scsi_user_done_ip6_mloopback_uvm_km_init_elf_read_from_minphys_fdformat_ip6_input_ext2fs_fsync_dqhash_mfs_doio_msdosfs_ioctl_sys_sbrk_uvm_km_free_audio_check_params_audiostartp_svr4_sys_utssys_sa_hw_if_ip6_forward_rt_blf_encrypt_bpf_setf_sys_clock_gettime_audio_drain_ietint_in6_addmulti_nfs_remove_rn_lookup_VOP_RECLAIM_ttyin_indent_audiostartr_pmap_is_modified4_4c_allocsys_nd6_maxnudhint_in6_ifscrub_pmap_clear_modify_p_gre_in_cksum_db_find_watchpoint_malloc_ip6_hdrnestlimit_sppp_lcp_RCN_nak_process_write_regs_qsphy_ca_viking_mmu_enable_audio_read_rcons_text_pmap_dumpmmu_machine_arch_getpropstring_uvm_cnt_head_vmi_list_ufs_init_ippr_raudio_out_uao_create_nfiles_randomwrite_qsphy_cd_sunos_sys_ioctl_mii_tick_holdrele_iso_nchstats_svr4_sys_execv_mbppwrite_wzero_cd_scsibus_setvol_fdcswintr_swap_key_cleanup_start_nfsio_if_qflush_msdosfs_read_union_access_sys_poll_cgsix_ca_xyc_chain_ippr_ftp_pasvmsg_fdesc_lookup_pgrphash_config_init_cd9660_fifoop_p_si_find_foundfpu_softdep_setup_blkmapdep_incore_route_dst_procfs_donote_maxlockdepth_db_list_breakpoints_db_set_breakpoints_rdstrategy_cgsix_cd_kernel_regmap_store_rr_prefix_uvm_map_call_ips_stats_sys_mkdir_db_read_line_iewatchdog_it_tab_ipsendredirects_sloutput_ssioctl_uvm_page_rehash_nfsrvw_procrastinate_hmac_opad_buffer_esp_input_pppdumpb_sppp_chap_input_va_null_ifmedia_ioctl_am7990_read_fubyte_mbpp_attach_svr4_sys_vhangup_prom_vend_zdmap_nfs_rename_unp_attach_logread_memset_svr4_sys_putmsg_cs4231_get_port_amd7930_set_port_ufs_access_nfsrv_lookup_pppioctl_uvm_vnp_setsize_VOP_WRITE_isp_async_ierint_fd_set_motor_des1_decrypt_sppp_ipcp_open_sppp_ipcp_down_ttyinfo_ttyoutput_randomopen_esp_dma_reset_nfsspec_write_null_unlock_nclruhead_spec_write_xboxattach_bsd_to_svr4_speed_ev_select_sw_options_gettdbbysrc_msdosfs_seek_vfs_unbusy_svr4_sys_pwrite_ext2fs_mkdir_mfs_init_ptsstart_ttylist_v_putc_sys_pwrite_db_output_line_lkm_list_svr4_ustat_si_free_tcp_do_sack_ttyfree_ncr5380_wait_req_timo_swbuf_svr4_sys_creat_inet6sw_VOP_READDIR_addupc_task_msgbufmapped_bppwrite_sbus_testdma_eeprom_update_pfkey_addr_cast5_zerokey_ttwrite_longjmp_uvm_swap_allocpages_swcr_id_fdesc_start_raw_usrreq_am7990_tint_viking_memerr_nfs_write_bpfdetach_mif6table_dqfreelist_in6_if_up_log_open_db_single_step_cmd_svr4_sys_time_si_obio_dma_setup_in_baddynamic_ifunit_db_break_table_xy_casdiv.o_cast5_setkey_ipfr_nattab_ipprintfs_svr4_sys_mknod_swap_encrypt_compat_43_sys_sigsetmask_sys_mknod_cd9660_bmap_uvm_km_suballoc_tcbhashsize_tunclose_ifmedia_set_bpfread_umap_mapids_compat_43_sys_truncate_X_db_lookup_xy_cd_uvm_swap_alloc_chkiqchg_ufs_lock_nosuidcoredump_svr4_sys_break_pmap_enu4_4c_ippr_ftp_out_nat_ifdetach_in6_ifdetach_thread_sleep_msg_sys_pipe_cd9660_statfs_db_prev_fb_pfour_id_iszerodev_ufs_link_ipflog_clear_ether_ip6multicast_min_dounmount_sys_read_ether_ipmulticast_min_nmi_hard_iematch_fdcmatch_ppplogchar_mfs_mountroot_procfs_doregs_disklist_acctwatch_X_db_symatoff_uvm_pagermapout_ip6intrq_cd9660_open_pmap_alloc_cpu_ch_switch_hardmemerr4m_rip_init_ifa_ifwithnet_sunos_sysent_pmap_zero_page_p_vm_physmem_ext2fs_mknod_tty_attach_setrunqueue_rcons_delchar_tcp_newtcpcb_VOP_ISLOCKED_sunos_sys_statfs_ufs_vinit_nfs_inactive_ether_ip6multicast_max_ktrsyscall_vop_remove_desc_ether_ipmulticast_max_am7990_rint_ms_rint_module_ms2_rip6src_ippr_raudio_new_ipsec_exp_first_use_ipsec_soft_first_use_msdosfs_sync_db_get_variable_kernel_segmap_store_esp_dma_setup_cd9660_rrip_getname_nd6_useloopback_pfkey_init_forkstat_db_machine_commands_install_rd_sleep_pri_am7990_watchdog_module_ms1_uvm_mlk_call_ipip_input_frstats_ipv4_tunnelsetup_sockargs_userconf_argbuf_tprintf_fl_tab_cd9660_islocked_audio_fill_silence_db_shift_expr_db_print_position_xdioctl_sadb_exts_required_out_arpioctl_portal_lookup_lf_getlock_bwrite_vop_generic_revoke_au_get_port_si_vme_dma_start_ipport_lastauto_sys_writev_si_head_fdesc_print_tctrl_ext_statuses_ip6_flow_seq_audioread_svr4_sys_fstat_mfs_checkexp_nfsrv_null_xdr_inaddr_encode_vfs_getuserstr_portal_start_sys_fstat_memcpy_fbrcons_rows_RMD160Init_msdosfs_mount_db_force_whitespace_db_breakpoint_cmd_svr4_sys_ioctl_xyc_remove_iorq_cs4231_query_devinfo_amd7930_query_devinfo_skipjack_forwards_ipl_unreach_kmeminit_sys_ioctl_isodirino_lewrcsr_memregattach_st_space_nqnfs_clientlease_nat_instances_procinit_uvm_init_ffs_write_in6_cksum_sppp_pap_open_consintr_frag6_init_sync_print_boottime_mbpp_ca_cgeight_ca_pmap_clear_modify4m_esp_dma_go_esp_read_reg_import_key_in6_init_prefix_ltimes_delete_each_prefix_uvm_grow_kbd_rint_Blowfish_expandstate_fdesc_readdir_device_ref_db_restart_at_pc_sunos_sys_mount_scanjet_ctl_write_mbpp_cd_cgeight_cdstrcat.o_cs4231_open_ch_position_ifnet_addrs_sys_getegid_db_search_cmd_ss_ca_sbppselect_esp_dma_isintr_ip6_mrtproto_uvm_mk_pcluster_ufs_mmap_rpc_reply_ifioctl_extent_alloc_subregion1_db_lookupudivdi3.o_makememarr_uvm_dump_ap_sess_list_procfs_bmap_lkmexists_vop_truncate_desc_db_trace_until_call_cmd_kbdread_cgthreemmap_nd6_setdefaultiface_VOP_LOOKUP_raw_input_ptcclose_pipe_write_ss_cd_cputyp_idprom_bootpath_amd7930_device_fr_tcpidletimeout_gre_sysctl_sppp_phase_network_m_devget_ncr53c9x_dmaselect_zstty_ffs_blkatoff_nfs_blkatoff_pppoutput_sys_ptrace_suiword_svr4_stream_ti_ioctl_cpu_hotfix_nd6_cache_lladdr_cast_setkey_consinit_rcons_puts_emulinstr_uvm_swap_initcrypt_all_ext2gennumber_ippr_ftp_new_procfs_open_hashinit_xd_ca_qecmatch_ifmedia_add_db_stack_trace_cmd_fpu_xtof_sun_noname_ttrstrt_ufs_fhtovp_iplattach_sppp_up_event_sbcompress_sleep_selwakeup_db_trap_db_delete_line_gifattach_xd_cd_virtual_avail_ifa_ifwithroute_pmap_enu4m_export_identity_esp_zeroize_udp6_ctlinput_tcp_ctlinput_deextend_allocbuf_m_getptr_X_db_stub_xh_runtime_ch_move_ldcontrolb_crypto_dispatch_send_icmp_err_route_proto_updatefats_portal_print_probeset_tctrl_attach_sunos_sys_vhangup_pmap_enter4_4c_uvmfault_anonget_ipforward_rt_rtalloc_sppp_ipcp_init_process_write_fpregs_nfs_vfsops_mbpp_rw_cgtwommap_si_obio_dma_start_uvm_pageboot_alloc_bridge_output_cpu_set_kpc_xdc_reset_scsidebug_luns_nfsrtton_ip6_sprintf_tdb_delete_inetsw_rt_newaddrmsg_union_ioctl_m_prepend_initsiginfo_strayintr_cd_read_toc_scsi_size_pmap_clear_reference_p_uvm_mlk_hint_uvm_loan_nfsm_uiotombuf_bridge_rtupdate_buffers_auth_hash_hmac_md5_96_sppp_set_ip_addr_iskmemdev_fdesc_targets_dofilereadv_compat_43_sys_getpagesize_intrcnt_svr4_sys_pwrite64_cd9660_vptofh_audioioctl_am7990_stop_mmu_3l_ufs_ihashinit_realitexpire_xymatch_cgfourteenclose_nfsm_rpchead_crypto_drivers_num_procfs_validfile_st_ca_svr4_sys_xmknod_rip6_output_nfsrv_link_rip_output_vn_closefile_wcopy_cs4231_round_buffersize_iommu_print_pfkeyv2_dump_walker_db_find_variable_sdwrite_pfkeyv2_get_m_pad_tcp_now_bridge_filter_vop_whiteout_desc_vop_mknod_desc_vaccess_st_cd_pmemarr_pfkey_sendup_uvm_lock_fpageq_rt_setgate_cpumatch_unknown_des_set_key_in_canforward_db_show_arptab_rawcb_uk_switch_uvm_map_init_ffs_reload_pgshift_be_put_in_pcbnotifymiss_msdosfs_access_reinsert_syncer_maxdelay_memchr_maxsmap_uvm_vslock_db_lbuf_end_stackgap_alloc_msdosfs_bmap_sw_ca_gre_input_myip_ifp_union_lease_fdesc_write_lkmclose_swap_bytes_change_sign16_le_change_sign16_le_amd7930_trap_in6_setpeeraddr_sppp_ipcp_RCN_rej_xboxprint_tcxioctl_in_pcblookup_nchash_sw_cd_cryptodesc_queue_ip4_input6_umap_node_create_db_map_current_svr4_sys_fpathconf_pmap_clear_modify4_4c_romgetcursoraddr_ip6_maxfragpackets_soo_ioctl_sys_fpathconf_sbus_ca_in6mask0_fix_incksum_msdosfs_open___moddi3_VOP_CREATE_db_read_token_memcmp_sppp_print_string_union_advlock_acctchkfreq_spec_lookup_VOP_ABORTOP_scsi_inquire_eeprom_take_ext2fs_inactive_nfsrv_noop_ipstate_log_ip6_output_win2unixfn_sbus_cd_turbosparc_get_syncflt_ms1_get_syncflt_viking_get_syncflt_hypersparc_get_syncflt_srmmu_get_syncflt_sunos_sys_lstat_trap_type_qe_mcreset_uvm_pager_init_isb_tab_sppp_lcp_check_and_close_fdesc_reclaim_db_read_variable_tctrl_process_response_lenocarrier_cdwrite_rco_tab_fixtick_vgone_cd9660_check_export_db_istab_firstchild_udp_sysctl_setregs_sigcode_segm_lru_qereset_cp_time_sys_mount_uvm_map_entry_pool_vhold_ptcwakeup_settime_sys_nosys_pgrp0_mbppopen_cgeightopen_ip6_optlen_ufs_rmdir_encdebug_null_bwrite_ticks_start_update_ether_addmultianddi3.o_svr4_sys_stat64_in6_embedscope_cd9660_sync_pv_size_want_resched_sbusreset_mrt6stat_igmpstat_ether_ifdetach_userconf_totdev_rcons_cnputc_emul_svr4_uvm_mmap_slioctl_bpfioctl_fc_lfcempty_fdesc_unmount_uvm_exit_cache_purgevfs_itimerfix_shmsegs_svr4_sys_utimes_pmap_rmk4_4c_ext2fs_mount_nfsrv_zapsock_nv2tov_type_udp_input_nd6_storelladdr_pipeclose_sys_utimes_db_ed_style_ffs_fragacct_sppp_pap_init_led_blink_swap_key_prepare_uvm_unmap_remove_ipqmaxlen_compat_43_sys_sendmsg_compat_43_sys_recvmsg_cd9660_quotactl_ncr53c9x_done_tcp_timers_etherip_output_fdesc_inactive_unp_connect_pmap_protect_p_setroot_semundo_clear_logselect_pfind_in6addr_loopback_inside_enc_xform_skipjack_udp_ctlinput_inet6domain_unixdomain_ktrpsig_qcopy_cs4231_free_tcp_iss_createde_fdavail_randomread_probe_switch_dqsync_nfsrv_init_etheripstat_kernfs_vfsops_cd9660_specop_p_if_attach_tctrl_write_data_dma_isintr_swap_bytes_change_sign16_be_change_sign16_be_lemediachange_uvm_map_reference_Blowfish_encipher_udp_usrreq_power_ca_probeget_cache_print_mem_no_hypersparc_mmu_enable_ms1_mmu_enable_nfs_setattrrpc_sppp_auth_send_union_check_p_shmid_n2o_sys_unmount_vop_bmap_desc_ccdioctl_db_stop_at_pc_db_putstring_power_cd_ext2fs_blkatoff_procfs_init_VOP_VFREE_uvm_map_inherit_db_command_loop_fr_ifpaddr_gre_ioctl_sysctl_iflist_fr_checkp_compat_43_sys_getpeername_sys_getpeername_compat_43_sys_creat_db_lex_stopprofclock_sys_getfh_ulmin_sbppclose_bestart_sparc_led_blink_ext2fs_cgupdate_rn_search_m_no_asyncflt_regs_cd1400_compute_baud_svr4_emul_path_memregmatch_mfs_inactive_ufs_inactive_esp_output_union_mount_sync_inactive_doclusterraz_qsphy_reset_fdmatch_ifconf_nullfs_statfs_kthread_create_deferred_uvm_fork_elf_copyargs_romboot_lebufattach_ricoh_is410_sw_sppp_proto_name_sys_geteuid_idle_u_mbpp_start_rcons_bell_db_stub_xh_st_rewind_deflate_ulmax_async_daemon_ss_quirk_patterns_st_quirk_patterns_scsi_quirk_patterns_tcp_mss_null_islocked_ffs_vfsops_compat_43_sys_setreuid_audio_close_db_dot_mbppselect_ext2fs_valloc_nqnfs_lease_updatetime_vnops_vfs_rootmountalloc_fuswintrskpc.o_fr_tcpstate_m_gethdr_brelvp_db_last_non_space_db_putchar_nfsrv_symlink_breada_linesw_cd9660_read_swap_bytes_panic_openpromclose_cgfourmmap_fdesc_vfree_fdesc_getattr_mixer_ioctlstrcmp.o_fbclose_chclose_uvm_pageratop_enc_xform_cast5_icmp_mtudisc_timeout_ip_mtudisc_timeout_unp_dispose_hardupdate_audio_clear_mem_page_p9100unblank_cgthreeopen_uvm_setpagesize_cd9660_rrip_getsymname_xyioctl_route6_input_icmp6stat_ttysleep_kbd_ascii_time_tolerance_breadn_pmap_removeashldi3.o_mmopen_cs4231_setup_output_nfsrtt_union_fsync_prtactive_db_watchpoint_alloc___iordi3_svr4_sys_lstat_sdstart_ext2fs_vinit_ext2fs_statfs_softdep_update_inodeblock_msdosfs_fhtovp_sys_lstat_vndstrategy_spifattach_ext2fs_vfree_fixskip_m_get_fifo_select_fifo_badop_ncr5380_abort_locnames_uvm_km_alloc_poolpage1_in_losing_siginit_lockinit_X_db_nsyms_virtual_end_aps_free_cd9660_seek_amd7930_getdev_tty_detach_uvm_scheduler_nexecs_db_output_position_ifindex2ifnet_rpc_auth_kerb___umoddi3_putphysbuf_uvm_km_valloc_db_free_watchpoints_rdwrite_m_adj_xdc_start_st_load_m_pullup2_db_printsym_raise_nd6_na_output_config_rootfound_ttcompatgetflags_stattach_nd6_na_input_cd9660_vget_ksymsopen_nfs_writebp_crypto_freesession_procfs_link_m_cat_m_copym2_allcftables_sys___semctl_compat_43_sys_fstat_kbd_repeat_start_des_is_weak_key_ipsec_exp_allocations_ipsec_soft_allocations_sppp_pap_scr_msdosfs_init_scanc_arc4random_8_max_linkhdr_msioctl_amd7930_start_input_blf_setkey_snprintf_logclose_panicstr_sbus_attach_getvnode_db_cmd_list_disk_attach_am7990_meminit_uvm_km_pgremove_nfsrv_remove_tcp_usrclosed_lf_addblock_cache_lookup_mainbus_match_amd7930_open_brelse_swift_get_syncflt_pmap_enk4m_cdstart_fdstrategy_rn_search_sppp_pap_tlu_msgbufenabled_stop_uvm_pageout_db_set_variable_in_pcbnotify_union_dowhiteout_null_bypass_crcopy_sys_sendto_rip6_ctlinput_fr_udptimeout_tcp_xmit_timer_fc_lmdistance_mbstat__remque_ssminphys_ufs_ihashrem_nfsrv_read_ipsec_common_input_cb_findwin95_nqsrv_unlocklease_ipsec_def_enc_igmp_init_netisr_vfs_getnewfsid_sys_flock_db_listbreak_cmd_romhalt_in_addmulti_union_mkdir_kernfs_open_bdwrite_ttselect_sys_rename_fifo_ebadf_pffasttimo_sys_msync_biowait___one_cmpldi2_dma_reset_ipsp_match_policy_pgdelete_svr4_netattach_svr4_ttold_ioctl_sun_dkioctl_dma_enintr_sdattach_nfsm_srvfattr_kernfs_epoch_fr_authend_limit0_cd9660_setattr_vput_sbpp_ca_etext_mii_mediachg_sl_compress_setup_ifa_ifwithaf_kernfs_xwrite_vn_select_logpri_sys___osemctl_cache_purge_sunos_sys_fcntl_pmap_extract4_4c_rcons_init_ext2fs_sysctl_ffs_setblock_db_sym_init_nfsfifo_close_ip6stat_fifo_close_spec_fsync_sbpp_cd_nfsrv_rename_vndthrottle_swapconf_kbdioctl_led_sc_quotaoff_cd9660_root_llinfo_nd6_vref_softdep_load_inodeblock_nat_ioctl_sppp_pap_tld_sys_connect_nsphy_ca_fbrcons_cols_esp_enable_lastdosdate_netcon_boothowto_db_symiter_uvm_unlock_fpageq_pmap_phys_address_pmap_page_protect4m_dqget_nfsm_strtmbuf_hostid_sys_setpgid_cd9660_vget_internal_m_retry_nsphy_cd_softdep_setup_directory_add_swcr_authcompute_bridge_blocknonip_nullfs_vptofh_ncr5380_intr_raster_textn_ufs_dirbad_fr_authexpire_ppp_compressors_m_getclr_q_to_b_trap_console_font_fixed_nd6_mmaxtries_ip6_get_prevhdr_ufs_start_soreceive_exit1_sys_getitimer_oldmon_w_cmd_blf_ecb_decrypt_sppp_ipcp_RCN_nak_msdosfs_lock_kmemusage_ncr53c9x_intr_exit2_sbppmatch_nam2blk_xyc_tick_union_mknod_crypto_thread_cpu_ca_bzero___negdi2_sunos_sys_unmount_cgfouropen_maxslp_around_rn_addroute_msdosfs_link_ptcselect_ttydefchars_fuword_cs4231_wait_statintr_fr_active_putc_execsw_vmeprint_null_print_kernfs_mount_mountlist_slock_disk_construct_ifinit_cpu_cd_msgpool_cgeightmmap_cpumatch_viking_netcls_crfree_db_single_step_sbpp_rw_cnioctl_fdioctl_nfsstats_bpf_mcopy_relookup_ipip_output_msdosfs_inactive_procfs_inactive_ieintr_bridge_brlconf_VOP_RMDIR_bucket_compat_43_sys_setregid_vop_generic_abortop_cd1400_read_reg_dma_setup_cd_load_toc_ufs_ihashins_in6_pcbnotify_union_copyfile_start_init_vn_default_error_ncr5380_init_bpp_ca_pmap_zero_page4_4c_scsi_get_xs_mapdev_sys_lseek_sys_select_scheduler_start_audio_ca_ah4_input_cb_au_get_gain_mmmmap_ext2fs_vptofh_sys_close_vndstart_audio_init_ringbuffer_ncr53c9x_init_bpp_cdstrlen.o_ipsp_kern_audio_cd_cgfourteenioctl_procfs_checkioperm_uao_reference_powerhook_list_shutdownhook_list_sys_semget_svr4_sys_waitsys_ufsspec_write_nfs_xdrneg1_union_statfs_portal_symlink_uvm_km_kmemalloc_vop_access_desc_db_endlp_timeoutsstrncasecmp.o_cdattach_db_show_callout_scsi_donestrcpy.o_cn_rxc_out_fdc_frsync_namei_hme_caurem.o_kernfs_xread_lbolt_VOP_BWRITE_audio_default_ieinit_cpu_attach_nextgennumber_umap_rename_hme_cd_iplclose_slinput_tbinput_sigexit_unsleep_compat_43_sys_gethostname_nfs_getcacheblkmemcmp.o_dqrele_ufs_print_nfs_reconnect_lkmioctl_compat_43_sys_sigblock_svr4_to_bsd_speed_scsi_autoconf_swstrategy_inflateSync_union_whiteout_procfs_validfpregs_pmap_rmu4_4c_in_revarpinput_revarpinput_led_ca_svr4_sys_alarm_lba2msf_uvmspace_share_crp_req_queue_tail_esp_input_cb_ah6_input_cb_ippr_rcmd_new_VOP_MKNOD_arc4random_db_help_cmd_ss_patterns_sd_scsibus_ops_cd_scsibus_ops_myetheraddr_vmebus_sc_skpc_tcp_clean_sackreport_sys_chmod_allproc_sema_uvm_anon_add_skipjack_encrypt_db_list_watchpoints_db_set_watchpoints_led_cd_regs_nsphymatch_nd6_umaxtries_icmp6_ifstatmax_ext2fs_rmdir_mfs_start_msdosfs_mmap_m_split_sys_chdir_cd_ca_sunos_sys_ustat_swap_encrypt_ctl_cred0_selrecord_in_setpeeraddr_ttwakeup_time_myleintr_ufs_ihashget_tcp_rttdflt_setstatclockrate_db_eregs_cd_cd_sunos_sys_ptrace_svr4_sys_fcntl_fbrcons_init_mainbus_model_removede_nchashtbl_vfs_sysctl_VOP_SETATTR_sys_fcntl_cd9660_rrip_offset_sd_crazymap_audio_init_record_mtty_attach_mustek_attach_bpf_freed_vfs_op_init_soabort_arc4random_state_sccs_cgsixmmap_sppp_dotted_quad_looutput_kernfs_inactive_fifo_inactive_be_ca_cypress_get_syncflt_ctx_alloc_dvma_mapout_getcacheinfo_sun4_pfdatatopacket_encioctl_bridge_rtage_union_close_db_search_ssstrategy_ufs_check_export_msdosfs_check_export_kernfs_vfree_tunattach_semu_nat_maplookup_tcp6_ctlinput_be_cd_svr4_sys_semsys_st_read_kernfs_init_sys_chown_au_set_lr_value_msginfo_loadfpstate_auth_hash_hmac_ripemd_160_96_sbappendcontrol_shmfork_sys_reboot_check_exec_audioclose_db_evars_eeprom_give_udpcksum_ip_directedbcast_zlib_version_db_tab_stop_width_ihash_tdb_expiration_lookup_msginit_VOP_STRATEGY_db_tok_string_raster_op_sysctl_vnode_db_watch_table_tick_makefstype_sys_opipe_audiocs_ca_raster_bitmask_amd7930attach_turbosparc_cache_enable_cypress_cache_enable_hypersparc_cache_enable_viking_cache_enable_ms1_cache_enable_pow_tab_ipseczeroes_icmpmaskrepl_vop_blkatoff_desc_import_lifetime___udivdi3_be_tcvr_write_be_tcvr_read_led_cycle_ufs_create_dead_write_vntblinit_shifthz_arp_ifinit_audiocs_cd_ukattach_mustek_rewind_scanner_icmp6_init_softdep_fsync_mountdev_ipsp_process_done_unp_discard_spec_ioctl_emul_find_pmap_rmu_p_lesetutp_cd_scsibus_get_mode_prelist_remove_in6_ifdel_VOP_FSYNC_ttsetwater_rootdev__remreplace_ie_setupram_in6_matchlen_rpc_mismatch_fr_timeoutstate_spec_inactive_config_scan_db_breakpoint_alloc_mfs_print_bridge_rtflush_vfs_free_netcred_nextc_pmap_zero_page4m_p9100attach_nfs_asyncio_in_broadcast___assert_vgetmemchr.o_pmap_pinit_si_dma_poll_tcxclose_in6ifa_ifpforlinklocal_uvm_km_free_poolpage1_ah_zeroize_ippr_rcmd_out_ip_maxqueue_netio_sysctl_doproc_xs_free_list_ah_input_cb_fdhash_sysctl_rdint_trace_req_ifnet_mbppread_module_unknown_ip6q_soo_close_udv_attach_nfs_valloc_des3_encrypt_des_encrypt_hardclock_sys_clock_settime_sbppioctl_pmap_reference_ipsec_esp_network_default_level_ipsec_esp_trans_default_level_ipsec_auth_default_level_bridge_start_lastseconds_isp_done_ip6_forwarding_tcp_sack_output_bigadj_isofncmp_crdup_bridge_rtdaddr_config_search_time_freq_ch_ca_msghdrs_svr4_stream_get_pmtu_expire_dqref_tcp_outflags_bremfree_svr4_sys_pread_xdcmatch_scsidebug_targets_rn_match_constty_sys_pread_elf_load_file_zswrite_in_control_union_check_ch_cd_svr4_sys_rdebug_nfs_pathconf_pidhash_tcp_sack_option_tcp_maxidle_llinfo_arp_updatepri_stty_compute_baud_uvm_wait_union_allocvp_vmcmd_map_readvn_ovbcopy_auiop_st_interpret_sense_sd_interpret_sense_scsi_interpret_sense_ext2fs_flushfiles_ffs_flushfiles_nfs_statfs_inet6ctlerrmap_dopowerhooks_iprintf_fdinit_compat_43_sys_lstat_numccd_bufpages_openpromioctl_icmp6errppslim_ext2fs_vnodeopv_descs_nfs_strategy_bridge_broadcast_vfs_opv_descs_fdfree_fbioctl_chioctl_amap_splitref_bpfclose_kernfs_link_slclose_tbclose_VOP_PATHCONF_audioselect_sys_unlink_vop_reclaim_desc_ipe4_input_in_ifaddr_VOP_MKDIR_sync_fsync_uao_detach_db_sstep_print_uvm_object_printit_svr4_sys_fchroot_ext2fs_direnter_ipfilter_version_pmap_enk4_4c_si_obio_dma_stop_defrouter_lookup_nat_masks_sys_setitimer_X_db_isym_isp_lostcmd__divreplace_pmap_rmk_p_iommu_enter_nfs_attrtimeo_vop_bwrite_desc_vop_update_desc_mntvnode_slock_fddump_auxio_regval_ipstat_union_setattr_oclock_ca_native_to_svr4_errno_uvm_vnp_uncache_randomselect_ncr53c9x_select_mem_access_fault4m_svr4_sys_ulimit_raster_op_nosrc_noclip_dmtext_st_touch_tape_fr_statemax_ipsec_exp_timeout_winChksum_userconf_history_msgbufp_audiogetinfo_sync_crash_defrouter_delreq_fr_scanlist_vnode_free_list_slock_oclock_cd_beattach_bpf_bufsize_portal_vfsops_umap_vfsops_disk_resetstat_pmap_copy_page_p_gre_allow_alldevs_leavepgrp_compat_43_sys_sethostname_vop_generic_bwrite_vndwrite_change_sign16_swap_bytes_le_vmes_scan_ext2fs_mountfs_sppp_ipcp_scr_exec_setup_stack_xyc_xyreset_nsphy_reset_mfs_initminiroot_ip_srcroute_sppp_output_fatentry_copyargs_sunos_sys_sigreturn_pagetables_end_amap_lookups_rpc_autherr_sys_sigreturn_crget_bread_sppp_ipcp_tls_ccdclose_msgmaps_sunos_sys_setpgrp_cluster_newbuf_db_lp_rn_newpair_sppp_dequeue_sppp_ipcp_tlu_logioctl_sys_fhstatfs_disk_detach_cast5_encrypt_route_cb_sem_nbuf_svr4_sys_shmsys_phys_avail_in6_ifstatmax_subnetsarelocal_sir_nsphy_service_shm_find_segment_by_shmid_vop_write_desc_shminfo_ippr_ftp_in_db_error_sppp_phase_name_sys_chflags_nullop_nbootpath_xdc_xdreset_pil_to_vme_nfs_sysctl_crypto_newsession_fr_addgroup_proc_targets_shminit_change_sign16_swap_bytes_besrandom.o_st_identify_drive_frag6_nfragpackets_ipport_firstauto_vmcmdset_extend_ncr53c9x_poll_svr4_sys_gettimeofday_sd_shutdown_ufs_pathconf_appr_init_ip6_savecontrol_pppasyncrelinq_sppp_detach_bpf_catchpacket_pipe_ioctl_sys_gettimeofday_random_state_kcopy_esym_pmap_clear_reference4m_xdc_ioctlcmd_appr_free_db_skip_to_eol_cpcb_cgtwoputcmap_ip6intr_uao_swhash_elt_pool_rt_timer_queue_change_procfs_lookup_ipc_n2o_userconf_histcur_userconf_histlen_tputchar_resettodr_mii_phy_reset_in6_gif_output_mbutl_kbd_docmd_mfs_strategy_ufs_strategy_arp_rtrequest_procfs_freevp_clalloc_mixer_close_db_search_symbol_db_le_X_db_search_symbol_tctrl_ca_nbpg_pv_link4m_bestop_tcp_sack_adjust_ndqb_ipc_o2n_soo_select_tickfixinterval_pfkeyv2_get_proto_alg_nqfhhashtbl_tcprexmtthresh_fs_posix_sysctl_clfree_cd1400_enable_transmitter_xyclose_icmp6_redirect_input_tdb_hashstats_sppp_ipcp_tld_soclose_fifo_ioctl_ncr5380_wait_phase_timo_uvm_map_printit_tctrl_cd_pmap_bootstrap_kdvma_mapin_ufs_direnter_esp_attach_uvm_swap_init_uvm_swap_free_nfsm_mbuftouio_arp_maxtries_sppp_ipcp_tlf_null_lookup_kernfs_get_rrootdev_shm_last_free_userconf_hist_int_kmemstats__udivreplace_getcpuinfo_iommu_match_nqnfs_prog_tcp_update_sack_list_arpt_prune_sysctl_ntptime_db_lc___cmpdi2_fbopen_chopen_ext2fs_dirempty_sppp_ipcp_up_umap_unlock_audio_write_db_qualify_lmin_dmamatch_scanjet_special_ffs_sbupdate_loif_lf_split_compat_43_sys_mmap_db_history_X_db_sym_init_romprop_ipport_hifirstauto_if_mark_ignore_fd_ca_lesetaui_ip6_init_fdesc_pathconf_logwakeup_sttyattach_fbnode_kvm_setcache_blf_zerokey_cdread_rpc_auth_unix_uipc_usrreq_diskerr_VOP_IOCTL_fd_cd_max_protohdr_sparc_db_command_table_dvma_malloc_fdchwintr_softdep_setup_inomapdep_ip_dosourceroute_kernfs_statfs_soconnect_dofilewrite_userconf_histbuf_sys_ogetfsstat_db_command_table_dma_ca_lmax_spifmatch_svr4_sys_signal_xystrategy_nd6_ns_input_uvm_ifpromisc_lasttime_rdattach_dma_go_export_key_getquota_etherip_allow_ipe4_zeroize_compat_43_sys_lseek_db_inst_count_SHA1Update_int_rmalloc_kern_sysctl_dma_cd_main_svr4_to_bsd_sig_msclose_mld6_input_nfs_vptofh_ah_input_bioops_firstc_fdrelease_eopnotsupp_ie_ca_delay_phys_map_sddkdriver_ffs_valloc_sppp_ipcp_RCR_chkdq_nfsspec_access_nqsrv_instimeq_unp_externalize_lkm_nofunc_svr4_sendsig_mfs_rootbase_rijndael128_decrypt_route_output_cinit_ie_cd_maxfiles_nfsnodehash_kernfs_root_sbappendaddr_cfree_msopen_berint_qestart_dvd_read_physical_cdsize_ppp_timeout_free_fbmmap_ie_map_ngif_in_ifinit_msdosfs_create_semu_alloc_lockstatus_db_readline_db_last_addr_st_decide_mode_ipfr_inuse_if_detach_rtdelete_union_newlower_fdesc_ioctl_extent_alloc_region_db_unread_char_pv_flushcache_uvm_analloc_nfsrv_getcache_rawcbtable_pppasyncctlp_userconf_hist_cmd_sys_setsid_svr4_sys_pgrpsys_dvd_read_bca_des_key_sched_arpt_keep_msdosfs_mountfs_VOP_LEASE_bereset_fdciop_ffs_statfs_inflateIncomp_isp_intr_fr_forgetifp_lortrequest_union_readlink_pmap_rmk4m_beqint_fc_purge_audio_select_db_loop_count_pmap_protect4m_ip6_defmcasthlim_RMD160Update_int_deflateInit2_db_lbuf_start_timer_ca_imin_mii_phy_detach_dead_print_svr4_elf_probe_sunos_sys_fchroot_svr4_trap_nd6_dad_duplicated_uvm_pager_put_nfsm_adj_userconf_hist_eoc_exec_map_kbdclose_cgfourteenopen_uvm_pagelookup_fr_tcpclosed_iplioctl_ipsp_spd_lookup_unp_internalize_sys_setuid_numvnd_timer_cd_ipforwarding_VOP_BALLOC_svr4_sys_utime_ufs_dirempty_ipsec_policy_head_dehash_audioprobe_iptime_domainnamelen_ksymsread_imax_pmap_copy_disabled_cnopen_fdopen_sunos_sys_mctl_inflateInit_sys_clock_getres_svr4_sys_pathconf_svr4_jerq_ioctl_chmatch_uvm_km_free_wakeup_sys_issetugid_sys_pathconf_isp_init_xyc_ioctlcmd_ireplace_ipsec_keep_invalid_sigprop_ktrops__uremreplace_cpu_match_ufs_lookup_nfsv3_type_tcp_mtudisc_increase_raw_init_prefetch_mttywrite_nat_lookupredir_tcp_quench_bawrite_enxio_edatabzero.o_kcur_pmap_copy_page4_4c_xycintr_kill_user_windows_chkiq_msqid_n2o_fixjobc_ntohl_tcp_rscale_ipq_inflateInit2_if_down_dead_ebadf_pgrphashtbl_mmrw_cgsixopen_ppp_dequeue_userconf_show_attr_vop_link_desc_VOP_ACCESS_svr4_sys_setegid_sys_shmctl_sys_setegid_chgproccnt_db_clear_watchpoints_scsibus_ca_cnclose_fdclose_gif_pmap_update_auth_hash_key_md5_bpf_setif_kernfs_read_rrootdev_shmexit_cngetc_xyc_entoact_nat_table_tcp_fasttimo_config_activate_children_gif_ioctl_nfs_symlink_time_constant_kthread_run_deferred_queue_audioprint_scsibus_cd_mii_phy_tick_SHA1Transform_if_up_sunos_sys_mmap_sadb_exts_allowed_out_ffs_sysctl_cd9660_select_end_st_crazymap_umapfs_mount_bcmp_raster_text_pfkeyv2_send_in6_gif_input_msdosfs_pathconf_procfs_pathconf_ktrcsw_biodone_iplh_deget_vfs_syncwait_fpu_cleanup_ukmatch_mii_pollstat_intr_fasttrap_in6_addrscope_icmp6_ifstat_ext2fs_update_ipfr_heads_ipfr_slowtimer_ip_randomid_sppp_isempty_fc_fileextends_db_expression_tinfo_t_copyoutstr_auxregbisc_amap_pp_establish_softdep_flushfiles_inetctlerrmapnegdi2.o___ucmpdi2___lshldi3_p9100match_nd6_p2p_rtrequest_sbx_tab_icmperrppslim_msdosfs_strategy___main_xyc_e2str_nd_prefix_ipll_ipfr_unload_bpfwrite_ktremul_vop_setattr_desc_icmp_sysctl_tcp_sysctl_au_get_lr_value_ifmedia_list_add_version_fdalloc_sys_oshmctl_sys_ntp_gettime_cmask_db_max_width_config_found_sm_cpumatch_sun4_tcp_newreno_wildcard_rt_tables_extent_destroy_endtsleep_db_nsymtabs_ffs_tcxmmap_cpumatch_hypersparc_dirchk_route_init_sohasoutofband_npty_cfroots_zsclose_pfxlist_onlink_check_uvm_map_deallocate_enoioctl_closef_sys_write_sunos_sys_open_swift_cache_enable_sun4_cache_enable_pmap_cache_enable_nfssvc_sockhead_db_prom_cmd_fd_types_export_lifetime_pager_map_ext2fs_sbupdate_iplt_lf_getblock_sys_xfspioctl_spec_badop_ch_exchange_rt_setmetrics_dead_read_setrunnable_betint_mii_phy_auto_fdstart_turbosparc_hotfix_ufs_close_ipv4_input_lf_clearlock_sys_socketpair_vn_syncer_add_to_worklist_vfs_opv_init_getc_fdcopy_falloc_bematch_pfkeyv2_parsemessage_ffs_mountfs_ip_natunload_routesw_fifo_bmap_emul_flags_translate_vmebus_translate_sbus_translate_icmp6_nodeinfo_ether_output_umapfs_statfs_vfs_allocate_syncvnode_cluster_read_dk_establish_blf_key_nextraloc_ienab_bis_4_4c_svr4_sys_socket_hypersparc_memerr_pmap_deactivate_ext2fs_write_nfsv2_type_nfsrvlruhead_nfsrv_readlink_sys_socket_mfs_badop_pfkeyv2_expire_gettdbbyaddr___lshrdi3_rt_timer_remove_all_find_last_set_ccdwrite_cdevsw_securelevel_ddb_regs_mbpp_match_sunos_sys_wait4_nqsrv_getlease_devout_device_unref_cd9660_readdir_ccdintr_ntohs_ffs_vptofh_nfsm_disct_fdesc_mount_schedcpu_fdc_ca_xboxmatch_dmmin_fb_attach_qeattach_ip6_lasthdr_fr_defaultauthage_fifo_open_si_vme_dma_stop_desireddquot_hztodivdi3.o_beinit_st_write_filemarks_udp6_usrreq_tcp_usrreq_sl_softc_kernfs_start_coredump_fdc_cd_min_cpumatch_sun4c_ext2fs_symlink_tcpstat_icmpstat_dosdirempty_devcls# $OpenBSD: disktab,v 1.16 1998/09/23 07:30:57 todd Exp $ # # @(#)disktab 5.5 (Berkeley) 2/27/91 # # Disk geometry and partition layout tables. # Key: # ty type of disk # ns #sectors/track # nt #tracks/cylinder # nc #cylinders/disk # rm rpm, 3600 default # se sector size, 512 default # sf supports bad144-style bad sector forwarding # so partition offsets in sectors # p[a-p] partition sizes in sectors # b[a-p] partition block sizes in bytes # f[a-p] partition fragment sizes in bytes # miniroot:\ :ty=winchester:se#512:nt#2:rm#300:ns#64:nc#80:\ :ts=3500:\ :pa#10240:oa#0:ba#8192:fa#1024:ta=4.2BSD:\ :pb#0:ob#0:\ :pc#10240:oc#0: rdroot:\ :ty=ramdisk:se#512:nt#2:rm#300:ns#8:nc#1024:\ :pa#8192:oa#0:ta=4.2BSD:ba#8192:fa#1024: \ :pc#8192:oc#0: floppy|floppy3|3in|3.5in High Density Floppy:\ :ty=floppy:se#512:nt#2:rm#300:ns#18:nc#80:\ :pa#2880:oa#0:ba#4096:fa#512:ta=4.2BSD:\ :pb#2880:ob#0:\ :pc#2880:oc#0: # test if not having an 'a' works? fakecdrom|Fake image for Bootable CDROM:\ :ty=winchester:se#512:nt#1:rm#350:ns#640:nc#2048:\ :pa#1310720:oa#0:ba#8192:fa#1024:ta=4.2BSD:\ :pb#1310720:ob#0:bb#8192:fb#1024:tb=4.2BSD:\ :pc#1310720:oc#0:bc#8192:fc#1024:tc=4.2BSD:\ :pd#1310720:od#0:bd#8192:fd#1024:td=4.2BSD: ASI-1.0GIBM:\ :ty#winchester:ns#80:nt#15:nc#1632: Arte DEC DSP3160S:\ :ty#winchester:ns#112:nt#16:nc#1744: CDC 9720-850:\ :ty#XD7053:ns#66:nt#15:nc#1358: CDC EMD 9720:\ :ty#XD7053:ns#48:nt#10:nc#1147: CDC EMD 9720-1230:\ :ty#XD7053:ns#82:nt#15:nc#1633: CDC IPI 9720:\ :ty#ISP-80:ns#82:nt#15:nc#1631:\ :pa#33210:oa#0:ba#8192:\ :pb#131610:ob#33210:\ :pc#2006130:oc#0:\ :pg#196800:og#164820:\ :ph#1644510:oh#361620: CDC IPI 9722:\ :ty#ISP-80:ns#156:nt#7:nc#1630:\ :pa#33852:oa#0:ba#8192:\ :pb#132132:ob#33852:\ :pc#1779960:oc#0:\ :pg#197652:og#165984:\ :ph#1416324:oh#363636: CDC Wren IV 94171-344:\ :ty#winchester:ns#46:nt#9:nc#1545: CONNER 30170E:\ :ty#winchester:ns#46:nt#8:nc#897:\ :pa#14720:oa#0:ba#8192:\ :pb#40480:ob#14720:\ :pc#330096:oc#0:\ :pg#274896:og#55200: CONNER 30200:\ :ty#winchester:ns#49:nt#4:nc#2121:\ :pc#415716:oc#0: CONNER CFP4207S 4.28GB:\ :ty#winchester:ns#125:nt#20:nc#3353:\ :pc#8382500:oc#0: CONNER CP3500-540MB-3.5:\ :ty#winchester:ns#50:nt#12:nc#1768:\ :pc#1060800:oc#0: CP3100:\ :ty#winchester:ns#49:nt#4:nc#1023:\ :pc#204864:oc#0: Conner CFP1060:\ :ty#winchester:ns#111:nt#8:nc#2329: Conner CP3540:\ :ty#winchester:ns#49:nt#12:nc#1805: DEC DSP3107L:\ :ty#winchester:ns#83:nt#8:nc#3147:\ :pc#2089608:oc#0: DEC DSP3210 2 GB:\ :ty#winchester:ns#86:nt#16:nc#3040:\ :pc#4183040:oc#0: DEC DSP5200:\ :ty#winchester:ns#71:nt#21:nc#2619:\ :pa#32802:oa#0:ba#8192:\ :pb#65604:ob#32802:\ :pc#3904929:oc#0:\ :pg#3806523:og#98406: DEC DSP5350:\ :ty#winchester:ns#91:nt#25:nc#3053: DEC_RZ26:\ :ty#winchester:ns#57:nt#14:nc#2568:\ :pa#66234:oa#0:ba#8192:\ :pb#132468:ob#66234:\ :pc#2049264:oc#0:\ :pg#1850562:og#198702: DEC_RZ28:\ :ty#winchester:ns#84:nt#16:nc#3043:\ :pa#64512:oa#0:ba#8192:\ :pb#196224:ob#64512:\ :pc#4089792:oc#0:\ :pg#3827712:og#260736: DEC_RZ58:\ :ty#winchester:ns#85:nt#15:nc#2112: DEC_RZ58_whole_disk:\ :\ :pc#2692800:oc#0: DEC_RZ74:\ :ty#winchester:ns#91:nt#25:nc#3053:\ :pa#65975:oa#0:ba#8192:\ :pb#193375:ob#65975:\ :pc#4192825:oc#0:\ :pg#3931200:og#259350:\ :ph#2752750:oh#4192825: Fujitsu M2243AS:\ :ty#ACB4000:ns#17:nt#11:nc#752: Fujitsu M2246E:\ :ty#winchester:ns#35:nt#6:nc#1196:\ :pa#16170:oa#0:ba#8192:\ :pb#28140:ob#16170:\ :pc#251160:oc#0:\ :pg#206850:og#44310: Fujitsu M2263SA:\ :ty#winchester:ns#53:nt#15:nc#1652: Fujitsu M2266SA 1.2GB:\ :ty#winchester:ns#85:nt#15:nc#1652: Fujitsu M2266SA 1GB:\ :ty#winchester:ns#85:nt#15:nc#1642: Fujitsu M2344K:\ :ty#XD7053:ns#64:nt#27:nc#622: Fujitsu M2511A:\ :ty#winchester:ns#25:nt#1:nc#9950: Fujitsu M2512A small:\ :ty#winchester:ns#25:nt#1:nc#9950:\ :pc#248750:oc#0: Fujitsu M2512A v2:\ :ty#winchester:ns#25:nt#1:nc#17840:\ :pc#446000:oc#0: Fujitsu M2622SA:\ :ty#winchester:ns#64:nt#7:nc#1429:\ :pc#640192:oc#0: Fujitsu M2624FA:\ :ty#winchester:ns#64:nt#11:nc#1440:\ :pa#22528:oa#0:ba#8192:\ :pb#67584:ob#22528:\ :pc#1013760:oc#0:\ :pg#450560:og#90112:\ :ph#473088:oh#540672: Fujitsu M2652SA:\ :ty#winchester:ns#88:nt#20:nc#1935: Fujitsu M2654SA:\ :ty#winchester:ns#88:nt#21:nc#2174: Fujitsu M2684S:\ :ty#SCSI:ns#74:nt#6:nc#2338: Fujitsu-M2284/M2322:\ :ty#XY450:ns#32:nt#10:nc#821: Fujitsu-M2312K:\ :ty#XY450:ns#32:nt#7:nc#587: Fujitsu-M2333:\ :ty#XD7053:ns#67:nt#10:nc#821: Fujitsu-M2351 Eagle:\ :ty#XD7053:ns#46:nt#20:nc#840: Fujitsu-M2361 Eagle:\ :ty#XD7053:ns#67:nt#20:nc#840: Fujitsu-M2372K:\ :ty#XD7053:ns#67:nt#27:nc#743: Fujitsu-M2382:\ :ty#XD7053:ns#81:nt#27:nc#743:\ :pa#80919:oa#0:ba#8192:\ :pb#129033:ob#80919:\ :pc#1624941:oc#0:\ :pd#470205:od#209952:\ :pe#944784:oe#680157:\ :pf#209952:of#0:\ :pg#1414989:og#209952:\ :ph#1544022:oh#80919: Fujitsu-M2624S-512:\ :ty#winchester:ns#64:nt#11:nc#1429: Fujitsu-M2651SA:\ :ty#winchester:ns#88:nt#16:nc#1934:\ :pc#2723072:oc#0: Fujitsu-M2694ESA:\ :ty#winchester:ns#77:nt#15:nc#1830: HP 97549T:\ :ty#winchester:ns#64:nt#16:nc#1909: HP 97556:\ :ty#winchester:ns#72:nt#11:nc#1668: HP 97558:\ :ty#winchester:ns#72:nt#15:nc#1933: HP 97560:\ :ty#winchester:ns#72:nt#19:nc#1933: HP C2247 1.05GB:\ :ty#winchester:ns#95:nt#13:nc#1661:\ :pc#2051335:oc#0:\ :pg#1640080:og#0:\ :ph#411255:oh#1640080: HP C3010 / Cranel 2.0GB Fast SCSI2 H10:\ :ty#winchester:ns#95:nt#19:nc#2165: HP97548SU 664MB:\ :ty#winchester:ns#56:nt#16:nc#1445:\ :pa#35840:oa#0:ba#8192:\ :pb#71680:ob#35840:\ :pc#1294720:oc#0:\ :pg#197120:og#215040:\ :ph#342720:oh#609280: Hewlett Packard C2490A:\ :ty#winchester:ns#107:nt#18:nc#2159: Hewlett Packard C3323A:\ :ty#winchester:ns#98:nt#7:nc#2995: Hewlett Packard C3725S:\ :ty#winchester:ns#140:nt#9:nc#3362:\ :pc#4236120:oc#0:\ :ph#4193280:oh#1260: Hitachi DK315C-10:\ :ty#winchester:ns#75:nt#11:nc#2467: Hitachi DK315C-11:\ :ty#winchester:ns#58:nt#15:nc#2478: Hitachi DK315C-14:\ :ty#winchester:ns#75:nt#15:nc#2462: Hitachi DK326C-10:\ :ty#winchester:ns#87:nt#7:nc#3200: Hitachi DK326C-6:\ :ty#winchester:ns#87:nt#4:nc#3200: Hitachi DK515C-78:\ :ty#winchester:ns#69:nt#14:nc#1354: Hitachi DK516C-16:\ :ty#winchester:ns#80:nt#15:nc#2170: Hitachi DK517C-37:\ :ty#winchester:ns#81:nt#21:nc#3297: Hitachi DK815-10:\ :ty#XD7053:ns#67:nt#15:nc#1735: IBM 0662-S12:\ :ty#winchester:ns#114:nt#6:nc#3002: IBM 0662S12:\ :ty#winchester:ns#108:nt#5:nc#3803: IBM 0663-E15:\ :ty#winchester:ns#37:nt#20:nc#3182: IBM 0663L12:\ :ty#winchester:ns#66:nt#15:nc#1979:\ :pc#1959210:oc#0: IBM 0664-M1H/N1H:\ :ty#winchester:ns#86:nt#16:nc#2856: IBM 0664CSH:\ :ty#winchester:ns#125:nt#30:nc#2787: IBM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM DFHSS1x:\ :ty#winchester:ns#125:nt#4:nc#4383: IBM DFHSS2x:\ :ty#winchester:ns#125:nt#8:nc#4388: IBM DFHSS4x:\ :ty#winchester:ns#125:nt#16:nc#4390: IBM DPES-31080:\ :ty#winchester:ns#108:nt#4:nc#4901:\ :pc#2117232:oc#0: IBM DSAS-3270:\ :ty#winchester:ns#108:nt#2:nc#2542: IBM DSAS-3360:\ :ty#winchester:ns#108:nt#2:nc#3297: IBM DSAS-3540:\ :ty#winchester:ns#108:nt#3:nc#3259: IBM DSAS-3720:\ :ty#winchester:ns#108:nt#4:nc#3292: IBM OEM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM OEM DFHSS2F:\ :ty#winchester:ns#135:nt#8:nc#4076:\ :pa#4100760:oa#0:ba#8192:\ :pb#301320:ob#4100760: MAXOPTIX (NON-ISO, 1024b) DATA:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 1024b) SYSTEM:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 512b) DATA:\ :ty#winchester:ns#60:nt#1:nc#15081: MAXOPTIX (NON-ISO, 512b) SYSTEM:\ :ty#winchester:ns#60:nt#1:nc#15081: MICROP 4221-09MZ 10204:\ :ty#winchester:ns#139:nt#9:nc#3198:\ :pc#4000698:oc#0: MICROPOLIS 1991-27:\ :ty#winchester:ns#149:nt#27:nc#4400: MICROPOLIS 3243-19:\ :ty#winchester:ns#106:nt#19:nc#4139: MICROPOLIS 4110-09:\ :ty#winchester:ns#95:nt#9:nc#2283: Maxtor 7213SR NB:\ :ty#winchester:ns#65:nt#4:nc#1595:\ :pc#414700:oc#0:\ :pg#414700:og#0: Maxtor DXP3105S:\ :ty#winchester:ns#57:nt#14:nc#2568: Maxtor LXT-200S:\ :ty#winchester:ns#43:nt#7:nc#1117: Maxtor LXT-340SY:\ :ty#winchester:ns#70:nt#7:nc#1355: Maxtor LXT535ST:\ :ty#winchester:ns#61:nt#11:nc#1547:\ :pc#1038037:oc#0: Maxtor MXT1240S:\ :ty#winchester:ns#70:nt#15:nc#2306:\ :pc#2421300:oc#0:\ :pg#2421300:og#0: Maxtor P0-12S (1632):\ :ty#winchester:ns#90:nt#15:nc#1478:\ :pc#1995300:oc#0:\ :pg#1995300:og#0: Maxtor P0-12S (1795):\ :ty#winchester:ns#90:nt#15:nc#1510:\ :pc#2038500:oc#0:\ :pg#2038500:og#0: Maxtor P1-17S:\ :ty#winchester:ns#83:nt#19:nc#1816:\ :pa#78850:oa#0:ba#8192:\ :pb#78850:ob#78850:\ :pc#2863832:oc#0:\ :pd#78850:od#157700:\ :pg#2469582:og#236550:\ :ph#78850:oh#2706132: Maxtor P1-17S NB:\ :ty#winchester:ns#90:nt#19:nc#1711:\ :pc#2925810:oc#0:\ :pg#2925810:og#0: Maxtor XT-1050:\ :ty#ACB4000:ns#17:nt#5:nc#1020: Maxtor XT-3280S:\ :ty#winchester:ns#25:nt#15:nc#1222: Maxtor XT-4380S:\ :ty#winchester:ns#36:nt#15:nc#1202: Maxtor XT-8380S:\ :ty#winchester:ns#53:nt#8:nc#1626: Maxtor XT-8610E:\ :ty#winchester:ns#52:nt#12:nc#1626: Maxtor XT-8760E:\ :ty#winchester:ns#50:nt#15:nc#1616:\ :pa#97500:oa#0:ba#8192:\ :pb#63750:ob#658500:\ :pc#1212000:oc#0:\ :pd#280500:od#97500:\ :pe#280500:oe#378000:\ :pf#489750:of#722250:\ :pg#561000:og#97500:\ :ph#658500:oh#0: Maxtor XT-8760S:\ :ty#winchester:ns#54:nt#15:nc#1614: Micropolis 1304:\ :ty#ACB4000:ns#17:nt#6:nc#825: Micropolis 1325:\ :ty#ACB4000:ns#17:nt#8:nc#1022: Micropolis 1355:\ :ty#winchester:ns#34:nt#8:nc#1018: Micropolis 1528-15:\ :ty#winchester:ns#83:nt#15:nc#2102:\ :pa#32370:oa#0:ba#8192:\ :pb#64740:ob#32370:\ :pc#2616990:oc#0:\ :pg#2519880:og#97110: Micropolis 1548-15:\ :ty#winchester:ns#131:nt#15:nc#1701:\ :pa#33405:oa#0:ba#8192:\ :pb#66810:ob#33405:\ :pc#3342465:oc#0:\ :pg#3242250:og#100215: Micropolis 1558:\ :ty#winchester:ns#35:nt#15:nc#1218: Micropolis 1578-15:\ :ty#winchester:ns#35:nt#15:nc#1231:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#646275:oc#0:\ :pg#548625:og#97650: Micropolis 1588-15:\ :ty#winchester:ns#53:nt#15:nc#1637:\ :pa#32595:oa#0:ba#8192:\ :pb#65190:ob#32595:\ :pc#1301415:oc#0:\ :pg#1203630:og#97785: Micropolis 1598-15:\ :ty#winchester:ns#70:nt#15:nc#1931:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#2027550:oc#0:\ :pg#1929900:og#97650: Micropolis 1624-7:\ :ty#winchester:ns#114:nt#7:nc#1647:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#1314306:oc#0:\ :pg#1216152:og#98154: Micropolis 1674-7:\ :ty#winchester:ns#35:nt#7:nc#1255:\ :pa#16415:oa#0:ba#8192:\ :pb#32830:ob#16415:\ :pc#307475:oc#0:\ :pg#258230:og#49245: Micropolis 1684-7:\ :ty#winchester:ns#53:nt#7:nc#1785:\ :pa#32648:oa#0:ba#8192:\ :pb#65296:ob#32648:\ :pc#662235:oc#0:\ :pg#564291:og#97944: Micropolis 1908-15:\ :ty#winchester:ns#95:nt#15:nc#1890:\ :pa#32775:oa#0:ba#8192:\ :pb#65550:ob#32775:\ :pc#2693250:oc#0:\ :pg#2594925:og#98325: Micropolis 1924-21:\ :ty#winchester:ns#94:nt#21:nc#2072:\ :pa#33558:oa#0:ba#8192:\ :pb#67116:ob#33558:\ :pc#4090128:oc#0:\ :pg#3989454:og#100674: Micropolis 1926-15:\ :ty#winchester:ns#101:nt#15:nc#2769:\ :pa#33330:oa#0:ba#8192:\ :pb#66660:ob#33330:\ :pc#4195035:oc#0:\ :pg#4095045:og#99990: Micropolis 1936-21:\ :ty#winchester:ns#101:nt#21:nc#2772:\ :pa#33936:oa#0:ba#8192:\ :pb#67872:ob#33936:\ :pc#5879412:oc#0:\ :pg#2846382:og#101808:\ :ph#2931222:oh#2948190: Micropolis 2105-8:\ :ty#winchester:ns#94:nt#8:nc#1448:\ :pa#32336:oa#0:ba#8192:\ :pb#64672:ob#32336:\ :pc#1088896:oc#0:\ :pg#991888:og#97008: Micropolis 2108-10:\ :ty#winchester:ns#94:nt#10:nc#1450:\ :pa#31960:oa#0:ba#8192:\ :pb#63920:ob#31960:\ :pc#1363000:oc#0:\ :pg#1267120:og#95880: Micropolis 2112-15:\ :ty#winchester:ns#94:nt#15:nc#1452:\ :pa#33840:oa#0:ba#8192:\ :pb#67680:ob#33840:\ :pc#2047320:oc#0:\ :pg#1945800:og#101520: Micropolis 2205-05:\ :ty#winchester:ns#109:nt#5:nc#2088:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#1137960:oc#0:\ :pg#1039860:og#98100: Micropolis 2210-09:\ :ty#winchester:ns#109:nt#9:nc#2099:\ :pa#33354:oa#0:ba#8192:\ :pb#66708:ob#33354:\ :pc#2059119:oc#0:\ :pg#1959057:og#100062: Micropolis 2217-15:\ :ty#winchester:ns#109:nt#15:nc#2105:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#3441675:oc#0:\ :pg#3343575:og#98100: Micropolis 4110:\ :ty#winchester:ns#114:nt#9:nc#1998: Micropolis 4221:\ :ty#winchester:ns#109:nt#9:nc#4079:\ :pa#4001499:oa#0:ba#8192:\ :pc#4001499:oc#0: NEC D2363:\ :ty#XD7053:ns#67:nt#27:nc#964: NEC-D2352:\ :ty#XD7053:ns#57:nt#19:nc#758: Quantum ELS 127S:\ :ty#winchester:ns#54:nt#3:nc#1541: Quantum ELS 170S:\ :ty#winchester:ns#54:nt#4:nc#1542: Quantum ELS 85S:\ :ty#winchester:ns#54:nt#2:nc#1535: Quantum Empire 540S:\ :ty#winchester:ns#92:nt#8:nc#1431: Quantum Empire 1080S:\ :ty#winchester:ns#92:nt#16:nc#1431: Quantum Empire 2100S:\ :ty#winchester:ns#137:nt#12:nc#2497:\ :pc#4105068:oc#0: Quantum GoDrive 120S:\ :ty#winchester:ns#56:nt#4:nc#1067: Quantum GoDrive 160S:\ :ty#winchester:ns#58:nt#4:nc#1413: Quantum LPS 105S:\ :ty#winchester:ns#42:nt#4:nc#1221: Quantum LPS 120S:\ :ty#winchester:ns#60:nt#2:nc#1987: Quantum LPS 240S:\ :ty#winchester:ns#60:nt#4:nc#1995: Quantum LPS 270S:\ :ty#winchester:ns#76:nt#7:nc#992: Quantum LPS 525S:\ :ty#winchester:ns#70:nt#6:nc#2444: Quantum LPS 540S:\ :ty#winchester:ns#125:nt#4:nc#2113: Quantum Lightning 730S:\ :ty#winchester:ns#63:nt#16:nc#1415:\ :pa#161280:oa#0:ba#8192:\ :pb#96768:ob#161280:\ :pc#1426320:oc#0:\ :pg#1168272:og#258048: Quantum PD 80S:\ :ty#winchester:ns#34:nt#6:nc#832: Quantum PD 120S:\ :ty#winchester:ns#42:nt#5:nc#1114: Quantum PD 170S:\ :ty#winchester:ns#42:nt#7:nc#1117: Quantum PD 210S:\ :ty#winchester:ns#49:nt#7:nc#1189: Quantum PD 425S:\ :ty#winchester:ns#60:nt#9:nc#1540: Quantum PD 700S:\ :ty#winchester:ns#70:nt#8:nc#2441: Quantum PD 1050iS:\ :ty#winchester:ns#92:nt#12:nc#1859:\ :pc#2052336:oc#0: Quantum PD 1050S:\ :ty#winchester:ns#70:nt#12:nc#2444: Quantum PD 1225S:\ :ty#winchester:ns#70:nt#14:nc#2442: Quantum XP32150:\ :ty#winchester:ns#109:nt#10:nc#3850: Quantum XP34301:\ :ty#winchester:ns#118:nt#20:nc#3561: Quantum XP34300W:\ :ty#winchester:ns#107:nt#20:nc#3907: RICOH RO-5031E:\ :ty#winchester:ns#54:nt#15:nc#710:\ :pc#575100:oc#0: RZ24:\ :ty#winchester:ns#38:nt#8:nc#1344:\ :pc#409792:oc#0: RZ55:\ :ty#winchester:ns#35:nt#15:nc#1218:\ :pa#32025:oa#0:ba#8192:\ :pb#59850:ob#32025:\ :pc#639450:oc#0:\ :pg#547575:og#91875: SEAGATE ST11950N:\ :ty#winchester:ns#81:nt#15:nc#2715:\ :pc#3298725:oc#0: SEAGATE ST15230N:\ :ty#winchester:ns#111:nt#19:nc#3974: SEAGATE ST31200N:\ :ty#winchester:ns#85:nt#9:nc#2692: SEAGATE ST31230N:\ :ty#winchester:ns#104:nt#5:nc#3978:\ :pc#2068560:oc#0: SEAGATE ST32550N:\ :ty#winchester:ns#109:nt#11:nc#3495:\ :pc#4190505:oc#0: SEAGATE ST3600N:\ :ty#winchester:ns#79:nt#7:nc#1853:\ :pc#1024709:oc#0: ST83220K:\ :ty#"ISP-80":ns#102:nt#19:nc#2652: SUN0104:\ :ty#winchester:ns#35:nt#6:nc#974: SUN0121:\ :ty#winchester:ns#39:nt#4:nc#1520: SUN0207:\ :ty#winchester:ns#36:nt#9:nc#1254: SUN0327:\ :ty#winchester:ns#46:nt#9:nc#1545: SUN0424:\ :ty#winchester:ns#80:nt#9:nc#1151: SUN0535:\ :ty#winchester:ns#80:nt#7:nc#1866: SUN0669:\ :ty#winchester:ns#54:nt#15:nc#1614: SUN1.3G:\ :ty#winchester:ns#80:nt#17:nc#1965: SUN2.1G:\ :ty#winchester:ns#80:nt#19:nc#2733: Sabre ST82500J:\ :ty#XD7053:ns#82:nt#19:nc#2609: Seagate (CDC) Wren V 94181-702:\ :ty#winchester:ns#48:nt#15:nc#1543: Seagate (CDC) Wren VI 94191-766:\ :ty#winchester:ns#52:nt#15:nc#1659: Seagate (CDC) Wren VII 94601-1.2G SunOS 4.1.1:\ :ty#winchester:ns#70:nt#15:nc#1925: Seagate (CDC) Wren VII 94601-15:\ :ty#winchester:ns#71:nt#15:nc#1905: Seagate (CDC) Wren VIII ST41650N:\ :ty#winchester:ns#89:nt#15:nc#2070: Seagate Elite ST43400N-3.5G:\ :ty#winchester:ns#99:nt#21:nc#2736:\ :pa#2843360:oa#0:ba#8192:\ :pb#2843360:ob#2841993: Seagate IPI ZBR Elite:\ :ty#"ISP-80":ns#78:nt#17:nc#1893:\ :pa#34476:oa#0:ba#8192:\ :pb#132600:ob#34476:\ :pc#2510118:oc#0:\ :pg#663000:og#167076:\ :ph#1680042:oh#830076: Seagate ST11200N:\ :ty#winchester:ns#80:nt#15:nc#1714:\ :pa#2056800:oa#0:ba#8192:\ :pc#2056800:oc#0: Seagate ST11900N:\ :ty#win# $OpenBSD: install.md,v 1.32 2000/04/24 16:33:44 millert Exp $ # $NetBSD: install.md,v 1.3.2.5 1996/08/26 15:45:28 gwr Exp $ # # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # # machine dependent section of installation/upgrade script. # # Machine-dependent install sets MSGBUF=/kern/msgbuf HOSTNAME=/kern/hostname MDSETS="kernel xbin xman xinc xcon" # an alias for hostname(1) hostname() { if [ -x /bin/hostname ]; then /bin/hostname $1 else if [ -z "$1" ]; then cat $HOSTNAME else echo $1 > $HOSTNAME fi fi } md_set_term() { test -n "$TERM" && return echo -n "Specify terminal type [sun]: " getresp sun TERM=$resp export TERM } md_makerootwritable() { # Was: do_mfs_mount "/tmp" "2048" # /tmp is the mount point # 2048 is the size in DEV_BIZE blocks if [ ! -w /tmp ]; then umount /tmp > /dev/null 2>&1 if ! mount_mfs -s 2048 swap /tmp ; then cat << __EOT FATAL ERROR: Can't mount the memory filesystem. __EOT exit fi # Bleh. Give mount_mfs a chance to DTRT. sleep 2 fi } md_get_msgbuf() { # Only want to see one boot's worth of info sed -n -f /dev/stdin $MSGBUF <<- OOF /^OpenBSD /h /^OpenBSD /!H \${ g p } OOF } md_machine_arch() { cat /kern/machine } md_get_diskdevs() { # return available disk devices md_get_msgbuf | sed -n -e '/^sd[0-9] /{s/ .*//;p;}' \ -e '/^x[dy][0-9] /{s/ .*//;p;}' } md_get_cddevs() { # return available CDROM devices md_get_msgbuf | sed -n -e '/^cd[0-9] /{s/ .*//;p;}' } md_get_partition_range() { # return range of valid partition letters echo [a-p] } md_questions() { : } md_installboot() { local _rawdev _prefix if [ -z "$1" ]; then echo No disk device specified, you must run installboot manually. return fi _rawdev=/dev/r${1}c # use extracted mdec if it exists (may be newer) if [ -e /mnt/usr/mdec/boot ]; then _prefix=/mnt/usr/mdec elif [ -e /usr/mdec/boot ]; then _prefix=/usr/mdec else echo No boot block prototypes found, you must run installboot manually. return fi echo Installing boot block... cp ${_prefix}/boot /mnt/boot sync; sync; sync installboot -v /mnt/boot ${_prefix}/bootxx ${_rawdev} } md_native_fstype() { : } md_native_fsopts() { : } md_checkfordisklabel() { # $1 is the disk to check local rval disklabel $1 > /dev/null 2> /tmp/checkfordisklabel if grep "no disk label" /tmp/checkfordisklabel; then rval=1 elif grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 else rval=0 fi rm -f /tmp/checkfordisklabel return $rval } md_prep_disklabel() { local _disk=$1 md_checkfordisklabel $_disk case $? in 0) ;; 1) echo WARNING: Label on disk $_disk has no label. You will be creating a new one. echo ;; 2) echo WARNING: Label on disk $_disk is corrupted. You will be repairing. echo ;; esac # display example cat << __EOT If you are unsure of how to use multiple partitions properly (ie. separating /, /usr, /tmp, /var, /usr/local, and other things) just split the space into a root and swap partition for now. __EOT disklabel -W ${_disk} disklabel -f /tmp/fstab.${_disk} -E ${_disk} } md_welcome_banner() { { if [ "$MODE" = install ]; then cat << __EOT Welcome to the OpenBSD/sparc ${VERSION_MAJOR}.${VERSION_MINOR} installation program. This program is designed to help you put OpenBSD on your disk in a simple and rational way. __EOT else cat << __EOT echo Welcome to the OpenBSD/sparc ${VERSION} upgrade program. This program is designed to help you upgrade your OpenBSD system in a simple and rational way. As a reminder, installing the 'etc' binary set is NOT recommended. Once the rest of your system has been upgraded, you should manually merge any changes to files in the 'etc' set into those files which already exist on your system. __EOT fi cat << __EOT As with anything which modifies your disk's contents, this program can cause SIGNIFICANT data loss, and you are advised to make sure your data is backed up before beginning the installation process. Default answers are displayed in brackets after the questions. You can hit Control-C at any time to quit, but if you do so at a prompt, you may have to hit return. Also, quitting in the middle of installation may leave your system in an inconsistent state. __EOT } | more } md_not_going_to_install() { cat << __EOT OK, then. Enter 'halt' at the prompt to halt the machine. Once the machine has halted, power-cycle the system to load new boot code. __EOT } md_congrats() { local what; if [ "$MODE" = install ]; then what=installed else what=upgraded fi cat << __EOT CONGRATULATIONS! You have successfully $what OpenBSD! To boot the installed system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT } tstore.10_prom0_fake_saveecho_pv_putchar_sun4_idprom.65_dtab_stringbuf.75_promdev_inuse_prom_mapin_prom_mapinfo_prom_mapinfo_cnt_prom_devmap_promvecstore.88version.ogcc2_compiled.___gnu_compiled_ccd9660.onfs.oufs.orarp.obootparam.orpc.ostrncpy.ostrerror.ogets.onet.oin_cksum.oarp.oether.omemcmp.oglobals.oexit.ocloseall.ocread.oread.oopen.olseek.oclose.oprintf.omemset.omemcpy.oalloc.osdiv.orem.ostrcmp.ostrlen.obzero.oashrdi3.o__main.ourem.oudiv.oumul.oinflate.oinfblock.ocrc32.oadler32.oinftrees.oinfcodes.oinffast.oinfutil.o@h 8`@#`3"" $@``T@1#H3b@%"@H*/+,2"c  0  "#,"# *,"# !`,"#@>> OpenBSD BOOT %s bsddevice[%s]: boot: open: %s: %s Booting %s @ 0x%x 㿘@4@- h@ 3!`L@ 3!313%3/+3)3-'3 5@a(@h $hh `@!@rM! 2%`@ P@iLP 2@B  Ȑ8@@@aBad format %d+%d+[%d+%d]=0x%x boot: short read x@s ;%?@ ?# @!2?3܀a"0?@ ?# @!2?%܀a""?@ ?# @! 2?܀a "?@ ?# @ 2 ܀`@"0@"?@ ?# @!  a ܤ` ܐ@܀?@@ ?# @! a "?@ a?# @!"  @ .@`@ 2.@"@?@k@2@ 䀤 .@?`耣 C.@ .`".`.`@`@Ő耢@F#2@ bܐ@  < b.@ .` .` .`b܀  ?`@2'@"@`? ? @3"@@"@o,c 2#3!@ b1  Ā 0@ː",? Ċ`Ī@` Ē`IJ@` @ dvma_mapin㿘? #@(1?@ #(1?dvma_mapout㿘 #@(1@#p1㿘@ " ْ㿘 @ʒ㿘1#H` @, "cp3  @/ #H $#H㿘1cH ? "cH,@}cpboot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s 㿐',@ p?73"(!' @@'@ p )32 @a-! 12p`#X@  23#X!' @h@#X'p@ 3 3 ȁ 2 3 Ё㿘3` 231"А#P"`"`"`"` "`"`" @`  "`Ȱ? 3  ?3 㿘  ; < 㿘 , @@B   @7"&  ?  promprom0㿘,#`2@2c  $  31 c`"3"!JJ`  -2*@3!@ (*`J@ @ *`  1cp3" J  *@J` )*@c 3`"!``%J@ -! @33 *:  d` s ahJ@h J@  h#aD @"hJ@  @Can't open device `%s' Can't open network device `%s' 㿘@0 ,#`  @aĔ8$` $`%32# `( $ 3`€   aD$` $`$@ @!p02@ $`&` 2!22,cP @А"V @Ɛ!0",c @,c4 @ , "cl#,`#x $$ 㿘#2c`   ``*  `c   '@`2`0`,6 * '@ 㿘  В& `& $& (   €Ӓ " '@ 㿘 ` @ 2# `( ( @0@ 㿘   2  @! $ ?2`$ *㿘2#` `0`4 㿘2#` `?`8 ? xmit: not a network device 㿘  ,`@!?Q@ Y`?㿘 ,;`€D㿐2 c` (`P#    #O/O O /O㿘㿐2# `      O ? X/O O /O㿐2#/  0T@㿘  㿘2#`t€㿘@,@㿐2c    #X# p@%x mac-address drop swap 6 cmoveX,#` #21 ##` 1   Њ@+`  .@ .` .` .` .` .`c` `€0 `@ c|@ielefdxyxdstsddevice_typeblocknetworkbyte㿘2#` !,`@@Xaа@a ' a@  @a   #`#N@J@2J`N` " 2 node %x property %s length %d > %d 㿘2#` € 0"@ 㿘1#ޖ ??" ,Invalid controller number prom_iopen: "%s" error=%d 㿘)2 쀢 ?N  @ 3"`p`p$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $` @T#+  " * @F $`0 "$`4 " @\$` @ 2 &  %  @*# 㿘#2`쀢  @ 4 "$` & 4$`prom_mapin: length=%dprom_mapin: invalid maptype %d㿘,# *`@ -!@b ` -,#        !@K` `,#@ ,# 8 <?*  d آ&@  ` ,#d@㿘?(1,12\&# H L` T ` X P d l$ p  t @2 .@2.1 @ ` J@(8(8    `J/`? `2A ` `!J@(8(8  . ` J J#   J@;..2J`;2 , `J@; @Є 8 <` CD001㿐@T( ( @`  -``( ( !@j     2` * @h * *` * +  *+`  h  @;(g 8@ @`-`  ` ΀ǰ    *` *   *  M `N JL *  2D     !*  *` * @*@  @  @ L  *  "M  !   L  *  2 M  : L  *    g2 @P``  `-`( U(  gh 8  *   *` * ƒ  @ @@ ˀg@+ @V   >>>&`>  * *`   * & +` * +   :>@^0  @X @U㿘  @N&  㷐 R@ N`@4 @H``@C@2 *@ `  @,  ( )􀢨$ 2@` ' 8'" w@'@@ @ B <@&hhB <@2&     ":?"   ? @ : ` :?  $2`"`"`  :`0 pؒ  @c@' 8 'pt@d ,  $ #`a#\b` @ ? 3 H "`؀`3@E  " Ȱ?㽠P  x@,  'P $` $` $`  $$` ($` ,$`@$` 8 t@ $`   h #`ab`$#\ @ ? 3  x 0  &,& &&& D& &(&$@㺈 ` ($a b ????#\#`  @k ? 3  `  dh@Ɛd .@  ?nfsread: short packet, %d < %ld 0  '  $  $  (  ,     $$L#`a $b (#\  @$ ,? L `" H3" Ȓ?@T@~0  #@w3 H"`Ȱ?㿘@w -3 "` 2" 6 & 2 ?  " $?!$ "  ?nfs_open: must mount first. 㷈2""`  @8  N  m `/2N N /" N a  0 ] @> x  <$N O  N  /  .ɔ A.0 0 2;@@ $+  (@;@O`/ @% x@! x  @ x N  &`  @ x@ x㿘  "& @ x&  nfs_read: hit EOF unexpectantly㿘' #3!3% @y   ݖ? `2  !D @X  ; B& > @ 2&     D  "; ?  ?  @ ;   `; ?  -0p( 4 2`:2` <"` @"`D :`0 㿐``@P 0@ `@`@o @͒ * @g   @%@ x ` *  d,  0 2 0 0@" x @ *  @`?``"? 6"?%` 0@9㿘 `  .` 8@ ^&  @   @`&@``@@6``,`G D& h`?  ,` @@!  @0$@     d ,  0 2 0 2 %@` ,`@@,`& 㿐   e<`P @@l 4`0*:  8  2`0 @8e<`0e<eD `L  Ȁ)n 2; @l`0$  " @'  `d  *  0 @'$ $  $&@&    b 8   @   " & 㿐`@͐  <@`@-5 2& :@ "   2  @  " *@B<@@` ڐ2 ``@Ӑ 㻀@  Ц @  &`@ @ $`   `  @2 %\F!T@  0@@eg0   @ t,   $@  '` L@  @5<`/2L@`L@ /"`L@"y   נ  / ``4k `L@  /`,@P谒 \,@+ W(  2LL@@  $H  E;@ E%( 8@ ="@ W 0 K䰒 *@ `  d*  0` @ O / ' 'ܒ L@  @   0@ P @ J@ G Ё㿘 &     . @ "  @ 50  .  "  @ *0 @ '@ $ а 㿐 @ Ɣ@&B<@@`@@ ``@0 2&     ":?"   ? @ : ` :?  2`"` "`:`0㿐`  8 `@@2.@``@.@+?) @ " " ""@@C <@  @@ @ B <@ rarp: bad socket. %d No response for RARP request 1 @ !J?  .@  7Ɛ(   , 4 , 4 ` 44 `~4 `4 `4 `b4 `4 #\"̐ .@ɚ @ !(? 32b( b(2  b( @ 0- ? @ -??"a( $`㿘- @ǘ 5㿐@ݘ3!"   5@2?@ 2?`(2?`&2?` 2 ? `@  ??bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d p k3"(1a"'А $  $ $ ''X@ג 2W?-`??"`4` $@!#`"#@ #\ @  !2@ S#<?#3!a@S!*`4a' @k2 6`@ :##?2'ܢ ܔ"""2a@ ?3"H2bXH@w  ?2@a ? ?  P2"2a''@H 2C?@ @? 2:?-`2?"`6 "&#`a#@b#\ @y   3 H"`Ȱ''@( 2?@J 2?#'@ ? ?㿘`&"@  &@  㿘`&@   ? & @ .@&  @""#d d " e" f" g"#" ?  +d +e +f +gd"@#callrpc: error = %d 㿐\@?<6   '?'?@ R?2ؐ '?` '?`@"آ"?'?Đ #`#` #`#`#\ #`a$ !@? 3` @``2"@ , (3 H"`Ȱ?recvrpc: reject, astat=%d, errno=%d 㿘!3$ @S 2"@ 2?`2 ?`` $ Ȑ!X@ ??"@?232`( 2  2 2 *?3  #  2(`"# " " " getport: %s㾐a"@3 o'?(' "p #\#` ""   6   p'0 #3!`@t"ؒ@ H$`Ȱ?  @(*`  bad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentUnknown error: code %d㿘`W1"p*` €10 1- 1* 81' P1$ `1! x1 1 1 1 1 1!1 !01 !H12 a` @Ґ8E8F8FL8FL8F48E8FL8F(8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8F@8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8FL8F8FL8FL8FL8FL8FL8FL8FL8FL8F8FL8FL8FL8E8E8E8E8E8E㿘  ,  ". /.".+."&  "!"..ܐ 0א Ր ?Ґ 0ϐ @͠Lɠ *L0Ð 0 0sendudp: bad write (%d != %d)x&$`$` $`$`$`$`<* @ *@@ &  ,`,` 4` $`  $`@4`  6 4 4 `'`'` '`'&$`,` '@4` 4 쀣?&$`$`$`  $` -!    2`'!'ܐ@ܖ@՘( @? @7readudp: huge packet, udp len %ld x@Ԙް zހ( (  t?@so?2m?<@ 2f? 2b?6` <`\@u 2X? &T?``  2L?` &@  "@4  ` 2=?` 5` %@l"0? ,  $ $ ' '`'''4 @8  ?$$ $ $ $ $$ $ $ $ ` ??sendrecv: short write! (%d < %d)㿘\   )3 <+`% (?@ @a@|,`4 2  Ȁ   $$@Ӧ` l J` Є * (Ж  (8. 53 ".?" 8" ?#  0 `(?`d((  `d(h(*  ?#㿘@㿘2!A,@  .  @ 0,@@ = "@  0,@@ 2  0,@,@6 ` "@(* 8("@ Є (@ 㿐 "= N -N`$* `.! גN*`? @ . Ȓ?N*`# @ .   J `   `&     ,` ` `   ( `߀` ܗ(2 ?# : :* arpwhohas: overflowed arp_list! arp: no response for %s- @ - @  'h@@C`@ `   $@"@ƒ  .@ 7Ɛ(  , 4 , 4  ~4   44  4  4  4 hc4 j4 h $@#\ .i? h!'l"hl@ ` `4` 4`  $4`㿘-@r(㿐@3-" (2*?@ 2&?`(2"?`&2?`  @??- -*@ *`@ `@  ??㿘@ /`(+`&'` # `@z   `6`6`` ` 6``6``6`6` 6` 6`   .6`  `6` (@6`㿘 3` 3` 3`  .+`+`+`+`3` *+` ??㿘)  @,   -a@%  "` ?` ?72-H :  0 *@ `  *@`*@`2*!H" @ ` ?  2   㿘2a`'H'L'P'T 'X @"a`@H@# exit㿘#㿘3"0 , @` @ , 㿘@@㿘@ 㿘 < " ? 2  @13 D& @=  $  Ȑ `$ <?$ 8 D$ ?$  @`$㿘אԐ* А* ̐?. ?$`8㿘-!  , @     & &"   & L`?& & S`?   2?  ?B& 8     `* ??w?2? o  e  "  < Z   <  ?& 81.1.3㿘@В?.`,@ P2!h. `"  P @H?@I 8 `@ &`D&@a&`@0 @ `@ǒ P@)?㿘 3 "`?3"0. @ 2. !h @ D@@ P@ 㿘2!h.  8?? ?2$  ?$8$ L "88 @.  "@"$ $$$$ @  43 Ȁ`$<" $& @$$$<S < D!3$ Ȑ@ $ Ȁ $<D$@ #$8 H@ " $H H ?$88 @W$$  @ ؔ $H8 2  < 2  2L H@ Ɣ" $H&㾘 3 3"0- @2@9!h-  `L @?2+$`)'$`" ` 3f c3b @F ` 42$`@   @ ?L @`D P @MH?@ 8$@$`D$`@.` 4@ 1@ /@ f )`' a !ڒ: @3  Yd 4 `0 Y"`Ȱ??㿐3. "0 @@  3 ,"`" @ * 2`      3 "` B< ' 3 "`&?㿐3"0 @  `  ` 3 D"`$@$`$` 'ꮔ 83@`` / "`J ,`)$@&$` #l@  2" € ` `#l `" ` @3" $@?㿘3. "0@ @  3 "  3  Y :@B: Y"`Ȱ? ?   ` 㿘3. "0 @  @  3 $"`2  " @      @ $3" Ȁ`3 " Ȱ?2|( |㿘!2!'L'P'T'X$!|@L!|*㿘'H'L'P'T'X#Ԓ@ H㿘#Ԓ@8N@`N@`%` N@`|` *` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @L N@ @C N@ @: N@ 0 x  @, N@ % w ls8f8gh8g8hl8hl8hl8hl8hl8hl8hl8f8hl8hl8g8h48hl8hl8gx8hl8h8hl8hl8hH0123456789abcdef㿈 @A @,@ڐ  ?L?|/-\㿘-!` 2!x apJ@ #!xꉐ (@ @   @ *0   @ *`-ḔḖ ? * `:```? -a "a"    -Ḑ?"  Ḁ@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  J@   J@J`   J "  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2* ?: :  *2@ : @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@㿘 ?`2"`0"`"`   "` @} 㿘 ? ` $ 2`0 " $@7 $  (€ $ 㿘"M?N 12I?8 D?2 @? &  @& & ( $ 2  `& $   (  )& "  `"   "`  ( ?"  `  %# *@D  "` ?㿘 unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check㿘 "@?  "<? 7` ?? ` .#Г*` € %  $ $  @  " `$  "bH 2    "bh " `  $ $    $`*   &@ݒb`   &@&@  ސ? `$ $    * "` $" `˒  $ $    *` " $" `  $ $    *` " $"    $ $  @ ` " $ $ 0" "b $ " @?   " F"" s @ `  5"@ "@  a? `$ $    * "` $" `N  $ $   *` " $" `9  $ $   *` " $" `$   $ $   " $@  "b $  " " ??8{,8{8|H8|8|8}<8}8}8~<8~8~8088㿘    "#? ? @۔ 0  ? & 06 * ?$@ @U  "@ 㿘 A?`2@0;  "@"` 20?  -!  @`#@  ?( "$$$ "` $$ "@?㿘 " ?   ?  @     㿘" <&? 8`$`(€  2 ( @  (& 8& 0& & & 4   & <&`0㿘`  `( @ 2` *  `(% $ $`(`$€ 0`  `(  $ ($ ,$ 8$  `( `$€ $`(`$€invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeath 0 4@`  "? ,"` '$!l*` €̨?  *`` 4  `&  `-`0  `4 $@&إ4@@耢 & & & @&``$  &`&@& 4?  &4 &#&`4& & @&``$  &`&@& 4֔??  *`` ?#4* @  &#&`& & @&``$  &`&@& 4?`&  m p  `& & @&``$  &`&@& 42D  , ` 0 ( @ "?"`22 & 4@  0 4 "@ ,? ," ` 0 ( @ "?"`2 & & @&``$  &`&@& 4U 8o "@`%%@ &     &?  *``  ?, & 4   ! !& &`& & @&``$  &`&@& 4? `  `( & & & @&``$  &`&@& 4? &4&   2  @  "?  *``   *@ *`"  & 2  4     "* *`"  &  &   $ @  `$`(€ 2&  && & @&``$  &`&@& 4&&  4   ! @  1!#`0 @,  ]?  *`@ ,   *`    $@ * "  & T4    @  A?  *`@ + 4$@  4 @ ! @$@ 4 2!  `$€`( &&`& & @&``$  &`&@& 4'?  ( ? + "@ &  4   ! @     4  $ `#\#`&    `''#d@5!`$`(€ ?"&& & @&``$  &`&@& 4@؀ 2& & & @&``$  &`&@& 4ʔ?&& & @&``$  &`&@& 4@  @ 0 4@`  "? ,"   g&&& 4@ 4 0 0 4@& & @&``$  &`&@& 4 && & @&``$  &`&@& 4q & & @&``$  &`&@& 4c?& & @&``$  &`&@& 4U& & @&``$  &`&@& 4G& & @&``$  &`&@& 49& & @&``$  &`&@& 4+& & @&``$  &`&@& 4& & @&``$  &`&@& 4& & @&``$  &`&@& 4?@88,88888@88h8㿘. `( `$€ (`(`$€ $`(`$€㿘 ( (@& 0& 4`?w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-$"(`Y G8$( @0(` @(` @0(` @0(` @0(` @0(` @0(` @0(0` $( @0(`8㿘?6  ` W R !6& @`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ @β` @`@J#F#񀦠,` #+3;CScspp !1Aa  0@` 'H'X\H'L'P'T''''''''''''''''@(@`&@H X&#1 @  .@"@ * 􀠠  (`@"@8 # (.@@  ,`(`@??&@0 '48' - @ `  @ `.@(&@h H`@*@ @ h'H'0?'p  '(+ '$??Hh((+`', M+`$   % ` d#,@   @&@ .`@8, . ``dp&@&#//! $0@8 '.@&@&X& 4#/,@  /@L   `/@`'LT (P/@ P(@`'0@ (?  ?..`& &   (@" @6@2@ .@@? '  .@+`@?2[  H+ ` 2?oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths tree㿀   ( ' #?#d#`#\#h   z ??(  ' (@ 2 (( ' ? ( $€oversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengths㿀d !  ( `' R?&&8!#\#`#d#h! ?  ,??(!-$ +('!&&\#`#d0"#\#h  ? 2 (??(! $ ?("("($ ? ( $€0 ( $€ --"!-"@1"" 㿘 (    * * " " "invalid literal/length codeinvalid distance code㿘 0 4 @`  "? ,"@` +!h*` €)` '& & @&``$@&@&`& 4 ` ``@.` 0 4@ `  "@? ,": $@ ` `$` $`$@` 1`  *  1c+`@ ` * @  @$ 4  $`$@  @ $` $`$@_   $@)$@ H&`& & @&``$  &`&@& 4?` 1``  *  1#+`  ` ` `$`$ $` $`$@4 ` 1`O  *  1c+`@ ` * @  @$  4 $` $` A$@ @ $` * 8$`)$@ h&`& & @&``$  &`&@& 4M?` 1`  *  1#+`  `  $` $ $@4  ( `   ," "@` "$@27  ,  0 ( @ "?"2% & 4@% 0 4 "@ ,? ,"  0 ( @ "?""&  ( ,   (`? $`$@2D `  ,  0 ( @ "?"22 ` & 4@ݐ 0 4 "@ ,? ,"  0 ( @ "?"2 ` & & @&``$  &`&@& 4 (k$@ & 4?`@ 4 0 0 4@& & @&``$  &`&@& 4r $@& & @&``$  &`&@& 4b & & @&``$  &`&@& 4T?& & @&``$  &`&@& 4F& & @&``$  &`&@& 48& & @&``$  &`&@& 4*& & @&``$  &`&@& 4& @&``$  &`&@& 4& & @&``$  &`&@& 4?@888808,88888؝㿘`(`$€invalid distance codeinvalid literal/length code㿘04@`  , 1. .`( ` (@( @ @+Ȑ#` !h6 . !`  6@(  ` (+ @@#` !96` ( &@(  `. '!@ 6'/ / , @ &@?/ (/ X @2 `. `(. @@@1  3"` @ . `. @(@@ 2```!/6/ 1 ` @8.`!" "@'@`'@"@"`"`"42 ` "`@8.`!" "@'@`'@"@"`"`"4? C `1  @8.`!" "@'@`'@"@"`"`"4 㿘 4 0@`  ,"` " `"&`&` 8 <& <&`0 ,@@ ' 4  (& 4 4`"   " `"&`&` 8 <& <&`0”@&` & 082868687`87h8788!8"8#l8#t8#8(8+08+x8,48,<8,8 88 88 8 8@8 8T8 8888888   8x@` 0123456789abcdef/8ΰ inflate 1.1.3 Copyright 1995-1998 Mark Adler `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`??8 8B8[P!84- 8ɀ58m:8C8r(I8IR8[8 f8$ u8k@z8 8 8T8=8 8Ʉ 8Ɉ88w8t 8ɐ8|8>8+8-88QhB8K 8X8t_8Rj8pr8|}8L8N8p88V8J88(8O\8z 8e 8!8+8 88B8+0M8r(T8e\8Ug 8t8!8 8P8B8q8'$ 8X8?488 888U8X`&8C/8p<8$J 8S8&Ha8+xk 8v8Pd8@8,<8 88(,8#l88T8,8ix89H88" 8X*8 9 8`H8 T8c8X@l8v886 887h8D8Ex88P888W 88f8788-8?@8U8k@[82e8pu8xx88x88@@888m88 8h 8p8 8̨'8i/8,4:8 D8Q8cY8?l8it8( 8̬8d88;88#8 8̰8W8888W8"8 ,8 &8#t38=8D8R 8̸Z8ba8ph84r8VT}8 8x8888|8\8\88B87`88 8 8" 8@(8Op/8 58l<8WB8LH8k(N8M,X8_8_ 8Df8\(m8 8H848jp8H8 8P 8ΰ888G8r 8 8h8a 8͠ 84 8z$ $8 0 8ͤ @ 8ͨ F86 Q8L a8$ q 8( w 80 ~8x 8 8 8 8 8 8 8 8 8 8 8 8 8 +8H 78  C8  R8  d8P p8 z8 8 8` 8p 8 8 8 8ǀ 8 8Ǡ 8 8 8 %8` 78d D8 U8x _8x n8x 8 8$ 8- 89 8; 8@( 8C 8D 8G 8H 8Qh 8R@ 8U 8W8 8W 8W 8W 8X@ 8a 8b $8c ,8d 48e =8i F8i O8jp W8k@ ^8m d8p m8p v8p ~8q 8r 8r( 8t 8w 8x 8 8( 8 88 8 8 8 _getsecs_rpc_fromaddr_open_dvma_mapin_gateip.rem_adler32.urem_sendudp_getprop_netif_put_nfs_getrootfh.div_devopen_socktodesc_obp_close_bp_getfile_inflate_codes_new_bp_server_addr_strtab_inflate_codes_free.umul.udiv_hostname_getchar_xdr_string_encode_inflate_trees_bits_nfs_readdir_in_cksum_pgofset_hostnamelen__udiv_arpwhohas_strcmp_net_close_inflate_trees_dynamic_inet_addr_strlen_inflate_set_dictionary_ether_sprintf_readudp_inflateSetDictionary_nfs_open_inet_ntoa_inflate_sprintf_netif_debug_freelist_netif_close_net_open_nfs_close__urem_printf_sendether_file_system_cd9660_close_inflate_trees_fixed_swapip_rpc_pmap_putcache___ashrdi3_nfs_readdata_domainname_xdr_string_decode_ufs_readdir_putchar_inflate_copyright_arp_reply_zcfree_strncpy_netdev_sock_nfs_lookupfh_rpc_xid_nfs_readlink_nfs_read_strtablen_ip_convertaddr_obp_strategy_nfs_seekstart_nfs_root_node_nfs_mount_cd9660_write_inflateSyncPoint_prom0_iclose_nfs_stat_twiddle_rarp_getipaddress_hz_getdevtype_rootip_net_mountroot_rpc_pmap_list_prom_ioctl_inflate_codes_zcalloc_rpc_port_obp_xmit_ufs_read_promvec_ufs_seek_obp_recv_strerror_prom0_close_file_system_nfs_inflate_flush_arp_num_closeall_bootfile_vprintf_ufs_stat_prom0_strategy_prom_getether_xdr_inaddr_decode_inflate_blocks_free__div_ufs_open_nfs_stat_types_inflateEnd_netmask_inflateReset__rtt_rpc_call_inflate_blocks_sync_point_file_system_ufs__rem_dvma_init_dvma_free_prom_boothow_prom_si_getpropstring_prom_bootdevice_memset_nfs_write_rootpath_cd9660_open_olseek_xdr_inaddr_encode_memcpy_get_crc_table_nameip_oclose_inflate_mask_bp_whoami_cputyp_cd9660_stat_pgshift_rpc_pmap_num_memcmp_prom0_iopen_inflate_fast_panic_cd9660_read_netif_open_prom_open_cd9660_seek_peekchar_etext_donottwiddle_ifname_oopen_bzero_getticks_readether_prom_init_inflateInit2__inflateSync_ndevs_loadfile_dvma_mapout_read_inflate_blocks_reset_arp_list_rpc_pmap_getcache_ufs_write_prom0_recv_errno_sockets_esym_intoa_nbpg_nfsys_exit_main_free_sendrecv_lseek_debug_close_inflate_blocks_new_domainnamelen_crc32_alloc_edata_cngetc_fbuf_end_dvma_alloc_bcea_gets___main_netif_get_version_oread_prom_bootfile_file_system_cd9660_inflateInit__prom0_xmit_bp_server_port_dbuf_ufs_close_inflate_blocks_cd9660_readdir_myip_files_devswsrt0.oboot.ogcc2_compiled.___gnu_compiled_cconf.ogcc2_compiled.___gnu_compiled_cdvma.ogcc2_compiled.___gnu_compiled_cnet.ogcc2_compiled.___gnu_compiled_c_open_countnetif_sun.ogcc2_compiled.___gnu_compiled_c_netif_prompromdev.ogcc2_compiled.___gnu_compiled_c_filestore.9_boo